BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8275_g1_i1 len=3097 path=[3299:0-1926 113:1927-3096]

Length=3097
                                                                      Score     E

ref|XP_009762733.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1257   0.0      
ref|XP_009777025.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1248   0.0      
ref|XP_009597829.1|  PREDICTED: poly [ADP-ribose] polymerase 3-li...   1244   0.0      
ref|XP_009597828.1|  PREDICTED: poly [ADP-ribose] polymerase 3-li...   1243   0.0      
ref|XP_009624066.1|  PREDICTED: poly [ADP-ribose] polymerase 3-li...   1236   0.0      
ref|XP_006349137.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1210   0.0      
ref|XP_004251377.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1205   0.0      
ref|XP_006365785.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1193   0.0      
ref|XP_010327085.1|  PREDICTED: poly [ADP-ribose] polymerase 3-li...   1187   0.0      
ref|XP_010327050.1|  PREDICTED: poly [ADP-ribose] polymerase 3-li...   1186   0.0      
ref|XP_010326946.1|  PREDICTED: poly [ADP-ribose] polymerase 3-li...   1185   0.0      
ref|XP_010326979.1|  PREDICTED: poly [ADP-ribose] polymerase 3-li...   1185   0.0      
ref|XP_010327013.1|  PREDICTED: putative poly [ADP-ribose] polyme...   1183   0.0      
ref|XP_010327106.1|  PREDICTED: poly [ADP-ribose] polymerase 3-li...   1170   0.0      
gb|EYU36951.1|  hypothetical protein MIMGU_mgv1a001445mg               1164   0.0      
ref|XP_007132420.1|  hypothetical protein PHAVU_011G093100g            1154   0.0      
ref|NP_001237586.1|  poly [ADP-ribose] polymerase 3                    1154   0.0      
gb|KHN38638.1|  Poly [ADP-ribose] polymerase 3                         1151   0.0      
ref|XP_011088879.1|  PREDICTED: poly [ADP-ribose] polymerase 3         1150   0.0      
ref|XP_003538122.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1149   0.0      
gb|KDO58060.1|  hypothetical protein CISIN_1g037230mg                  1147   0.0      
ref|XP_004506166.1|  PREDICTED: putative poly [ADP-ribose] polyme...   1139   0.0      
ref|XP_006487980.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...   1139   0.0      
ref|XP_002523787.1|  poly [ADP-ribose] polymerase, putative            1137   0.0      Ricinus communis
ref|XP_003606139.1|  Poly                                              1137   0.0      
gb|KHN21141.1|  Poly [ADP-ribose] polymerase 3                         1130   0.0      
ref|XP_010271692.1|  PREDICTED: putative poly [ADP-ribose] polyme...   1123   0.0      
ref|XP_002274597.2|  PREDICTED: poly [ADP-ribose] polymerase 3         1123   0.0      Vitis vinifera
emb|CBI28338.3|  unnamed protein product                               1121   0.0      
ref|XP_002872003.1|  poly polymerase 3 (PARP-3) ADP-ribosyltransf...   1118   0.0      
ref|XP_006289126.1|  hypothetical protein CARUB_v10002547mg            1118   0.0      
gb|KFK24049.1|  hypothetical protein AALP_AAs62505U000200              1117   0.0      
ref|XP_010520427.1|  PREDICTED: poly [ADP-ribose] polymerase 3 is...   1116   0.0      
gb|KCW50823.1|  hypothetical protein EUGRSUZ_J00484                    1116   0.0      
ref|XP_007206433.1|  hypothetical protein PRUPE_ppa001509mg            1116   0.0      
ref|NP_197639.2|  poly [ADP-ribose] polymerase 3                       1115   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229450.1|  PREDICTED: poly [ADP-ribose] polymerase 3         1113   0.0      
emb|CDY26932.1|  BnaC09g36510D                                         1112   0.0      
dbj|BAB09119.1|  seed maturation protein PM38 protein                  1111   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011004520.1|  PREDICTED: poly [ADP-ribose] polymerase 3         1110   0.0      
ref|XP_010520428.1|  PREDICTED: poly [ADP-ribose] polymerase 3 is...   1110   0.0      
ref|XP_010493334.1|  PREDICTED: poly [ADP-ribose] polymerase 3         1109   0.0      
ref|XP_010421038.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1109   0.0      
ref|XP_010454512.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1107   0.0      
ref|XP_008378254.1|  PREDICTED: poly [ADP-ribose] polymerase 3         1102   0.0      
ref|XP_009120655.1|  PREDICTED: poly [ADP-ribose] polymerase 3         1102   0.0      
emb|CDX92348.1|  BnaA10g13870D                                         1101   0.0      
ref|XP_004291612.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1100   0.0      
ref|XP_010031503.1|  PREDICTED: poly [ADP-ribose] polymerase 3         1098   0.0      
ref|XP_002313672.2|  hypothetical protein POPTR_0009s14610g            1098   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010520429.1|  PREDICTED: poly [ADP-ribose] polymerase 3 is...   1096   0.0      
ref|XP_010089844.1|  Poly [ADP-ribose] polymerase 3                    1095   0.0      
ref|XP_009364326.1|  PREDICTED: poly [ADP-ribose] polymerase 3         1094   0.0      
ref|XP_004162473.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1093   0.0      
sp|Q1SGF1.1|PARP3_MEDTR  RecName: Full=Putative poly [ADP-ribose]...   1093   0.0      Medicago truncatula
ref|XP_004149282.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like    1092   0.0      
ref|XP_008458691.1|  PREDICTED: putative poly [ADP-ribose] polyme...   1091   0.0      
ref|XP_008788145.1|  PREDICTED: poly [ADP-ribose] polymerase 3 is...   1090   0.0      
ref|XP_010907127.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...   1088   0.0      
ref|XP_006591922.1|  PREDICTED: poly [ADP-ribose] polymerase 3 is...   1087   0.0      
ref|XP_006400753.1|  hypothetical protein EUTSA_v10015477mg            1087   0.0      
ref|XP_008788139.1|  PREDICTED: poly [ADP-ribose] polymerase 3 is...   1086   0.0      
gb|KDP37595.1|  hypothetical protein JCGZ_07941                        1086   0.0      
ref|XP_010686033.1|  PREDICTED: poly [ADP-ribose] polymerase 3         1081   0.0      
gb|KHG11804.1|  Poly [ADP-ribose] polymerase 3                         1076   0.0      
ref|XP_009624068.1|  PREDICTED: poly [ADP-ribose] polymerase 3-li...   1062   0.0      
gb|EPS73841.1|  hypothetical protein M569_00904                        1060   0.0      
ref|XP_007015851.1|  Poly [ADP-ribose] polymerase 3, putative          1058   0.0      
gb|KHG11805.1|  Poly [ADP-ribose] polymerase 3                         1055   0.0      
ref|XP_009417034.1|  PREDICTED: poly [ADP-ribose] polymerase 3         1043   0.0      
ref|XP_006424260.1|  hypothetical protein CICLE_v10027891mg            1023   0.0      
ref|XP_007132419.1|  hypothetical protein PHAVU_011G093100g            1003   0.0      
gb|EMS61650.1|  Poly [ADP-ribose] polymerase 3                          972   0.0      
ref|XP_006648689.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like     969   0.0      
ref|XP_003575066.1|  PREDICTED: poly [ADP-ribose] polymerase 3          963   0.0      
ref|NP_001047021.1|  Os02g0530600                                       961   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952637.1|  PREDICTED: poly [ADP-ribose] polymerase 3-like     956   0.0      
gb|EMT09472.1|  Poly (ADP-ribose) polymerase 3                          955   0.0      
gb|ADK35366.1|  poly(ADP-ribose) polymerase                             932   0.0      
dbj|BAD25449.1|  putative seed maturation protein                       931   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008645748.1|  PREDICTED: poly [ADP-ribose] polymerase 3          922   0.0      
emb|CAN64918.1|  hypothetical protein VITISV_027338                     902   0.0      Vitis vinifera
dbj|BAK08221.1|  predicted protein                                      845   0.0      
ref|XP_002983418.1|  hypothetical protein SELMODRAFT_422701             674   0.0      
ref|XP_002960621.1|  hypothetical protein SELMODRAFT_73333              647   0.0      
dbj|BAC42749.1|  unknown protein                                        599   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_001763226.1|  predicted protein                                  608   0.0      
ref|XP_006384625.1|  hypothetical protein POPTR_0004s19480g             518   1e-170   
emb|CDP06936.1|  unnamed protein product                                427   2e-137   
ref|XP_006341445.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     371   7e-108   
ref|XP_004235864.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    369   3e-107   
gb|KDP21330.1|  hypothetical protein JCGZ_21801                         369   4e-107   
ref|XP_010318682.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    369   5e-107   
ref|XP_007199702.1|  hypothetical protein PRUPE_ppa000811mg             369   6e-107   
ref|XP_009367708.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    364   2e-105   
ref|XP_009367706.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    364   2e-105   
ref|XP_008235714.1|  PREDICTED: poly [ADP-ribose] polymerase 1          364   2e-105   
ref|XP_011080022.1|  PREDICTED: poly [ADP-ribose] polymerase 1          363   4e-105   
ref|XP_008461881.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    356   5e-103   
ref|XP_009354923.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     356   1e-102   
ref|XP_008461880.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    356   1e-102   
ref|XP_008461878.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    356   1e-102   
ref|XP_010679215.1|  PREDICTED: poly [ADP-ribose] polymerase 1          355   3e-102   
ref|XP_004493762.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     355   4e-102   
ref|XP_006293618.1|  hypothetical protein CARUB_v10022570mg             355   5e-102   
ref|XP_004289918.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     354   7e-102   
ref|XP_009781597.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    354   7e-102   
ref|XP_009781599.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    354   9e-102   
ref|XP_009781598.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    354   1e-101   
ref|XP_004151977.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     353   1e-101   
gb|EPS63698.1|  hypothetical protein M569_11084                         353   2e-101   
ref|XP_010918778.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     352   3e-101   
gb|EYU46476.1|  hypothetical protein MIMGU_mgv1a000724mg                353   3e-101   
ref|XP_009617762.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    352   3e-101   
ref|XP_010652358.1|  PREDICTED: poly [ADP-ribose] polymerase 1          352   4e-101   
emb|CDY24761.1|  BnaC04g13660D                                          350   5e-101   
ref|XP_009617761.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    352   5e-101   
gb|KEH23887.1|  poly(ADP-ribose) polymerase domain protein              352   7e-101   
ref|XP_010038006.1|  PREDICTED: poly [ADP-ribose] polymerase 1          352   9e-101   
ref|XP_006443872.1|  hypothetical protein CICLE_v10018683mg             351   2e-100   
ref|XP_009144226.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    348   6e-100   
ref|XP_009144225.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    348   7e-100   
ref|XP_010274828.1|  PREDICTED: poly [ADP-ribose] polymerase 1          347   2e-99    
ref|XP_002881169.1|  hypothetical protein ARALYDRAFT_902162             347   2e-99    
ref|XP_007050348.1|  Poly(ADP-ribose) polymerase 2 isoform 2            347   3e-99    
ref|XP_010522166.1|  PREDICTED: poly [ADP-ribose] polymerase 1          347   3e-99    
ref|XP_008794292.1|  PREDICTED: poly [ADP-ribose] polymerase 1          346   5e-99    
emb|CDP03723.1|  unnamed protein product                                346   6e-99    
gb|KFK31229.1|  hypothetical protein AALP_AA6G085200                    345   2e-98    
ref|NP_850165.1|  poly [ADP-ribose] polymerase 2                        345   2e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AAD20677.1|  putative poly (ADP-ribose) polymerase                   345   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521021.1|  poly [ADP-ribose] polymerase, putative             344   3e-98    Ricinus communis
ref|XP_010933094.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    344   4e-98    
emb|CDY10794.1|  BnaA05g11420D                                          348   1e-97    
ref|XP_010510210.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     343   1e-97    
ref|XP_003521279.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    343   1e-97    
ref|XP_010414140.1|  PREDICTED: poly [ADP-ribose] polymerase 1          342   2e-97    
ref|XP_010469693.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     342   2e-97    
ref|XP_003554282.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     342   3e-97    
gb|EEC81908.1|  hypothetical protein OsI_25738                          340   1e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_010111892.1|  Poly [ADP-ribose] polymerase 1                     340   1e-96    
ref|XP_002459755.1|  hypothetical protein SORBIDRAFT_02g009900          338   2e-96    Sorghum bicolor [broomcorn]
ref|NP_001059453.1|  Os07g0413700                                       338   3e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001769461.1|  predicted protein                                  337   2e-95    
ref|XP_003557295.1|  PREDICTED: poly [ADP-ribose] polymerase 1          335   8e-95    
ref|XP_002302058.2|  poly (ADP-ribose) polymerase family protein        335   1e-94    Populus trichocarpa [western balsam poplar]
ref|XP_011028774.1|  PREDICTED: poly [ADP-ribose] polymerase 1          333   3e-94    
gb|KHN10726.1|  Poly [ADP-ribose] polymerase 1                          337   8e-94    
ref|XP_007162524.1|  hypothetical protein PHAVU_001G159200g             330   6e-93    
tpg|DAA39431.1|  TPA: hypothetical protein ZEAMMB73_927988              329   7e-93    
emb|CAA10889.1|  poly(ADP-ribose) polymerase                            329   8e-93    Zea mays [maize]
ref|NP_001288538.1|  poly [ADP-ribose] polymerase 1                     329   1e-92    
gb|KDO68484.1|  hypothetical protein CISIN_1g035625mg                   327   2e-92    
ref|XP_006410264.1|  hypothetical protein EUTSA_v10016190mg             327   5e-92    
ref|XP_009398035.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    325   1e-91    
ref|XP_009398034.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    325   2e-91    
ref|XP_006657714.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     325   2e-91    
ref|XP_007050347.1|  Poly(ADP-ribose) polymerase 2 isoform 1            324   3e-91    
emb|CAN75718.1|  hypothetical protein VITISV_037618                     319   4e-89    Vitis vinifera
ref|XP_006827511.1|  hypothetical protein AMTR_s00009p00184050          315   7e-89    
emb|CDP06935.1|  unnamed protein product                                285   8e-85    
ref|XP_002973881.1|  hypothetical protein SELMODRAFT_100128             298   6e-82    
ref|XP_002969183.1|  hypothetical protein SELMODRAFT_90144              297   1e-81    
emb|CDP20882.1|  unnamed protein product                                276   2e-81    
ref|XP_004959167.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     273   3e-74    
gb|ADE76583.1|  unknown                                                 248   8e-69    
ref|XP_007050349.1|  Poly(ADP-ribose) polymerase 2 isoform 3            252   3e-67    
gb|AAH37545.1|  Poly (ADP-ribose) polymerase 1                          246   2e-64    Homo sapiens [man]
ref|XP_009860226.1|  PREDICTED: poly [ADP-ribose] polymerase 1          246   2e-64    
gb|ABM82562.1|  poly (ADP-ribose) polymerase family, member 1           246   2e-64    
dbj|BAG10250.1|  poly [ADP-ribose] polymerase-1                         245   4e-64    
gb|AAB59447.1|  poly(ADP-ribose) synthetase                             244   5e-64    Homo sapiens [man]
ref|NP_001609.2|  poly [ADP-ribose] polymerase 1                        244   5e-64    Homo sapiens [man]
gb|AAA60137.1|  poly(ADP-ribose) polymerase                             244   5e-64    Homo sapiens [man]
ref|XP_002809428.2|  PREDICTED: poly [ADP-ribose] polymerase 1          244   6e-64    
ref|XP_004083528.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     244   9e-64    
ref|XP_007670669.1|  PREDICTED: poly [ADP-ribose] polymerase 1          243   1e-63    
ref|XP_007986456.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    243   1e-63    
ref|XP_003814976.1|  PREDICTED: poly [ADP-ribose] polymerase 1          243   1e-63    
ref|XP_007552911.1|  PREDICTED: poly [ADP-ribose] polymerase 1          243   2e-63    
dbj|BAG64403.1|  unnamed protein product                                243   2e-63    Homo sapiens [man]
ref|XP_009568032.1|  PREDICTED: poly [ADP-ribose] polymerase 1          243   2e-63    
ref|XP_007905391.1|  PREDICTED: poly [ADP-ribose] polymerase 1          242   3e-63    
ref|XP_003999138.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    242   3e-63    
ref|XP_003462410.1|  PREDICTED: poly [ADP-ribose] polymerase 1          242   4e-63    
dbj|BAG35260.1|  unnamed protein product                                241   4e-63    Homo sapiens [man]
gb|AAA60155.1|  poly(ADP-ribose) polymerase                             241   5e-63    Homo sapiens [man]
ref|XP_004271024.1|  PREDICTED: poly [ADP-ribose] polymerase 1          241   5e-63    
ref|XP_003385071.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     240   6e-63    
ref|XP_003949754.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    241   6e-63    
ref|XP_006871190.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     241   7e-63    
ref|XP_003930339.1|  PREDICTED: poly [ADP-ribose] polymerase 1          241   7e-63    
ref|XP_008396025.1|  PREDICTED: poly [ADP-ribose] polymerase 1          241   8e-63    
ref|XP_001090628.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    240   1e-62    Macaca mulatta [rhesus macaque]
ref|XP_002760624.1|  PREDICTED: poly [ADP-ribose] polymerase 1          240   1e-62    Callithrix jacchus [common marmoset]
ref|XP_001090984.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    240   2e-62    Macaca mulatta [rhesus macaque]
ref|XP_010611507.1|  PREDICTED: poly [ADP-ribose] polymerase 1          240   2e-62    
gb|EHH15492.1|  hypothetical protein EGK_01593                          240   2e-62    
ref|XP_009504077.1|  PREDICTED: poly [ADP-ribose] polymerase 1          238   2e-62    
gb|KFO19690.1|  Poly [ADP-ribose] polymerase 1                          239   2e-62    
ref|XP_001638875.1|  predicted protein                                  239   2e-62    Nematostella vectensis
ref|XP_009684683.1|  PREDICTED: poly [ADP-ribose] polymerase 1          238   5e-62    
ref|XP_010380279.1|  PREDICTED: poly [ADP-ribose] polymerase 1          238   5e-62    
ref|XP_005541069.1|  PREDICTED: poly [ADP-ribose] polymerase 1          238   7e-62    
gb|KFW91620.1|  Poly [ADP-ribose] polymerase 1                          236   7e-62    
ref|XP_010007824.1|  PREDICTED: poly [ADP-ribose] polymerase 1          237   9e-62    
ref|XP_006157311.1|  PREDICTED: poly [ADP-ribose] polymerase 1          237   1e-61    
ref|XP_009581523.1|  PREDICTED: poly [ADP-ribose] polymerase 1          237   1e-61    
ref|XP_010732988.1|  PREDICTED: poly [ADP-ribose] polymerase 1          237   1e-61    
ref|XP_010391791.1|  PREDICTED: poly [ADP-ribose] polymerase 1          237   1e-61    
ref|XP_006198888.1|  PREDICTED: poly [ADP-ribose] polymerase 1          237   1e-61    
ref|XP_007935170.1|  PREDICTED: poly [ADP-ribose] polymerase 1          237   1e-61    
ref|XP_005289623.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    236   1e-61    
ref|XP_005404552.1|  PREDICTED: poly [ADP-ribose] polymerase 1          237   1e-61    
gb|EFB29647.1|  hypothetical protein PANDA_016433                       237   2e-61    Ailuropoda melanoleuca
gb|AAI00002.1|  Poly (ADP-ribose) polymerase family, member 1           237   2e-61    Danio rerio [leopard danio]
ref|XP_005043071.1|  PREDICTED: poly [ADP-ribose] polymerase 1          236   2e-61    
ref|XP_009470783.1|  PREDICTED: poly [ADP-ribose] polymerase 1          236   2e-61    
emb|CDQ76498.1|  unnamed protein product                                237   2e-61    
ref|XP_002926747.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     237   2e-61    
ref|XP_010300324.1|  PREDICTED: poly [ADP-ribose] polymerase 1          236   2e-61    
ref|XP_006268817.1|  PREDICTED: poly [ADP-ribose] polymerase 1          236   2e-61    
ref|NP_001038407.1|  poly [ADP-ribose] polymerase 1                     236   2e-61    Danio rerio [leopard danio]
ref|XP_008266574.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    236   2e-61    
ref|XP_004313311.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    236   3e-61    
ref|XP_009969669.1|  PREDICTED: poly [ADP-ribose] polymerase 1          236   3e-61    
ref|XP_004375937.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    236   3e-61    
ref|XP_004605484.1|  PREDICTED: poly [ADP-ribose] polymerase 1          236   3e-61    
ref|XP_005241893.1|  PREDICTED: poly [ADP-ribose] polymerase 1          235   4e-61    
ref|XP_005289622.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    236   5e-61    
ref|XP_009910585.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    235   5e-61    
ref|XP_009076073.1|  PREDICTED: poly [ADP-ribose] polymerase 1          235   5e-61    
ref|XP_010076719.1|  PREDICTED: poly [ADP-ribose] polymerase 1          235   5e-61    
ref|XP_005014800.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    234   5e-61    
ref|XP_003791037.1|  PREDICTED: poly [ADP-ribose] polymerase 1          235   6e-61    
ref|XP_008499362.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   6e-61    
ref|XP_009283832.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   8e-61    
ref|XP_009092024.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   8e-61    
ref|XP_005427073.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   9e-61    
ref|XP_007102732.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   1e-60    
ref|XP_006016655.1|  PREDICTED: poly [ADP-ribose] polymerase 1          235   1e-60    
ref|XP_010589425.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   1e-60    
ref|XP_547506.3|  PREDICTED: poly [ADP-ribose] polymerase 1 isofo...    235   1e-60    Canis lupus familiaris [dogs]
ref|XP_007071821.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   1e-60    
ref|XP_008628789.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   1e-60    
ref|XP_007481564.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    233   1e-60    
ref|XP_008159430.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   1e-60    
ref|XP_007464233.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   1e-60    
ref|XP_005441299.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   1e-60    
ref|XP_005880205.1|  PREDICTED: poly [ADP-ribose] polymerase 1          233   2e-60    
ref|NP_777176.1|  poly [ADP-ribose] polymerase 1                        234   2e-60    Bos taurus [bovine]
ref|XP_005488534.1|  PREDICTED: poly [ADP-ribose] polymerase 1          233   2e-60    
ref|XP_009184638.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   2e-60    
ref|XP_009892579.1|  PREDICTED: poly [ADP-ribose] polymerase 1          233   2e-60    
ref|XP_008933052.1|  PREDICTED: poly [ADP-ribose] polymerase 1          233   2e-60    
ref|XP_010576040.1|  PREDICTED: poly [ADP-ribose] polymerase 1          233   2e-60    
ref|NP_001233650.1|  poly [ADP-ribose] polymerase 1                     233   2e-60    
gb|KFM63822.1|  Poly [ADP-ribose] polymerase 1                          233   2e-60    
ref|XP_001491507.4|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    233   3e-60    Equus caballus [domestic horse]
ref|XP_006046140.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    233   3e-60    
ref|XP_010180660.1|  PREDICTED: poly [ADP-ribose] polymerase 1          233   3e-60    
ref|XP_006046141.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    233   3e-60    
ref|XP_005326600.1|  PREDICTED: poly [ADP-ribose] polymerase 1          233   4e-60    
ref|XP_007481563.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    233   4e-60    
ref|XP_005734478.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    233   4e-60    
ref|XP_010704958.1|  PREDICTED: poly [ADP-ribose] polymerase 1          232   4e-60    
ref|XP_010195273.1|  PREDICTED: poly [ADP-ribose] polymerase 1          232   4e-60    
ref|XP_009476172.1|  PREDICTED: poly [ADP-ribose] polymerase 1          232   4e-60    
dbj|BAE41080.1|  unnamed protein product                                233   4e-60    Mus musculus [mouse]
ref|XP_004541848.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     233   4e-60    
ref|XP_006914334.1|  PREDICTED: poly [ADP-ribose] polymerase 1          233   4e-60    
ref|XP_005216853.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    233   4e-60    
ref|XP_008058853.1|  PREDICTED: poly [ADP-ribose] polymerase 1          232   4e-60    
ref|XP_006897812.1|  PREDICTED: poly [ADP-ribose] polymerase 1          233   5e-60    
ref|XP_005523344.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    233   5e-60    
ref|XP_005523343.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    232   5e-60    
ref|XP_005690591.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    232   5e-60    
tpg|DAA21368.1|  TPA: poly [ADP-ribose] polymerase 1                    232   5e-60    
ref|XP_005690590.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    232   6e-60    
ref|XP_004472547.1|  PREDICTED: poly [ADP-ribose] polymerase 1          233   6e-60    
ref|XP_004013685.1|  PREDICTED: poly [ADP-ribose] polymerase 1          232   6e-60    
ref|XP_005959159.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     232   6e-60    
ref|XP_003449904.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    232   7e-60    
ref|XP_009646446.1|  PREDICTED: poly [ADP-ribose] polymerase 1          231   7e-60    
ref|XP_004700007.1|  PREDICTED: poly [ADP-ribose] polymerase 1          232   8e-60    
ref|XP_005454773.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    232   8e-60    
ref|XP_003357689.1|  PREDICTED: poly [ADP-ribose] polymerase 1          232   9e-60    
ref|XP_005914568.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    232   9e-60    
ref|XP_010851174.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    232   9e-60    
ref|XP_010851175.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    231   1e-59    
dbj|BAE39743.1|  unnamed protein product                                231   1e-59    
ref|XP_009331916.1|  PREDICTED: poly [ADP-ribose] polymerase 1          231   1e-59    
dbj|BAE27352.1|  unnamed protein product                                231   1e-59    
ref|XP_010990763.1|  PREDICTED: poly [ADP-ribose] polymerase 1          231   1e-59    
ref|XP_006188179.1|  PREDICTED: poly [ADP-ribose] polymerase 1          231   1e-59    
ref|XP_004641229.1|  PREDICTED: poly [ADP-ribose] polymerase 1          231   1e-59    
ref|XP_002194832.2|  PREDICTED: poly [ADP-ribose] polymerase 1          233   1e-59    
ref|NP_031441.2|  poly [ADP-ribose] polymerase 1                        231   1e-59    
ref|XP_005914567.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    231   1e-59    
ref|XP_006797147.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     231   1e-59    
ref|XP_005151917.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    231   2e-59    
ref|XP_008579018.1|  PREDICTED: poly [ADP-ribose] polymerase 1          231   2e-59    
ref|XP_006625727.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     231   2e-59    
ref|XP_009935626.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    230   2e-59    
ref|XP_007167258.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    231   2e-59    
ref|XP_004439616.1|  PREDICTED: poly [ADP-ribose] polymerase 1          230   2e-59    
ref|XP_010972367.1|  PREDICTED: poly [ADP-ribose] polymerase 1          231   2e-59    
ref|XP_010162117.1|  PREDICTED: poly [ADP-ribose] polymerase 1          230   2e-59    
gb|EMS59387.1|  Poly [ADP-ribose] polymerase 1                          222   2e-59    
dbj|BAE35080.1|  unnamed protein product                                231   2e-59    
ref|XP_003971725.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     230   2e-59    
ref|XP_010134097.1|  PREDICTED: poly [ADP-ribose] polymerase 1          230   3e-59    
ref|XP_004065376.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    230   3e-59    
sp|P11103.3|PARP1_MOUSE  RecName: Full=Poly [ADP-ribose] polymera...    230   3e-59    
ref|XP_004393605.1|  PREDICTED: poly [ADP-ribose] polymerase 1          230   3e-59    
sp|P26446.2|PARP1_CHICK  RecName: Full=Poly [ADP-ribose] polymera...    230   3e-59    
ref|XP_003770730.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     231   3e-59    
ref|XP_005078195.1|  PREDICTED: poly [ADP-ribose] polymerase 1          230   3e-59    
ref|XP_004889988.1|  PREDICTED: poly [ADP-ribose] polymerase 1          229   4e-59    
gb|AIZ09031.1|  poly [ADP-ribose] polymerase 1                          229   4e-59    
ref|XP_312938.4|  AGAP003230-PA                                         229   5e-59    
ref|XP_006118141.1|  PREDICTED: poly [ADP-ribose] polymerase 1          231   5e-59    
ref|NP_990594.1|  poly [ADP-ribose] polymerase 1                        229   6e-59    
ref|XP_004862328.1|  PREDICTED: poly [ADP-ribose] polymerase 1          229   6e-59    
ref|XP_009899525.1|  PREDICTED: poly [ADP-ribose] polymerase 1          229   6e-59    
gb|ELW49552.1|  Poly [ADP-ribose] polymerase 1                          229   7e-59    
ref|XP_004356596.1|  Poly(ADPribose) polymerase catalytic domain ...    229   8e-59    
ref|XP_008948173.1|  PREDICTED: poly [ADP-ribose] polymerase 1          228   9e-59    
dbj|BAE38574.1|  unnamed protein product                                229   9e-59    
ref|XP_005507407.1|  PREDICTED: poly [ADP-ribose] polymerase 1          228   1e-58    
ref|XP_009993082.1|  PREDICTED: poly [ADP-ribose] polymerase 1          228   1e-58    
ref|XP_006974251.1|  PREDICTED: poly [ADP-ribose] polymerase 1          228   1e-58    
ref|XP_010224835.1|  PREDICTED: poly [ADP-ribose] polymerase 1          228   1e-58    
gb|EHB06347.1|  Poly [ADP-ribose] polymerase 1                          229   2e-58    
ref|XP_008311175.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    228   2e-58    
ref|XP_008285170.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    228   2e-58    
ref|XP_002941174.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    227   3e-58    
gb|EGW11182.1|  Poly [ADP-ribose] polymerase 1                          227   3e-58    
ref|NP_037195.1|  poly [ADP-ribose] polymerase 1                        227   4e-58    
ref|XP_010863533.1|  PREDICTED: poly [ADP-ribose] polymerase 1          226   7e-58    
ref|XP_005349022.1|  PREDICTED: poly [ADP-ribose] polymerase 1          226   1e-57    
ref|XP_004761979.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    226   1e-57    
ref|XP_004761981.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    225   1e-57    
ref|XP_008311174.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    225   1e-57    
gb|EFX75651.1|  hypothetical protein DAPPUDRAFT_55885                   224   3e-57    
gb|ELT93548.1|  hypothetical protein CAPTEDRAFT_223861                  224   3e-57    
ref|XP_008820594.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   4e-57    
ref|XP_011063716.1|  PREDICTED: poly [ADP-ribose] polymerase isof...    223   4e-57    
gb|EMC85168.1|  Poly [ADP-ribose] polymerase 1                          222   4e-57    
ref|NP_001081571.1|  poly [ADP-ribose] polymerase 1                     224   5e-57    
sp|P31669.1|PARP1_XENLA  RecName: Full=Poly [ADP-ribose] polymera...    223   5e-57    
ref|XP_004653313.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   5e-57    
ref|XP_001177436.2|  PREDICTED: poly [ADP-ribose] polymerase 1-like     223   5e-57    
ref|XP_009872148.1|  PREDICTED: poly [ADP-ribose] polymerase 1          220   8e-57    
ref|XP_004994319.1|  hypothetical protein PTSG_05004                    223   1e-56    
gb|EAW69785.1|  poly (ADP-ribose) polymerase family, member 1, is...    222   1e-56    
ref|XP_007253978.1|  PREDICTED: poly [ADP-ribose] polymerase 1          222   1e-56    
gb|EMT10594.1|  Poly (ADP-ribose) polymerase 1                          217   2e-56    
ref|XP_006812383.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     221   2e-56    
gb|ETN59550.1|  poly [adp-ribose] polymerase                            218   2e-55    
ref|XP_002109067.1|  hypothetical protein TRIADDRAFT_19562              216   8e-55    
ref|XP_001604917.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    216   1e-54    
ref|XP_008203357.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    216   1e-54    
gb|EKC34863.1|  Poly [ADP-ribose] polymerase 1                          215   2e-54    
ref|XP_001661932.1|  poly [adp-ribose] polymerase                       215   2e-54    
ref|XP_003216114.1|  PREDICTED: poly [ADP-ribose] polymerase 1          215   3e-54    
ref|XP_003693603.1|  PREDICTED: poly [ADP-ribose] polymerase-like       214   4e-54    
ref|XP_011063718.1|  PREDICTED: poly [ADP-ribose] polymerase isof...    213   1e-53    
ref|XP_003424731.1|  PREDICTED: poly [ADP-ribose] polymerase            212   3e-53    
ref|XP_624477.3|  PREDICTED: poly [ADP-ribose] polymerase               212   3e-53    
ref|XP_002058751.1|  GJ11149                                            212   4e-53    
gb|EFN69632.1|  Poly [ADP-ribose] polymerase                            211   4e-53    
ref|XP_008559441.1|  PREDICTED: poly [ADP-ribose] polymerase-like       211   6e-53    
gb|KFB53219.1|  AGAP003230-PA-like protein                              211   6e-53    
gb|EFZ14625.1|  hypothetical protein SINV_00499                         209   2e-52    
ref|XP_004914864.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    210   2e-52    
ref|XP_001998459.1|  GI23619                                            209   2e-52    
ref|XP_004761978.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    209   2e-52    
dbj|BAE31150.1|  unnamed protein product                                209   3e-52    
gb|EQB78542.1|  poly [ADP-ribose] polymerase 1                          209   5e-52    
ref|XP_006612556.1|  PREDICTED: poly [ADP-ribose] polymerase-like       208   7e-52    
ref|XP_005906361.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     204   1e-51    
gb|EPQ16369.1|  Poly [ADP-ribose] polymerase 1                          207   1e-51    
ref|XP_004519483.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    207   2e-51    
ref|XP_004519484.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    206   2e-51    
ref|XP_002019344.1|  GL12354                                            206   2e-51    
emb|CCD60678.1|  poly [ADP-ribose] polymerase, putative                 205   4e-51    
ref|XP_003707671.1|  PREDICTED: poly [ADP-ribose] polymerase-like       205   6e-51    
ref|XP_002409668.1|  poly [ADP-ribose] polymerase, putative             204   7e-51    
ref|XP_002787829.1|  conserved hypothetical protein                     205   8e-51    
gb|EFN84955.1|  Poly [ADP-ribose] polymerase                            204   1e-50    
ref|XP_007438395.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     201   1e-50    
ref|XP_002786786.1|  conserved hypothetical protein                     204   1e-50    
gb|KFB53220.1|  AGAP003230-PA-like protein                              204   1e-50    
ref|XP_002090141.1|  GE20224                                            202   4e-50    
ref|NP_001191521.1|  poly-(ADP-ribose) polymerase I                     202   4e-50    
ref|XP_006744107.1|  PREDICTED: poly [ADP-ribose] polymerase 1          199   6e-50    
ref|XP_004761980.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    202   8e-50    
ref|XP_004761977.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    202   8e-50    
gb|EZA56984.1|  Poly [ADP-ribose] polymerase                            201   9e-50    
ref|XP_004926518.1|  PREDICTED: poly [ADP-ribose] polymerase            201   1e-49    
ref|XP_004690817.1|  PREDICTED: poly [ADP-ribose] polymerase 1          201   1e-49    
ref|XP_001996195.1|  GH22365                                            200   2e-49    
gb|KHJ46115.1|  Poly(ADP-ribose) polymerase catalytic domain protein    199   3e-49    
ref|NP_001153714.1|  poly-(ADP-ribose) polymerase                       199   3e-49    
sp|Q11208.1|PARP_SARPE  RecName: Full=Poly [ADP-ribose] polymeras...    199   7e-49    
gb|ERE73581.1|  poly [ADP-ribose] polymerase 1                          198   8e-49    
ref|XP_007534861.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    198   8e-49    
gb|AAB35558.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            194   1e-48    
pdb|4DQY|C  Chain C, Structure Of Human Parp-1 Bound To A Dna Dou...    191   2e-48    
ref|NP_001104452.1|  Poly-(ADP-ribose) polymerase                       196   6e-48    
pdb|4OPX|C  Chain C, Structure Of Human Parp-1 Bound To A Dna Dou...    189   7e-48    
ref|XP_002073889.1|  GK14355                                            195   8e-48    
ref|XP_005175604.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    195   1e-47    
ref|XP_001862547.1|  poly                                               195   1e-47    
gb|KFD59055.1|  hypothetical protein M513_00218                         194   1e-47    
gb|AAA51599.1|  poly(ADP-ribose) polymerase                             189   2e-47    
ref|XP_003487068.1|  PREDICTED: poly [ADP-ribose] polymerase-like       192   6e-47    
ref|XP_003396806.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    192   7e-47    
ref|XP_006756108.1|  PREDICTED: poly [ADP-ribose] polymerase 1          191   2e-46    
ref|XP_002430760.1|  polyA polymerase, putative                         190   4e-46    
gb|AAB35559.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            186   7e-46    
ref|XP_005830024.1|  PARP1 poly polymerase                              189   8e-46    
gb|AAB35557.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            184   1e-45    
ref|XP_008695580.1|  PREDICTED: poly [ADP-ribose] polymerase 1          188   1e-45    
gb|EHJ70647.1|  poly                                                    188   2e-45    
ref|XP_002137908.2|  GA25584                                            187   4e-45    
ref|XP_009025261.1|  hypothetical protein HELRODRAFT_95414              186   6e-45    
ref|XP_009708662.1|  PREDICTED: poly [ADP-ribose] polymerase 1          184   1e-44    
gb|ADM32529.1|  parp                                                    185   2e-44    
ref|XP_010069904.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    182   2e-44    
ref|XP_010069905.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    179   4e-44    
ref|XP_004333519.1|  Poly(ADPribose) polymerase catalytic domain ...    182   4e-44    
gb|AAB35560.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            179   7e-44    
emb|CBY18306.1|  unnamed protein product                                182   9e-44    
ref|XP_003275213.1|  PREDICTED: poly [ADP-ribose] polymerase 1          182   9e-44    
ref|XP_001947212.1|  PREDICTED: poly [ADP-ribose] polymerase            182   1e-43    
ref|XP_007199613.1|  hypothetical protein PRUPE_ppa002806mg             179   1e-43    
emb|CAA46478.1|  Poly(ADP-ribose) polymerase                            176   3e-43    
ref|XP_008547744.1|  PREDICTED: poly [ADP-ribose] polymerase-like       181   3e-43    
ref|XP_002457804.1|  hypothetical protein SORBIDRAFT_03g013840          177   7e-43    
ref|XP_009335699.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    177   8e-43    
gb|AAF61293.1|AF126717_1  msPARP                                        174   9e-43    
ref|XP_009061157.1|  hypothetical protein LOTGIDRAFT_206927             179   1e-42    
ref|XP_008244417.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     176   1e-42    
ref|XP_003740601.1|  PREDICTED: poly [ADP-ribose] polymerase-like       179   1e-42    
ref|XP_008355487.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    176   2e-42    
ref|XP_008355488.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    176   2e-42    
ref|XP_009335716.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    175   2e-42    
ref|XP_009134436.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    174   6e-42    
ref|XP_009134435.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    174   6e-42    
ref|XP_009405432.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    172   1e-41    
ref|XP_011033516.1|  PREDICTED: poly [ADP-ribose] polymerase 2          172   2e-41    
ref|XP_010652197.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    171   3e-41    
emb|CDY18025.1|  BnaC03g30970D                                          171   5e-41    
ref|XP_010652198.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    170   8e-41    
ref|XP_008559442.1|  PREDICTED: poly [ADP-ribose] polymerase            173   8e-41    
emb|CDP17120.1|  unnamed protein product                                170   9e-41    
ref|XP_009405431.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    169   1e-40    
ref|XP_004292663.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     169   1e-40    
ref|XP_010780561.1|  PREDICTED: poly [ADP-ribose] polymerase 1          171   1e-40    
ref|XP_008655901.1|  PREDICTED: poly [ADP-ribose] polymerase 2          170   2e-40    
ref|XP_005087536.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    169   2e-40    
emb|CBI36874.3|  unnamed protein product                                168   2e-40    
ref|XP_004968713.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     169   2e-40    
ref|XP_005087537.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    168   2e-40    
ref|XP_010088282.1|  Poly [ADP-ribose] polymerase 2                     169   2e-40    
ref|XP_006644151.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A-...    168   5e-40    
emb|CDX90941.1|  BnaA03g26210D                                          168   5e-40    
sp|O50017.1|PARP2_MAIZE  RecName: Full=Poly [ADP-ribose] polymera...    168   5e-40    
ref|XP_001782209.1|  predicted protein                                  168   6e-40    
ref|XP_010230864.1|  PREDICTED: poly [ADP-ribose] polymerase 2          168   9e-40    
sp|Q5Z8Q9.2|PRP2A_ORYSJ  RecName: Full=Poly [ADP-ribose] polymera...    167   1e-39    
dbj|BAD52929.1|  putative poly(ADP-ribose) polymerase                   167   1e-39    
gb|AAB35561.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            166   1e-39    
gb|EEE54532.1|  hypothetical protein OsJ_01694                          167   1e-39    
ref|XP_006375453.1|  Poly [ADP-ribose] polymerase family protein        166   1e-39    
gb|AAM50807.1|  LD31274p                                                166   2e-39    
gb|ELK36014.1|  Poly [ADP-ribose] polymerase 1                          169   2e-39    
ref|XP_010684359.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A ...    166   2e-39    
ref|XP_010684358.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A ...    166   2e-39    
ref|XP_011079644.1|  PREDICTED: poly [ADP-ribose] polymerase 2          167   2e-39    
ref|XP_006396446.1|  hypothetical protein EUTSA_v10028509mg             165   3e-39    
ref|XP_009144575.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     165   4e-39    
ref|XP_010931665.1|  PREDICTED: poly [ADP-ribose] polymerase 2          164   6e-39    
gb|EYU46735.1|  hypothetical protein MIMGU_mgv1a020376mg                165   6e-39    
ref|XP_008235208.1|  PREDICTED: poly [ADP-ribose] polymerase 2          165   6e-39    
ref|XP_006479982.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    164   7e-39    
dbj|GAA38154.2|  poly [ADP-ribose] polymerase                           167   8e-39    
ref|XP_010522796.1|  PREDICTED: poly [ADP-ribose] polymerase 2          164   9e-39    
gb|EMP24541.1|  Poly [ADP-ribose] polymerase 1                          164   1e-38    
gb|ETE69570.1|  Poly [ADP-ribose] polymerase 1                          167   1e-38    
gb|KDO87191.1|  hypothetical protein CISIN_1g006883mg                   163   1e-38    
ref|XP_008451559.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    163   2e-38    
ref|XP_006444375.1|  hypothetical protein CICLE_v10019312mg             163   2e-38    
ref|XP_006479983.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    162   3e-38    
ref|XP_006479981.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    162   3e-38    
ref|XP_007050950.1|  Poly(ADP-ribose) polymerase isoform 1              162   4e-38    
ref|NP_192148.2|  poly(ADP-ribose) polymerase                           162   4e-38    
gb|AAC19283.1|  T14P8.19                                                162   4e-38    



>ref|XP_009762733.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Nicotiana sylvestris]
Length=810

 Score =  1257 bits (3252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/822 (74%), Positives = 714/822 (87%), Gaps = 16/822 (2%)
 Frame = -2

Query  2988  THHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkaeeedgkaadv  2809
              HHA+DEE+ VTRKQKA+SK  Q+ DE    SP KK KT       E  +E+ +GK+   
Sbjct  3     VHHASDEEKKVTRKQKAESKS-QESDE---QSP-KKPKT-------EGNSEQANGKSNST  50

Query  2808  aaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCG  2629
               AAEFEKFC+ATSEHLS++QMR+IL+ N +D+S SD+ +VPRCQ+I+FYGP+  CPVCG
Sbjct  51    DIAAEFEKFCKATSEHLSIKQMREILEANGRDASVSDDAVVPRCQDILFYGPLGPCPVCG  110

Query  2628  GALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKN  2449
             G LE S  G YHC+G +SEWSSC YSTR+PPR+EEPL IP+SV KTP+SDLI+KH+DPK+
Sbjct  111   GTLEFSGDG-YHCRGAYSEWSSCVYSTRDPPRREEPLNIPDSVGKTPVSDLIEKHRDPKS  169

Query  2448  RPLKEQVITV-KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAER  2272
             R LK ++  V KP  GMMISLSGRL+RTHQYWK++IEKNGGKVANSVIG TCLVVSP ER
Sbjct  170   R-LKPEITGVDKPFVGMMISLSGRLSRTHQYWKTKIEKNGGKVANSVIGATCLVVSPTER  228

Query  2271  ERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPS  2092
             +RGGSSKVAEAVERGIPVVREAWL DSIEKKE   LDAYDVASDIAVDG+GI LDKQD S
Sbjct  229   DRGGSSKVAEAVERGIPVVREAWLADSIEKKEALALDAYDVASDIAVDGKGIALDKQDSS  288

Query  2091  AEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQ  1912
               ALE +T+ELKV+GKRGVHKDTKLQDEGG ILEKDGLLYNCAL++CDQGR +NDFCIMQ
Sbjct  289   VVALETVTAELKVFGKRGVHKDTKLQDEGGTILEKDGLLYNCALTICDQGRNMNDFCIMQ  348

Query  1911  LIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREK  1732
             LI+A ENRLH+YY+KG++GD+ R DDKLEEWEN + AIKEF+++FEELTGNEF   EREK
Sbjct  349   LIMARENRLHLYYKKGKIGDSLRADDKLEEWENLNDAIKEFAKLFEELTGNEFEPWEREK  408

Query  1731  KIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYAL  1552
             KIQKK  KF+P+D+ DG+EVRHGGL LRQLG+AA HSKLDP VANFMK+LCSQEIYRYAL
Sbjct  409   KIQKKHLKFFPIDIDDGVEVRHGGLGLRQLGVAAAHSKLDPKVANFMKVLCSQEIYRYAL  468

Query  1551  MEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMP  1372
             MEMGYD PE+P+GML+D HL+RCE+TLL FV++++S+KE G Q EALWA+FS KWFTLMP
Sbjct  469   MEMGYDSPEVPVGMLTDFHLKRCEETLLRFVDKLKSSKETGNQEEALWADFSQKWFTLMP  528

Query  1371  STRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISAL  1192
             +TRP   +DF ++ADHAAS +E++RDIN ASRLI DMSGSTLDDPL+DRYVKLGCS+S +
Sbjct  529   TTRPLSFKDFGELADHAASAYEAIRDINTASRLIGDMSGSTLDDPLFDRYVKLGCSVSPV  588

Query  1191  EKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWC  1012
             EK++DDYKMI+KYLE+TY+PV VG+ SYGVSVENIFAVE SACPSLD +KKLPNKVLLWC
Sbjct  589   EKETDDYKMIVKYLERTYEPVMVGETSYGVSVENIFAVEVSACPSLDVIKKLPNKVLLWC  648

Query  1011  GTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLA  832
             GTRSSNLLRHLQ GFLPA C+LP PGYMFG+AIVCSDAAAEAA+YG+TAVDRPEGFLVLA
Sbjct  649   GTRSSNLLRHLQMGFLPAACALPAPGYMFGRAIVCSDAAAEAARYGYTAVDRPEGFLVLA  708

Query  831   VASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQ  652
             VAS+GEEI EFSSPPEDTKSLE+KK GAK  G+KKTDESEHFVWKDDI+VPCG+LI  S+
Sbjct  709   VASLGEEIQEFSSPPEDTKSLEEKKTGAKGLGKKKTDESEHFVWKDDIRVPCGKLI-PSE  767

Query  651   HNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             H +SP +YNEYAVYDPQQVSIRFLVAVK++E+ VEY T EP+
Sbjct  768   HKDSPLEYNEYAVYDPQQVSIRFLVAVKFEEQDVEYDTVEPE  809



>ref|XP_009777025.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Nicotiana sylvestris]
Length=815

 Score =  1248 bits (3230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/832 (73%), Positives = 707/832 (85%), Gaps = 22/832 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRS  H A DE +M TRKQKA++K  QD   P      KKAKT        ++  
Sbjct  1     MKVHETRSQAHAAGDERKM-TRKQKAETKS-QDSASP------KKAKT--------EEDN  44

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
              ++G+ + V   AEFEKFC+A SEHLS++QMR+IL+ N Q SSG D+ +VPRCQ+IMFYG
Sbjct  45    GQEGEESMVDIRAEFEKFCKALSEHLSIKQMREILEANGQYSSGDDDAVVPRCQDIMFYG  104

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+D CP+CGG LECS G  YHC GD+SEWSSC YSTR PPR+E+ LR P+SV+ TP+SDL
Sbjct  105   PLDNCPICGGMLECS-GDRYHCVGDYSEWSSCIYSTREPPRREDTLRFPKSVESTPVSDL  163

Query  2475  IKKHQDPK-NRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG--  2305
             IKK  DPK NRP ++     KP  GMMISL+GRLTRTHQYWKS IEK+GGKV NSVIG  
Sbjct  164   IKKRGDPKKNRPPRKYSAPKKPFDGMMISLAGRLTRTHQYWKSIIEKHGGKVNNSVIGGA  223

Query  2304  -VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVD  2128
              VTCLVVSPAER+RGGSSKVAEAVER IPVVREAWL DSIEK++ QPL AYD+ASDIAV+
Sbjct  224   RVTCLVVSPAERDRGGSSKVAEAVERSIPVVREAWLSDSIEKEQAQPLAAYDIASDIAVE  283

Query  2127  GRGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCD  1948
             GRGIPLDK DPSAEALE IT++LKV+GKRGVHKDTK+QDEG +ILEKDGLLYNCALSVC+
Sbjct  284   GRGIPLDKMDPSAEALETITADLKVFGKRGVHKDTKMQDEGARILEKDGLLYNCALSVCN  343

Query  1947  QGRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEEL  1768
             Q   +NDFCIMQLI++PENRLHMY +KGR+GD+ R D+KLEEWEN D AIKEF+R+FEEL
Sbjct  344   QKNRINDFCIMQLIMSPENRLHMYCKKGRIGDSIRADNKLEEWENVDDAIKEFARLFEEL  403

Query  1767  TGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMK  1588
             TGNEF S EREKKIQKK HKF+P+DV DG+EVRHG L LRQLG AA HSKLDPMVANFMK
Sbjct  404   TGNEFESWEREKKIQKKHHKFFPIDVDDGVEVRHGALGLRQLGSAAAHSKLDPMVANFMK  463

Query  1587  ILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALW  1408
             +LCSQEIYRYALME+G+D PE+PIGML+D+HL+RCE+TLL+FVE+++S KE GQ  E +W
Sbjct  464   VLCSQEIYRYALMELGHDSPEVPIGMLTDLHLKRCEETLLYFVEKVKSMKETGQAAEGVW  523

Query  1407  AEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYD  1228
              EFS +WFTLMPS RPF  RD+ D+A+HAAS +E++RD+N ASR+IEDMSGSTLDDPL++
Sbjct  524   YEFSQRWFTLMPSIRPFTFRDYTDLAEHAASAYETIRDVNFASRIIEDMSGSTLDDPLFE  583

Query  1227  RYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDD  1048
             RY KLGC +S LEKDSDDYKMI+ YLEKTY+P+RVGD+SYGVSVENIF+VE SACPSLDD
Sbjct  584   RYKKLGCFVSPLEKDSDDYKMIVNYLEKTYEPIRVGDMSYGVSVENIFSVEVSACPSLDD  643

Query  1047  MKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFT  868
             +KKLPNKVLLWCGTRSSNLLRHL  GFLP+VCSLPV GYMFG+A+VCSDAAAEAA+YGFT
Sbjct  644   IKKLPNKVLLWCGTRSSNLLRHLHRGFLPSVCSLPVSGYMFGRAVVCSDAAAEAAQYGFT  703

Query  867   AVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDI  688
             A+DRPEGFLVLA+AS+GEEI EFSSPPEDTK+LE+KK+G K  GRKKTDE EHF+WKDDI
Sbjct  704   AIDRPEGFLVLAIASLGEEIKEFSSPPEDTKALEEKKIGVKGLGRKKTDEKEHFIWKDDI  763

Query  687   KVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
              VPCGRLI  S+H +S  +YNEYAVYDPQQVSIR+LVAVK+DE+ V Y TAE
Sbjct  764   TVPCGRLI-PSEHKDSVLEYNEYAVYDPQQVSIRYLVAVKFDEQGVVYDTAE  814



>ref|XP_009597829.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009597830.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X3 [Nicotiana 
tomentosiformis]
Length=815

 Score =  1244 bits (3219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/830 (73%), Positives = 708/830 (85%), Gaps = 16/830 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHE R H H A+DEE+ VTRKQKA+SK  +    P      KK KT       E   E
Sbjct  1     MKVHEKRGHPH-ASDEEKKVTRKQKAESKSQESGQSP------KKPKT-------EGDNE  46

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
             + +GK+     AAEFEKFC+ATSEHLS++QMR+IL+ N +D+S SD+ +VPRCQ+I+FYG
Sbjct  47    QANGKSNAADIAAEFEKFCKATSEHLSIKQMREILEANGRDASVSDDAVVPRCQDILFYG  106

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+D CPVCGG LE S  G Y C+G +SEWSSC YSTR+PPR+EEPL IPESV KT +SDL
Sbjct  107   PLDPCPVCGGTLEFSGDG-YQCQGAYSEWSSCVYSTRDPPRREEPLNIPESVGKTRVSDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             I+KH+DPK+R  +E     KP +GMMI+LSGRL+RTHQYWK++IEKNGGKVANSVIG TC
Sbjct  166   IEKHRDPKSRLKREITGQDKPFAGMMITLSGRLSRTHQYWKTKIEKNGGKVANSVIGATC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSP ER+RGGSSKVAEAVER IPVVREAWL DSIEKKE   LDAYDVASDIAV G+GI
Sbjct  226   LVVSPTERDRGGSSKVAEAVERSIPVVREAWLADSIEKKEALALDAYDVASDIAVYGKGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
              LDKQD S  ALE + +ELKV+GKRGVHKDTKLQDEGG ILEKDG+LYNC L+VCDQGR 
Sbjct  286   ALDKQDSSVVALETVAAELKVFGKRGVHKDTKLQDEGGTILEKDGVLYNCVLTVCDQGRD  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             +NDFCIMQLI+A ENRLH+YY+KG++GD+ R DDKLEEWEN + AIKEF+++FEELTGNE
Sbjct  346   MNDFCIMQLIMARENRLHLYYKKGKIGDSLRADDKLEEWENLNDAIKEFAKLFEELTGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKK  KF+P+D+ DG+EVRHGGL LRQLG+AA H KLDP VANFMK+LCS
Sbjct  406   FEPWEREKKIQKKHLKFFPIDIDDGVEVRHGGLGLRQLGVAAAHCKLDPKVANFMKVLCS  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIYRYALMEMGYD PE+P+GML+D HL+RCE+ LL+FV++++S+KE G+Q EA WA+FS
Sbjct  466   QEIYRYALMEMGYDSPEVPVGMLTDFHLKRCEEILLYFVDKLKSSKETGKQEEASWADFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTL+P+TRP   +DF ++ADHAAS +E++RDIN ASRLI DMSGSTLDDPL+DRYVK
Sbjct  526   QRWFTLLPTTRPLSFKDFGELADHAASSYEAIRDINTASRLIGDMSGSTLDDPLFDRYVK  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCS+S LEK++DDYKMI+KYLEKTY+PV VGD SYGVSV+NIFAVE SACPSLDD+KKL
Sbjct  586   LGCSVSPLEKETDDYKMIVKYLEKTYEPVTVGDTSYGVSVDNIFAVEVSACPSLDDIKKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSNL RHLQ GFLPA C+LP PGYMFG+AIVCSDAAAEAA+YG+TAVDR
Sbjct  646   PNKVLLWCGTRSSNLSRHLQMGFLPATCALPAPGYMFGRAIVCSDAAAEAARYGYTAVDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+GEEI EFSSPPEDTKSLE+KK+GAK  G+KKTDESEHFVWKDDIKVPC
Sbjct  706   PEGFLVLAVASLGEEIQEFSSPPEDTKSLEEKKIGAKGLGKKKTDESEHFVWKDDIKVPC  765

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             G+LI  S++ +SP +YNEYAVYDPQQVSIRFLVAVK++E+ VEY T EP+
Sbjct  766   GKLI-PSEYKDSPLEYNEYAVYDPQQVSIRFLVAVKFEEQDVEYETVEPE  814



>ref|XP_009597828.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=847

 Score =  1243 bits (3215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/830 (73%), Positives = 707/830 (85%), Gaps = 16/830 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
              +VHE R H H A+DEE+ VTRKQKA+SK  +    P      KK KT       E   E
Sbjct  33    FQVHEKRGHPH-ASDEEKKVTRKQKAESKSQESGQSP------KKPKT-------EGDNE  78

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
             + +GK+     AAEFEKFC+ATSEHLS++QMR+IL+ N +D+S SD+ +VPRCQ+I+FYG
Sbjct  79    QANGKSNAADIAAEFEKFCKATSEHLSIKQMREILEANGRDASVSDDAVVPRCQDILFYG  138

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+D CPVCGG LE S  G Y C+G +SEWSSC YSTR+PPR+EEPL IPESV KT +SDL
Sbjct  139   PLDPCPVCGGTLEFSGDG-YQCQGAYSEWSSCVYSTRDPPRREEPLNIPESVGKTRVSDL  197

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             I+KH+DPK+R  +E     KP +GMMI+LSGRL+RTHQYWK++IEKNGGKVANSVIG TC
Sbjct  198   IEKHRDPKSRLKREITGQDKPFAGMMITLSGRLSRTHQYWKTKIEKNGGKVANSVIGATC  257

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSP ER+RGGSSKVAEAVER IPVVREAWL DSIEKKE   LDAYDVASDIAV G+GI
Sbjct  258   LVVSPTERDRGGSSKVAEAVERSIPVVREAWLADSIEKKEALALDAYDVASDIAVYGKGI  317

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
              LDKQD S  ALE + +ELKV+GKRGVHKDTKLQDEGG ILEKDG+LYNC L+VCDQGR 
Sbjct  318   ALDKQDSSVVALETVAAELKVFGKRGVHKDTKLQDEGGTILEKDGVLYNCVLTVCDQGRD  377

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             +NDFCIMQLI+A ENRLH+YY+KG++GD+ R DDKLEEWEN + AIKEF+++FEELTGNE
Sbjct  378   MNDFCIMQLIMARENRLHLYYKKGKIGDSLRADDKLEEWENLNDAIKEFAKLFEELTGNE  437

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKK  KF+P+D+ DG+EVRHGGL LRQLG+AA H KLDP VANFMK+LCS
Sbjct  438   FEPWEREKKIQKKHLKFFPIDIDDGVEVRHGGLGLRQLGVAAAHCKLDPKVANFMKVLCS  497

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIYRYALMEMGYD PE+P+GML+D HL+RCE+ LL+FV++++S+KE G+Q EA WA+FS
Sbjct  498   QEIYRYALMEMGYDSPEVPVGMLTDFHLKRCEEILLYFVDKLKSSKETGKQEEASWADFS  557

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTL+P+TRP   +DF ++ADHAAS +E++RDIN ASRLI DMSGSTLDDPL+DRYVK
Sbjct  558   QRWFTLLPTTRPLSFKDFGELADHAASSYEAIRDINTASRLIGDMSGSTLDDPLFDRYVK  617

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCS+S LEK++DDYKMI+KYLEKTY+PV VGD SYGVSV+NIFAVE SACPSLDD+KKL
Sbjct  618   LGCSVSPLEKETDDYKMIVKYLEKTYEPVTVGDTSYGVSVDNIFAVEVSACPSLDDIKKL  677

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSNL RHLQ GFLPA C+LP PGYMFG+AIVCSDAAAEAA+YG+TAVDR
Sbjct  678   PNKVLLWCGTRSSNLSRHLQMGFLPATCALPAPGYMFGRAIVCSDAAAEAARYGYTAVDR  737

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+GEEI EFSSPPEDTKSLE+KK+GAK  G+KKTDESEHFVWKDDIKVPC
Sbjct  738   PEGFLVLAVASLGEEIQEFSSPPEDTKSLEEKKIGAKGLGKKKTDESEHFVWKDDIKVPC  797

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             G+LI  S++ +SP +YNEYAVYDPQQVSIRFLVAVK++E+ VEY T EP+
Sbjct  798   GKLI-PSEYKDSPLEYNEYAVYDPQQVSIRFLVAVKFEEQDVEYETVEPE  846



>ref|XP_009624066.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=812

 Score =  1236 bits (3197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/829 (72%), Positives = 707/829 (85%), Gaps = 19/829 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRS  H A+ EER +TRK+KA++K  QD   P      KKAKT        ++  
Sbjct  1     MKVHETRSQAHTAS-EERKMTRKRKAETKS-QDSASP------KKAKT--------EEDN  44

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
              + G+ + V   AEFE FC+A +EHLS++QMR+IL+ N Q SS  D+ +VPRCQ+IMFYG
Sbjct  45    GQGGEESMVDIRAEFENFCKAIAEHLSIKQMREILEANGQYSSCDDDAVVPRCQDIMFYG  104

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+D CP+CGG LECS G  YHC GD+SEWSSC YSTR P R+E+ LR P+SV+ TP+SDL
Sbjct  105   PLDNCPICGGMLECS-GDRYHCVGDYSEWSSCIYSTREPLRREDSLRFPKSVESTPVSDL  163

Query  2475  IKKHQDPK-NRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             IKK+ DPK NRP K+     KP  GMMISL+GRLTRTHQYWKS+IEK GGKV NSVIGVT
Sbjct  164   IKKYGDPKKNRPPKKYSAPEKPFDGMMISLAGRLTRTHQYWKSKIEKYGGKVNNSVIGVT  223

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAER+RGGSSKVAEAVER IPVVREAWL DSIEK++ QPLDAYD+ASDIAV+GRG
Sbjct  224   CLVVSPAERDRGGSSKVAEAVERSIPVVREAWLSDSIEKEQAQPLDAYDIASDIAVEGRG  283

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IPLDK DPS EALE IT+ELKV+GKRGVHKDTK+QDEG +ILEKDGLLYNCALSVC+Q  
Sbjct  284   IPLDKMDPSEEALETITAELKVFGKRGVHKDTKMQDEGARILEKDGLLYNCALSVCNQKN  343

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
              +NDFCIMQLI++PEN LHMY +KGR+GD+ R DDKLEEWE+ D AIKEF+R+F+ELTGN
Sbjct  344   QINDFCIMQLIMSPENCLHMYCKKGRIGDSIRADDKLEEWEDVDDAIKEFARLFQELTGN  403

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF S EREKKIQKK HKF+P+DV DG+EVRHG L LRQLG +AVHSKLDPMVANFMK+LC
Sbjct  404   EFESWEREKKIQKKHHKFFPIDVDDGVEVRHGALGLRQLGSSAVHSKLDPMVANFMKVLC  463

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIYRYALME+G+D PE+PIGML+D+HL+RCE+TLL+FVE+++S KE GQ+ E +W +F
Sbjct  464   SQEIYRYALMELGHDSPEVPIGMLTDLHLKRCEETLLYFVEKVKSMKETGQEAEGVWYDF  523

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S +WFTLMPS RPF  RD+ D+A+HAAS +E++RD+N ASR+I+DMSGSTLDDPL++RY 
Sbjct  524   SQRWFTLMPSIRPFTFRDYTDLAEHAASAYETIRDVNFASRIIQDMSGSTLDDPLFERYK  583

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGC +S LEK+SDDYKMI+ YLEKTY+P+ VG++SYGVSVENIFAVE S+CPSLDD+KK
Sbjct  584   KLGCIVSPLEKESDDYKMIVNYLEKTYEPISVGEMSYGVSVENIFAVEVSSCPSLDDIKK  643

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLR+LQ GFLP+VCSLPV GYMFG+A+VCSDAAAEAA+YGFTA+D
Sbjct  644   LPNKVLLWCGTRSSNLLRYLQKGFLPSVCSLPVSGYMFGRAVVCSDAAAEAARYGFTAID  703

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+GEE+ EFS+PPEDTK+LE+KK+G K  GRKKTDE EHFVWKDDIKVP
Sbjct  704   RPEGFLVLAVASLGEEVKEFSNPPEDTKALEEKKIGVKGLGRKKTDEKEHFVWKDDIKVP  763

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             CGRLI  S+H +S  +YNEYAVYDPQQVSIR+LVAVK+DE+ V Y T+E
Sbjct  764   CGRLI-PSEHKDSVLEYNEYAVYDPQQVSIRYLVAVKFDEQGVVYDTSE  811



>ref|XP_006349137.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Solanum tuberosum]
Length=844

 Score =  1210 bits (3131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/833 (69%), Positives = 692/833 (83%), Gaps = 19/833 (2%)
 Frame = -2

Query  3021  PDMKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekk  2842
             P+  VHE RSH+H +++E+++ TRK KA++               KK+K  + G  ++K 
Sbjct  30    PEDYVHEKRSHSHASDEEKKVTTRKHKAEAA-------------PKKSKIANEGEDNDKV  76

Query  2841  aeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMF  2662
                                FCR T EHLS++QMR+IL+ NA+D+S +DE +VPRCQ+I+F
Sbjct  77    NGRSSVADVAAEFEK----FCRETREHLSIKQMREILEANARDASIADEAVVPRCQDILF  132

Query  2661  YGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLS  2482
             YGPV  CPVCGG LE S  G YHC+G +SEWSSC YSTR+PPR+EEP  IPES+ KTP+ 
Sbjct  133   YGPVGDCPVCGGTLEFSGDG-YHCQGAYSEWSSCVYSTRSPPRREEPTNIPESIGKTPVY  191

Query  2481  DLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGV  2302
             DLI+KH+DPK+RP +E  +  KP  GMMI+L+GRL+RTHQYWK +IEKNGGKVANSVIG 
Sbjct  192   DLIEKHRDPKSRPRREIAVADKPFVGMMIALAGRLSRTHQYWKKKIEKNGGKVANSVIGA  251

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
             TCLVVSP+ER+RGGSSKVAEAVERGIPVVREAWL DSI++K+ + LDAYD+ASDIAV+G+
Sbjct  252   TCLVVSPSERDRGGSSKVAEAVERGIPVVREAWLTDSIKEKQAETLDAYDIASDIAVEGK  311

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             G+ LD+QD S  ALE +T+ELKV+GKRGVH D+KLQ+EGGKILEKDG+LYNCAL+VCDQG
Sbjct  312   GLALDQQDSSVVALETLTAELKVFGKRGVHIDSKLQNEGGKILEKDGILYNCALTVCDQG  371

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
             R LNDFCIMQLIVA ENRL++YYRKG++GD+ R DDKLEEWEN + AI+EF+++FEELTG
Sbjct  372   RNLNDFCIMQLIVARENRLYLYYRKGKIGDSPRADDKLEEWENVNDAIREFAKLFEELTG  431

Query  1761  NEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKIL  1582
              +F   EREKKI KK  KF+P+D+ DG+EVR+GGL LRQLG+AA HSKLDP VAN MK+L
Sbjct  432   GQFELWEREKKIHKKNMKFFPIDIDDGVEVRYGGLGLRQLGVAAAHSKLDPKVANLMKVL  491

Query  1581  CSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAE  1402
             CSQEIYRYAL+EMGYD PEIPIGM++D+HL RCE+TL  FVE+++S+   G + +A WA+
Sbjct  492   CSQEIYRYALVEMGYDSPEIPIGMVTDLHLRRCEETLKEFVEKLKSSTVTGNKADAFWAD  551

Query  1401  FSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRY  1222
             F+ +WFTL+P+TRPF  +D+ ++AD  AS +E++RDIN ASRLI DMSGSTLDDPL++RY
Sbjct  552   FTQRWFTLIPTTRPFPFKDYEELADQGASSYEAIRDINTASRLIGDMSGSTLDDPLFERY  611

Query  1221  VKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK  1042
             VKL CS+S LEK+ DDYKMI+KYL+KTYDPVR+GD+SYGVSVENIFAVE SACPSLDD++
Sbjct  612   VKLNCSVSPLEKEEDDYKMIVKYLDKTYDPVRIGDVSYGVSVENIFAVEASACPSLDDIR  671

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KLPNKVLLWCGTRSSNLLRHLQ GFLP+ CSLPVPGYMFG+AIVCSDAAAEAA+YGFTAV
Sbjct  672   KLPNKVLLWCGTRSSNLLRHLQMGFLPSTCSLPVPGYMFGRAIVCSDAAAEAARYGFTAV  731

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
             DRPEGFLVLAVAS+GEEI EFSSPPEDT SLE+K +GAK  G+KKTDESEHFVWKDDIKV
Sbjct  732   DRPEGFLVLAVASLGEEIQEFSSPPEDTISLEEKGIGAKGLGKKKTDESEHFVWKDDIKV  791

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDE  523
             PCG+LI  S+H  SP +YNEYAVYDPQQVSIRFLVAVKY+E+ VEY   E  E
Sbjct  792   PCGKLI-PSEHKESPLEYNEYAVYDPQQVSIRFLVAVKYEEQDVEYEAVEQPE  843



>ref|XP_004251377.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Solanum lycopersicum]
Length=818

 Score =  1205 bits (3117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/828 (69%), Positives = 688/828 (83%), Gaps = 19/828 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHE RSH+H +++E+++ TRKQKA++   +     + N    K K        +  AE
Sbjct  1     MKVHEKRSHSHASDEEKKVTTRKQKAEAAPKKPK---IANEGEDKDKVNGRSNAADVAAE  57

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
              E               FCR T EHLS++QMR+IL+ NA+D+S +DE +VPRCQ+I+FYG
Sbjct  58    FEK--------------FCRETREHLSIKQMREILEANARDASIADEAVVPRCQDILFYG  103

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             PV  CPVCGG LE S G +YHC+G +SEWSSC YSTR+PPR+EEP+ IPES+ KTP+ +L
Sbjct  104   PVGDCPVCGGKLELS-GDSYHCEGAYSEWSSCVYSTRSPPRREEPINIPESIGKTPVYEL  162

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             I+KH+DPK+RP +E     KP  GMMI+LSGRL+RTHQYWK +IEKNGGKVANSVIG TC
Sbjct  163   IEKHRDPKSRPKREIASVDKPFVGMMIALSGRLSRTHQYWKKKIEKNGGKVANSVIGATC  222

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSP+ER+RGGSSKVAEAVERGIPVVREAWL DSIEKK+ + LDAYD+ASDIAV+G+G+
Sbjct  223   LVVSPSERDRGGSSKVAEAVERGIPVVREAWLTDSIEKKQAETLDAYDIASDIAVEGKGL  282

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
              LD+QD S  ALE +T+ELKV+GKR VH D+KLQDEGGKILEKDG+LYNCAL+VCDQGR 
Sbjct  283   ALDQQDSSVVALETLTAELKVFGKRAVHIDSKLQDEGGKILEKDGILYNCALTVCDQGRN  342

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             LNDFCIMQLIVA ENRL++YYRKG++G++ R DDKLEEWEN + AI+EF+++FEELTG++
Sbjct  343   LNDFCIMQLIVARENRLYLYYRKGKIGNSPRADDKLEEWENVNDAIREFAKLFEELTGDQ  402

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKI KK  KF+P+D+ DG+EVR+GGL LRQLG+AA HSKLDP VAN MK+LCS
Sbjct  403   FEPWEREKKIHKKNMKFFPIDIDDGVEVRYGGLGLRQLGVAASHSKLDPKVANLMKVLCS  462

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIYRYALMEMGYD PEIPIGM++D+HL RCEDTL  F E+++S+   G + +A WA+F+
Sbjct  463   QEIYRYALMEMGYDSPEIPIGMVTDLHLRRCEDTLKEFAEKLKSSTPTGNKADAAWADFT  522

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTL+P+TRPF  +D+ ++AD   S +E++RDIN ASRLI DMSGSTLDDPL++RY+K
Sbjct  523   QRWFTLVPTTRPFPFKDYEELADQGVSSYEAIRDINTASRLIGDMSGSTLDDPLFERYMK  582

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             L CS+S LEK+ DDYKMI+KYL+KTY+PV + D+SYGVSV+NIFAVE SACPSLDD+KKL
Sbjct  583   LNCSLSPLEKEEDDYKMIVKYLDKTYEPVSIADVSYGVSVQNIFAVEASACPSLDDIKKL  642

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSNLLRHLQ GFLP+ CSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVDR
Sbjct  643   PNKVLLWCGTRSSNLLRHLQLGFLPSTCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDR  702

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+GEEI EFSSPPEDTKSLE+K +GAK  G+KKTDESEHFVWKD+I VPC
Sbjct  703   PEGFLVLAVASLGEEIQEFSSPPEDTKSLEEKGIGAKGLGKKKTDESEHFVWKDNINVPC  762

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             G+LI  S+H  SP +YNEYAVYDPQQVSIRFLV VK++E+ VEY   E
Sbjct  763   GKLI-PSEHKESPLEYNEYAVYDPQQVSIRFLVEVKFEEKDVEYEAVE  809



>ref|XP_006365785.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Solanum tuberosum]
Length=962

 Score =  1193 bits (3087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/830 (70%), Positives = 687/830 (83%), Gaps = 19/830 (2%)
 Frame = -2

Query  3009  VHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkaeee  2830
             VHETRS  H A+ EER VTRKQ+A+S   +       ++  KKAKT +    +    E+ 
Sbjct  151   VHETRSEAHSAS-EERKVTRKQQAESNSQE-------SASHKKAKTEEEEEEEGTDHEDG  202

Query  2829  dgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPV  2650
                  +         FC+  +EHLSV+QMR+IL+ N Q S G D+ +VPRCQ+IMF+GP+
Sbjct  203   IRAEFEK--------FCKTITEHLSVKQMREILEANGQYSKGEDDAVVPRCQDIMFFGPL  254

Query  2649  DKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK  2470
             D CP+CGG LECS G +YHC GD+SEWSSC YST+ PPR+EE L++P+SV+ TP+SDLIK
Sbjct  255   DNCPICGGKLECS-GDSYHCVGDYSEWSSCIYSTKEPPRREESLKLPKSVESTPVSDLIK  313

Query  2469  KHQDP-KNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCL  2293
             K  +P K+RP KE     KP  GMMISL+GRLTR HQYWKS+IEK GGKV NSV GV C+
Sbjct  314   KRGNPNKSRPRKEISAPRKPFDGMMISLAGRLTRKHQYWKSKIEKFGGKVNNSVTGVACV  373

Query  2292  VVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIP  2113
             VVSPAER+RGGSSKVAEA+E+GIPVVREAWL DSIE +E QPLDAYDVASDIAV+G+GIP
Sbjct  374   VVSPAERDRGGSSKVAEALEKGIPVVREAWLSDSIEMEEAQPLDAYDVASDIAVEGKGIP  433

Query  2112  LDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGL  1933
             LDK DPSAEALE +T+ELKV+GKRGVH+DTK+QDEG +ILEKDGLLYNCALSVC+Q   L
Sbjct  434   LDKMDPSAEALETVTAELKVFGKRGVHRDTKMQDEGARILEKDGLLYNCALSVCNQKNKL  493

Query  1932  NDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEF  1753
             NDFCIMQLI++ ENRLHMYYR+GR GD+ R  DKLEEWEN D AIKEF+R+FEE+TGNEF
Sbjct  494   NDFCIMQLIMSSENRLHMYYRRGRNGDSLRAHDKLEEWENVDDAIKEFARLFEEMTGNEF  553

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
                EREKKI KK HKFYP+D+ DG+EVRHG L LRQLG AA HSKLD +VANFMK+LCSQ
Sbjct  554   EPWEREKKIHKKHHKFYPIDIDDGVEVRHGALGLRQLGSAAAHSKLDSVVANFMKVLCSQ  613

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             EIYRYALME+G+D PEIPIGML+++HL RCE+ L HFVE+I+S KE G + E +W EFS 
Sbjct  614   EIYRYALMELGHDSPEIPIGMLTNLHLRRCEEILQHFVEKIKSMKETGPKAEGVWYEFSQ  673

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
              WFTLMPSTRPF  RD+AD+ +HAAS +E++RDIN ASR+IEDMSGSTLDDPL++ Y KL
Sbjct  674   MWFTLMPSTRPFTFRDYADLTEHAASAYETIRDINFASRIIEDMSGSTLDDPLFECYKKL  733

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLP  1033
              CSIS LEK SDDYKMI+ YLEKTY+PV+VGD+SYGVSVENIFAVE SACPSLD++K+LP
Sbjct  734   LCSISPLEKKSDDYKMIVNYLEKTYEPVQVGDMSYGVSVENIFAVEVSACPSLDEIKELP  793

Query  1032  NKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRP  853
             NKVLLWCGTRSSNLLRHLQ GFLP+VCSLPV GYMFG+AIVCSDAAAEAA+YGFTAVDRP
Sbjct  794   NKVLLWCGTRSSNLLRHLQKGFLPSVCSLPVSGYMFGRAIVCSDAAAEAARYGFTAVDRP  853

Query  852   EGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCG  673
             EGFLVLAVAS+GEEI EF SPPEDT++LE+KK+G K  GRKKT+E EHFVWKDDIKVPCG
Sbjct  854   EGFLVLAVASLGEEIKEFPSPPEDTRALEEKKVGVKGLGRKKTNEKEHFVWKDDIKVPCG  913

Query  672   RLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDE  523
             +LI  S+H +S  +YNEYAVYDPQQVSIR+LVAVK+DE+   Y TAEP +
Sbjct  914   KLI-PSEHKDSVLEYNEYAVYDPQQVSIRYLVAVKFDEQDAVYDTAEPGQ  962



>ref|XP_010327085.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X5 [Solanum 
lycopersicum]
Length=814

 Score =  1187 bits (3072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/834 (70%), Positives = 685/834 (82%), Gaps = 22/834 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRS  H +  EER V RKQ+A+S   +        +  KKAKT D   G   +  
Sbjct  1     MKVHETRSQAH-STSEERKVMRKQQAESNSQE-------TASHKKAKTDDEEEGVVHEDG  52

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                              FC+  +EHLSV+QMR+IL+ N Q S G D+ +VPRCQ++MFYG
Sbjct  53    IRAEFEK----------FCKTITEHLSVKQMREILEANGQYSKGEDDAVVPRCQDVMFYG  102

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+D CP+CGG LECS  G YHC GD+SEWSSC YST+ PPR+EE L++PESV+ TP+SDL
Sbjct  103   PLDNCPICGGKLECSGDG-YHCVGDYSEWSSCIYSTKEPPRREESLKLPESVESTPISDL  161

Query  2475  IKKHQDP-KNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             IKK  +P K+RP KE     KP  GM++SL+GRLTR HQYWKS+IEK GG+V NS+ GV 
Sbjct  162   IKKRGNPNKSRPRKEISSPKKPFDGMVVSLAGRLTRKHQYWKSKIEKFGGEVNNSITGVA  221

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             C+VVSPAER+RGGSSKVAEA+E+GIPVVREAWL DSIEK+E Q LDAYD+ASDIAV+G+G
Sbjct  222   CVVVSPAERDRGGSSKVAEALEKGIPVVREAWLSDSIEKEEAQSLDAYDIASDIAVEGKG  281

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IPLDK DPSAEALE +T+ELKVYGKRGVHKD+K+QDEG +ILEKDGLLYNCALS+C+Q +
Sbjct  282   IPLDKMDPSAEALETVTAELKVYGKRGVHKDSKMQDEGARILEKDGLLYNCALSICNQKK  341

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
              LNDFCIMQL+++ ENRLHMY R+GR GD+ R DDKLEEWEN D AIKEF+R+FEE+TGN
Sbjct  342   KLNDFCIMQLVMSSENRLHMYLRRGRNGDSLRADDKLEEWENVDYAIKEFARLFEEMTGN  401

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKI KK HKFYP+D+ DGIEVRHG L LRQLG AA HSKLD +VANFMK+LC
Sbjct  402   EFEHWEREKKIHKKHHKFYPIDIDDGIEVRHGALGLRQLGSAAAHSKLDSVVANFMKVLC  461

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIYRYALME+ +D PEIPIGML++ HL RCE+ LLHFVE+I+S KE G + E +W EF
Sbjct  462   SQEIYRYALMELVHDSPEIPIGMLTNFHLRRCEEILLHFVEKIKSMKETGPEAEGVWHEF  521

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S  WFTLMPSTRPF  RD+ D+A+HAAS +E++RDIN ASR+IEDMSGSTLDDPL++ Y 
Sbjct  522   SQMWFTLMPSTRPFTFRDYTDLAEHAASAYETIRDINFASRIIEDMSGSTLDDPLFECYK  581

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KL CS+S LEK+SDDYKMI+ YLEKTY+PV+VGD+SYG+SVENIFAVE SACPSLD++K 
Sbjct  582   KLRCSVSPLEKESDDYKMIVNYLEKTYEPVQVGDMSYGISVENIFAVEASACPSLDEIKG  641

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLRHLQ GFLP+VCSLPV GYMFG+AIVC+DAAAEAA+YGFTAVD
Sbjct  642   LPNKVLLWCGTRSSNLLRHLQKGFLPSVCSLPVSGYMFGRAIVCTDAAAEAARYGFTAVD  701

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPE FLVLAVAS+G+EI EF SPPEDT++LE+KK+G K  GRKKT+E EHFVWKDDIKVP
Sbjct  702   RPESFLVLAVASLGDEIKEFPSPPEDTRALEEKKIGVKGLGRKKTNEKEHFVWKDDIKVP  761

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDEPE  517
             CG+LI  S+H +S  +YNEYAVYDPQQVSIR+LVAVK+DE+ V Y TAEP EPE
Sbjct  762   CGKLI-PSEHKDSVLEYNEYAVYDPQQVSIRYLVAVKFDEQDVVYDTAEP-EPE  813



>ref|XP_010327050.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X4 [Solanum 
lycopersicum]
Length=816

 Score =  1186 bits (3068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/834 (69%), Positives = 685/834 (82%), Gaps = 22/834 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             +KVHETRS  H +  EER V RKQ+A+S   +        +  KKAKT D   G   +  
Sbjct  3     VKVHETRSQAH-STSEERKVMRKQQAESNSQE-------TASHKKAKTDDEEEGVVHEDG  54

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                              FC+  +EHLSV+QMR+IL+ N Q S G D+ +VPRCQ++MFYG
Sbjct  55    IRAEFEK----------FCKTITEHLSVKQMREILEANGQYSKGEDDAVVPRCQDVMFYG  104

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+D CP+CGG LECS  G YHC GD+SEWSSC YST+ PPR+EE L++PESV+ TP+SDL
Sbjct  105   PLDNCPICGGKLECSGDG-YHCVGDYSEWSSCIYSTKEPPRREESLKLPESVESTPISDL  163

Query  2475  IKKHQDP-KNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             IKK  +P K+RP KE     KP  GM++SL+GRLTR HQYWKS+IEK GG+V NS+ GV 
Sbjct  164   IKKRGNPNKSRPRKEISSPKKPFDGMVVSLAGRLTRKHQYWKSKIEKFGGEVNNSITGVA  223

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             C+VVSPAER+RGGSSKVAEA+E+GIPVVREAWL DSIEK+E Q LDAYD+ASDIAV+G+G
Sbjct  224   CVVVSPAERDRGGSSKVAEALEKGIPVVREAWLSDSIEKEEAQSLDAYDIASDIAVEGKG  283

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IPLDK DPSAEALE +T+ELKVYGKRGVHKD+K+QDEG +ILEKDGLLYNCALS+C+Q +
Sbjct  284   IPLDKMDPSAEALETVTAELKVYGKRGVHKDSKMQDEGARILEKDGLLYNCALSICNQKK  343

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
              LNDFCIMQL+++ ENRLHMY R+GR GD+ R DDKLEEWEN D AIKEF+R+FEE+TGN
Sbjct  344   KLNDFCIMQLVMSSENRLHMYLRRGRNGDSLRADDKLEEWENVDYAIKEFARLFEEMTGN  403

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKI KK HKFYP+D+ DGIEVRHG L LRQLG AA HSKLD +VANFMK+LC
Sbjct  404   EFEHWEREKKIHKKHHKFYPIDIDDGIEVRHGALGLRQLGSAAAHSKLDSVVANFMKVLC  463

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIYRYALME+ +D PEIPIGML++ HL RCE+ LLHFVE+I+S KE G + E +W EF
Sbjct  464   SQEIYRYALMELVHDSPEIPIGMLTNFHLRRCEEILLHFVEKIKSMKETGPEAEGVWHEF  523

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S  WFTLMPSTRPF  RD+ D+A+HAAS +E++RDIN ASR+IEDMSGSTLDDPL++ Y 
Sbjct  524   SQMWFTLMPSTRPFTFRDYTDLAEHAASAYETIRDINFASRIIEDMSGSTLDDPLFECYK  583

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KL CS+S LEK+SDDYKMI+ YLEKTY+PV+VGD+SYG+SVENIFAVE SACPSLD++K 
Sbjct  584   KLRCSVSPLEKESDDYKMIVNYLEKTYEPVQVGDMSYGISVENIFAVEASACPSLDEIKG  643

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLRHLQ GFLP+VCSLPV GYMFG+AIVC+DAAAEAA+YGFTAVD
Sbjct  644   LPNKVLLWCGTRSSNLLRHLQKGFLPSVCSLPVSGYMFGRAIVCTDAAAEAARYGFTAVD  703

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPE FLVLAVAS+G+EI EF SPPEDT++LE+KK+G K  GRKKT+E EHFVWKDDIKVP
Sbjct  704   RPESFLVLAVASLGDEIKEFPSPPEDTRALEEKKIGVKGLGRKKTNEKEHFVWKDDIKVP  763

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDEPE  517
             CG+LI  S+H +S  +YNEYAVYDPQQVSIR+LVAVK+DE+ V Y TAEP EPE
Sbjct  764   CGKLI-PSEHKDSVLEYNEYAVYDPQQVSIRYLVAVKFDEQDVVYDTAEP-EPE  815



>ref|XP_010326946.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X1 [Solanum 
lycopersicum]
Length=863

 Score =  1185 bits (3066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/834 (69%), Positives = 685/834 (82%), Gaps = 22/834 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             +KVHETRS  H +  EER V RKQ+A+S   +        +  KKAKT D   G   +  
Sbjct  50    VKVHETRSQAH-STSEERKVMRKQQAESNSQE-------TASHKKAKTDDEEEGVVHEDG  101

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                              FC+  +EHLSV+QMR+IL+ N Q S G D+ +VPRCQ++MFYG
Sbjct  102   IRAEFEK----------FCKTITEHLSVKQMREILEANGQYSKGEDDAVVPRCQDVMFYG  151

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+D CP+CGG LECS  G YHC GD+SEWSSC YST+ PPR+EE L++PESV+ TP+SDL
Sbjct  152   PLDNCPICGGKLECSGDG-YHCVGDYSEWSSCIYSTKEPPRREESLKLPESVESTPISDL  210

Query  2475  IKKHQDP-KNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             IKK  +P K+RP KE     KP  GM++SL+GRLTR HQYWKS+IEK GG+V NS+ GV 
Sbjct  211   IKKRGNPNKSRPRKEISSPKKPFDGMVVSLAGRLTRKHQYWKSKIEKFGGEVNNSITGVA  270

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             C+VVSPAER+RGGSSKVAEA+E+GIPVVREAWL DSIEK+E Q LDAYD+ASDIAV+G+G
Sbjct  271   CVVVSPAERDRGGSSKVAEALEKGIPVVREAWLSDSIEKEEAQSLDAYDIASDIAVEGKG  330

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IPLDK DPSAEALE +T+ELKVYGKRGVHKD+K+QDEG +ILEKDGLLYNCALS+C+Q +
Sbjct  331   IPLDKMDPSAEALETVTAELKVYGKRGVHKDSKMQDEGARILEKDGLLYNCALSICNQKK  390

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
              LNDFCIMQL+++ ENRLHMY R+GR GD+ R DDKLEEWEN D AIKEF+R+FEE+TGN
Sbjct  391   KLNDFCIMQLVMSSENRLHMYLRRGRNGDSLRADDKLEEWENVDYAIKEFARLFEEMTGN  450

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKI KK HKFYP+D+ DGIEVRHG L LRQLG AA HSKLD +VANFMK+LC
Sbjct  451   EFEHWEREKKIHKKHHKFYPIDIDDGIEVRHGALGLRQLGSAAAHSKLDSVVANFMKVLC  510

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIYRYALME+ +D PEIPIGML++ HL RCE+ LLHFVE+I+S KE G + E +W EF
Sbjct  511   SQEIYRYALMELVHDSPEIPIGMLTNFHLRRCEEILLHFVEKIKSMKETGPEAEGVWHEF  570

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S  WFTLMPSTRPF  RD+ D+A+HAAS +E++RDIN ASR+IEDMSGSTLDDPL++ Y 
Sbjct  571   SQMWFTLMPSTRPFTFRDYTDLAEHAASAYETIRDINFASRIIEDMSGSTLDDPLFECYK  630

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KL CS+S LEK+SDDYKMI+ YLEKTY+PV+VGD+SYG+SVENIFAVE SACPSLD++K 
Sbjct  631   KLRCSVSPLEKESDDYKMIVNYLEKTYEPVQVGDMSYGISVENIFAVEASACPSLDEIKG  690

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLRHLQ GFLP+VCSLPV GYMFG+AIVC+DAAAEAA+YGFTAVD
Sbjct  691   LPNKVLLWCGTRSSNLLRHLQKGFLPSVCSLPVSGYMFGRAIVCTDAAAEAARYGFTAVD  750

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPE FLVLAVAS+G+EI EF SPPEDT++LE+KK+G K  GRKKT+E EHFVWKDDIKVP
Sbjct  751   RPESFLVLAVASLGDEIKEFPSPPEDTRALEEKKIGVKGLGRKKTNEKEHFVWKDDIKVP  810

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDEPE  517
             CG+LI  S+H +S  +YNEYAVYDPQQVSIR+LVAVK+DE+ V Y TAEP EPE
Sbjct  811   CGKLI-PSEHKDSVLEYNEYAVYDPQQVSIRYLVAVKFDEQDVVYDTAEP-EPE  862



>ref|XP_010326979.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X2 [Solanum 
lycopersicum]
Length=840

 Score =  1185 bits (3065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/834 (69%), Positives = 685/834 (82%), Gaps = 22/834 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             +KVHETRS  H +  EER V RKQ+A+S   +        +  KKAKT D   G   +  
Sbjct  27    VKVHETRSQAH-STSEERKVMRKQQAESNSQE-------TASHKKAKTDDEEEGVVHEDG  78

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                              FC+  +EHLSV+QMR+IL+ N Q S G D+ +VPRCQ++MFYG
Sbjct  79    IRAEFEK----------FCKTITEHLSVKQMREILEANGQYSKGEDDAVVPRCQDVMFYG  128

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+D CP+CGG LECS  G YHC GD+SEWSSC YST+ PPR+EE L++PESV+ TP+SDL
Sbjct  129   PLDNCPICGGKLECSGDG-YHCVGDYSEWSSCIYSTKEPPRREESLKLPESVESTPISDL  187

Query  2475  IKKHQDP-KNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             IKK  +P K+RP KE     KP  GM++SL+GRLTR HQYWKS+IEK GG+V NS+ GV 
Sbjct  188   IKKRGNPNKSRPRKEISSPKKPFDGMVVSLAGRLTRKHQYWKSKIEKFGGEVNNSITGVA  247

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             C+VVSPAER+RGGSSKVAEA+E+GIPVVREAWL DSIEK+E Q LDAYD+ASDIAV+G+G
Sbjct  248   CVVVSPAERDRGGSSKVAEALEKGIPVVREAWLSDSIEKEEAQSLDAYDIASDIAVEGKG  307

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IPLDK DPSAEALE +T+ELKVYGKRGVHKD+K+QDEG +ILEKDGLLYNCALS+C+Q +
Sbjct  308   IPLDKMDPSAEALETVTAELKVYGKRGVHKDSKMQDEGARILEKDGLLYNCALSICNQKK  367

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
              LNDFCIMQL+++ ENRLHMY R+GR GD+ R DDKLEEWEN D AIKEF+R+FEE+TGN
Sbjct  368   KLNDFCIMQLVMSSENRLHMYLRRGRNGDSLRADDKLEEWENVDYAIKEFARLFEEMTGN  427

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKI KK HKFYP+D+ DGIEVRHG L LRQLG AA HSKLD +VANFMK+LC
Sbjct  428   EFEHWEREKKIHKKHHKFYPIDIDDGIEVRHGALGLRQLGSAAAHSKLDSVVANFMKVLC  487

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIYRYALME+ +D PEIPIGML++ HL RCE+ LLHFVE+I+S KE G + E +W EF
Sbjct  488   SQEIYRYALMELVHDSPEIPIGMLTNFHLRRCEEILLHFVEKIKSMKETGPEAEGVWHEF  547

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S  WFTLMPSTRPF  RD+ D+A+HAAS +E++RDIN ASR+IEDMSGSTLDDPL++ Y 
Sbjct  548   SQMWFTLMPSTRPFTFRDYTDLAEHAASAYETIRDINFASRIIEDMSGSTLDDPLFECYK  607

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KL CS+S LEK+SDDYKMI+ YLEKTY+PV+VGD+SYG+SVENIFAVE SACPSLD++K 
Sbjct  608   KLRCSVSPLEKESDDYKMIVNYLEKTYEPVQVGDMSYGISVENIFAVEASACPSLDEIKG  667

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLRHLQ GFLP+VCSLPV GYMFG+AIVC+DAAAEAA+YGFTAVD
Sbjct  668   LPNKVLLWCGTRSSNLLRHLQKGFLPSVCSLPVSGYMFGRAIVCTDAAAEAARYGFTAVD  727

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPE FLVLAVAS+G+EI EF SPPEDT++LE+KK+G K  GRKKT+E EHFVWKDDIKVP
Sbjct  728   RPESFLVLAVASLGDEIKEFPSPPEDTRALEEKKIGVKGLGRKKTNEKEHFVWKDDIKVP  787

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDEPE  517
             CG+LI  S+H +S  +YNEYAVYDPQQVSIR+LVAVK+DE+ V Y TAEP EPE
Sbjct  788   CGKLI-PSEHKDSVLEYNEYAVYDPQQVSIRYLVAVKFDEQDVVYDTAEP-EPE  839



>ref|XP_010327013.1| PREDICTED: putative poly [ADP-ribose] polymerase 3 isoform X3 
[Solanum lycopersicum]
Length=840

 Score =  1183 bits (3060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/832 (69%), Positives = 683/832 (82%), Gaps = 22/832 (3%)
 Frame = -2

Query  3009  VHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkaeee  2830
             VHETRS  H +  EER V RKQ+A+S   +        +  KKAKT D   G   +    
Sbjct  29    VHETRSQAH-STSEERKVMRKQQAESNSQE-------TASHKKAKTDDEEEGVVHEDGIR  80

Query  2829  dgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPV  2650
                            FC+  +EHLSV+QMR+IL+ N Q S G D+ +VPRCQ++MFYGP+
Sbjct  81    AEFEK----------FCKTITEHLSVKQMREILEANGQYSKGEDDAVVPRCQDVMFYGPL  130

Query  2649  DKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK  2470
             D CP+CGG LECS  G YHC GD+SEWSSC YST+ PPR+EE L++PESV+ TP+SDLIK
Sbjct  131   DNCPICGGKLECSGDG-YHCVGDYSEWSSCIYSTKEPPRREESLKLPESVESTPISDLIK  189

Query  2469  KHQDP-KNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCL  2293
             K  +P K+RP KE     KP  GM++SL+GRLTR HQYWKS+IEK GG+V NS+ GV C+
Sbjct  190   KRGNPNKSRPRKEISSPKKPFDGMVVSLAGRLTRKHQYWKSKIEKFGGEVNNSITGVACV  249

Query  2292  VVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIP  2113
             VVSPAER+RGGSSKVAEA+E+GIPVVREAWL DSIEK+E Q LDAYD+ASDIAV+G+GIP
Sbjct  250   VVSPAERDRGGSSKVAEALEKGIPVVREAWLSDSIEKEEAQSLDAYDIASDIAVEGKGIP  309

Query  2112  LDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGL  1933
             LDK DPSAEALE +T+ELKVYGKRGVHKD+K+QDEG +ILEKDGLLYNCALS+C+Q + L
Sbjct  310   LDKMDPSAEALETVTAELKVYGKRGVHKDSKMQDEGARILEKDGLLYNCALSICNQKKKL  369

Query  1932  NDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEF  1753
             NDFCIMQL+++ ENRLHMY R+GR GD+ R DDKLEEWEN D AIKEF+R+FEE+TGNEF
Sbjct  370   NDFCIMQLVMSSENRLHMYLRRGRNGDSLRADDKLEEWENVDYAIKEFARLFEEMTGNEF  429

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
                EREKKI KK HKFYP+D+ DGIEVRHG L LRQLG AA HSKLD +VANFMK+LCSQ
Sbjct  430   EHWEREKKIHKKHHKFYPIDIDDGIEVRHGALGLRQLGSAAAHSKLDSVVANFMKVLCSQ  489

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             EIYRYALME+ +D PEIPIGML++ HL RCE+ LLHFVE+I+S KE G + E +W EFS 
Sbjct  490   EIYRYALMELVHDSPEIPIGMLTNFHLRRCEEILLHFVEKIKSMKETGPEAEGVWHEFSQ  549

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
              WFTLMPSTRPF  RD+ D+A+HAAS +E++RDIN ASR+IEDMSGSTLDDPL++ Y KL
Sbjct  550   MWFTLMPSTRPFTFRDYTDLAEHAASAYETIRDINFASRIIEDMSGSTLDDPLFECYKKL  609

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLP  1033
              CS+S LEK+SDDYKMI+ YLEKTY+PV+VGD+SYG+SVENIFAVE SACPSLD++K LP
Sbjct  610   RCSVSPLEKESDDYKMIVNYLEKTYEPVQVGDMSYGISVENIFAVEASACPSLDEIKGLP  669

Query  1032  NKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRP  853
             NKVLLWCGTRSSNLLRHLQ GFLP+VCSLPV GYMFG+AIVC+DAAAEAA+YGFTAVDRP
Sbjct  670   NKVLLWCGTRSSNLLRHLQKGFLPSVCSLPVSGYMFGRAIVCTDAAAEAARYGFTAVDRP  729

Query  852   EGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCG  673
             E FLVLAVAS+G+EI EF SPPEDT++LE+KK+G K  GRKKT+E EHFVWKDDIKVPCG
Sbjct  730   ESFLVLAVASLGDEIKEFPSPPEDTRALEEKKIGVKGLGRKKTNEKEHFVWKDDIKVPCG  789

Query  672   RLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDEPE  517
             +LI  S+H +S  +YNEYAVYDPQQVSIR+LVAVK+DE+ V Y TAEP EPE
Sbjct  790   KLI-PSEHKDSVLEYNEYAVYDPQQVSIRYLVAVKFDEQDVVYDTAEP-EPE  839



>ref|XP_010327106.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X6 [Solanum 
lycopersicum]
 ref|XP_010327141.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X6 [Solanum 
lycopersicum]
Length=795

 Score =  1170 bits (3027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/757 (73%), Positives = 654/757 (86%), Gaps = 4/757 (1%)
 Frame = -2

Query  2784  FCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSG  2605
             FC+  +EHLSV+QMR+IL+ N Q S G D+ +VPRCQ++MFYGP+D CP+CGG LECS  
Sbjct  41    FCKTITEHLSVKQMREILEANGQYSKGEDDAVVPRCQDVMFYGPLDNCPICGGKLECSGD  100

Query  2604  GTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDP-KNRPLKEQV  2428
             G YHC GD+SEWSSC YST+ PPR+EE L++PESV+ TP+SDLIKK  +P K+RP KE  
Sbjct  101   G-YHCVGDYSEWSSCIYSTKEPPRREESLKLPESVESTPISDLIKKRGNPNKSRPRKEIS  159

Query  2427  ITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERERGGSSKV  2248
                KP  GM++SL+GRLTR HQYWKS+IEK GG+V NS+ GV C+VVSPAER+RGGSSKV
Sbjct  160   SPKKPFDGMVVSLAGRLTRKHQYWKSKIEKFGGEVNNSITGVACVVVSPAERDRGGSSKV  219

Query  2247  AEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEALENIT  2068
             AEA+E+GIPVVREAWL DSIEK+E Q LDAYD+ASDIAV+G+GIPLDK DPSAEALE +T
Sbjct  220   AEALEKGIPVVREAWLSDSIEKEEAQSLDAYDIASDIAVEGKGIPLDKMDPSAEALETVT  279

Query  2067  SELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENR  1888
             +ELKVYGKRGVHKD+K+QDEG +ILEKDGLLYNCALS+C+Q + LNDFCIMQL+++ ENR
Sbjct  280   AELKVYGKRGVHKDSKMQDEGARILEKDGLLYNCALSICNQKKKLNDFCIMQLVMSSENR  339

Query  1887  LHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHK  1708
             LHMY R+GR GD+ R DDKLEEWEN D AIKEF+R+FEE+TGNEF   EREKKI KK HK
Sbjct  340   LHMYLRRGRNGDSLRADDKLEEWENVDYAIKEFARLFEEMTGNEFEHWEREKKIHKKHHK  399

Query  1707  FYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYP  1528
             FYP+D+ DGIEVRHG L LRQLG AA HSKLD +VANFMK+LCSQEIYRYALME+ +D P
Sbjct  400   FYPIDIDDGIEVRHGALGLRQLGSAAAHSKLDSVVANFMKVLCSQEIYRYALMELVHDSP  459

Query  1527  EIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLR  1348
             EIPIGML++ HL RCE+ LLHFVE+I+S KE G + E +W EFS  WFTLMPSTRPF  R
Sbjct  460   EIPIGMLTNFHLRRCEEILLHFVEKIKSMKETGPEAEGVWHEFSQMWFTLMPSTRPFTFR  519

Query  1347  DFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYK  1168
             D+ D+A+HAAS +E++RDIN ASR+IEDMSGSTLDDPL++ Y KL CS+S LEK+SDDYK
Sbjct  520   DYTDLAEHAASAYETIRDINFASRIIEDMSGSTLDDPLFECYKKLRCSVSPLEKESDDYK  579

Query  1167  MILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGTRSSNLL  988
             MI+ YLEKTY+PV+VGD+SYG+SVENIFAVE SACPSLD++K LPNKVLLWCGTRSSNLL
Sbjct  580   MIVNYLEKTYEPVQVGDMSYGISVENIFAVEASACPSLDEIKGLPNKVLLWCGTRSSNLL  639

Query  987   RHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEI  808
             RHLQ GFLP+VCSLPV GYMFG+AIVC+DAAAEAA+YGFTAVDRPE FLVLAVAS+G+EI
Sbjct  640   RHLQKGFLPSVCSLPVSGYMFGRAIVCTDAAAEAARYGFTAVDRPESFLVLAVASLGDEI  699

Query  807   MEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDY  628
              EF SPPEDT++LE+KK+G K  GRKKT+E EHFVWKDDIKVPCG+LI  S+H +S  +Y
Sbjct  700   KEFPSPPEDTRALEEKKIGVKGLGRKKTNEKEHFVWKDDIKVPCGKLI-PSEHKDSVLEY  758

Query  627   NEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDEPE  517
             NEYAVYDPQQVSIR+LVAVK+DE+ V Y TAEP EPE
Sbjct  759   NEYAVYDPQQVSIRYLVAVKFDEQDVVYDTAEP-EPE  794



>gb|EYU36951.1| hypothetical protein MIMGU_mgv1a001445mg [Erythranthe guttata]
Length=818

 Score =  1164 bits (3010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/830 (66%), Positives = 690/830 (83%), Gaps = 14/830 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRS  H  +  ER VTRKQKA++K     D  L  SP KKAK       +E++  
Sbjct  1     MKVHETRSQAHGTD--ERKVTRKQKAEAKT----DAEL--SP-KKAKI---EDENEEENG  48

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
             +     +  A  AEFEKFC+ATSEHLS++QMR+IL+ N QDS+ SD+ +VPRCQ+I+FYG
Sbjct  49    QGQNGKSIEAIKAEFEKFCKATSEHLSIKQMREILEANGQDSTLSDDAVVPRCQDILFYG  108

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+D CPVCGG LE S+   Y CKG +SEWS+C+++T  PPRK+EP+++P+SV+ + ++DL
Sbjct  109   PLDSCPVCGGPLEVSNNMNYSCKGVYSEWSTCTFTTTEPPRKDEPIKLPDSVKSSNVADL  168

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +++HQD K+RP ++  +T KP  GMMISL+GRLTRTHQYWK++IEK+GGKVA+S+IGVTC
Sbjct  169   LREHQDVKSRPSRKSTVTDKPFKGMMISLAGRLTRTHQYWKTKIEKHGGKVASSIIGVTC  228

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSPAERERGGSSKV EA+E+GIP+VREAWL DSIEKK+ QPLD YDV SDI V GR I
Sbjct  229   LVVSPAERERGGSSKVVEAMEKGIPIVREAWLSDSIEKKKPQPLDEYDVISDITVAGRDI  288

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             PL  QDP+ EALE IT+ELKVYGKRGVHKDTKLQD+GG+ILEKDG+LYNCA +  D+GRG
Sbjct  289   PLYHQDPTEEALETITAELKVYGKRGVHKDTKLQDDGGQILEKDGILYNCAFTSSDKGRG  348

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             +NDFCI+QLI  PE++L+MYY++G++GD+   +++L+EW+N D AIKEF + FE LTGNE
Sbjct  349   VNDFCIVQLITVPESKLYMYYKRGKIGDSTAAEERLDEWDNVDNAIKEFVKQFEGLTGNE  408

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKI+KK   F+P+D+ DG+E+RHGGL LRQLG+AA H KLD  VANFMK+LCS
Sbjct  409   FEPWEREKKIEKKMQMFFPIDLDDGVEIRHGGLGLRQLGVAAAHCKLDSKVANFMKVLCS  468

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIYRYALME G D+P++P+GM++D+HL+RCE+ LL F+++++S KE GQ+ EALW++FS
Sbjct  469   QEIYRYALMETGLDFPDLPLGMVTDIHLKRCEEVLLEFLDKLKSNKETGQKAEALWSDFS  528

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              + FTL+PS RP+  RDF DIADH A+ FE++RDIN ASRL+ DMSG+TLDDPL+DRY K
Sbjct  529   QRIFTLLPSIRPYVFRDFHDIADHGAAAFETIRDINVASRLVGDMSGATLDDPLFDRYKK  588

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGC++S +EKD++D+KMI  YLEKTY+PV+VG+ISYGVS+E++FAVE SACPSLD++KKL
Sbjct  589   LGCAVSPVEKDTEDFKMIANYLEKTYEPVKVGEISYGVSIEDVFAVEVSACPSLDEIKKL  648

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNK LLWCGTRS NLLRHLQ GFLPA CSLPVPGYMFGKAIVCSDAAAEAA+YGFTAVDR
Sbjct  649   PNKTLLWCGTRSCNLLRHLQKGFLPAPCSLPVPGYMFGKAIVCSDAAAEAARYGFTAVDR  708

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFL+LAVAS+GE I E + PPED+  LE+KK G    GRKKTDE+EHF+WK+DIKVPC
Sbjct  709   PEGFLILAVASLGENITELTGPPEDSTELEEKKNGVIGLGRKKTDETEHFMWKNDIKVPC  768

Query  675   GRLI--EESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             G+LI  E  +H +SP +YNEYAVYDP+QVSIRFLV+VK++E+ VEY TAE
Sbjct  769   GKLIPSEHKEHKDSPLEYNEYAVYDPKQVSIRFLVSVKFEEKDVEYDTAE  818



>ref|XP_007132420.1| hypothetical protein PHAVU_011G093100g [Phaseolus vulgaris]
 gb|ESW04414.1| hypothetical protein PHAVU_011G093100g [Phaseolus vulgaris]
Length=812

 Score =  1154 bits (2985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/828 (66%), Positives = 677/828 (82%), Gaps = 16/828 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKV ETRSH H   +EE+++TRKQKA+SK  +     + +SP KKAK         +  +
Sbjct  1     MKVQETRSHVHAPGEEEKVMTRKQKAESKAHE-----VEHSP-KKAKV--------ENED  46

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                        A E+++FC+AT+EHL ++QM++IL+ N  DSSGSD  I  RCQ+++FYG
Sbjct  47    GHVNGKTVADVADEYDEFCKATNEHLPLEQMKEILEANGLDSSGSDLEITRRCQDLLFYG  106

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              +DKC VC G+LE   G  Y C+G +SEW+SC +STRNPPRK+EP+++P+SVQ +  SDL
Sbjct  107   ALDKCSVCNGSLEFD-GRRYVCRGFYSEWASCIFSTRNPPRKQEPIKLPDSVQNSLPSDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +KK+QDP +RP K+  +  KP +GMMISL GRLTRTH YWK+ IEK+GGKVANS++G TC
Sbjct  166   LKKYQDPSHRPHKDLGLAEKPFTGMMISLMGRLTRTHHYWKTAIEKHGGKVANSILGATC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LV SPAERERGG+SK+AEA+ERGIPVVREAWLVDSIEK+E QPL+AYD+ASD++V G+GI
Sbjct  226   LVASPAERERGGTSKLAEAMERGIPVVREAWLVDSIEKQEPQPLEAYDLASDLSVYGKGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQDP  EA+E++++ELK+YGKRGV+KDTKLQ++GGKI E+DG+LYNCA S+CDQGRG
Sbjct  286   PQDKQDPGEEAIESLSAELKLYGKRGVYKDTKLQEQGGKIFERDGILYNCAFSLCDQGRG  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             LND+CIMQLIV PENRLHMY++KGRVGD    +++LEE +N D ++KEF+R+FEE+TGNE
Sbjct  346   LNDYCIMQLIVVPENRLHMYFKKGRVGDDPNAEERLEESDNVDSSLKEFARLFEEITGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKK QKKP KFYP+D+ DG+EVRHG L LRQLGIA  H KL+PMVANFMK+LCS
Sbjct  406   FEPWEREKKFQKKPLKFYPIDMDDGVEVRHGALGLRQLGIAVTHCKLEPMVANFMKVLCS  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALMEMGYD P++P+GM+++VHL+RCED LL F+++++S KE G + EA+W +FS
Sbjct  466   QEIYKYALMEMGYDSPDLPVGMVTNVHLKRCEDVLLEFIDKVKSLKETGLKAEAVWTDFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTLM STRPF  RD+ +IADHAA+  E  RDI  AS LI DM+GST+DDPL + Y K
Sbjct  526   QRWFTLMHSTRPFNFRDYHEIADHAAAALEGARDITLASHLIGDMTGSTIDDPLSETYKK  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCSIS L+K S+DY+MI+KYLE TY+PV+VGDI YGVSVENIFAV+   CPS +++ KL
Sbjct  586   LGCSISPLDKSSNDYQMIVKYLETTYEPVKVGDIDYGVSVENIFAVQTGGCPSYENIVKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCG+RSSNLLRHL  GFLPA+CSLPVPGYMFGKAIVCSDAAAEAA+YGFTAVDR
Sbjct  646   PNKVLLWCGSRSSNLLRHLHKGFLPAICSLPVPGYMFGKAIVCSDAAAEAARYGFTAVDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLA+AS+G EI EF SPPEDT SLE+KKLG K  G+KKTDESEHFVWKDDIKVPC
Sbjct  706   PEGFLVLAIASLGNEITEFKSPPEDTSSLEEKKLGVKGLGKKKTDESEHFVWKDDIKVPC  765

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             G+L+  S H +SP +YNEYAVYDP+Q  I +LV VKY+E+ VE  TAE
Sbjct  766   GKLV-ASDHQDSPLEYNEYAVYDPKQARISYLVGVKYEEKGVEIDTAE  812



>ref|NP_001237586.1| poly [ADP-ribose] polymerase 3 [Glycine max]
 sp|Q9SWB4.1|PARP3_SOYBN RecName: Full=Poly [ADP-ribose] polymerase 3; Short=PARP-3; AltName: 
Full=NAD(+) ADP-ribosyltransferase 3; Short=ADPRT-3; 
AltName: Full=Poly[ADP-ribose] synthase 3 [Glycine max]
 gb|AAD51626.1|AF169023_1 seed maturation protein PM38 [Glycine max]
Length=815

 Score =  1154 bits (2984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/820 (66%), Positives = 677/820 (83%), Gaps = 16/820 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKV ETRSH H   +EE+++TRKQKA+SK  +     + +SP KKAK         +K +
Sbjct  1     MKVQETRSHVHALGEEEKVMTRKQKAESKAHE-----VEHSP-KKAKV--------EKED  46

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                   ++   A E+++FC+AT+EHL ++QMR IL+ N  DSSGSD  I  RCQ+++FYG
Sbjct  47    GHINGKSETGVAEEYDEFCKATTEHLPLEQMRDILEANGLDSSGSDLEITRRCQDLLFYG  106

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              +DKC VC G+LE   G  Y C+G +SEW+SC++STRNPPRK+EP+++P+SVQ +  SDL
Sbjct  107   ALDKCSVCNGSLEFD-GRRYVCRGFYSEWASCTFSTRNPPRKQEPIKLPDSVQNSLASDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +KK+QDP +RP ++  +  KP +GMMISL GRLTRTH YWK+ IEK+GGKVANS+IG TC
Sbjct  166   LKKYQDPSHRPHRDLGLAEKPFTGMMISLMGRLTRTHHYWKTTIEKHGGKVANSIIGSTC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LV SPAERERGG+SK+AEA+ER IPVVREAWL+DSIEK+E QPL+AYD+ SD++VDG+GI
Sbjct  226   LVASPAERERGGTSKLAEAMERSIPVVREAWLIDSIEKQEPQPLEAYDLVSDLSVDGKGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQDP  EA+E++++ELK+YGKRGV+KDTKLQ++GGKI E+DG+LYNCA SVCDQGRG
Sbjct  286   PWDKQDPGEEAIESLSAELKLYGKRGVYKDTKLQEQGGKIFERDGILYNCAFSVCDQGRG  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             LND+C+MQLIV PENRLH+Y++KGRVGD    +++LEEW+N DGA+KEF R+FEE+TGNE
Sbjct  346   LNDYCVMQLIVVPENRLHLYFKKGRVGDDPNAEERLEEWDNVDGALKEFVRLFEEITGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKK QKKP KFYP+D+ DGIEVRHG L LRQLGIAA H KL+P+VANFMK+LCS
Sbjct  406   FEPWEREKKFQKKPLKFYPIDMDDGIEVRHGALGLRQLGIAATHCKLEPLVANFMKVLCS  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALMEMGYD P++PIGM++++HL++CED LL F+++++S KE G + EA+W +FS
Sbjct  466   QEIYKYALMEMGYDCPDLPIGMVTNLHLKKCEDVLLEFIDKVKSLKETGPKAEAVWTDFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTLM STRPF  RD+ +IADHAA+  E VRDI  AS LI DM+GST+DDPL + Y K
Sbjct  526   QRWFTLMHSTRPFNFRDYQEIADHAAAALEGVRDITQASHLIGDMTGSTIDDPLSETYKK  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCSISAL+K SDDY+MI+KYLEKTY+PV+VGDI YGVSVENIFAV+   CPS +D+ KL
Sbjct  586   LGCSISALDKSSDDYEMIVKYLEKTYEPVKVGDIEYGVSVENIFAVQTGGCPSYEDIIKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCG+RSSNLLRHLQ GFLPA+CSLP+PGYMFGKAIVCSDAAAEAA+YGFTAVDR
Sbjct  646   PNKVLLWCGSRSSNLLRHLQKGFLPAICSLPIPGYMFGKAIVCSDAAAEAARYGFTAVDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLA+AS+G EI E  +PPED  SLE+KK+G K  G+KKTDESEHFVWKDDIKVPC
Sbjct  706   PEGFLVLAIASLGNEITELKTPPEDASSLEEKKVGVKGPGKKKTDESEHFVWKDDIKVPC  765

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
             G+L+  S H +SP +YNEYAVYD ++  I +LV VKY+E+
Sbjct  766   GKLV-ASDHQDSPLEYNEYAVYDKKRARISYLVGVKYEEK  804



>gb|KHN38638.1| Poly [ADP-ribose] polymerase 3 [Glycine soja]
Length=812

 Score =  1151 bits (2978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/828 (65%), Positives = 682/828 (82%), Gaps = 16/828 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKV ETRSH H   +EE+++TRKQKA+SK  +     + +SP KKAK         +K +
Sbjct  1     MKVQETRSHVHAPGEEEKVMTRKQKAESKAHE-----VEHSP-KKAKV--------EKED  46

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
              +    ++   A E+++FC+ T+EHL ++QMR+I++ N+ DSSGSD  I  RCQ+++FYG
Sbjct  47    GQINGKSETGVAEEYDEFCKVTNEHLPLEQMREIMEANSLDSSGSDLEIARRCQDLLFYG  106

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              +DKC VC G+LE   G  Y C+G +SEW+SC++STRNPPRK+EP+++P+SVQ +  SDL
Sbjct  107   ALDKCSVCNGSLEFD-GRRYVCRGFYSEWASCTFSTRNPPRKQEPIKLPDSVQDSLASDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +KK+QDP +RP ++  +  KP +GMMISL GRLTRTH YWK+ IEK+GGKVANS+IG TC
Sbjct  166   LKKYQDPSHRPHRDLGLAEKPFTGMMISLMGRLTRTHHYWKTTIEKHGGKVANSIIGATC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LV SPAERERGG+SK+AEA+ERGIPVVREAWL+DSIEK+E QPL++YD+ SD++VDG+GI
Sbjct  226   LVASPAERERGGTSKLAEAMERGIPVVREAWLIDSIEKQEPQPLESYDLVSDLSVDGKGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQDP  EA+E++++ELK+YGKRGV+KD+KLQ++GGKI E+DG+LYNCA SVCDQG G
Sbjct  286   PWDKQDPGEEAIESLSAELKLYGKRGVYKDSKLQEQGGKIFERDGILYNCAFSVCDQGLG  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             LND+C+MQLIV PEN LH+Y++KGRVGD    +++LEEW+N DGA+KEF+R+F+E+TGNE
Sbjct  346   LNDYCVMQLIVVPENPLHLYFKKGRVGDDPNAEEQLEEWDNVDGALKEFARLFDEITGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKK QKKP KFYP+D+ DG+EVRHG L LRQLGIAA H KL+P+VANFMK+LCS
Sbjct  406   FEPWEREKKFQKKPLKFYPIDMDDGVEVRHGALGLRQLGIAATHCKLEPLVANFMKVLCS  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALMEMGYD P++PIGM++++HL+RCED LL F+++++S KE G + EA+W +FS
Sbjct  466   QEIYKYALMEMGYDSPDLPIGMVTNLHLKRCEDVLLEFIDKMKSLKETGPKAEAVWTDFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTLM STRPF  RD+ +IA+HAA+  E VRDI  AS LI DM+GST+DDPL + Y K
Sbjct  526   QRWFTLMHSTRPFNFRDYQEIAEHAAAALEGVRDITQASHLIGDMTGSTIDDPLSETYKK  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCSISAL+K SDDY+MI+KYLEKTY+PV+VGDI YGVSVENIFAV+   CPS +D+ KL
Sbjct  586   LGCSISALDKSSDDYEMIVKYLEKTYEPVKVGDIEYGVSVENIFAVQTGGCPSYEDIVKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCG+RSSNLLRHL  GFLPA+CSLPVPGYMFGKAI+CSDAAAEAA+YGFTAVDR
Sbjct  646   PNKVLLWCGSRSSNLLRHLHKGFLPAICSLPVPGYMFGKAIICSDAAAEAARYGFTAVDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLA+AS+G EI E  SPPEDT SLE+KK+G K  G+KKTDESEHFVWKDDIKVPC
Sbjct  706   PEGFLVLAIASLGNEITELKSPPEDTSSLEEKKVGVKGLGKKKTDESEHFVWKDDIKVPC  765

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             G+L+  S H +SP +YNEYAVYD +Q  I +LV VKY+E+     TAE
Sbjct  766   GKLV-ASDHQDSPLEYNEYAVYDKKQARISYLVGVKYEEKGAVIDTAE  812



>ref|XP_011088879.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Sesamum indicum]
Length=820

 Score =  1150 bits (2976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/828 (67%), Positives = 685/828 (83%), Gaps = 8/828 (1%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRSH H + D+ER +TRKQKA+ K  +   E    SP KKAK         K   
Sbjct  1     MKVHETRSHAHSSGDDERKITRKQKAEGKTAEAEAE---QSP-KKAKI--EDEDKTKNEN  54

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
              ++   +      EFEKFC+ATSEHLS+QQMR+IL+ N QD+SG+D+ +VPRCQ+I+FYG
Sbjct  55    GQENGKSTEDIKVEFEKFCKATSEHLSIQQMREILEANGQDASGADDAVVPRCQDILFYG  114

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+DKCPVCGG LE S   TY C G +SEWSSC++++++PPR++EP+++P+SV+ + ++DL
Sbjct  115   PLDKCPVCGGNLEVSDT-TYMCTGAYSEWSSCTFTSQDPPRRDEPIKLPDSVKDSGVADL  173

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +KK +D K R       T KP  GMMI+LSGRLTRTHQYWKS+IEK+GGKVANSVIG TC
Sbjct  174   LKKFEDRKGRIRPVLPGTDKPFRGMMIALSGRLTRTHQYWKSKIEKHGGKVANSVIGATC  233

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSP ERERGGSSKVAEA+ERGIP+V+EAWL +SIEKKE QPLDA+++ SD  V GR I
Sbjct  234   LVVSPVERERGGSSKVAEAMERGIPIVKEAWLSESIEKKETQPLDAFNIVSDRTVAGRPI  293

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             PL +QD S EALE +T+ELK++GKR VHKD+KLQDEGG+ILEKDG+LYNCA +  D+GRG
Sbjct  294   PLYQQDASEEALETLTAELKMFGKRSVHKDSKLQDEGGQILEKDGILYNCAFAASDRGRG  353

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             +N+FCI+QLI  PENRL+MYY++GR+GD A  +++L+EWEN D AIKEF++ F+ LTGNE
Sbjct  354   VNEFCIVQLITVPENRLYMYYKRGRIGDEAGAEERLDEWENVDNAIKEFAKQFQGLTGNE  413

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F + EREKKI+KK HK +P+D+ DG+EVRHGGL LRQLGIAA H KLD  VANFMK+LC 
Sbjct  414   FETWEREKKIEKKIHKLFPIDIDDGVEVRHGGLGLRQLGIAAAHCKLDSEVANFMKVLCG  473

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIYRYALMEMG D+P++P+GM++D+HL+RCE+ LL FV R++S K+ GQ+ E+LW++FS
Sbjct  474   QEIYRYALMEMGLDFPDLPLGMVTDLHLKRCEEVLLDFVNRLQSNKDTGQKGESLWSDFS  533

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              + FTLMPSTRP+  RDF+DIADH A+ FE+VRDIN ASRLI DMSG+TLDDPL++RY K
Sbjct  534   QRMFTLMPSTRPYVFRDFSDIADHGAAAFETVRDINVASRLIGDMSGATLDDPLFERYKK  593

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCSIS + KD+DDYKM+  YLEKTY+PV+VG+ISYGVS++N+FAVE SACPSL +++KL
Sbjct  594   LGCSISPVGKDTDDYKMVANYLEKTYEPVKVGEISYGVSLQNVFAVELSACPSLHEIRKL  653

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSNL+RHLQ GFLPAVC LPVPGYMFGKAIVCSDAAAEAA+YGFTAVDR
Sbjct  654   PNKVLLWCGTRSSNLMRHLQKGFLPAVCFLPVPGYMFGKAIVCSDAAAEAARYGFTAVDR  713

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+GE + E +SPPE++ SLE+KKLG    GRKKTDESEHF WKDDIKVPC
Sbjct  714   PEGFLVLAVASLGERVTELTSPPENSTSLEEKKLGVVGIGRKKTDESEHFTWKDDIKVPC  773

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             G+LI  S H  S  +YNEYA+YDPQQVSI FLVAVK++E+ VEY TAE
Sbjct  774   GKLI-PSDHEQSQLEYNEYAIYDPQQVSICFLVAVKFEEKDVEYDTAE  820



>ref|XP_003538122.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Glycine max]
Length=812

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/828 (65%), Positives = 681/828 (82%), Gaps = 16/828 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKV ETRSH H   +EE+++TRKQKA+SK  +     + +SP KKAK         +K +
Sbjct  1     MKVQETRSHVHAPGEEEKVMTRKQKAESKAHE-----VEHSP-KKAKV--------EKED  46

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
              +    ++   A E+++FC+ T+EHL ++QMR+I++ N+ DSSGSD  I  RCQ+++FYG
Sbjct  47    GQINGKSETGVAEEYDEFCKVTNEHLPLEQMREIMEANSLDSSGSDLEIARRCQDLLFYG  106

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              +DKC VC G+LE   G  Y C+G +SEW+SC++STRNPPRK+EP+++P+SVQ +  SDL
Sbjct  107   ALDKCSVCNGSLEFD-GRRYVCRGFYSEWASCTFSTRNPPRKQEPIKLPDSVQDSLASDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +KK+QDP +RP ++  +  KP +GMMISL GRLTRTH YWK+ IEK+GGKVANS+IG TC
Sbjct  166   LKKYQDPSHRPHRDLGLAEKPFTGMMISLMGRLTRTHHYWKTTIEKHGGKVANSIIGATC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LV SPAERERGG+SK+AEA+ERGIPVVREAWL+DSIEK+E QPL++YD+ SD++VDG+GI
Sbjct  226   LVASPAERERGGTSKLAEAMERGIPVVREAWLIDSIEKQEPQPLESYDLVSDLSVDGKGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQDP  EA+E++++ELK+YGKRGV+KD+KLQ++GGKI E+DG+LYNCA SVCDQG G
Sbjct  286   PWDKQDPGEEAIESLSAELKLYGKRGVYKDSKLQEQGGKIFERDGILYNCAFSVCDQGLG  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             LND+C+MQLIV PEN LH+Y++KGRVGD    +++LEEW+N DGA+KEF+R+F+E+TGNE
Sbjct  346   LNDYCVMQLIVVPENPLHLYFKKGRVGDDPNAEEQLEEWDNVDGALKEFARLFDEITGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKK QKKP KFYP+D+ DG+EVRHG L LRQLGIAA H KL+P+VANFMK+LCS
Sbjct  406   FEPWEREKKFQKKPLKFYPIDMDDGVEVRHGALGLRQLGIAATHCKLEPLVANFMKVLCS  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALMEMGYD P++PIGM++++HL+RCED LL F+++++S KE G + EA+W +FS
Sbjct  466   QEIYKYALMEMGYDSPDLPIGMVTNLHLKRCEDVLLEFIDKMKSLKETGPKAEAVWTDFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTLM STRPF  RD+ +IA+HAA+  E VRDI  AS LI DM+GST+DDPL + Y K
Sbjct  526   QRWFTLMHSTRPFNFRDYQEIAEHAAAALEGVRDITQASHLIGDMTGSTIDDPLSETYKK  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCSISAL+K SDDY+MI+KYLEKTY+PV+VGDI YGVSVENIFAV+   CPS +D+ KL
Sbjct  586   LGCSISALDKSSDDYEMIVKYLEKTYEPVKVGDIEYGVSVENIFAVQTGGCPSYEDIVKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCG+RSSNLLRHL  GF PA+CSLPVPGYMFGKAI+CSDAAAEAA+YGFTAVDR
Sbjct  646   PNKVLLWCGSRSSNLLRHLHKGFSPAICSLPVPGYMFGKAIICSDAAAEAARYGFTAVDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLA+AS+G EI E  SPPEDT SLE+KK+G K  G+KKTDESEHFVWKDDIKVPC
Sbjct  706   PEGFLVLAIASLGNEITELKSPPEDTSSLEEKKVGVKGLGKKKTDESEHFVWKDDIKVPC  765

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             G+L+  S H +SP +YNEYAVYD +Q  I +LV VKY+E+     TAE
Sbjct  766   GKLV-ASDHQDSPLEYNEYAVYDKKQARISYLVGVKYEEKGAVIDTAE  812



>gb|KDO58060.1| hypothetical protein CISIN_1g037230mg [Citrus sinensis]
Length=815

 Score =  1147 bits (2967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/828 (66%), Positives = 665/828 (80%), Gaps = 13/828 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRSH H ++DEE+++TRKQKA++K  Q+  E    +P KK K       +     
Sbjct  1     MKVHETRSHAHASSDEEKVMTRKQKAENKT-QEATE----TPPKKTK------QENNGNG  49

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                         AEFE+FC++    LS +QMR+IL+ N QDSSGSD  +V +C +++FYG
Sbjct  50    GHANGKRSGDVTAEFEEFCKSIEGQLSAEQMREILELNGQDSSGSDVAVVTKCLDMLFYG  109

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+DKCPVC G LE   G  Y CKG +SEWS+C++ T++PPRK+EP ++P+SV  +P+SDL
Sbjct  110   PLDKCPVCNGNLEFD-GKRYSCKGMYSEWSTCTFRTKDPPRKQEPTKLPDSVLNSPISDL  168

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
              K++QDP +RP ++    VKP +GM ISL GRL+RTHQYW++ IEK+GGKVA S IG+TC
Sbjct  169   AKRYQDPSHRPRRDVGAAVKPFTGMTISLMGRLSRTHQYWRTTIEKHGGKVAASPIGLTC  228

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LV SPAERERGGSSK+ EA+ERG  VV EAWL+DSIEK+E QPL+AYD+ +D+A D +GI
Sbjct  229   LVASPAERERGGSSKLVEAMERGTRVVSEAWLIDSIEKQEAQPLEAYDLVTDLAPDSKGI  288

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DK DPS EA+E+I +ELK+YGKRGV+KDTKLQ++GGKILEKDG+LYNCA S+CDQGRG
Sbjct  289   PWDKMDPSEEAIESIAAELKLYGKRGVYKDTKLQEQGGKILEKDGILYNCAFSLCDQGRG  348

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             +N +CI+QLI  P++ LH+YY+KG+VGD    +++LEEW   D AIKEF R+FEE+TGNE
Sbjct  349   MNLYCIVQLITVPDSNLHLYYKKGKVGDDPNAEERLEEWTGVDNAIKEFVRLFEEVTGNE  408

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKK QKKP KFYP+D+ DG+EVRHGGL +RQLG+AA HSKLDP+VANFMK+LCS
Sbjct  409   FEPWEREKKFQKKPLKFYPIDMDDGVEVRHGGLGMRQLGVAAAHSKLDPVVANFMKVLCS  468

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QE+YRYALMEMG D P++PIGMLS+VHL RCE+ L  F+E ++STKE GQ+ EA+W +FS
Sbjct  469   QEVYRYALMEMGLDAPDLPIGMLSNVHLNRCEEVLQQFIEAVKSTKETGQKAEAIWTDFS  528

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             N+WFTLM S RPF  RD  +IADHAAS FE+VRDI  AS LI DMSGSTLDDPL D Y K
Sbjct  529   NRWFTLMHSLRPFIFRDNQEIADHAASSFEAVRDITVASHLIGDMSGSTLDDPLSDCYEK  588

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             L CSISALEKDSDDYKMI+ YLEKTY+PV++GDI YGVSV+NIF +E +A PSLD++KKL
Sbjct  589   LACSISALEKDSDDYKMIVNYLEKTYEPVKLGDIEYGVSVDNIFVIESNAQPSLDEIKKL  648

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSNLLRHLQ GFLPA CSLPVPGYMFG+AIVCSDAAAEAA+YGFTA DR
Sbjct  649   PNKVLLWCGTRSSNLLRHLQKGFLPASCSLPVPGYMFGRAIVCSDAAAEAARYGFTAADR  708

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+G+++ E   PPEDTKSLE KKLG K  GRKKTDESEHF W DDIKVP 
Sbjct  709   PEGFLVLAVASLGDQVTELKKPPEDTKSLEDKKLGVKGLGRKKTDESEHFFWNDDIKVPG  768

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             GRLI  S+H NSP +YNEYAVYDP+Q SIRFLV VK++E  VE   AE
Sbjct  769   GRLI-PSEHKNSPLEYNEYAVYDPKQTSIRFLVGVKFEERGVEMEPAE  815



>ref|XP_004506166.1| PREDICTED: putative poly [ADP-ribose] polymerase 3-like [Cicer 
arietinum]
Length=811

 Score =  1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/829 (66%), Positives = 675/829 (81%), Gaps = 19/829 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHAN-DEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKV E RSH HHA+ +EE+++TRKQKA+SK  +     + +SP KKAK         +  
Sbjct  1     MKV-EARSHVHHAHGEEEKVMTRKQKAESKAHE-----VEHSP-KKAKV--------ENE  45

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
             +      ++     E+++FC+ T+E LS++QMR+IL+ N  DSSG++  I  RCQ+++F+
Sbjct  46    DGHTNGKSEANVVEEYDEFCKVTNEKLSLEQMREILEANGLDSSGTEPEITRRCQDLLFF  105

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             G ++KC VC G LE   G  Y C+G +SEWSSC++STR+PPRKEEP+++P+SVQ +P+SD
Sbjct  106   GALEKCLVCNGNLEFD-GRRYACRGFYSEWSSCNFSTRDPPRKEEPIKLPDSVQDSPVSD  164

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             L+KK+QDP +RP ++  +  KP +GMMISL GRL RTHQYWK  IEK+GGKVANS+IG T
Sbjct  165   LLKKYQDPSHRPQRDLGLATKPFTGMMISLMGRLNRTHQYWKKTIEKHGGKVANSIIGAT  224

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLV SPAERERGG+SK+AEA+E+GIPVVREAWL DSIEK+E QPL+AYD+ SD++V G+G
Sbjct  225   CLVASPAERERGGTSKLAEAMEKGIPVVREAWLTDSIEKQEPQPLEAYDLVSDLSVAGKG  284

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDP  EA+E++++ELK+YGKRG++KDTKLQ++ GKI EKDG+LYNCA SVCDQGR
Sbjct  285   IPWDKQDPGEEAIESLSAELKLYGKRGIYKDTKLQEQDGKIFEKDGILYNCAFSVCDQGR  344

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
              LND+C+MQLI   ENRLHMY++KGRVGD    +++LEE+EN D AIKEF R+FEE+TGN
Sbjct  345   RLNDYCVMQLITQ-ENRLHMYFKKGRVGDDPNAEERLEEFENVDNAIKEFVRLFEEITGN  403

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF S EREKK QKKP KFYP+D+ DG+EVRHG L LRQLGIA  H KL+P VANFMKILC
Sbjct  404   EFESWEREKKFQKKPLKFYPIDMDDGVEVRHGALGLRQLGIAVTHCKLEPQVANFMKILC  463

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIY+YALMEMGYD P++PIGM++D+HL+RCE+ LL F+E+++S KE G + +A+W++F
Sbjct  464   SQEIYKYALMEMGYDSPDLPIGMVTDLHLKRCEEVLLEFIEKVKSLKETGPKTDAIWSDF  523

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S +WFTLM STRPF  RD+ +IADHAA+  E VRDI  AS LI DMSGST+DDPL D Y 
Sbjct  524   SQRWFTLMHSTRPFIFRDYQEIADHAAAALEGVRDITLASHLIGDMSGSTIDDPLSDTYK  583

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGCSIS LEKDS+DY+MI+KYLEKTY+PV+VGDI YGVSVENIF VE SACPS +D+ K
Sbjct  584   KLGCSISPLEKDSNDYEMIVKYLEKTYEPVKVGDIEYGVSVENIFTVESSACPSYEDIVK  643

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCG+RSSNLLRHL  GFLPA+CSLPVPGYMFGKAIVCSDAAAEAA+YGFTAVD
Sbjct  644   LPNKVLLWCGSRSSNLLRHLHKGFLPAICSLPVPGYMFGKAIVCSDAAAEAARYGFTAVD  703

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLA+AS+G EI E  SPPEDT SLE KK G K  G+KKTDESEHFVWKDDIKVP
Sbjct  704   RPEGFLVLAIASLGNEITELKSPPEDTTSLEDKKNGVKGLGKKKTDESEHFVWKDDIKVP  763

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             CGR+I  S+  +SP +YNEYAVYDP+QV I +LV VKY+E+     TAE
Sbjct  764   CGRII-ASEDEDSPLEYNEYAVYDPKQVRISYLVGVKYEEKDTVIDTAE  811



>ref|XP_006487980.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
3-like [Citrus sinensis]
Length=823

 Score =  1139 bits (2945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/829 (66%), Positives = 662/829 (80%), Gaps = 13/829 (2%)
 Frame = -2

Query  3018  DMKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             ++KVHETRSH H ++DEE+++TRKQKA++K  Q+  E    +P KK K       +    
Sbjct  8     NVKVHETRSHAHASSDEEKVMTRKQKAENKT-QEATE----TPPKKTK------QENNGN  56

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
                          AEFE+FC++    LS +QMR+IL+ N QDSSGSD  +V +C +++FY
Sbjct  57    GGHANGKRSGDVTAEFEEFCKSIEGQLSAEQMREILELNGQDSSGSDVAVVTKCLDMLFY  116

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             GP+DKCPVC G LE   G  Y CKG +SEWS+C++ T++PPRK+EP ++P+SV  +P+SD
Sbjct  117   GPLDKCPVCNGNLEFD-GKRYSCKGMYSEWSTCTFRTKDPPRKQEPTKLPDSVLNSPISD  175

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             L K++QDP +RP ++    VKP +GM ISL GRL+RT QYW++ IEK+GGKVA S IG+ 
Sbjct  176   LAKRYQDPSHRPRRDVGAAVKPFTGMTISLMGRLSRTQQYWRTTIEKHGGKVAASPIGLN  235

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLV SPAERERGGSSK+ EA+ERG  VV E WL+DSIEK+E QPL+AYD+  D+A D +G
Sbjct  236   CLVASPAERERGGSSKLVEAMERGTRVVSEGWLIDSIEKQEAQPLEAYDLVXDLAPDSKG  295

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DK DPS EA+E++ +ELK+YGKRGV+KDTKLQ++GGKILEKDG+LYNCA S+CDQGR
Sbjct  296   IPWDKMDPSEEAIESMAAELKLYGKRGVYKDTKLQEQGGKILEKDGILYNCAFSLCDQGR  355

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             G+N +CI+QLI  P++ LH+YY+KG+VGD    +++LEEW   D AIKEF R+FEE+TGN
Sbjct  356   GMNLYCIVQLITVPDSNLHLYYKKGKVGDDPNAEERLEEWTGVDNAIKEFVRLFEEVTGN  415

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKK QKKP KFYP+D+ DG+EVRHGGL +RQLG+AA HSKLDP+VANFMK+LC
Sbjct  416   EFEPWEREKKFQKKPLKFYPIDMDDGVEVRHGGLGMRQLGVAAAHSKLDPVVANFMKVLC  475

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQE+YRYALMEMG D P++PIGMLS+VHL RCE+ L  F+E ++STKE GQ+ EA+W +F
Sbjct  476   SQEVYRYALMEMGLDAPDLPIGMLSNVHLNRCEEVLQQFIEAVKSTKETGQKAEAIWTDF  535

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             SN+WFTLM S RPF  RD  +IADHAAS FE+VRDI  AS LI DMSGSTLDDPL D Y 
Sbjct  536   SNRWFTLMHSLRPFIFRDNQEIADHAASSFEAVRDITVASHLIGDMSGSTLDDPLSDCYE  595

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KL CSISALEKDSDDYKMI+ YLEKTY+PV++GDI YGVSV+NIF +E +A PSLD++KK
Sbjct  596   KLACSISALEKDSDDYKMIVNYLEKTYEPVKLGDIEYGVSVDNIFVIESNAQPSLDEIKK  655

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLRHLQ GFLPA CSLPVPGYMFG+AIVCSDAAAEAA+YGFTA D
Sbjct  656   LPNKVLLWCGTRSSNLLRHLQKGFLPASCSLPVPGYMFGRAIVCSDAAAEAARYGFTAAD  715

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+G+++ E   PPEDTKSLE KKLG K  GRKKTDESEHF W DDIKVP
Sbjct  716   RPEGFLVLAVASLGDQVTELKKPPEDTKSLEDKKLGVKGLGRKKTDESEHFFWNDDIKVP  775

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
              GRLI  S+H NSP +YNEYAVYDP+Q SIRFLV VK++E  VE   AE
Sbjct  776   GGRLI-PSEHKNSPLEYNEYAVYDPKQTSIRFLVGVKFEERGVEMEPAE  823



>ref|XP_002523787.1| poly [ADP-ribose] polymerase, putative [Ricinus communis]
 gb|EEF38513.1| poly [ADP-ribose] polymerase, putative [Ricinus communis]
Length=815

 Score =  1137 bits (2941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/829 (66%), Positives = 668/829 (81%), Gaps = 17/829 (2%)
 Frame = -2

Query  3012  KVHETRSHTHH-ANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             KVHETRS TH  A DE +++TRKQKA++K  +    P      KKAK         +   
Sbjct  3     KVHETRSQTHGPAADEGKVMTRKQKAENKGHEGEQSP------KKAKN--------ENDS  48

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                 +      + EFE+F RA  EHLSV QMR+IL+ N QDSSGSD  ++ +CQ+++  G
Sbjct  49    SHANEKTKTDISKEFEEFSRAIREHLSVSQMREILEMNDQDSSGSDGAVITKCQDLLLLG  108

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+ KCP+C   LE   G  Y C G +SEWSSC++ TR+PPRKEEPL+ P+SV K+P++DL
Sbjct  109   PLGKCPLCDCTLEFD-GKRYSCNGFYSEWSSCTFKTRSPPRKEEPLKFPDSVLKSPIADL  167

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +KKHQDPKNRP +E     KP +GM+ISLSGRL+RTHQYWK  IEK GGKV+NSVIGVTC
Sbjct  168   LKKHQDPKNRPRQELGAPGKPFAGMIISLSGRLSRTHQYWKKTIEKYGGKVSNSVIGVTC  227

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSPAERERGGSSK++EA+ER IPV RE WL+DSIEK+E  PL+AYDV SD+AV+G+GI
Sbjct  228   LVVSPAERERGGSSKLSEAMERNIPVAREEWLLDSIEKQEPLPLEAYDVVSDLAVEGKGI  287

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQ+ S EALE+I++ELK+YGKRGVHKD+KLQ+  G+I EKDG+LYNCA S+CD GR 
Sbjct  288   PWDKQETSEEALESISAELKLYGKRGVHKDSKLQERDGEIFEKDGILYNCAFSLCDMGRE  347

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             +ND+CI+QLI  PE+ LH+YY+KGRVGD    D++LEEWE+ D A+KEF +IFEE+TGNE
Sbjct  348   INDYCILQLINVPESNLHLYYKKGRVGDDPGADERLEEWEDVDNAVKEFVKIFEEITGNE  407

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKK +KK  KFYP+D+ DG+EVR GGL LRQLG AA HSKL+P +A FMKILCS
Sbjct  408   FEPWEREKKFEKKRLKFYPIDMDDGVEVRQGGLGLRQLGAAAAHSKLEPQLAYFMKILCS  467

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIYRYALMEMG D PE+P+GMLSD+HL+RCE+ LL FVE ++S K  GQ+ EA+W+++S
Sbjct  468   QEIYRYALMEMGLDPPELPMGMLSDLHLKRCEEVLLQFVEAVKSMKGTGQKAEAVWSDYS  527

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTLM STRP  LRD+ ++AD+ A+ FE+VRDIN ASRLI DMSGSTLDDPL DRY K
Sbjct  528   QRWFTLMHSTRPLILRDYDELADNVAAAFETVRDINVASRLIGDMSGSTLDDPLSDRYKK  587

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCSIS + K++DDYKMI+ YLE+TY+P+RVGDI YGVSVENIFAVE SA PSLD++KKL
Sbjct  588   LGCSISPVGKETDDYKMIVNYLERTYEPIRVGDIDYGVSVENIFAVESSAHPSLDEIKKL  647

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSNLLRHLQ GFLPA CSLPVPGYMFGKAIVCSDAAAEAA+YGFTAVDR
Sbjct  648   PNKVLLWCGTRSSNLLRHLQKGFLPAACSLPVPGYMFGKAIVCSDAAAEAARYGFTAVDR  707

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFL+LAVAS+G+E+ E SS PEDTKS E+KK+G K  GRKKTDESEHF+W+DDIKVPC
Sbjct  708   PEGFLILAVASLGDEVTEVSSTPEDTKSFEEKKIGVKGLGRKKTDESEHFMWRDDIKVPC  767

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEP  529
             GRL+  S++ + P +YNEYAVYDP+Q SIRFLV +KY+E+     TAEP
Sbjct  768   GRLM-PSENKDGPLEYNEYAVYDPKQTSIRFLVGIKYEEKDAVMDTAEP  815



>ref|XP_003606139.1| Poly [Medicago truncatula]
 gb|AES88336.1| poly(ADP-ribose) polymerase domain protein [Medicago truncatula]
Length=814

 Score =  1137 bits (2941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/830 (65%), Positives = 678/830 (82%), Gaps = 18/830 (2%)
 Frame = -2

Query  3015  MKVHETRSHT-HHAN-DEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekk  2842
             MKV E+RSH  HHA+ +EE+++TRKQKA+SK  +     + +SP KKAK        E +
Sbjct  1     MKV-ESRSHNVHHAHGEEEKVMTRKQKAESKAHE-----VEHSP-KKAKV-------EDE  46

Query  2841  aeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMF  2662
                     +      E+++FC+AT+E LS++QM++IL+ N  DSSGSD  I  RCQ+++F
Sbjct  47    KNGHTNGKSASDVVQEYDEFCKATNEQLSLEQMKEILEANDLDSSGSDLEITRRCQDLLF  106

Query  2661  YGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLS  2482
             +G ++KC VC G +E   G  Y C+G +SEWSSC++STR PPRK+EP+++P+SVQ +P+S
Sbjct  107   FGALEKCMVCNGNMEFD-GRRYGCRGFYSEWSSCTFSTREPPRKDEPIKLPDSVQNSPVS  165

Query  2481  DLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGV  2302
             DL+KK+QDP  RP ++  + +KP +GMMISL GRL RTHQYWK  IEK+GGKVANS+IG 
Sbjct  166   DLLKKYQDPSKRPQRDLGLAIKPFTGMMISLMGRLNRTHQYWKKTIEKHGGKVANSIIGA  225

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
             +CLV SPAER+RGG+SK+A+A+ERGIPVVREAWL DSIEK+E QPL++YD+ SD++VDG+
Sbjct  226   SCLVASPAERDRGGTSKLADAMERGIPVVREAWLTDSIEKQEPQPLESYDLVSDLSVDGK  285

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             GIP DKQDP  EA+E++++ELK+YGKRGV+KDTKL ++ GKI EKDG+LYNCA S+CDQG
Sbjct  286   GIPWDKQDPGEEAIESLSAELKLYGKRGVYKDTKLHEQDGKIFEKDGILYNCAFSLCDQG  345

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
             R LND+C+MQLIV PEN LH+Y++KGRVGD    +++LEE EN D AIKEF R+FEE+TG
Sbjct  346   RKLNDYCVMQLIVVPENSLHLYFKKGRVGDDPSAEERLEECENVDNAIKEFVRLFEEITG  405

Query  1761  NEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKIL  1582
             NEF S EREKK QKKP KFYP+D+ DG+EVRHG L LRQLGIAA H KL+PMVANFMK+L
Sbjct  406   NEFESWEREKKFQKKPLKFYPIDMDDGVEVRHGALGLRQLGIAATHCKLEPMVANFMKVL  465

Query  1581  CSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAE  1402
             CSQEIY+YALMEMGYD P++PIGM++++HL+RCE+ LL F+E++++ KE G + +A+W++
Sbjct  466   CSQEIYKYALMEMGYDSPDLPIGMVTNLHLKRCEEILLEFIEKVKTLKETGPKADAIWSD  525

Query  1401  FSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRY  1222
             FS KWFTLM STRPF  RD+ +IADHAA+  E VRDI  AS LI DMSGST+DDPL D Y
Sbjct  526   FSQKWFTLMHSTRPFIFRDYQEIADHAAAALEGVRDITLASHLIGDMSGSTIDDPLSDTY  585

Query  1221  VKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK  1042
              KLGCSI+ LEK+S+DY+MI+KYLEKTY+PV+VGDI YGVSVENIF VE SACPS  D+ 
Sbjct  586   KKLGCSITPLEKNSNDYEMIVKYLEKTYEPVKVGDIEYGVSVENIFTVESSACPSYADIV  645

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             K+PNKVLLWCG+RSSNLLRHL  GFLPA+CSLPVPGYMFGKAIVCSDAAAEAA+YGFTAV
Sbjct  646   KMPNKVLLWCGSRSSNLLRHLHKGFLPAICSLPVPGYMFGKAIVCSDAAAEAARYGFTAV  705

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
             DRPEGFLVLA+AS+G EI E  SPPEDT SLE+KK+G K  G+KKTDESEHFVWKDDIKV
Sbjct  706   DRPEGFLVLAIASLGNEITELKSPPEDTTSLEEKKVGVKGLGKKKTDESEHFVWKDDIKV  765

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             PCG +I  S+H +SP +YNEYAVYDP+QV I +LV VKY+E+     TAE
Sbjct  766   PCGSII-ASEHEDSPLEYNEYAVYDPKQVRISYLVGVKYEEKDAVIDTAE  814



>gb|KHN21141.1| Poly [ADP-ribose] polymerase 3 [Glycine soja]
Length=796

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/743 (69%), Positives = 634/743 (85%), Gaps = 2/743 (0%)
 Frame = -2

Query  2784  FCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSG  2605
             FC+AT+EHL ++QMR IL+ N  DSSGSD  I  RCQ+++FYG +DKC VC G+LE   G
Sbjct  45    FCKATTEHLPLEQMRDILEANGLDSSGSDLEITRRCQDLLFYGALDKCSVCNGSLEFD-G  103

Query  2604  GTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVI  2425
               Y C+G +SEW+SC++STRNPPRK+EP+++P+SVQ +  SDL+KK+QDP +RP ++  +
Sbjct  104   RRYVCRGFYSEWASCTFSTRNPPRKQEPIKLPDSVQNSLASDLLKKYQDPSHRPHRDLGL  163

Query  2424  TVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERERGGSSKVA  2245
               KP +GMMISL GRLTRTH YWK+ IEK+GGKVANS+IG TCLV SPAERERGG+SK+A
Sbjct  164   AEKPFTGMMISLMGRLTRTHHYWKTTIEKHGGKVANSIIGSTCLVASPAERERGGTSKLA  223

Query  2244  EAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEALENITS  2065
             EA+ER IPVVREAWL+DSIEK+E QPL+AYD+ SD++VDG+GIP DKQDP  EA+E++++
Sbjct  224   EAMERSIPVVREAWLIDSIEKQEPQPLEAYDLVSDLSVDGKGIPWDKQDPGEEAIESLSA  283

Query  2064  ELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRL  1885
             ELK+YGKRGV+KDTKLQ++GGKI E+DG+LYNCA SVCDQGRGLND+C+MQLIV PENRL
Sbjct  284   ELKLYGKRGVYKDTKLQEQGGKIFERDGILYNCAFSVCDQGRGLNDYCVMQLIVVPENRL  343

Query  1884  HMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKF  1705
             H+Y++KGRVGD    +++LEEW+N DGA+KEF R+FEE+TGNEF   EREKK QKKP KF
Sbjct  344   HLYFKKGRVGDDPNAEERLEEWDNVDGALKEFVRLFEEITGNEFEPWEREKKFQKKPLKF  403

Query  1704  YPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPE  1525
             YP+D+ DGIEVRHG L LRQLGIAA H KL+P+VANFMK+LCSQEIY+YALMEMGYD P+
Sbjct  404   YPIDMDDGIEVRHGALGLRQLGIAATHCKLEPLVANFMKVLCSQEIYKYALMEMGYDCPD  463

Query  1524  IPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLRD  1345
             +PIGM++++HL++CED LL F+++++S KE G + EA+W +FS +WFTLM STRPF  RD
Sbjct  464   LPIGMVTNLHLKKCEDVLLEFIDKVKSLKETGPKAEAVWTDFSQRWFTLMHSTRPFNFRD  523

Query  1344  FADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKM  1165
             + +IADHAA+  E VRDI  AS LI DM+GST+DDPL + Y KLGCSISAL+K SDDY+M
Sbjct  524   YQEIADHAAAALEGVRDITQASHLIGDMTGSTIDDPLSETYKKLGCSISALDKSSDDYEM  583

Query  1164  ILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGTRSSNLLR  985
             I+KYLEKTY+PV+VGDI YGVSVENIFAV+   CPS +D+ KLPNKVLLWCG+RSSNLLR
Sbjct  584   IVKYLEKTYEPVKVGDIEYGVSVENIFAVQTGGCPSYEDIIKLPNKVLLWCGSRSSNLLR  643

Query  984   HLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIM  805
             HLQ GFLPA+CSLP+PGYMFGKAIVCSDAAAEAA+YGFTAVDRPEGFLVLA+AS+G EI 
Sbjct  644   HLQKGFLPAICSLPIPGYMFGKAIVCSDAAAEAARYGFTAVDRPEGFLVLAIASLGNEIT  703

Query  804   EFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYN  625
             E  +PPED  SLE+KK+G K  G+KKTDESEHFVWKDDIKVPCG+L+  S H +SP +YN
Sbjct  704   ELKTPPEDASSLEEKKVGVKGPGKKKTDESEHFVWKDDIKVPCGKLV-ASDHQDSPLEYN  762

Query  624   EYAVYDPQQVSIRFLVAVKYDEE  556
             EYAVYD ++  I +LV VKY+E+
Sbjct  763   EYAVYDKKRARISYLVRVKYEEK  785



>ref|XP_010271692.1| PREDICTED: putative poly [ADP-ribose] polymerase 3 [Nelumbo nucifera]
Length=814

 Score =  1123 bits (2905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/821 (64%), Positives = 662/821 (81%), Gaps = 17/821 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDE-ERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MK  ETRS  +   DE E++ TRK K    + ++ +    N  TK     +G    +  A
Sbjct  2     MKGPETRSQAYAGADEDEKVGTRKHKTVKAEHKEQELEHKNKKTKSENCVNGHPNGKSTA  61

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
             +                 FC+AT E  S+QQM++IL+ N QDSSGSD+ +V RCQ+++FY
Sbjct  62    DVPAEFDE----------FCKATKEQFSIQQMKEILEANDQDSSGSDDAVVHRCQDMLFY  111

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             GP+ +CPVC G +EC+ GG Y C+G +SEWS+C Y TR+P RKEEP+++PE ++    +D
Sbjct  112   GPLGRCPVCNGHMECT-GGNYSCRGAYSEWSTCIYKTRDPTRKEEPIKLPEGIK----TD  166

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             LIK+HQ+P +RP +      KP  GMMISLSGRL+RTH YW+++IEK+GGKVAN+V GVT
Sbjct  167   LIKQHQNPSHRPHRTLTPVDKPFLGMMISLSGRLSRTHHYWRTEIEKHGGKVANTVPGVT  226

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAER+RGGSSK+AEA+ERGIPVVREAWL DSI+K+E QPL+ YDV +D++VDG+G
Sbjct  227   CLVVSPAERDRGGSSKLAEAMERGIPVVREAWLTDSIKKQEAQPLEVYDVVTDLSVDGKG  286

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS E++E++++E K+YGKR V+KD+ LQD+GGKI EKDG+++NCA S+CDQGR
Sbjct  287   IPWDKQDPSEESIESLSAEPKIYGKRSVYKDSLLQDQGGKIFEKDGIIFNCAFSICDQGR  346

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             GLN +CIMQLI+ PENRLH YY+KG+VGD  + +++L++W+N D A+KEF+R+FEELTGN
Sbjct  347   GLNHYCIMQLIMVPENRLHFYYKKGKVGDDPKAEERLKKWDNVDNAVKEFARLFEELTGN  406

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKK QKKP KFYP+D+ DG++VR+GGL LRQLG+A  H KL+P+VANFMK++C
Sbjct  407   EFEPWEREKKFQKKPLKFYPIDMDDGVDVRYGGLGLRQLGVAVTHCKLEPLVANFMKVIC  466

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIY+YA+MEM  D P++P+GMLSD+HL+RCE+TLL F+E ++ST E GQ+  A+W++F
Sbjct  467   SQEIYKYAMMEMALDSPDLPMGMLSDLHLKRCEETLLQFIETVKSTDETGQKAHAVWSDF  526

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S +WFTLM STRPF  RD  DIADHAA+  E+VRDIN ASRLI D++GST+DDPL DRY 
Sbjct  527   SQRWFTLMHSTRPFIFRDCQDIADHAAAALETVRDINVASRLIGDLTGSTIDDPLSDRYK  586

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGCSI  LEKDSDDYKMIL YLEKTY+PV++GDISYGV+VENIF+VE SA PS +++KK
Sbjct  587   KLGCSIHPLEKDSDDYKMILNYLEKTYEPVKLGDISYGVTVENIFSVESSALPSYEEIKK  646

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLRHL  GFLPA+CSLPVPGYMFGKAI+CSDAAAEAA+YGFTAVD
Sbjct  647   LPNKVLLWCGTRSSNLLRHLHKGFLPAICSLPVPGYMFGKAIICSDAAAEAARYGFTAVD  706

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFL+LA+AS+G ++ E  SPPEDTK+LE+KK G K  GRKK DESEH  WKDDI+VP
Sbjct  707   RPEGFLILAIASLGNKVTELKSPPEDTKTLEEKKAGVKALGRKKPDESEHTTWKDDIRVP  766

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
             CG+LI   Q  +SP ++NEYAVYDP+QVSIRFLVAVKY+E+
Sbjct  767   CGKLIPTGQ-EDSPLEFNEYAVYDPKQVSIRFLVAVKYEEK  806



>ref|XP_002274597.2| PREDICTED: poly [ADP-ribose] polymerase 3 [Vitis vinifera]
Length=815

 Score =  1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/828 (64%), Positives = 671/828 (81%), Gaps = 13/828 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETR   H   +EE+   +KQKA++K  +         P K+ K      G      
Sbjct  1     MKVHETRPQAHANAEEEKAGGKKQKAENKTHEAEQAQKKAKPEKEDKDNGQKNGKSAAEI  60

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
              ++ +            FC+ATS+HLS++QMR+IL+ N QD SGSD+ +VPRCQ++MFYG
Sbjct  61    AKEFEQ-----------FCKATSQHLSIKQMREILEANEQDHSGSDDAVVPRCQDMMFYG  109

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              ++KCP C    EC+ G  Y C G FSEWSSC+YSTR+P R++EP+++P+SV+++   +L
Sbjct  110   ALEKCPACDNTFECT-GDNYVCTGAFSEWSSCTYSTRDPVRRKEPVKLPDSVRESSAFEL  168

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             IK HQ+  N P +    T KP +GM+I LSGRL+RTH YW+++IE++GGK ANSV+G TC
Sbjct  169   IKNHQEQGNFPRRNLNPTGKPFTGMLICLSGRLSRTHHYWRTKIEEHGGKDANSVLGATC  228

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSPAERERGGSSKV EA+ERGIPVVREAWL DSIEK+E QPL+AYDV SD++V+G+GI
Sbjct  229   LVVSPAERERGGSSKVVEAMERGIPVVREAWLSDSIEKQEAQPLEAYDVVSDLSVEGKGI  288

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQDPS EALE+I++E+K+YGKRGV+KD+KLQ++GGKI EKDG+LYNCA S+CDQGRG
Sbjct  289   PWDKQDPSEEALESISAEIKLYGKRGVYKDSKLQEQGGKIFEKDGILYNCAFSICDQGRG  348

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             +ND+CI+QLI+ PEN+LH+YY+KGRVGD  R ++++EEW+N D A+KEF R+FEELTGNE
Sbjct  349   VNDYCILQLIIVPENQLHLYYKKGRVGDDTRAEERVEEWQNVDAAVKEFVRLFEELTGNE  408

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKK QKK  KFYP+D+ DG++VR+GGL LRQ G+A  H KL+P+VANFMK+LCS
Sbjct  409   FEPWEREKKFQKKLLKFYPIDMDDGVDVRYGGLGLRQQGVAVAHCKLEPLVANFMKVLCS  468

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIYRYA+MEMG D P++P+GMLS++HL+RCE+ LL+F+E ++S KE   + +A W++FS
Sbjct  469   QEIYRYAMMEMGLDSPDLPMGMLSNIHLKRCEEVLLNFIETVKSIKEMDIKAKATWSDFS  528

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTL+ STRPF  RD  +IADHAA+  E VRDI  AS L+ D++GSTLDDPL+DRY K
Sbjct  529   QRWFTLLHSTRPFIFRDHQEIADHAAAALEIVRDITVASHLVGDLTGSTLDDPLFDRYKK  588

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCSIS LEKD+DDY+MILKYLEKTY+PV+VG+ISYGVSV+NIFAVEPSACPS D+MKKL
Sbjct  589   LGCSISPLEKDTDDYRMILKYLEKTYEPVKVGEISYGVSVDNIFAVEPSACPSHDEMKKL  648

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             P+KVLLWCGTRSSNL+R+L  GFLPA+CSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVDR
Sbjct  649   PSKVLLWCGTRSSNLMRYLNKGFLPAICSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDR  708

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAV S+G+++ E+ +PPE+TKSLE+K+LG K  GRKK DE+EH VW+DD+KVPC
Sbjct  709   PEGFLVLAVVSLGDQVNEYKNPPEETKSLEEKQLGGKGLGRKKPDENEHTVWEDDVKVPC  768

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             G LI  S++ +SP +YNEY VYDP+QVSIRFLV VKY+E  VE  TAE
Sbjct  769   GHLI-PSEYKDSPLEYNEYCVYDPKQVSIRFLVGVKYEERDVEMDTAE  815



>emb|CBI28338.3| unnamed protein product [Vitis vinifera]
Length=828

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/829 (64%), Positives = 672/829 (81%), Gaps = 13/829 (2%)
 Frame = -2

Query  3018  DMKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             ++KVHETR   H   +EE+   +KQKA++K  +         P K+ K      G     
Sbjct  13    NVKVHETRPQAHANAEEEKAGGKKQKAENKTHEAEQAQKKAKPEKEDKDNGQKNGKSAAE  72

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
               ++ +            FC+ATS+HLS++QMR+IL+ N QD SGSD+ +VPRCQ++MFY
Sbjct  73    IAKEFEQ-----------FCKATSQHLSIKQMREILEANEQDHSGSDDAVVPRCQDMMFY  121

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             G ++KCP C    EC+ G  Y C G FSEWSSC+YSTR+P R++EP+++P+SV+++   +
Sbjct  122   GALEKCPACDNTFECT-GDNYVCTGAFSEWSSCTYSTRDPVRRKEPVKLPDSVRESSAFE  180

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             LIK HQ+  N P +    T KP +GM+I LSGRL+RTH YW+++IE++GGK ANSV+G T
Sbjct  181   LIKNHQEQGNFPRRNLNPTGKPFTGMLICLSGRLSRTHHYWRTKIEEHGGKDANSVLGAT  240

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAERERGGSSKV EA+ERGIPVVREAWL DSIEK+E QPL+AYDV SD++V+G+G
Sbjct  241   CLVVSPAERERGGSSKVVEAMERGIPVVREAWLSDSIEKQEAQPLEAYDVVSDLSVEGKG  300

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS EALE+I++E+K+YGKRGV+KD+KLQ++GGKI EKDG+LYNCA S+CDQGR
Sbjct  301   IPWDKQDPSEEALESISAEIKLYGKRGVYKDSKLQEQGGKIFEKDGILYNCAFSICDQGR  360

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             G+ND+CI+QLI+ PEN+LH+YY+KGRVGD  R ++++EEW+N D A+KEF R+FEELTGN
Sbjct  361   GVNDYCILQLIIVPENQLHLYYKKGRVGDDTRAEERVEEWQNVDAAVKEFVRLFEELTGN  420

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKK QKK  KFYP+D+ DG++VR+GGL LRQ G+A  H KL+P+VANFMK+LC
Sbjct  421   EFEPWEREKKFQKKLLKFYPIDMDDGVDVRYGGLGLRQQGVAVAHCKLEPLVANFMKVLC  480

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIYRYA+MEMG D P++P+GMLS++HL+RCE+ LL+F+E ++S KE   + +A W++F
Sbjct  481   SQEIYRYAMMEMGLDSPDLPMGMLSNIHLKRCEEVLLNFIETVKSIKEMDIKAKATWSDF  540

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S +WFTL+ STRPF  RD  +IADHAA+  E VRDI  AS L+ D++GSTLDDPL+DRY 
Sbjct  541   SQRWFTLLHSTRPFIFRDHQEIADHAAAALEIVRDITVASHLVGDLTGSTLDDPLFDRYK  600

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGCSIS LEKD+DDY+MILKYLEKTY+PV+VG+ISYGVSV+NIFAVEPSACPS D+MKK
Sbjct  601   KLGCSISPLEKDTDDYRMILKYLEKTYEPVKVGEISYGVSVDNIFAVEPSACPSHDEMKK  660

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LP+KVLLWCGTRSSNL+R+L  GFLPA+CSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVD
Sbjct  661   LPSKVLLWCGTRSSNLMRYLNKGFLPAICSLPVPGYMFGRAIVCSDAAAEAARYGFTAVD  720

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAV S+G+++ E+ +PPE+TKSLE+K+LG K  GRKK DE+EH VW+DD+KVP
Sbjct  721   RPEGFLVLAVVSLGDQVNEYKNPPEETKSLEEKQLGGKGLGRKKPDENEHTVWEDDVKVP  780

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             CG LI  S++ +SP +YNEY VYDP+QVSIRFLV VKY+E  VE  TAE
Sbjct  781   CGHLI-PSEYKDSPLEYNEYCVYDPKQVSIRFLVGVKYEERDVEMDTAE  828



>ref|XP_002872003.1| poly polymerase 3 (PARP-3) ADP-ribosyltransferase 3 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48262.1| poly polymerase 3 (PARP-3) ADP-ribosyltransferase 3 [Arabidopsis 
lyrata subsp. lyrata]
Length=815

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/831 (64%), Positives = 677/831 (81%), Gaps = 17/831 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVT-RKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHETRSH H + DE++    RK KA+ K       P      KKAK+         + 
Sbjct  1     MKVHETRSHAHMSGDEQKKGNLRKHKAEGKL------PEAEQSQKKAKS---------EN  45

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
             +          AA+E+ +FC+A  E+LSV Q++++L+ N QD S  +ET++ +CQ+++FY
Sbjct  46    DNGRSVNGAGDAASEYNEFCKAVEENLSVDQIKEVLEINGQDCSAPEETLLAQCQDLLFY  105

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             G ++KCP+CGG L C +   + C G+ SEW SC YST++PPRKEEP++IP+SV  + +SD
Sbjct  106   GALEKCPLCGGNLICDNEKRFICGGEISEWCSCVYSTKDPPRKEEPVKIPDSVMNSAISD  165

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             LIKKHQDPK+RP +E     KP +GMMISL GRLTRTHQYWK +IE+NGGKV+N+V GVT
Sbjct  166   LIKKHQDPKSRPKRELGSADKPFAGMMISLMGRLTRTHQYWKKKIERNGGKVSNTVQGVT  225

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAERERGG+SK+ EA+E+G+PVV EAWL+DS+EK E QPL+AYDV SD++V+G+G
Sbjct  226   CLVVSPAERERGGTSKMVEAMEQGLPVVSEAWLIDSVEKHEAQPLEAYDVVSDLSVEGKG  285

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS EA+E++++ELK+YGKRGV+ DTKLQ+ GGKILEKDGLLYNCA S+CD G+
Sbjct  286   IPWDKQDPSEEAIESLSAELKMYGKRGVYMDTKLQERGGKILEKDGLLYNCAFSICDLGK  345

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             G N++CIMQLI  PE+ L+MY+++G+VGD    +++LEEWE+ED AIKEF+R+FEE+TGN
Sbjct  346   GRNEYCIMQLITVPESNLNMYFKRGKVGDDPNSEERLEEWEDEDAAIKEFARLFEEMTGN  405

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKIQKKPHKF+P+D+ DGIEVR G L LRQLG+A+ H KLD  VANF+K+LC
Sbjct  406   EFEPWEREKKIQKKPHKFFPIDMDDGIEVRSGALGLRQLGVASAHCKLDSFVANFIKVLC  465

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
              QEIY+YALME+G D P++P+GML+DVHL+RCE+ LL FV+++++TKE GQ+ EA+WA+F
Sbjct  466   GQEIYKYALMELGLDPPDLPMGMLTDVHLKRCEEVLLEFVDKVKTTKETGQKAEAMWADF  525

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S++WF+L+ STRP  L D  ++ADHAAS FE+VRDIN ASRLI DM G TLDDPL DRY 
Sbjct  526   SSRWFSLLHSTRPMRLHDVHELADHAASAFETVRDINTASRLIGDMRGDTLDDPLSDRYN  585

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGC IS ++K+S+DYKMI+KYLE TY+PV+V D+ YGVSV+N+FAVE +A PSLDD+KK
Sbjct  586   KLGCKISVVDKESEDYKMIVKYLETTYEPVKVSDVEYGVSVQNVFAVESNAIPSLDDIKK  645

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCG+ SSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVD
Sbjct  646   LPNKVLLWCGSWSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVD  705

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+GEE+ EF++PPEDTK+LE+KK+G K  GRKKT+ESEHF+W+DDIKVP
Sbjct  706   RPEGFLVLAVASLGEEVTEFTNPPEDTKTLEEKKIGVKGLGRKKTEESEHFMWRDDIKVP  765

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             CGRL+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  766   CGRLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEPE  815



>ref|XP_006289126.1| hypothetical protein CARUB_v10002547mg [Capsella rubella]
 gb|EOA22024.1| hypothetical protein CARUB_v10002547mg [Capsella rubella]
Length=814

 Score =  1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/830 (64%), Positives = 670/830 (81%), Gaps = 16/830 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRSH H + DE++   RK KA+ K       P      KKAK+         + +
Sbjct  1     MKVHETRSHAHMSGDEQKGNLRKHKAEGKL------PEAEQTQKKAKS---------END  45

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                        A+E+ +FC+A  E+LSV Q++++L  N QDSS  +ET++ +CQ+++FYG
Sbjct  46    NGRSVNGAGDVASEYNEFCKAVEENLSVDQIKEVLDINGQDSSAPEETLLAQCQDLLFYG  105

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              + KCP+C G+L C +   + C G+ SEW SC +ST+NPPRKEEP++IP+SV  + +SDL
Sbjct  106   ALAKCPLCEGSLICDNEKRFICGGEISEWCSCVFSTKNPPRKEEPIKIPDSVMNSAISDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             IKKHQDPK+RP +E     KP +GMMISL GRLTRTHQYWK +IE+NGGKV+N+V GVTC
Sbjct  166   IKKHQDPKSRPKRELGSADKPFAGMMISLMGRLTRTHQYWKKKIERNGGKVSNTVQGVTC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSPAERERGG+SK+ EA+E+G+PVV EAWL+DS+EK E QPL+AYDV SD++V+G+GI
Sbjct  226   LVVSPAERERGGTSKMVEAMEQGLPVVSEAWLIDSVEKHEAQPLEAYDVVSDLSVEGKGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQDPS EA+E++++ELK+YGKRGV+ DTKLQ+ GGKI EKDGLLYNCA S+CD G+G
Sbjct  286   PWDKQDPSEEAIESLSAELKMYGKRGVYMDTKLQERGGKIFEKDGLLYNCAFSLCDLGKG  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
              N++CIMQLI  PE+ L+MY+++G+VGD    +++LEEWE+ED AIKEF+R+FEE+TGNE
Sbjct  346   RNEYCIMQLITVPESNLNMYFKRGKVGDDPNAEERLEEWEDEDAAIKEFARLFEEVTGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKKPHKF+P+D+ DG+EVR G L LRQLG+A+ H KLD  VANF+K+LC 
Sbjct  406   FEPWEREKKIQKKPHKFFPIDMDDGVEVRSGALGLRQLGVASAHCKLDSFVANFIKVLCG  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALME+  D P++P+GML+D+HL+RCE+ LL FVE+I++TKE GQ+ EA+WA+FS
Sbjct  466   QEIYKYALMELAMDPPDLPMGMLTDIHLKRCEEVLLEFVEKIKTTKETGQKAEAMWADFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             ++WF+LM STRP  L D  ++ADHAAS FE+VRDIN ASRLI DM G TLDDPL DRY +
Sbjct  526   SRWFSLMHSTRPMRLHDVHELADHAASAFETVRDINTASRLIGDMRGDTLDDPLSDRYKR  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGC IS ++K+SDDYKM++KYLE TY+PV+V D+ YG SV+N+FAVE  A PSLD++KKL
Sbjct  586   LGCKISVVDKESDDYKMVVKYLETTYEPVKVSDVEYGASVQNVFAVESEAIPSLDEIKKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVDR
Sbjct  646   PNKVLLWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+GEE+ EF+SPPEDTK+LE KK+G K  GRKKT+ESEHF+W+DDIKVPC
Sbjct  706   PEGFLVLAVASLGEEVTEFTSPPEDTKTLEDKKMGVKGLGRKKTEESEHFMWRDDIKVPC  765

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             GRL+  S+H +S  +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  766   GRLV-PSEHKDSSLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEPE  814



>gb|KFK24049.1| hypothetical protein AALP_AAs62505U000200 [Arabis alpina]
Length=813

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/830 (64%), Positives = 679/830 (82%), Gaps = 19/830 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVT-RKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHETRSH H + DE++    RK KA+ K +Q+ ++       KKAK+           
Sbjct  1     MKVHETRSHAHMSGDEQKKGNLRKHKAEGK-VQEAEQS-----HKKAKS-----------  43

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
             E  +G       A+E+ +FC+A +++LSV Q++++L+ N QDSSG+ E ++ +CQ+++FY
Sbjct  44    ENNNGIDGAGDVASEYNEFCKAVADNLSVDQIKEVLETNGQDSSGTQEILLAQCQDLLFY  103

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             G + KCP+CGG L C +   + C G+ SEW SC YST+NPPR EEP++IP+SV  + +SD
Sbjct  104   GALAKCPLCGGNLICDNEKRFVCGGEISEWCSCVYSTKNPPRNEEPVKIPDSVMNSNISD  163

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             LIKKHQDPK+RP +E     KP +GMMISL GRLTRTHQYWK +IE++GGKV+N+V GVT
Sbjct  164   LIKKHQDPKSRPKRELGSADKPFTGMMISLMGRLTRTHQYWKKKIERHGGKVSNTVQGVT  223

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAERERGGSSK+ EA+E+G+PVV EAWL+DS+EK+E QPL+AYDV SD++V+G+G
Sbjct  224   CLVVSPAERERGGSSKMVEAMEQGLPVVSEAWLIDSVEKQEAQPLEAYDVVSDLSVEGKG  283

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS EA+E++++ELK+YGK+GV+KDTKLQ++GG I EKDGLLYNCA S+CD G+
Sbjct  284   IPWDKQDPSEEAIESLSAELKMYGKKGVYKDTKLQEKGGMIFEKDGLLYNCAFSICDLGK  343

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             G N++CIMQLI  PE+ L++Y+++G+VGD    +++LEEWE+E+ AIKEF R+FEE+TGN
Sbjct  344   GRNEYCIMQLITMPESNLNLYFKRGKVGDDPNAEERLEEWEDEEAAIKEFVRLFEEITGN  403

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKIQKKPHKF+P+D+ DGIEVR G L LRQLG++A H KLD  VANF+K+LC
Sbjct  404   EFEPWEREKKIQKKPHKFFPIDMDDGIEVRSGALGLRQLGVSAAHCKLDSFVANFVKVLC  463

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
              QEIY+YALME+G D P++P+GML+D+H++R E+ LL FVE++++TKE GQ+ EA+WA+F
Sbjct  464   GQEIYKYALMELGLDPPDLPMGMLTDIHMKRSEEVLLEFVEKLKTTKETGQKAEAMWADF  523

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S++WF+LM STRP  L DF ++ADHAAS FE+VRDIN ASRLI DM G TLDDPL DRY 
Sbjct  524   SSRWFSLMQSTRPMRLHDFHELADHAASAFETVRDINTASRLIGDMRGDTLDDPLSDRYN  583

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGC IS ++K+S+DYKM++KYLE TY+PV+V D+ YGVSVEN+FAVE  A PSLDD+KK
Sbjct  584   KLGCKISVVDKESEDYKMVVKYLETTYEPVKVSDVEYGVSVENVFAVESDAIPSLDDIKK  643

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVD
Sbjct  644   LPNKVLLWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVD  703

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+GEE+ EF++PPEDTK+LE KK+G K  GRKKT+ESEHF+WKDDIKVP
Sbjct  704   RPEGFLVLAVASLGEEVTEFTNPPEDTKTLEDKKIGVKGLGRKKTEESEHFMWKDDIKVP  763

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEP  529
             CGRL+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP
Sbjct  764   CGRLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEP  812



>ref|XP_010520427.1| PREDICTED: poly [ADP-ribose] polymerase 3 isoform X1 [Tarenaya 
hassleriana]
Length=810

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/829 (63%), Positives = 665/829 (80%), Gaps = 20/829 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVH+TRSH H ++D+++++ RK KA+ K  +    P      KKAK             
Sbjct  1     MKVHDTRSHAHMSSDDKKVMARKHKAEGKLPESDHSP------KKAKP------------  42

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
             E    A D AA +EF++FC A   +LSV+QM+Q+L+ N QDSSG+ + ++ RCQ+++FYG
Sbjct  43    ENGNGAGDSAAVSEFKEFCEAVKANLSVEQMKQVLESNGQDSSGTHDEVISRCQDLLFYG  102

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              ++KCPVCG  + C +   Y CK D SEW SC +ST++PPRKE+ ++IP+SV  + +SD+
Sbjct  103   ALEKCPVCGNDVYCDNK-RYFCKSDISEWCSCVFSTKSPPRKEDSIKIPDSVLNSAVSDM  161

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             IKK QDP  RP +E     KP SG M+SL GRLTRTHQYWK +IE++GGKV NS+ GVTC
Sbjct  162   IKKRQDPSRRPKRELRAADKPFSGKMVSLMGRLTRTHQYWKKKIERHGGKVTNSIQGVTC  221

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSPAERERGGS K+ EA+ER IPVV EAWL+DSIEK+EVQPL+AYDV SD++V G+GI
Sbjct  222   LVVSPAERERGGSPKLVEAMERNIPVVSEAWLIDSIEKQEVQPLEAYDVVSDLSVAGKGI  281

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQD S EALE ++ ELK+YGKR V+KDT+L++ GGKILEKDGLLYNCA S+CD G+G
Sbjct  282   PWDKQDSSQEALELLSGELKMYGKRAVYKDTRLRERGGKILEKDGLLYNCAFSICDLGKG  341

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
              N++CIMQLI  PE+ L++Y+++G+VGD    +++LEEWE+ + AI+EFSR+FEE+TGNE
Sbjct  342   RNEYCIMQLITVPESNLNLYFKRGKVGDDPNAEERLEEWEDTEAAIREFSRLFEEVTGNE  401

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKKPHKF+P+D+ DG+EVRHG L LRQLG+AA H KLD  VANFMK++CS
Sbjct  402   FEPWEREKKIQKKPHKFFPIDMDDGVEVRHGALGLRQLGVAAAHCKLDSFVANFMKVICS  461

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALME+G D P++PIGM++D+HL+RCE+ LL F+E+ ++T E GQ+  ALWA+FS
Sbjct  462   QEIYKYALMELGLDPPDLPIGMVTDLHLKRCEEVLLEFIEKFKTTTETGQKATALWADFS  521

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             ++WF+L+  TRP  L DF ++A+H A+VFE+VRDIN ASR+I DM   TLDDPL DRY K
Sbjct  522   SRWFSLLHVTRPMILHDFHELAEHGAAVFETVRDINVASRVIGDMGADTLDDPLSDRYNK  581

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGC IS ++K+S+DYKMI+KYLE TY+PVRV D+ YGVSVENIF+VE  A PSLD++KKL
Sbjct  582   LGCKISVVDKESEDYKMIVKYLETTYEPVRVADVEYGVSVENIFSVESDAMPSLDEIKKL  641

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFGKAIVCSDAAAEAA+YGFTAVDR
Sbjct  642   PNKVLLWCGSRSSNLLRHVYKGFLPAVCSLPVPGYMFGKAIVCSDAAAEAARYGFTAVDR  701

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFL+LAVAS+GE+I E +SPPEDTKSLE+KK+G K  GRKKT+ES HFVW DDIKVPC
Sbjct  702   PEGFLILAVASLGEKITELTSPPEDTKSLEEKKMGVKGLGRKKTEESTHFVWGDDIKVPC  761

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEP  529
             GRL+  S+H +SP ++NEYAVYDP+Q SIRFLV VKY+E+  EY   EP
Sbjct  762   GRLV-PSEHKDSPLEFNEYAVYDPKQTSIRFLVGVKYEEKRAEYVDVEP  809



>gb|KCW50823.1| hypothetical protein EUGRSUZ_J00484 [Eucalyptus grandis]
Length=813

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/823 (64%), Positives = 671/823 (82%), Gaps = 17/823 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTK-KAKTTdggagdekka  2839
             MKVHETRS  H   D+++M+TRKQKAD  +LQ+ ++    SP K KA+  +G    +   
Sbjct  1     MKVHETRSQAHAPMDDDKMMTRKQKADQHKLQESEQ----SPKKPKAENNNGHPDRKPSD  56

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
             + +                CRAT EHLSV  M++IL+ N QDSSG+   +  +CQ+++FY
Sbjct  57    KVDAEFKE----------LCRATEEHLSVDLMQEILEANGQDSSGTPGVVTTKCQDLLFY  106

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             GP+DKCP+C G +E +S   Y CKG +SEW+SC++ST+ PPR+EEP+++P+SV  +P++D
Sbjct  107   GPLDKCPICNGTIEFTST-KYKCKGAYSEWASCTFSTKYPPRREEPIKLPDSVLNSPVAD  165

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             L+KK+QDP  RP  +  I  KPL GM+ISLSGRL+RTHQYWK++IE++GGK +NSVIGVT
Sbjct  166   LLKKYQDPTCRPRTDPGIVDKPLRGMVISLSGRLSRTHQYWKTEIERHGGKASNSVIGVT  225

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAERERGGS+KVAEAVERGIPVV E WL+DSIEK+E QPL AYDV SD+AV+GRG
Sbjct  226   CLVVSPAERERGGSAKVAEAVERGIPVVNEGWLLDSIEKQEAQPLSAYDVMSDLAVEGRG  285

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS EALE+I++ELK+YGK+ V+KDTKL++ GGKI E+DG+LYNCA S+CD G 
Sbjct  286   IPWDKQDPSEEALESISAELKLYGKQAVYKDTKLRERGGKIFERDGILYNCAFSLCDMGE  345

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             GLND+CIMQL+  P++ LH+YY++GRVGD    +++LE WEN D A+KEF ++FEE+TGN
Sbjct  346   GLNDYCIMQLVTVPDDNLHLYYKRGRVGDDPNAEEQLEAWENVDNAVKEFVKLFEEITGN  405

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   E EKK QKK  KF P+D+ +GI+ RHG L LRQLG+AAVH KL+P+VANFMK+LC
Sbjct  406   EFEPWETEKKFQKKLLKFCPVDMDNGIDARHGALGLRQLGVAAVHCKLEPLVANFMKVLC  465

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIYRYALMEMG D P++P+GMLS +HL+RCE+ LL FVE++++ KE GQ+ EA+W+++
Sbjct  466   SQEIYRYALMEMGLDSPDLPMGMLSKIHLQRCEEVLLEFVEKVKTMKETGQKAEAVWSDY  525

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S +WFTLM STRPF  RDF ++ADHAA+ FE+VRDI  AS LI DM+G+T+DDPL DRY 
Sbjct  526   SQRWFTLMHSTRPFIFRDFQEVADHAAAAFETVRDIIDASHLIGDMTGATVDDPLSDRYN  585

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             +L C +  LEK+S+DYKMI+ Y+EKTY+PV+VG++SYGVSVENI+AVE +A PS D++K+
Sbjct  586   ELNCKVLPLEKESNDYKMIVNYVEKTYEPVKVGEVSYGVSVENIYAVESTAAPSYDEIKE  645

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNL+RHL  GFLPAVCSLPVPGYMFGKAIVCSDAAAEAA+YGFTA+D
Sbjct  646   LPNKVLLWCGTRSSNLMRHLHKGFLPAVCSLPVPGYMFGKAIVCSDAAAEAARYGFTAID  705

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFL+LA+AS+G++++E   PPEDTKSLE+KK G K  GRKKTDESEHF+WKDDIKVP
Sbjct  706   RPEGFLILAIASLGDQVLEVKHPPEDTKSLEEKKAGVKGLGRKKTDESEHFIWKDDIKVP  765

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAV  550
             CGRLI  S+H +SP +YNEYAV+DP+Q SIRF+V VKY+E+ +
Sbjct  766   CGRLI-PSEHKDSPLEYNEYAVFDPKQTSIRFVVGVKYEEQGM  807



>ref|XP_007206433.1| hypothetical protein PRUPE_ppa001509mg [Prunus persica]
 gb|EMJ07632.1| hypothetical protein PRUPE_ppa001509mg [Prunus persica]
Length=811

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/820 (64%), Positives = 664/820 (81%), Gaps = 16/820 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             M+VHETRSH+H   +E++++TRKQKA++K  +    P      KK K+        +   
Sbjct  1     MRVHETRSHSHPNTEEDKVMTRKQKAENKAHEAEQSP------KKPKS--------EGDN  46

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                   +     AEFEK C A  ++LS +QMR+IL+ N QDSSGSD  ++ +CQ+++FYG
Sbjct  47    GHANGKSSEDIVAEFEKVCTAVKDNLSAEQMREILEANGQDSSGSDANVLRKCQDLLFYG  106

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+DKCP C G LE + G  Y C G +SEW+SC+YST++PPRK+EP+++P+S+  +P SDL
Sbjct  107   PLDKCPACNGNLEFT-GIRYSCTGSYSEWASCTYSTKDPPRKQEPIKLPDSILNSPASDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             IKK++DP  RP K   I  KP +GM++SL GRL+ +HQYW+ +IEK+GGKVAN VIGVTC
Sbjct  166   IKKYEDPSRRPRKVLSIPDKPFTGMLMSLMGRLSVSHQYWRKEIEKHGGKVANHVIGVTC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             L+ S  ERERGGSSK+AEA+ERGIPVV EAWL DSIEK+E QPL+AYD+ +D+A DGRGI
Sbjct  226   LIASSVERERGGSSKLAEAMERGIPVVSEAWLKDSIEKQEPQPLEAYDIVTDLAPDGRGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P +K DPS EALE++++ELK+YGKRGVHKDTKLQ+ GGKI EKDG+LYNCA S CD G+ 
Sbjct  286   PWEKMDPSEEALESLSAELKLYGKRGVHKDTKLQERGGKIFEKDGILYNCAFSRCDLGKK  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             LND+ +MQLI  PE+ L++YY+KG+VGD  + +++LEEWEN + A+KEF R+FEE+TGNE
Sbjct  346   LNDYSVMQLISVPESNLNLYYKKGKVGDDPKAEERLEEWENVEAAVKEFVRLFEEVTGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKKP KFYP+D+ DG++VRHGGL L QLG+AA H KL+P+VANFMK+LCS
Sbjct  406   FEPWEREKKIQKKPLKFYPIDMDDGLDVRHGGLGLHQLGVAATHCKLEPLVANFMKVLCS  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALMEMGYD PE+P+GMLSD HL+RCE+ L  FVE ++S K+ G + +A+W++FS
Sbjct  466   QEIYKYALMEMGYDPPELPMGMLSDAHLKRCEEVLQKFVETLKSMKDTGPKAKAVWSDFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTLM STRPF  +DF ++AD+AA+  E++RDI  AS LI DM GST+DDPL +RY K
Sbjct  526   QRWFTLMHSTRPFIFKDFQELADNAAAALETIRDITVASHLIGDMGGSTVDDPLSERYNK  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             +GCSIS L+K+SDD KMILKYLE TY+PV+VGD+ Y VSV+NIF VE SACPS+D++KKL
Sbjct  586   MGCSISPLDKESDDCKMILKYLETTYEPVKVGDVEYKVSVDNIFVVESSACPSVDEIKKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGT+SSNLLRHL  GFLPA+CSLPVPGYMFGKAIVCSDAAAEA +YGFTAVDR
Sbjct  646   PNKVLLWCGTQSSNLLRHLHRGFLPAICSLPVPGYMFGKAIVCSDAAAEATRYGFTAVDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+G+EI+E  SPPEDTKSLE+KK+G K  GRKKTDESEHFVW+DDIKVPC
Sbjct  706   PEGFLVLAVASLGDEIIEIKSPPEDTKSLEEKKVGVKGMGRKKTDESEHFVWQDDIKVPC  765

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
             GRL+  S + +S  +YNEYAVYDP+QVSIRFLV VKY+E+
Sbjct  766   GRLV-PSDNKDSILEYNEYAVYDPKQVSIRFLVGVKYEEK  804



>ref|NP_197639.2| poly [ADP-ribose] polymerase 3 [Arabidopsis thaliana]
 sp|Q9FK91.2|PARP3_ARATH RecName: Full=Poly [ADP-ribose] polymerase 3; Short=PARP-3; AltName: 
Full=NAD(+) ADP-ribosyltransferase 3; Short=ADPRT-3; 
AltName: Full=Poly[ADP-ribose] synthase 3 [Arabidopsis thaliana]
 gb|AED93031.1| poly [ADP-ribose] polymerase 3 [Arabidopsis thaliana]
Length=814

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/830 (64%), Positives = 670/830 (81%), Gaps = 16/830 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRSH H + DE++   RK KA+ K       P      KKAK          + +
Sbjct  1     MKVHETRSHAHMSGDEQKGNLRKHKAEGKL------PESEQSQKKAKP---------END  45

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
             +         AA+E+ +FC+A  E+LS+ Q++++L+ N QD S  +ET++ +CQ+++FYG
Sbjct  46    DGRSVNGAGDAASEYNEFCKAVEENLSIDQIKEVLEINGQDCSAPEETLLAQCQDLLFYG  105

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              + KCP+CGG L C +   + C G+ SEW SC +ST++PPRKEEP++IP+SV  + +SDL
Sbjct  106   ALAKCPLCGGTLICDNEKRFVCGGEISEWCSCVFSTKDPPRKEEPVKIPDSVMNSAISDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             IKKHQDPK+RP +E     KP  GMMISL GRLTRTHQYWK +IE+NGGKV+N+V GVTC
Sbjct  166   IKKHQDPKSRPKRELGSADKPFVGMMISLMGRLTRTHQYWKKKIERNGGKVSNTVQGVTC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSPAERERGG+SK+ EA+E+G+PVV EAWL+DS+EK E QPL+AYDV SD++V+G+GI
Sbjct  226   LVVSPAERERGGTSKMVEAMEQGLPVVSEAWLIDSVEKHEAQPLEAYDVVSDLSVEGKGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQDPS EA+E+ ++ELK+YGKRGV+ DTKLQ+ GGKI EKDGLLYNCA S+CD G+G
Sbjct  286   PWDKQDPSEEAIESFSAELKMYGKRGVYMDTKLQERGGKIFEKDGLLYNCAFSICDLGKG  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
              N++CIMQL+  P++ L+MY+++G+VGD    +++LEEWE+E+ AIKEF+R+FEE+ GNE
Sbjct  346   RNEYCIMQLVTVPDSNLNMYFKRGKVGDDPNAEERLEEWEDEEAAIKEFARLFEEIAGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKKPHKF+P+D+ DGIEVR G L LRQLGIA+ H KLD  VANF+K+LC 
Sbjct  406   FEPWEREKKIQKKPHKFFPIDMDDGIEVRSGALGLRQLGIASAHCKLDSFVANFIKVLCG  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY YALME+G D P++P+GML+D+HL+RCE+ LL FVE++++TKE GQ+ EA+WA+FS
Sbjct  466   QEIYNYALMELGLDPPDLPMGMLTDIHLKRCEEVLLEFVEKVKTTKETGQKAEAMWADFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             ++WF+LM STRP  L D  ++ADHAAS FE+VRDIN ASRLI DM G TLDDPL DRY K
Sbjct  526   SRWFSLMHSTRPMRLHDVNELADHAASAFETVRDINTASRLIGDMRGDTLDDPLSDRYKK  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGC IS ++K+S+DYKM++KYLE TY+PV+V D+ YGVSV+N+FAVE  A PSLDD+KKL
Sbjct  586   LGCKISVVDKESEDYKMVVKYLETTYEPVKVSDVEYGVSVQNVFAVESDAIPSLDDIKKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVDR
Sbjct  646   PNKVLLWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+GEE+ EF+SPPEDTK+LE KK+G K  GRKKT+ESEHF+W+DDIKVPC
Sbjct  706   PEGFLVLAVASLGEEVTEFTSPPEDTKTLEDKKIGVKGLGRKKTEESEHFMWRDDIKVPC  765

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             GRL+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  766   GRLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEPE  814



>ref|XP_008229450.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Prunus mume]
Length=811

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/820 (64%), Positives = 661/820 (81%), Gaps = 16/820 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             M+VHETRSH+H   +E++++TRKQKA++K  +    P      KK K+        +   
Sbjct  1     MRVHETRSHSHPNAEEDKVMTRKQKAENKAHEAEQSP------KKPKS--------EGDN  46

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                   +     AEFE  C A  ++LS +QMR+IL+ N QDSSGSD  ++ +CQ+++FYG
Sbjct  47    GHANGKSSEDIVAEFEVVCTAVKDNLSTEQMREILEANGQDSSGSDANVLRKCQDLLFYG  106

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+DKCP C G LE + G  Y C G +SEW+SC+YST++PPRK+EP+++P+S+  +P SDL
Sbjct  107   PLDKCPACNGNLEFT-GIRYSCTGSYSEWASCTYSTKDPPRKQEPIKLPDSILNSPASDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             IKK++DP  RP K   I  +P +GM++SL GRL+ +HQYW+ +IEK+GGKVAN VIG TC
Sbjct  166   IKKYEDPSRRPRKVLSIPDRPFTGMLMSLMGRLSASHQYWRKEIEKHGGKVANHVIGATC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             L+ SPAERERGGSSK+AEA+ERGIPVV EAWL D IEK+E QPL+AYD+ +DIA +G+GI
Sbjct  226   LIASPAERERGGSSKLAEAMERGIPVVSEAWLKDGIEKQEPQPLEAYDIVTDIAANGKGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DK DPS EALE++++ELK+YGKRGVHKDTKLQ+ GGKI EKDG+LYNCA S CD G+ 
Sbjct  286   PWDKMDPSEEALESLSAELKLYGKRGVHKDTKLQERGGKIFEKDGILYNCAFSRCDLGKK  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             LND+ +MQLI  PE+ L++YY+KG+VGD    +++LEEWEN + A+KEF R+FEE+TGNE
Sbjct  346   LNDYSVMQLISVPESNLNLYYKKGKVGDDPNAEERLEEWENVEAAVKEFVRLFEEVTGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKKP KFYP+D+ DG++VRHGGL L QLG+AA H KL+P+VANFMK++CS
Sbjct  406   FEPWEREKKIQKKPLKFYPIDMDDGVDVRHGGLGLHQLGVAATHCKLEPLVANFMKVVCS  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALMEMGYD PE+P+GMLSD HL+RCE+ L  FVE ++S K+ G + +A+W++FS
Sbjct  466   QEIYKYALMEMGYDPPELPMGMLSDAHLKRCEEVLQKFVETLKSMKDTGPKAKAVWSDFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTLM STRPF  +DF ++AD+AA+  E++RDI  AS LI DM GSTLDDPL +RY K
Sbjct  526   QRWFTLMHSTRPFIFKDFQELADNAAAALETIRDITVASHLIGDMGGSTLDDPLSERYNK  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             +GCSIS L+K+SDDYKMILKYLE TY+PV+VGD+ Y VSV+NIF VE SA PS+D++KKL
Sbjct  586   MGCSISPLDKESDDYKMILKYLETTYEPVKVGDVEYKVSVDNIFVVESSARPSVDEIKKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGT+SSNLLRHL  GFLPA+CSLPVPGYMFGKAI+CSDAAAEA +YGFTAVDR
Sbjct  646   PNKVLLWCGTQSSNLLRHLHRGFLPAICSLPVPGYMFGKAILCSDAAAEATRYGFTAVDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+G+EI E  SPPEDTKSLE+KK+G K  GRKKTDESEHFVW+DDIKVPC
Sbjct  706   PEGFLVLAVASLGDEITEIKSPPEDTKSLEEKKVGVKGLGRKKTDESEHFVWQDDIKVPC  765

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
             GRL+  S + +S  +YNEYA+Y+P+QVSIRFLV VKY+EE
Sbjct  766   GRLV-PSDNKDSILEYNEYAMYNPKQVSIRFLVGVKYEEE  804



>emb|CDY26932.1| BnaC09g36510D [Brassica napus]
Length=808

 Score =  1112 bits (2876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/831 (63%), Positives = 680/831 (82%), Gaps = 24/831 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVT-RKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHETRSH H ++DE++    RK KA+ K  +    P      KKAK+           
Sbjct  1     MKVHETRSHAHMSSDEQKKGNMRKHKAEGKLPEAEQSP------KKAKS-----------  43

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
                  K +      E+++FC+A  E+LSV Q++++L+ N QD S  +ET++ +CQ+++FY
Sbjct  44    ----EKDSVNGTGDEYKEFCKAVEENLSVDQIKEVLETNGQDCSAPEETLLAQCQDLLFY  99

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             G +DKCP+CGG L C +   + C G+ SEW SC +ST++PPRKEEP+++P+SV  + +SD
Sbjct  100   GALDKCPLCGGNLICDNEKRFVCGGEISEWCSCVFSTKSPPRKEEPIKLPDSVLNSAISD  159

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             LIKKHQDPK RP K ++ + KP +GMMISL GRLTRTHQYWK++IEK+GGKV+NSV GVT
Sbjct  160   LIKKHQDPKTRP-KRELSSDKPFAGMMISLMGRLTRTHQYWKNKIEKHGGKVSNSVKGVT  218

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAERERGGSSK+ EA+E+G+PVV EAWL+DSIEK+E QPL+AYDV SD++V+G+G
Sbjct  219   CLVVSPAERERGGSSKLVEAMEQGLPVVSEAWLIDSIEKQEAQPLEAYDVVSDLSVEGKG  278

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS EA+E++++ELK++GKRGV++DTKL++ GGKI EKDGLLYNCA S+CD G+
Sbjct  279   IPWDKQDPSEEAVESLSAELKMFGKRGVYRDTKLEESGGKIFEKDGLLYNCAFSLCDLGK  338

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             G N++CIMQL+  PE+ L+MY+++G+VGD    +++LEEWE+E+ AIKEF+R+FEE+TGN
Sbjct  339   GRNEYCIMQLVTVPESNLNMYFKRGKVGDDPNAEERLEEWEDEEEAIKEFARLFEEITGN  398

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKIQKKPHKF+P+D+ DGI+VR G L LRQLG+A+ H KLD  VANF+K++C
Sbjct  399   EFEPWEREKKIQKKPHKFFPIDMDDGIDVRSGALGLRQLGVASAHCKLDSFVANFLKVVC  458

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
              QEIY+YALME+G D P++P+GML+D+HL+RCE+ LL FVE++++TKE+GQ+ EA+WA+F
Sbjct  459   GQEIYKYALMELGLDPPDLPMGMLTDIHLKRCEEVLLEFVEKLKTTKESGQKAEAMWADF  518

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S++WF+LM STRP  L DF ++ADHAAS FE+VRDIN ASRL+ DM G TLDDPL DRY 
Sbjct  519   SSRWFSLMHSTRPMRLHDFNELADHAASAFETVRDINTASRLVGDMRGDTLDDPLSDRYN  578

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGC IS ++K+S+DYKMI+KYLE TY+PV+V D++Y  +V N+FAVE  A PSLDD+KK
Sbjct  579   KLGCKISVVDKESEDYKMIVKYLETTYEPVKVSDVAYSATVVNVFAVESKAIPSLDDIKK  638

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVD
Sbjct  639   LPNKVLLWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVD  698

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+GEE+ EF+SPPEDTK+LE+KK+G K  GRKKT+ESEHF+W+DDIKVP
Sbjct  699   RPEGFLVLAVASLGEEVKEFTSPPEDTKTLEEKKVGVKGLGRKKTEESEHFMWRDDIKVP  758

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             CG+L+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  759   CGKLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKETEIVDVEPE  808



>dbj|BAB09119.1| seed maturation protein PM38 protein [Arabidopsis thaliana]
Length=815

 Score =  1111 bits (2874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/831 (64%), Positives = 670/831 (81%), Gaps = 17/831 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVT-RKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHETRSH H + DE++    RK KA+ K       P      KKAK          + 
Sbjct  1     MKVHETRSHAHMSGDEQKKGNLRKHKAEGKL------PESEQSQKKAKP---------EN  45

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
             ++         AA+E+ +FC+A  E+LS+ Q++++L+ N QD S  +ET++ +CQ+++FY
Sbjct  46    DDGRSVNGAGDAASEYNEFCKAVEENLSIDQIKEVLEINGQDCSAPEETLLAQCQDLLFY  105

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             G + KCP+CGG L C +   + C G+ SEW SC +ST++PPRKEEP++IP+SV  + +SD
Sbjct  106   GALAKCPLCGGTLICDNEKRFVCGGEISEWCSCVFSTKDPPRKEEPVKIPDSVMNSAISD  165

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             LIKKHQDPK+RP +E     KP  GMMISL GRLTRTHQYWK +IE+NGGKV+N+V GVT
Sbjct  166   LIKKHQDPKSRPKRELGSADKPFVGMMISLMGRLTRTHQYWKKKIERNGGKVSNTVQGVT  225

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAERERGG+SK+ EA+E+G+PVV EAWL+DS+EK E QPL+AYDV SD++V+G+G
Sbjct  226   CLVVSPAERERGGTSKMVEAMEQGLPVVSEAWLIDSVEKHEAQPLEAYDVVSDLSVEGKG  285

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS EA+E+ ++ELK+YGKRGV+ DTKLQ+ GGKI EKDGLLYNCA S+CD G+
Sbjct  286   IPWDKQDPSEEAIESFSAELKMYGKRGVYMDTKLQERGGKIFEKDGLLYNCAFSICDLGK  345

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             G N++CIMQL+  P++ L+MY+++G+VGD    +++LEEWE+E+ AIKEF+R+FEE+ GN
Sbjct  346   GRNEYCIMQLVTVPDSNLNMYFKRGKVGDDPNAEERLEEWEDEEAAIKEFARLFEEIAGN  405

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKIQKKPHKF+P+D+ DGIEVR G L LRQLGIA+ H KLD  VANF+K+LC
Sbjct  406   EFEPWEREKKIQKKPHKFFPIDMDDGIEVRSGALGLRQLGIASAHCKLDSFVANFIKVLC  465

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
              QEIY YALME+G D P++P+GML+D+HL+RCE+ LL FVE++++TKE GQ+ EA+WA+F
Sbjct  466   GQEIYNYALMELGLDPPDLPMGMLTDIHLKRCEEVLLEFVEKVKTTKETGQKAEAMWADF  525

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S++WF+LM STRP  L D  ++ADHAAS FE+VRDIN ASRLI DM G TLDDPL DRY 
Sbjct  526   SSRWFSLMHSTRPMRLHDVNELADHAASAFETVRDINTASRLIGDMRGDTLDDPLSDRYK  585

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGC IS ++K+S+DYKM++KYLE TY+PV+V D+ YGVSV+N+FAVE  A PSLDD+KK
Sbjct  586   KLGCKISVVDKESEDYKMVVKYLETTYEPVKVSDVEYGVSVQNVFAVESDAIPSLDDIKK  645

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVD
Sbjct  646   LPNKVLLWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVD  705

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+GEE+ EF+SPPEDTK+LE KK+G K  GRKKT+ESEHF+W+DDIKVP
Sbjct  706   RPEGFLVLAVASLGEEVTEFTSPPEDTKTLEDKKIGVKGLGRKKTEESEHFMWRDDIKVP  765

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             CGRL+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  766   CGRLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEPE  815



>ref|XP_011004520.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Populus euphratica]
Length=796

 Score =  1110 bits (2872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/811 (65%), Positives = 653/811 (81%), Gaps = 16/811 (2%)
 Frame = -2

Query  2958  VTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkaeeedgkaadvaaaaefeKFC  2779
             +TRKQK    +  + ++    SP KKAK  +          E++              FC
Sbjct  1     MTRKQKVGQSKAHEGEQ----SPKKKAKNGEDQNDSTNGKSEDNIAKEYEE-------FC  49

Query  2778  RATSEHLSVQQMRQILQDNAQDSS-GSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGG  2602
             +A  EHLSV+QMR+IL  N +DSS  SD  +  +CQ+++F+GP+DKCP+C   LE   G 
Sbjct  50    KAIEEHLSVEQMREILDMNDEDSSSASDGVVTAKCQDVLFFGPLDKCPLCSSNLEFD-GK  108

Query  2601  TYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVIT  2422
                CKG +SEWS C++ TRNPPRKEEPL++P+SV  + +++L+KKHQDP  RP   Q   
Sbjct  109   RCSCKGFYSEWSGCTFKTRNPPRKEEPLKLPDSVLNSSVAELLKKHQDPSRRPC--QGAP  166

Query  2421  VKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERERGGSSKVAE  2242
             +KPL+G+++SLSGRL+RTHQYWK +IEK+GGKV++SV G+TCLVVSPAERERGGS+K+A+
Sbjct  167   IKPLAGIVVSLSGRLSRTHQYWKMEIEKHGGKVSSSVKGITCLVVSPAERERGGSTKLAD  226

Query  2241  AVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEALENITSE  2062
             A+E GIPVVRE WL+DSIEK+E QP++AYDV SD++V+G GIP DKQDPS EAL +I++E
Sbjct  227   ALEAGIPVVREDWLLDSIEKQEPQPMEAYDVVSDLSVEGNGIPWDKQDPSEEALVSISAE  286

Query  2061  LKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLH  1882
             LK+YGKRGV+KDT++Q+ GG+I EKDG+LYNCA S+CD GRGLN++CIMQLI  P++ LH
Sbjct  287   LKLYGKRGVYKDTRMQERGGQIFEKDGILYNCAFSLCDVGRGLNEYCIMQLITVPDSNLH  346

Query  1881  MYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFY  1702
              YY+KG+VGD A  +++LEEWEN + AIKEF R+F ELTGNEF   EREKK +KK   FY
Sbjct  347   SYYKKGKVGDDANAEERLEEWENVENAIKEFVRLFVELTGNEFEPWEREKKFEKKRLYFY  406

Query  1701  PLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEI  1522
             P+D+ DG++VRHGGL LRQLG+AA HS L+P +A FMKILCSQEIY+YA ME+G D P++
Sbjct  407   PIDMDDGMDVRHGGLGLRQLGVAAAHSSLEPKIAYFMKILCSQEIYKYATMEIGLDSPDL  466

Query  1521  PIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLRDF  1342
             P GMLSD+HLERCE+ LL F E ++S KE GQ+ EA+W+++S +W TL+ STRPF  RD+
Sbjct  467   PTGMLSDLHLERCEEVLLQFAEAVKSMKETGQKAEAVWSDYSQRWSTLLHSTRPFVFRDY  526

Query  1341  ADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMI  1162
              DIADH A+ FE+VRDIN ASRL+ DM GSTLDDPL DRY KLGCS+SALEKD DDYKMI
Sbjct  527   QDIADHGAAAFETVRDINVASRLVGDMFGSTLDDPLSDRYKKLGCSVSALEKDFDDYKMI  586

Query  1161  LKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGTRSSNLLRH  982
             +KYL+ TY+PVRVGD  YGVSVENIF+VEP+ACPSLD++KKLPNKVLLWCGTRSSN+LRH
Sbjct  587   VKYLDTTYEPVRVGDTDYGVSVENIFSVEPNACPSLDEIKKLPNKVLLWCGTRSSNMLRH  646

Query  981   LQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIME  802
             LQ GFLP+VCSLPVPGYMFGKAIVCSDAAAEAAKYGFT+V+RPEGFLVLAVAS+G++I+E
Sbjct  647   LQKGFLPSVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTSVERPEGFLVLAVASLGDQIIE  706

Query  801   FSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNE  622
               SPPEDTKSLE+KKLG K  G+KKTDESEHF+WKDDIKVPCGRLI  S+H +SP +YNE
Sbjct  707   VKSPPEDTKSLEEKKLGVKGLGKKKTDESEHFMWKDDIKVPCGRLI-PSEHRDSPLEYNE  765

Query  621   YAVYDPQQVSIRFLVAVKYDEEAVEYYTAEP  529
             YAVYDP+Q  IRFLV VKY+E   E  T EP
Sbjct  766   YAVYDPKQTRIRFLVEVKYEEMGAELDTTEP  796



>ref|XP_010520428.1| PREDICTED: poly [ADP-ribose] polymerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=809

 Score =  1110 bits (2872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/829 (63%), Positives = 664/829 (80%), Gaps = 21/829 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVH+TRSH H ++D+ +++ RK KA+ K  +    P      KKAK             
Sbjct  1     MKVHDTRSHAHMSSDD-KVMARKHKAEGKLPESDHSP------KKAKP------------  41

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
             E    A D AA +EF++FC A   +LSV+QM+Q+L+ N QDSSG+ + ++ RCQ+++FYG
Sbjct  42    ENGNGAGDSAAVSEFKEFCEAVKANLSVEQMKQVLESNGQDSSGTHDEVISRCQDLLFYG  101

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              ++KCPVCG  + C +   Y CK D SEW SC +ST++PPRKE+ ++IP+SV  + +SD+
Sbjct  102   ALEKCPVCGNDVYCDNK-RYFCKSDISEWCSCVFSTKSPPRKEDSIKIPDSVLNSAVSDM  160

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             IKK QDP  RP +E     KP SG M+SL GRLTRTHQYWK +IE++GGKV NS+ GVTC
Sbjct  161   IKKRQDPSRRPKRELRAADKPFSGKMVSLMGRLTRTHQYWKKKIERHGGKVTNSIQGVTC  220

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSPAERERGGS K+ EA+ER IPVV EAWL+DSIEK+EVQPL+AYDV SD++V G+GI
Sbjct  221   LVVSPAERERGGSPKLVEAMERNIPVVSEAWLIDSIEKQEVQPLEAYDVVSDLSVAGKGI  280

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQD S EALE ++ ELK+YGKR V+KDT+L++ GGKILEKDGLLYNCA S+CD G+G
Sbjct  281   PWDKQDSSQEALELLSGELKMYGKRAVYKDTRLRERGGKILEKDGLLYNCAFSICDLGKG  340

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
              N++CIMQLI  PE+ L++Y+++G+VGD    +++LEEWE+ + AI+EFSR+FEE+TGNE
Sbjct  341   RNEYCIMQLITVPESNLNLYFKRGKVGDDPNAEERLEEWEDTEAAIREFSRLFEEVTGNE  400

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKKPHKF+P+D+ DG+EVRHG L LRQLG+AA H KLD  VANFMK++CS
Sbjct  401   FEPWEREKKIQKKPHKFFPIDMDDGVEVRHGALGLRQLGVAAAHCKLDSFVANFMKVICS  460

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALME+G D P++PIGM++D+HL+RCE+ LL F+E+ ++T E GQ+  ALWA+FS
Sbjct  461   QEIYKYALMELGLDPPDLPIGMVTDLHLKRCEEVLLEFIEKFKTTTETGQKATALWADFS  520

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             ++WF+L+  TRP  L DF ++A+H A+VFE+VRDIN ASR+I DM   TLDDPL DRY K
Sbjct  521   SRWFSLLHVTRPMILHDFHELAEHGAAVFETVRDINVASRVIGDMGADTLDDPLSDRYNK  580

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGC IS ++K+S+DYKMI+KYLE TY+PVRV D+ YGVSVENIF+VE  A PSLD++KKL
Sbjct  581   LGCKISVVDKESEDYKMIVKYLETTYEPVRVADVEYGVSVENIFSVESDAMPSLDEIKKL  640

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFGKAIVCSDAAAEAA+YGFTAVDR
Sbjct  641   PNKVLLWCGSRSSNLLRHVYKGFLPAVCSLPVPGYMFGKAIVCSDAAAEAARYGFTAVDR  700

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFL+LAVAS+GE+I E +SPPEDTKSLE+KK+G K  GRKKT+ES HFVW DDIKVPC
Sbjct  701   PEGFLILAVASLGEKITELTSPPEDTKSLEEKKMGVKGLGRKKTEESTHFVWGDDIKVPC  760

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEP  529
             GRL+  S+H +SP ++NEYAVYDP+Q SIRFLV VKY+E+  EY   EP
Sbjct  761   GRLV-PSEHKDSPLEFNEYAVYDPKQTSIRFLVGVKYEEKRAEYVDVEP  808



>ref|XP_010493334.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Camelina sativa]
Length=815

 Score =  1109 bits (2869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/831 (63%), Positives = 672/831 (81%), Gaps = 17/831 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVT-RKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHETRSH H + DE++    RK KA+ K       P      KKAK+         + 
Sbjct  1     MKVHETRSHAHMSGDEQKKGNLRKHKAEGKV------PEGEQSQKKAKS---------EN  45

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
             +           A+E+++FC+A  E+LSV Q++++L+ N QD S  +ET++ +CQ+++FY
Sbjct  46    DNGRSVNGAGDVASEYDEFCKAVEENLSVDQIKEVLEINGQDCSAPEETLLAQCQDLLFY  105

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             G + KCP+CGG+L C     + C G+ SEW SC +ST+NPPRKE+P++ P+SV  + +SD
Sbjct  106   GALAKCPLCGGSLICDKEKRFICGGEISEWCSCVFSTKNPPRKEDPVKTPDSVMNSAISD  165

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             LIKKHQDPK+RP +E     KP +GMMISL GRLTRTHQYWK +IE+NGGKV+N+V GVT
Sbjct  166   LIKKHQDPKSRPKRELGSADKPFAGMMISLMGRLTRTHQYWKKKIERNGGKVSNTVQGVT  225

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAERERGG+SK+ EA+E+ +PVV EAWL+DS+EK E QPL+AYDV SD++V+G+G
Sbjct  226   CLVVSPAERERGGTSKMVEAMEQDLPVVSEAWLIDSVEKHEAQPLEAYDVVSDLSVEGKG  285

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS EA+E++++ELK+YGKRGV+ DTKL++ GGKI EKDGLLYNCA S+CD G+
Sbjct  286   IPWDKQDPSEEAIESLSAELKMYGKRGVYMDTKLEERGGKIFEKDGLLYNCAFSICDLGK  345

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             G N++CIMQ+I  PE+ L+MY+++G+VGD    +++LEEWE+E+ AIKEF+R+FEE+TGN
Sbjct  346   GRNEYCIMQMITVPESNLNMYFKRGKVGDDPNAEERLEEWEDEEAAIKEFARLFEEITGN  405

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKIQKKPHKF+P+D+ DGIEVR G L LRQLG+A+ H KLD  VANF+K+LC
Sbjct  406   EFEPWEREKKIQKKPHKFFPIDMDDGIEVRSGALGLRQLGVASAHCKLDSFVANFIKVLC  465

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
              QEIY+YALME+G D P++P+GML+D+HL+RCE+ LL FVER+++TKE GQ+ EA+WA+F
Sbjct  466   GQEIYKYALMELGLDPPDLPMGMLTDIHLKRCEEVLLEFVERVKTTKETGQKAEAMWADF  525

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S++WF+LM +TRP  L D  ++ADHAAS FE+VRDIN ASRLI DM G TLDDPL DRY 
Sbjct  526   SSRWFSLMHTTRPMRLHDVHELADHAASAFETVRDINTASRLIGDMRGDTLDDPLSDRYN  585

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGC IS ++K+S+DYKMI+KYLE TY+PV+V D+ YG SV+N+FAVE  A PSLDD+KK
Sbjct  586   KLGCKISVVDKESEDYKMIVKYLETTYEPVKVSDVEYGASVQNVFAVESDAIPSLDDIKK  645

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVD
Sbjct  646   LPNKVLLWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVD  705

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+GEE+ EF++PPEDTK+LE+KK+G K  GRKKT+ESEHF+W+DDIKVP
Sbjct  706   RPEGFLVLAVASLGEEVTEFTNPPEDTKTLEEKKVGVKGLGRKKTEESEHFMWRDDIKVP  765

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             CGRL+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  766   CGRLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKETEIIDVEPE  815



>ref|XP_010421038.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Camelina sativa]
Length=815

 Score =  1109 bits (2869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/831 (63%), Positives = 672/831 (81%), Gaps = 17/831 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVT-RKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHETRSH H + D+++    RK KA+ K       P      KKAK          ++
Sbjct  1     MKVHETRSHAHMSGDDQKKGNLRKHKAEGKL------PEGEQSQKKAKP---------ES  45

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
             +           A+E+ +FC+A  E+LS  Q++++L+ N QD S  +ET++ +CQ+++FY
Sbjct  46    DNGRSVNGAGDVASEYNEFCKAVEENLSADQIKEVLESNGQDCSAPEETLLAQCQDLLFY  105

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             G + KCP+CGG+L C     + C G+ SEW SC +ST+NPPRKEEP++IP+SV  + +SD
Sbjct  106   GALGKCPLCGGSLICDKEKRFICGGEISEWCSCVFSTKNPPRKEEPVKIPDSVMNSAISD  165

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             LIKKHQDPK+RP +E     KP +GMMISL GRLTRTHQYWK +IE+NGGKV+N+V GVT
Sbjct  166   LIKKHQDPKSRPKRELGSADKPFAGMMISLMGRLTRTHQYWKKKIERNGGKVSNTVQGVT  225

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAERERGG+SK+ EA+E+G+PVV EAWL+DS+EK E QPL+AYDV SD++V+G+G
Sbjct  226   CLVVSPAERERGGTSKMVEAMEQGLPVVSEAWLIDSVEKHEAQPLEAYDVVSDLSVEGKG  285

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS EA+E++++ELK+YGKRGV+ DTKL++ GGKI EKDGLLYNCA S+CD G+
Sbjct  286   IPWDKQDPSEEAIESLSAELKMYGKRGVYMDTKLEERGGKIFEKDGLLYNCAFSICDLGK  345

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             G N++CIMQ+I  PE+ L+MY+++G+VGD    +++LEEWE+E+ AIK+F+R+FEE+TGN
Sbjct  346   GRNEYCIMQMITVPESNLNMYFKRGKVGDDPNAEERLEEWEDEEAAIKDFARLFEEITGN  405

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKIQKKPHKF+P+D+ DGIEVR G L LRQLG+A+ H KLD  VANF+K+LC
Sbjct  406   EFEPWEREKKIQKKPHKFFPIDMDDGIEVRSGALGLRQLGVASAHCKLDSFVANFIKVLC  465

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
              QEIY+YALME+G D P++P+GML+++HL+RCE+ LL FVE++++TKE GQ+ EA+WA+F
Sbjct  466   GQEIYKYALMELGLDPPDLPMGMLTEIHLKRCEEVLLEFVEKVKTTKETGQKAEAMWADF  525

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S++WF+LM +TRP  L D  ++ADHAAS FE+VRDIN ASRLI DM G TLDDPL DRY 
Sbjct  526   SSRWFSLMHTTRPMRLHDVHELADHAASAFETVRDINTASRLIGDMRGDTLDDPLSDRYN  585

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGC IS ++K+S+DYKMI+KYLE TY+PV+V D+ YG SV+NIFAVE +A PSLDD+KK
Sbjct  586   KLGCKISVVDKESEDYKMIVKYLETTYEPVKVSDVEYGASVQNIFAVESAAIPSLDDVKK  645

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVD
Sbjct  646   LPNKVLLWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVD  705

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+GEE+ EF++PPEDTK+LE+KK G K  GRKKT+ESEHF+W+DDIKVP
Sbjct  706   RPEGFLVLAVASLGEEVTEFTNPPEDTKTLEEKKNGVKGLGRKKTEESEHFMWRDDIKVP  765

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             CGRL+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  766   CGRLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIIDVEPE  815



>ref|XP_010454512.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Camelina sativa]
Length=815

 Score =  1107 bits (2864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/831 (63%), Positives = 671/831 (81%), Gaps = 17/831 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVT-RKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHETRSH H + DE++    RK KA+ K       P      KKAK+         + 
Sbjct  1     MKVHETRSHAHMSGDEQKKGNLRKHKAEGKL------PEVEQSQKKAKS---------EN  45

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
             +           A+E+ +FC+A  E+LSV Q++++L+ N Q+ S  +ET++ +CQ+++FY
Sbjct  46    DNGRSVNGGGDVASEYNEFCKAVEENLSVDQIKEVLEINGQECSAPEETLLAQCQDLLFY  105

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             G + KCP+CGG+L C     + C G+ SEW SC +ST+NPPRKE+P++IP+SV  + +SD
Sbjct  106   GALAKCPLCGGSLICDKEKRFICGGEISEWCSCVFSTKNPPRKEDPVKIPDSVMNSAISD  165

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             LIKKHQDPK+RP +E     KP +GMMISL GRLTRTHQYWK +IE+NGGKV+N+V G T
Sbjct  166   LIKKHQDPKSRPKRELGSADKPFAGMMISLMGRLTRTHQYWKKKIERNGGKVSNTVHGAT  225

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAERERGG+SK+ EA+E+G+PVV EAWL+DS+EK E QPL+AYDV SD++V+G+G
Sbjct  226   CLVVSPAERERGGTSKMVEAMEQGLPVVSEAWLIDSVEKHEAQPLEAYDVVSDLSVEGKG  285

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS EA+E++++ELK+YGKRGV+ DTKL++ GGKI EKDGLLYNCA S+CD G+
Sbjct  286   IPWDKQDPSEEAIESLSAELKMYGKRGVYMDTKLEERGGKIFEKDGLLYNCAFSICDLGK  345

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             G N++CIMQ+I  PE+ L+MY+++G+VGD    +++LEEWE+E+ AIKEF+R+FEE+TGN
Sbjct  346   GRNEYCIMQMITVPESNLNMYFKRGKVGDDPNAEERLEEWEDEEAAIKEFARLFEEITGN  405

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKI+KKPHKF+P+D+ DGIEVR G L LRQLG+A+ H KLD  VANF+K+LC
Sbjct  406   EFEPWEREKKIEKKPHKFFPVDMDDGIEVRSGALGLRQLGVASAHCKLDSFVANFIKVLC  465

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
              QEIY+YALME+G D P++P+GML+D+HL+RCE+ LL FVE++++TKE GQ+ EA+WA+F
Sbjct  466   GQEIYKYALMELGLDPPDLPMGMLTDIHLKRCEEVLLEFVEKLKTTKETGQKAEAMWADF  525

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S++WF+LM +TRP  L D  ++ADHAAS FE+VRDIN ASRLI DM G TLDDPL DRY 
Sbjct  526   SSRWFSLMHTTRPVRLHDVHELADHAASAFETVRDINTASRLIGDMRGDTLDDPLSDRYN  585

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGC IS L+K+S+DYKMI+KYLE TY+PV+V D+ YG SV+N+FAVE  A PSLDD+KK
Sbjct  586   KLGCKISVLDKESEDYKMIVKYLETTYEPVKVSDVEYGASVQNVFAVESDAMPSLDDIKK  645

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVD
Sbjct  646   LPNKVLLWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVD  705

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+GEE+ EF++PPEDTK+LE+KK G K  GRKKT+ESEHF+W+DDIKVP
Sbjct  706   RPEGFLVLAVASLGEEVTEFTNPPEDTKTLEEKKNGVKGLGRKKTEESEHFMWRDDIKVP  765

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             CGRL+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  766   CGRLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIIDVEPE  815



>ref|XP_008378254.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Malus domestica]
Length=813

 Score =  1102 bits (2851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/833 (63%), Positives = 659/833 (79%), Gaps = 21/833 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRSH+H   +E+++ TRKQKA++K  +    P      KKAK+            
Sbjct  1     MKVHETRSHSHGNAEEDKVTTRKQKAENKAHEAEQSP------KKAKS----------EG  44

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
             +     +     AE+EK C A  ++LS +QMR+IL+ N QDSSGSD TI+ +CQ+++FYG
Sbjct  45    DNANGKSAENVVAEYEKLCTAVKDNLSTEQMREILEANGQDSSGSDSTILRKCQDLLFYG  104

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+DKCP C G LE      Y C G +SEW++C+++T+NPPRK+EP+++P+SV  +P SDL
Sbjct  105   PLDKCPACNGDLEFRVI-RYFCTGSYSEWATCTFNTKNPPRKQEPIKLPDSVLNSPASDL  163

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +K ++DP  RP K+  I VKP +G++ISL GRL+ +HQYW+ +IEK+GGK+AN VIG TC
Sbjct  164   LKNYEDPSRRPHKDLSIPVKPFTGILISLMGRLSASHQYWRKEIEKHGGKLANHVIGATC  223

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             L+ SPAER+RGG+ K+AEA+ERGIPVV EAWL DSIEK+E QPL+AYD+ SD+A DGRG+
Sbjct  224   LIASPAERDRGGTGKLAEAMERGIPVVSEAWLKDSIEKQEPQPLEAYDIVSDLAPDGRGV  283

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DK DPS EALE++ +ELK+YGKR VHKD+KL++  GKI E+D +LYNCA S CD GR 
Sbjct  284   PWDKMDPSEEALESLLTELKMYGKRSVHKDSKLRERDGKIFERDSILYNCAFSRCDLGRK  343

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             LND+ IMQLI  PE+ LH+YY+KG+VGD    +++LEEW+N D A+KEF R+FEE TGNE
Sbjct  344   LNDYSIMQLITVPESNLHLYYKKGKVGDDPNAEERLEEWDNVDNAVKEFVRLFEEATGNE  403

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKKP KFYP+D+ DG++VRHGG  LRQLG+AA H KL+PMVANFM +LCS
Sbjct  404   FEPWEREKKIQKKPLKFYPIDMDDGVDVRHGGXGLRQLGVAATHCKLEPMVANFMMVLCS  463

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALMEMGYD PE+P+GMLS VHL+ CE+ L  FVE ++S K+AG + EA+W++FS
Sbjct  464   QEIYKYALMEMGYDAPELPMGMLSVVHLKLCEEVLQKFVETLKSMKDAGPKAEAVWSDFS  523

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTLM STRPF  +D+ ++AD+AA+  E++RDI  AS LI DM  STLDDPL +RY K
Sbjct  524   QRWFTLMHSTRPFIFKDYQELADNAAAALETIRDITMASHLIGDMGESTLDDPLSERYNK  583

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCSIS L+K+SDDYKMILKYLEKTY+PV+VGD+ YGVSV+NIF +E SAC SLD++KKL
Sbjct  584   LGCSISPLDKESDDYKMILKYLEKTYEPVKVGDVEYGVSVDNIFLIESSACQSLDEIKKL  643

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSN+LRHL  GFLPA+CSLPVPGYMFG+AIVC DAAAEAA+YGFTAVDR
Sbjct  644   PNKVLLWCGTRSSNMLRHLHKGFLPAICSLPVPGYMFGRAIVCXDAAAEAARYGFTAVDR  703

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS G++I E  + PEDTKSLE+KK+G K  GRKKTDESEHFVW+DDIKVPC
Sbjct  704   PEGFLVLAVASQGDKITEVKTAPEDTKSLEEKKVGVKGLGRKKTDESEHFVWQDDIKVPC  763

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDEPE  517
             GRL+  S   +S  +YNEYA+YDP QVS+RFLVAVKY+E+       EP +PE
Sbjct  764   GRLV-PSDDKDSVLEYNEYAIYDPTQVSVRFLVAVKYEEKES---VMEPMKPE  812



>ref|XP_009120655.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Brassica rapa]
Length=809

 Score =  1102 bits (2850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/832 (63%), Positives = 677/832 (81%), Gaps = 25/832 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVT-RKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHETRSH H + DE++    RK KA+ K  +    P      KKAK+           
Sbjct  1     MKVHETRSHAHMSGDEQKKGNLRKHKAEGKLPEAEQSP------KKAKS-----------  43

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
                  K +      E+++FC+A  E+LSV Q++++L+ N QD S  +ET++ +CQ+++FY
Sbjct  44    ----EKDSVNGTGDEYKEFCKAVEENLSVDQIKEVLETNGQDCSAPEETLLAQCQDLLFY  99

Query  2658  GPVDKCPVCGGALEC-SSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLS  2482
             G +DKCP+CGG L C +    + C G+ SEW SC +ST++PPRKEEP+++P+SV  + +S
Sbjct  100   GALDKCPLCGGNLICDNEKKRFVCGGEISEWCSCVFSTKSPPRKEEPIKLPDSVMNSAIS  159

Query  2481  DLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGV  2302
             DL+KKHQDPK RP K ++ + KP +GMMISL GRLTRTHQYWK++IEK+GGKV+NSV GV
Sbjct  160   DLLKKHQDPKTRP-KRELSSDKPFTGMMISLMGRLTRTHQYWKNKIEKHGGKVSNSVKGV  218

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
             TCLVVSPAERERGGSSK+ EA+E+G+PVV EAWL+DSIEK+E QPL+AYDV SD++V+G+
Sbjct  219   TCLVVSPAERERGGSSKLVEAMEQGLPVVSEAWLIDSIEKQEAQPLEAYDVVSDLSVEGK  278

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             GIP DKQDPS EA+E++++ELK++GKRGV+KDTKL++ GGKI EKDGLLYNCA S+CD G
Sbjct  279   GIPWDKQDPSEEAIESLSAELKMFGKRGVYKDTKLEESGGKIFEKDGLLYNCAFSLCDLG  338

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
             +G N++CIMQL+  PE+ L+MY+++G+VGD    +++LEEWE+E+ AIKEF+R+FEE+TG
Sbjct  339   KGRNEYCIMQLVTVPESNLNMYFKRGKVGDDPNAEERLEEWEDEEEAIKEFARLFEEITG  398

Query  1761  NEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKIL  1582
             NEF   EREKKIQKKPHKF+P+D+ DGI+VR G L LRQLG+A+ H KL+  VANF+K+L
Sbjct  399   NEFEPWEREKKIQKKPHKFFPIDMDDGIDVRSGALGLRQLGVASAHCKLESFVANFLKVL  458

Query  1581  CSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAE  1402
             C QEIY+YALME+G D P++P+GML+D+HL+RCE+ LL FVE++++TKE GQ+ EA+WA+
Sbjct  459   CGQEIYKYALMELGLDPPDLPMGMLTDIHLKRCEEVLLEFVEKLKTTKETGQKAEAIWAD  518

Query  1401  FSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRY  1222
             FS++WF+LM STRP  L DF ++ADHAAS FE+VRDIN AS L+ DM G TLDDPL DRY
Sbjct  519   FSSRWFSLMHSTRPMRLHDFNELADHAASAFETVRDINTASHLVGDMRGDTLDDPLSDRY  578

Query  1221  VKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK  1042
              KLGC IS ++K+S+DYKMI+KYLE TY+PV+V D++Y  +V N+FAVE  A PSLD++K
Sbjct  579   NKLGCKISVVDKESEDYKMIVKYLETTYEPVKVSDVAYTATVVNVFAVESKAIPSLDEIK  638

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KLPNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAV
Sbjct  639   KLPNKVLLWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAV  698

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
             DRPEGFLVLAVAS+GE++ EF+SPPEDTK+LE+KK+G K  GRKKT+ESEHF+W+DDIKV
Sbjct  699   DRPEGFLVLAVASLGEDVKEFTSPPEDTKTLEEKKVGVKGLGRKKTEESEHFMWRDDIKV  758

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             PCG+L+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  759   PCGKLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEPE  809



>emb|CDX92348.1| BnaA10g13870D [Brassica napus]
Length=809

 Score =  1101 bits (2848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/832 (63%), Positives = 676/832 (81%), Gaps = 25/832 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVT-RKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHETRSH H + DE++    RK KA+ K  +    P      KKAK+           
Sbjct  1     MKVHETRSHAHMSGDEQKKGNLRKHKAEGKLPEAEQSP------KKAKS-----------  43

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
                  K +      E+++FC+A  E+LSV Q++++L+ N QD S  +ET++ +CQ+++FY
Sbjct  44    ----EKDSVNGTGDEYKEFCKAVEENLSVDQIKEVLETNGQDCSAPEETLLAQCQDLLFY  99

Query  2658  GPVDKCPVCGGALEC-SSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLS  2482
             G +DKCP+CGG L C +    + C G+ SEW SC +ST++PPRKEEP+++P+SV  + +S
Sbjct  100   GALDKCPLCGGNLICDNEKKRFVCGGEISEWCSCVFSTKSPPRKEEPIKLPDSVMNSAIS  159

Query  2481  DLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGV  2302
             DL+KKHQDPK RP K ++ + KP +GMMISL GRLTRTHQYWK++IEK+GGKV+NSV GV
Sbjct  160   DLLKKHQDPKTRP-KRELSSDKPFTGMMISLMGRLTRTHQYWKNKIEKHGGKVSNSVKGV  218

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
             TCLVVSPAERERGGSSK+ EA+E+G+PVV EAWL+DSIEK+E QPL++YDV SD++V+G+
Sbjct  219   TCLVVSPAERERGGSSKLVEAMEQGLPVVSEAWLIDSIEKQEAQPLESYDVVSDLSVEGK  278

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             GIP DKQDPS EA+E++++ELK++GKRGV+KDTKL++ GGKI EKDGLLYNCA S+CD G
Sbjct  279   GIPWDKQDPSEEAIESLSAELKMFGKRGVYKDTKLEESGGKIFEKDGLLYNCAFSLCDLG  338

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
             +G N++CIMQL+   E+ L+MY+++G+VGD    +++LEEWE+E  AIKEF+R+FEE+TG
Sbjct  339   KGRNEYCIMQLVTVSESNLNMYFKRGKVGDDPNAEERLEEWEDEGEAIKEFARLFEEITG  398

Query  1761  NEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKIL  1582
             NEF   EREKKIQKKPHKF+P+D+ DG++VR G L LRQLG+A+ H KL+  VANF+K+L
Sbjct  399   NEFEPWEREKKIQKKPHKFFPIDMDDGLDVRSGALGLRQLGVASAHCKLESFVANFLKVL  458

Query  1581  CSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAE  1402
             C QEIY+YALME+G D P++P+GML+D+HL+RCE+ LL FVE++++TKE GQ+ EA+WA+
Sbjct  459   CGQEIYKYALMELGLDPPDLPMGMLTDIHLKRCEEVLLEFVEKLKTTKETGQKAEAMWAD  518

Query  1401  FSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRY  1222
             FS++WF+LM STRP  L DF ++ADHAAS FE+VRDIN ASRL+ DM G TLDDPL DRY
Sbjct  519   FSSRWFSLMHSTRPMRLHDFNELADHAASAFETVRDINTASRLVGDMRGDTLDDPLSDRY  578

Query  1221  VKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK  1042
              KLGC IS ++K+S+DYKMI+KYLE TY+PV+V D++Y  +V N+FAVE  A PSLDD+K
Sbjct  579   NKLGCKISVVDKESEDYKMIVKYLETTYEPVKVSDVAYSATVVNVFAVESKAIPSLDDIK  638

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KLPNKVLLWCG+RSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAV
Sbjct  639   KLPNKVLLWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAV  698

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
             DRPEGFLVLAVAS+GE++ EF+SPPEDTK+LE+KK+G K  GRKKT+ESEHF+W+DDIKV
Sbjct  699   DRPEGFLVLAVASLGEDVKEFTSPPEDTKTLEEKKVGVKGLGRKKTEESEHFMWRDDIKV  758

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             PCG+L+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  759   PCGKLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEPE  809



>ref|XP_004291612.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Fragaria vesca 
subsp. vesca]
Length=813

 Score =  1100 bits (2846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/821 (64%), Positives = 664/821 (81%), Gaps = 19/821 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMV-TRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHETRSH+H   DEE+ V TRKQKA++K  +         P KK K            
Sbjct  1     MKVHETRSHSHSNPDEEKKVMTRKQKAENKAHEG------GHPPKKPKA----------E  44

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
             ++ +G A    + AEFE+   A  EHLS +QMR+IL+ N QDSSG D  ++ +CQ+++FY
Sbjct  45    DDYNGHANGKPSPAEFEELYSAVKEHLSTEQMREILEFNDQDSSGPDAAVLRKCQDLLFY  104

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             GP+DKC +C G LE + G  Y C G +SEW+SC+ +TR+PPRK+EP  +PESV+K+P SD
Sbjct  105   GPLDKCRICNGKLEFN-GIRYSCTGTYSEWASCTLNTRDPPRKQEPTNLPESVEKSPASD  163

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             L+KK+QDP  RP ++     KP +GM+ISL GRLTR+HQYW+ +++K+GGKVAN VIGVT
Sbjct  164   LLKKYQDPSRRPKRDLSTPDKPFTGMLISLMGRLTRSHQYWRQEVDKHGGKVANHVIGVT  223

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CL+ SPAERERGG++K+AEA+ERGIPVV E WL+DSIEK+E QPL+AYD+ +D+A DG+G
Sbjct  224   CLIASPAERERGGTNKLAEAMERGIPVVSEKWLIDSIEKQEPQPLEAYDIVTDLAPDGKG  283

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             +P +K DPS EA+E++++ELK+YGKR V+KDTKLQ++GGKI E+D +LYN A+S CD GR
Sbjct  284   VPWEKMDPSEEAIESLSAELKLYGKRAVYKDTKLQEKGGKIFERDEILYNSAVSRCDLGR  343

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
              LND+CI+QLI+ PEN L++YY+KGRVGD    +++LEEW++ D A+KEF RIFEE+TGN
Sbjct  344   KLNDYCILQLIMVPENSLNLYYKKGRVGDDPNAEERLEEWKDVDDAVKEFVRIFEEVTGN  403

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKKIQKKP KF+P D+ DG+EVRHGGL LRQLG++A H KL P VANFMK+LC
Sbjct  404   EFEPWEREKKIQKKPLKFFPTDMDDGVEVRHGGLGLRQLGVSATHCKLQPEVANFMKVLC  463

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIY+YALMEMG D P++P+GML+DVHL+RCED L  FVE+++S KE+G + EA+W++F
Sbjct  464   SQEIYKYALMEMGLDAPDLPMGMLTDVHLKRCEDVLQEFVEKLKSVKESGPESEAIWSDF  523

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S +WFTL+ STRPF  R+F ++ADHAA+  E+VRDI AAS LI DMSG+T+DDPL DRY 
Sbjct  524   SQRWFTLLHSTRPFIFRNFQELADHAAAALETVRDITAASHLIGDMSGATIDDPLSDRYS  583

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KL CSIS L+K+SDDYKMILKYL+KTY+PV+VGD  YG+SVENIF VE +ACPSLD++KK
Sbjct  584   KLRCSISPLDKESDDYKMILKYLDKTYEPVKVGDTEYGLSVENIFVVESNACPSLDEIKK  643

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNK LLWCGTRSSNL+RHL  GFLP++CSLPVPGYM GKAIVCSDAAAEAA+YG+TAVD
Sbjct  644   LPNKFLLWCGTRSSNLMRHLHKGFLPSICSLPVPGYMAGKAIVCSDAAAEAARYGYTAVD  703

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+GE+I+E  SPPEDTKSLE KK G K  G+KKTDESEHFVW+DDIKVP
Sbjct  704   RPEGFLVLAVASLGEDIIELKSPPEDTKSLEDKKAGVKGIGKKKTDESEHFVWQDDIKVP  763

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
             CG+L+  S + +S  +YNEYAVYDP+Q  IRFLV VKY+E+
Sbjct  764   CGQLV-PSDNKDSILEYNEYAVYDPKQTCIRFLVGVKYEEK  803



>ref|XP_010031503.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Eucalyptus grandis]
Length=800

 Score =  1098 bits (2841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/809 (64%), Positives = 662/809 (82%), Gaps = 17/809 (2%)
 Frame = -2

Query  2973  DEERMVTRKQKADSKQLQDHDEPLHNSPTK-KAKTTdggagdekkaeeedgkaadvaaaa  2797
             D+++M+TRKQKAD  +LQ+ ++    SP K KA+  +G    +   + +           
Sbjct  2     DDDKMMTRKQKADQHKLQESEQ----SPKKPKAENNNGHPDRKPSDKVDAEFKE------  51

Query  2796  efeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALE  2617
                  CRAT EHLSV  M++IL+ N QDSSG+   +  +CQ+++FYGP+DKCP+C G +E
Sbjct  52    ----LCRATEEHLSVDLMQEILEANGQDSSGTPGVVTTKCQDLLFYGPLDKCPICNGTIE  107

Query  2616  CSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK  2437
              +S   Y CKG +SEW+SC++ST+ PPR+EEP+++P+SV  +P++DL+KK+QDP  RP  
Sbjct  108   FTST-KYKCKGAYSEWASCTFSTKYPPRREEPIKLPDSVLNSPVADLLKKYQDPTCRPRT  166

Query  2436  EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERERGGS  2257
             +  I  KPL GM+ISLSGRL+RTHQYWK++IE++GGK +NSVIGVTCLVVSPAERERGGS
Sbjct  167   DPGIVDKPLRGMVISLSGRLSRTHQYWKTEIERHGGKASNSVIGVTCLVVSPAERERGGS  226

Query  2256  SKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEALE  2077
             +KVAEAVERGIPVV E WL+DSIEK+E QPL AYDV SD+AV+GRGIP DKQDPS EALE
Sbjct  227   AKVAEAVERGIPVVNEGWLLDSIEKQEAQPLSAYDVMSDLAVEGRGIPWDKQDPSEEALE  286

Query  2076  NITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAP  1897
             +I++ELK+YGK+ V+KDTKL++ GGKI E+DG+LYNCA S+CD G GLND+CIMQL+  P
Sbjct  287   SISAELKLYGKQAVYKDTKLRERGGKIFERDGILYNCAFSLCDMGEGLNDYCIMQLVTVP  346

Query  1896  ENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKK  1717
             ++ LH+YY++GRVGD    +++LE WEN D A+KEF ++FEE+TGNEF   E EKK QKK
Sbjct  347   DDNLHLYYKRGRVGDDPNAEEQLEAWENVDNAVKEFVKLFEEITGNEFEPWETEKKFQKK  406

Query  1716  PHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGY  1537
               KF P+D+ +GI+ RHG L LRQLG+AAVH KL+P+VANFMK+LCSQEIYRYALMEMG 
Sbjct  407   LLKFCPVDMDNGIDARHGALGLRQLGVAAVHCKLEPLVANFMKVLCSQEIYRYALMEMGL  466

Query  1536  DYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPF  1357
             D P++P+GMLS +HL+RCE+ LL FVE++++ KE GQ+ EA+W+++S +WFTLM STRPF
Sbjct  467   DSPDLPMGMLSKIHLQRCEEVLLEFVEKVKTMKETGQKAEAVWSDYSQRWFTLMHSTRPF  526

Query  1356  YLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSD  1177
               RDF ++ADHAA+ FE+VRDI  AS LI DM+G+T+DDPL DRY +L C +  LEK+S+
Sbjct  527   IFRDFQEVADHAAAAFETVRDIIDASHLIGDMTGATVDDPLSDRYNELNCKVLPLEKESN  586

Query  1176  DYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGTRSS  997
             DYKMI+ Y+EKTY+PV+VG++SYGVSVENI+AVE +A PS D++K+LPNKVLLWCGTRSS
Sbjct  587   DYKMIVNYVEKTYEPVKVGEVSYGVSVENIYAVESTAAPSYDEIKELPNKVLLWCGTRSS  646

Query  996   NLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMG  817
             NL+RHL  GFLPAVCSLPVPGYMFGKAIVCSDAAAEAA+YGFTA+DRPEGFL+LA+AS+G
Sbjct  647   NLMRHLHKGFLPAVCSLPVPGYMFGKAIVCSDAAAEAARYGFTAIDRPEGFLILAIASLG  706

Query  816   EEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSP  637
             ++++E   PPEDTKSLE+KK G K  GRKKTDESEHF+WKDDIKVPCGRLI  S+H +SP
Sbjct  707   DQVLEVKHPPEDTKSLEEKKAGVKGLGRKKTDESEHFIWKDDIKVPCGRLI-PSEHKDSP  765

Query  636   FDYNEYAVYDPQQVSIRFLVAVKYDEEAV  550
              +YNEYAV+DP+Q SIRF+V VKY+E+ +
Sbjct  766   LEYNEYAVFDPKQTSIRFVVGVKYEEQGM  794



>ref|XP_002313672.2| hypothetical protein POPTR_0009s14610g [Populus trichocarpa]
 gb|EEE87627.2| hypothetical protein POPTR_0009s14610g [Populus trichocarpa]
Length=804

 Score =  1098 bits (2840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/830 (64%), Positives = 657/830 (79%), Gaps = 29/830 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             +KVHETRS  H  +DE R++TRKQK    +  + ++    SP KKAK             
Sbjct  3     VKVHETRSQAHAPSDESRIMTRKQKVGQSKAHEGEQ----SPKKKAKNGKDQNDSTNGKS  58

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQ-DSSGSDETIVPRCQEIMFY  2659
             E++              FC+A  EHLSV+QMR+IL  N +  SSGSD+        ++F+
Sbjct  59    EDNIAKEYEE-------FCKAIEEHLSVEQMREILDMNDKYSSSGSDD--------LLFF  103

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             GP+DKCP+C   LE   G    CKG +SEWSSC++ TR PPRKEEPL++P+SV  + +++
Sbjct  104   GPLDKCPLCSSNLEFD-GKRCSCKGFYSEWSSCTFKTRTPPRKEEPLKLPDSVLSSSVAE  162

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             L+KKHQDP  RP   Q   +KPL+G+++SLSGRL+RTHQYWK +IEK+GGKV++S  G+T
Sbjct  163   LLKKHQDPSRRPC--QGAPIKPLAGIVVSLSGRLSRTHQYWKREIEKHGGKVSSSFKGIT  220

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLVVSPAERERGGS+K+A+A+E GIPVVRE WL+DSIEK+E QP++AYDV SD++V+G+G
Sbjct  221   CLVVSPAERERGGSTKLADALEAGIPVVREDWLLDSIEKQEPQPMEAYDVVSDLSVEGKG  280

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQDPS EALE+I++ELK+YGKRGV+KDT++Q+ GG+I EKDG+LYNCA S+CD GR
Sbjct  281   IPWDKQDPSEEALESISAELKLYGKRGVYKDTRMQERGGQIFEKDGILYNCAFSLCDLGR  340

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
             GLN++CIMQLI  P++ LH YY+KG+VGD    +++LEEWEN D AIKEF R+F ELTGN
Sbjct  341   GLNEYCIMQLITVPDSNLHSYYKKGKVGDNTNAEERLEEWENVDNAIKEFVRLFVELTGN  400

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKK +KK   FYP+D+ DG++VRHGGL LRQLG+AA HS L+P +A  MKI  
Sbjct  401   EFEPWEREKKFEKKRLCFYPIDMDDGMDVRHGGLGLRQLGVAAAHSSLEPKIAYLMKIFV  460

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
                  +YA+MEMG D P++P+GMLSD+HLERCE+ LL FVE ++S KE GQ+ EA+W+++
Sbjct  461   -----QYAMMEMGLDSPDVPMGMLSDLHLERCEEVLLQFVEAVKSMKETGQKAEAVWSDY  515

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S +  TL+ STRPF  RD+ D+ADH A+ FE++RDIN ASRL+ DM GSTLDDPL DRY 
Sbjct  516   SQRCSTLLHSTRPFVFRDYQDLADHGAAAFETIRDINMASRLVGDMFGSTLDDPLSDRYK  575

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGCS+SALEKDSDDYKMI+KYL+ TY+PVRVGDI YGVSVENIF+VEPSACPSLD++KK
Sbjct  576   KLGCSVSALEKDSDDYKMIVKYLDTTYEPVRVGDIDYGVSVENIFSVEPSACPSLDEIKK  635

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLRHLQ GFLP+VCSLPVPGYMFGKAIVCSDAAAEAA+YGFT+V+
Sbjct  636   LPNKVLLWCGTRSSNLLRHLQKGFLPSVCSLPVPGYMFGKAIVCSDAAAEAARYGFTSVE  695

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+G++I+E  SPPEDTKSLE+KK G K  G+KKTDESEHF+WKDDIKVP
Sbjct  696   RPEGFLVLAVASLGDQIIEVKSPPEDTKSLEEKKRGVKGLGKKKTDESEHFIWKDDIKVP  755

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEP  529
             CGRLI  S+H +SP +YNEYAVYDP+Q  IRFLV VKY+E   E  T EP
Sbjct  756   CGRLI-PSEHRDSPLEYNEYAVYDPKQTRIRFLVEVKYEEMGAELDTTEP  804



>ref|XP_010520429.1| PREDICTED: poly [ADP-ribose] polymerase 3 isoform X3 [Tarenaya 
hassleriana]
Length=795

 Score =  1096 bits (2834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/752 (66%), Positives = 625/752 (83%), Gaps = 2/752 (0%)
 Frame = -2

Query  2784  FCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSG  2605
             FC A   +LSV+QM+Q+L+ N QDSSG+ + ++ RCQ+++FYG ++KCPVCG  + C + 
Sbjct  45    FCEAVKANLSVEQMKQVLESNGQDSSGTHDEVISRCQDLLFYGALEKCPVCGNDVYCDNK  104

Query  2604  GTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVI  2425
               Y CK D SEW SC +ST++PPRKE+ ++IP+SV  + +SD+IKK QDP  RP +E   
Sbjct  105   -RYFCKSDISEWCSCVFSTKSPPRKEDSIKIPDSVLNSAVSDMIKKRQDPSRRPKRELRA  163

Query  2424  TVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERERGGSSKVA  2245
               KP SG M+SL GRLTRTHQYWK +IE++GGKV NS+ GVTCLVVSPAERERGGS K+ 
Sbjct  164   ADKPFSGKMVSLMGRLTRTHQYWKKKIERHGGKVTNSIQGVTCLVVSPAERERGGSPKLV  223

Query  2244  EAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEALENITS  2065
             EA+ER IPVV EAWL+DSIEK+EVQPL+AYDV SD++V G+GIP DKQD S EALE ++ 
Sbjct  224   EAMERNIPVVSEAWLIDSIEKQEVQPLEAYDVVSDLSVAGKGIPWDKQDSSQEALELLSG  283

Query  2064  ELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRL  1885
             ELK+YGKR V+KDT+L++ GGKILEKDGLLYNCA S+CD G+G N++CIMQLI  PE+ L
Sbjct  284   ELKMYGKRAVYKDTRLRERGGKILEKDGLLYNCAFSICDLGKGRNEYCIMQLITVPESNL  343

Query  1884  HMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKF  1705
             ++Y+++G+VGD    +++LEEWE+ + AI+EFSR+FEE+TGNEF   EREKKIQKKPHKF
Sbjct  344   NLYFKRGKVGDDPNAEERLEEWEDTEAAIREFSRLFEEVTGNEFEPWEREKKIQKKPHKF  403

Query  1704  YPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPE  1525
             +P+D+ DG+EVRHG L LRQLG+AA H KLD  VANFMK++CSQEIY+YALME+G D P+
Sbjct  404   FPIDMDDGVEVRHGALGLRQLGVAAAHCKLDSFVANFMKVICSQEIYKYALMELGLDPPD  463

Query  1524  IPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLRD  1345
             +PIGM++D+HL+RCE+ LL F+E+ ++T E GQ+  ALWA+FS++WF+L+  TRP  L D
Sbjct  464   LPIGMVTDLHLKRCEEVLLEFIEKFKTTTETGQKATALWADFSSRWFSLLHVTRPMILHD  523

Query  1344  FADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKM  1165
             F ++A+H A+VFE+VRDIN ASR+I DM   TLDDPL DRY KLGC IS ++K+S+DYKM
Sbjct  524   FHELAEHGAAVFETVRDINVASRVIGDMGADTLDDPLSDRYNKLGCKISVVDKESEDYKM  583

Query  1164  ILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGTRSSNLLR  985
             I+KYLE TY+PVRV D+ YGVSVENIF+VE  A PSLD++KKLPNKVLLWCG+RSSNLLR
Sbjct  584   IVKYLETTYEPVRVADVEYGVSVENIFSVESDAMPSLDEIKKLPNKVLLWCGSRSSNLLR  643

Query  984   HLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIM  805
             H+  GFLPAVCSLPVPGYMFGKAIVCSDAAAEAA+YGFTAVDRPEGFL+LAVAS+GE+I 
Sbjct  644   HVYKGFLPAVCSLPVPGYMFGKAIVCSDAAAEAARYGFTAVDRPEGFLILAVASLGEKIT  703

Query  804   EFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYN  625
             E +SPPEDTKSLE+KK+G K  GRKKT+ES HFVW DDIKVPCGRL+  S+H +SP ++N
Sbjct  704   ELTSPPEDTKSLEEKKMGVKGLGRKKTEESTHFVWGDDIKVPCGRLV-PSEHKDSPLEFN  762

Query  624   EYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEP  529
             EYAVYDP+Q SIRFLV VKY+E+  EY   EP
Sbjct  763   EYAVYDPKQTSIRFLVGVKYEEKRAEYVDVEP  794



>ref|XP_010089844.1| Poly [ADP-ribose] polymerase 3 [Morus notabilis]
 gb|EXB38460.1| Poly [ADP-ribose] polymerase 3 [Morus notabilis]
Length=794

 Score =  1095 bits (2833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/751 (68%), Positives = 631/751 (84%), Gaps = 2/751 (0%)
 Frame = -2

Query  2784  FCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSG  2605
             FC+A  EHLS+ QMRQIL+ N  DSSGS+ +++ +CQ+++FYG +DKC VCGG LE  +G
Sbjct  46    FCKAIREHLSLDQMRQILEANGLDSSGSEGSVMRKCQDLLFYGLLDKCQVCGGTLE-YNG  104

Query  2604  GTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVI  2425
               Y C G +SEWSSC+ STR+PPRKEEP+++P+SV  TP+SDL+ K+QDP  RP K   I
Sbjct  105   IRYSCTGSYSEWSSCTVSTRDPPRKEEPIKLPDSVLNTPISDLLNKYQDPSRRPHKNLEI  164

Query  2424  TVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERERGGSSKVA  2245
             T KP  GM+ISL GRL+RTHQYWK +IEK+GGKV+NSVIGVTCL+ S AERERGG+SK+ 
Sbjct  165   TDKPFKGMVISLMGRLSRTHQYWKKEIEKHGGKVSNSVIGVTCLIASSAERERGGTSKLD  224

Query  2244  EAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEALENITS  2065
             EA++RGIPVVRE WL+DSIEK+E QPL+AYD+ASD++VDG+GIP DK +PS EALE++++
Sbjct  225   EALDRGIPVVREKWLLDSIEKQEPQPLEAYDIASDLSVDGKGIPCDKLNPSEEALESLSA  284

Query  2064  ELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRL  1885
             ELK+Y KRGV+KDT LQ++GGKI EKDGLL+NCA S+CD GRG+N +CIMQLI  PE  L
Sbjct  285   ELKLYVKRGVYKDTNLQEQGGKIFEKDGLLFNCAFSLCDLGRGMNHYCIMQLITVPERPL  344

Query  1884  HMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKF  1705
             H+YY+KG+VGD    +++LEEWE+ED A+KEF R+FEE+TGNEF   EREKKIQKKP KF
Sbjct  345   HLYYKKGKVGDDPNAEERLEEWEDEDNAVKEFVRLFEEVTGNEFEPWEREKKIQKKPLKF  404

Query  1704  YPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPE  1525
             YP+D+AD +EVRHG L LRQLG+A  H KL+P+VANFMK+LCSQEIYRYALMEMG D P+
Sbjct  405   YPIDMADEVEVRHGALGLRQLGVAVAHCKLEPLVANFMKVLCSQEIYRYALMEMGLDSPD  464

Query  1524  IPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLRD  1345
             +PIG+ S+VHL+RCE+ LL FVE ++S KE+G++ EA+W++FS +WFTLMPSTRPF  RD
Sbjct  465   LPIGVASNVHLKRCEEVLLKFVETVKSMKESGRKAEAVWSDFSQRWFTLMPSTRPFIFRD  524

Query  1344  FADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKM  1165
             F ++ADH AS FE+VRDI  AS LI DMSGSTLDDPL DRY KL CSISALE +SDDYKM
Sbjct  525   FQELADHGASAFETVRDITVASSLIGDMSGSTLDDPLSDRYNKLDCSISALETNSDDYKM  584

Query  1164  ILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGTRSSNLLR  985
             IL YLEKTY+P +VGDI YG+SV+NIF V+P ACPS +++KKLPNK+LLWCG+RSSN+LR
Sbjct  585   ILNYLEKTYEPFKVGDIEYGISVDNIFVVQPKACPSFEEIKKLPNKMLLWCGSRSSNMLR  644

Query  984   HLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIM  805
             HL  GFLP+VCSLPVPGYMFG+AIVCSDAAAEAA+YGFTA DRP+GFLVLAVAS+G +I+
Sbjct  645   HLHRGFLPSVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAADRPDGFLVLAVASLGNDII  704

Query  804   EFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYN  625
             E  S PEDTKSLE+ K+G K  GRKKTDESEH  W+ DIKVPCGRLI  S+H +SP +YN
Sbjct  705   EMKSAPEDTKSLEENKMGVKGLGRKKTDESEHQTWEGDIKVPCGRLI-PSEHKDSPLEYN  763

Query  624   EYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             EYAVYDP+QV IRFLV V+Y+E+ V   T E
Sbjct  764   EYAVYDPKQVLIRFLVEVRYEEKGVAMETEE  794



>ref|XP_009364326.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Pyrus x bretschneideri]
Length=812

 Score =  1094 bits (2829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/820 (63%), Positives = 651/820 (79%), Gaps = 16/820 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRSH+H   +E+++ TRKQKA++K  +    P      KKAK+        +   
Sbjct  1     MKVHETRSHSHGNAEEDKVTTRKQKAENKAHEAEQSP------KKAKS--------EGDN  46

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                   +     AE+EK C A  ++LS +QM +IL+ N QDSSGSD TI+ +CQ+++FYG
Sbjct  47    GNTNGKSSEKVVAEYEKLCAAVKDNLSTEQMHEILEANGQDSSGSDSTILRKCQDLLFYG  106

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+DKCP C G LE      Y C G +SEW++C++ T++PPRK EP+++P+SV  +P SDL
Sbjct  107   PLDKCPACNGDLEFRVI-RYFCTGSYSEWATCTFITKDPPRKLEPIKLPDSVLNSPASDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +K ++DP  RP K   I VKP +GM++SL GRL+ +HQYW+ +IEK+GGKVAN VIGVTC
Sbjct  166   LKDYEDPGCRPQKHLSIPVKPFTGMLMSLMGRLSASHQYWRKEIEKHGGKVANHVIGVTC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             L+ SPAER+RGG+ K+AEA+  GIPV+ EAWL DSIEK++ QPL+AYD+ SD+A DGRG+
Sbjct  226   LIASPAERDRGGTGKLAEAMXXGIPVISEAWLKDSIEKQDPQPLEAYDIVSDLAPDGRGV  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P  K DPS EALE+++++LK+YGKR VHKD+KL++  GKI E+DG+LYNCA S CD GR 
Sbjct  286   PWYKMDPSEEALESLSTKLKIYGKRSVHKDSKLRERDGKIFERDGILYNCAFSRCDLGRK  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             LND+CIMQLI  P++ LH+YY+KG+VGD    +++LEEW+N D A+ EF R+F+E TGNE
Sbjct  346   LNDYCIMQLITVPQSNLHLYYKKGKVGDDPNAEERLEEWDNVDYAVMEFVRLFKEATGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKKP KFYP+D+ DG++VRHGGL L QLG+AA H KL+PMVANFMK+LCS
Sbjct  406   FEPWEREKKIQKKPLKFYPIDMDDGVDVRHGGLGLHQLGVAATHCKLEPMVANFMKVLCS  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALMEMGYD PE+P+GMLS VHL RCE+ L  FVE ++S K+AG + EA+W++FS
Sbjct  466   QEIYKYALMEMGYDAPELPMGMLSVVHLNRCEEVLQKFVETLKSMKDAGPKAEAVWSDFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTLM STRPF  RD+ ++AD+AA+  E++RDI  AS LI DM  STLDDPL +RY K
Sbjct  526   QRWFTLMHSTRPFIFRDYQELADNAAAALETIRDITMASHLIGDMGESTLDDPLSERYNK  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCSIS L+K+SDDYKMILKYLEKTY+PV+VGD+ YGVSV+NIF +E SAC SLD+MKKL
Sbjct  586   LGCSISPLDKESDDYKMILKYLEKTYEPVKVGDVEYGVSVDNIFVIESSACQSLDEMKKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSN+LRHL  GFLPA+CSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVDR
Sbjct  646   PNKVLLWCGTRSSNMLRHLHKGFLPAICSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS G++I +  + PEDTKSLE+KK+G K  GRKKTDESEHFVW+DDIKVPC
Sbjct  706   PEGFLVLAVASQGDQITKVKTAPEDTKSLEEKKVGVKGLGRKKTDESEHFVWQDDIKVPC  765

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
             GRL+  S    S  +YNEYA+YDP QVSIRFLVAVKY+E+
Sbjct  766   GRLV-PSDDKESILEYNEYAIYDPTQVSIRFLVAVKYEEK  804



>ref|XP_004162473.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Cucumis sativus]
Length=815

 Score =  1093 bits (2826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/830 (64%), Positives = 666/830 (80%), Gaps = 17/830 (2%)
 Frame = -2

Query  3015  MKVHETRSH--THHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekk  2842
             MKVHETRSH  TH A +EE+++TRKQKA+SK  ++   P      KK K+       E +
Sbjct  1     MKVHETRSHSHTHGAGEEEKIMTRKQKAESKTHENEQSP------KKIKS-------EDE  47

Query  2841  aeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMF  2662
                 +GK+       EFE+FC+AT E LS+ QM++ILQ N QDS+G D  I  +CQ+++F
Sbjct  48    NGRANGKSEASDLTKEFEEFCKATRESLSIDQMKEILQMNDQDSTGPDYEIASKCQDLLF  107

Query  2661  YGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLS  2482
             YG ++ CPVC G L    G  Y C G  SEWS+C++ T++PPR+ E  ++PESV  +P+S
Sbjct  108   YGALETCPVCRGRL-VFDGKRYVCNGFLSEWSTCTFKTKDPPRRNETNKLPESVLNSPVS  166

Query  2481  DLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGV  2302
             DLIKK+Q+P  RP +    + KP SGM ISLSGRL+RTH YW+ +IEK+GG V NSVIGV
Sbjct  167   DLIKKYQNPSQRPKRNLGQSDKPFSGMTISLSGRLSRTHHYWRKEIEKHGGTVNNSVIGV  226

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
             +CLVVSPAERERGGSSKVAEAVERGI V+REAWL+DSIEK+E QPL+AYDV +D+AV+G+
Sbjct  227   SCLVVSPAERERGGSSKVAEAVERGIRVIREAWLLDSIEKQEAQPLEAYDVVTDLAVEGK  286

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             GIP DKQDPS EALE++T+ELK+YGKRGVHKDTKLQ++GG+I EKDG+LYNCA S+CDQG
Sbjct  287   GIPWDKQDPSEEALESLTAELKLYGKRGVHKDTKLQEQGGEIFEKDGILYNCAFSLCDQG  346

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
             RGLN++CI QLI  P+  LH++Y+KG+VGD    +++LEEWENE  A+KEF R+F+E+TG
Sbjct  347   RGLNEYCITQLIKVPDKNLHLFYKKGKVGDDPNAEERLEEWENEGNAVKEFVRLFKEITG  406

Query  1761  NEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKIL  1582
             NEF   EREKK +KK   F+P+D+ DG++VRHGGL LRQLGIA VHSKL+P +ANFMK+L
Sbjct  407   NEFELWEREKKFEKKRGSFHPIDMDDGVDVRHGGLGLRQLGIATVHSKLEPEIANFMKVL  466

Query  1581  CSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAE  1402
             CSQEIY+YALMEM +D PE+P+GMLS  HLERCE+ LL F+E+++S +E G + EA+W +
Sbjct  467   CSQEIYKYALMEMAHDPPELPMGMLSKFHLERCEEILLEFIEKVKSMEETGFKAEAVWTD  526

Query  1401  FSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRY  1222
             +SN+WFTLM STRP   +D+ +IA+HAA+V E VRD+  AS LI DMSGST+DDPL DRY
Sbjct  527   YSNRWFTLMHSTRPLIFKDYQEIAEHAAAVLEGVRDVTVASHLIGDMSGSTIDDPLSDRY  586

Query  1221  VKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK  1042
              KLG S+S LEKDSDDYKMI+ YLEKTY+PV+VGDI YGV+V+NIF+VE +A PS  ++K
Sbjct  587   GKLGGSVSLLEKDSDDYKMIVNYLEKTYEPVKVGDIEYGVTVDNIFSVESAALPSYGEIK  646

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             K PNKVLLWCGTRSSNLLRHL  GFLPA+CSLPVPGYMFG+AIVCSDAAAEAA+YGFTAV
Sbjct  647   KQPNKVLLWCGTRSSNLLRHLHKGFLPAICSLPVPGYMFGRAIVCSDAAAEAARYGFTAV  706

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
             DRPEGFLVLA+ S+GEEI E +S PEDTK LE++K+G K  GRKKTDESEHFVWKD+I+V
Sbjct  707   DRPEGFLVLAIVSLGEEITEITSLPEDTKLLEERKMGVKALGRKKTDESEHFVWKDEIRV  766

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             PCG LI  S+H +SP +YNEYAVY+P+Q +IRFLV VKY+E+ V   T E
Sbjct  767   PCGPLI-TSEHKDSPLEYNEYAVYNPKQTNIRFLVGVKYEEKGVVMDTQE  815



>sp|Q1SGF1.1|PARP3_MEDTR RecName: Full=Putative poly [ADP-ribose] polymerase 3; Short=PARP-3; 
AltName: Full=NAD(+) ADP-ribosyltransferase 3; Short=ADPRT-3; 
AltName: Full=Poly[ADP-ribose] synthase 3 [Medicago 
truncatula]
Length=799

 Score =  1093 bits (2826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/830 (63%), Positives = 662/830 (80%), Gaps = 33/830 (4%)
 Frame = -2

Query  3015  MKVHETRSHT-HHAN-DEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekk  2842
             MKV E+RSH  HHA+ +EE+++TRKQKA+SK  +     + +SP KKAK        E +
Sbjct  1     MKV-ESRSHNVHHAHGEEEKVMTRKQKAESKAHE-----VEHSP-KKAKV-------EDE  46

Query  2841  aeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMF  2662
                     +      E+++FC+AT+E LS++QM++IL+ N  DSSGSD  I  RCQ+++F
Sbjct  47    KNGHTNGKSASDVVQEYDEFCKATNEQLSLEQMKEILEANDLDSSGSDLEITRRCQDLLF  106

Query  2661  YGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLS  2482
             +G ++KC VC G +E   G  Y C+G +SEWSSC++STR PPRK+EP+++P+SVQ +P+S
Sbjct  107   FGALEKCMVCNGNMEFD-GRRYGCRGFYSEWSSCTFSTREPPRKDEPIKLPDSVQNSPVS  165

Query  2481  DLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGV  2302
             DL+KK+QDP  RP ++  + +KP +GMMISL GRL RTH  +                G 
Sbjct  166   DLLKKYQDPSKRPQRDLGLAIKPFTGMMISLMGRLNRTHLNFS---------------GA  210

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
             +CLV SPAER+RGG+SK+A+A+ERGIPVVREAWL DSIEK+E QPL++YD+ SD++VDG+
Sbjct  211   SCLVASPAERDRGGTSKLADAMERGIPVVREAWLTDSIEKQEPQPLESYDLVSDLSVDGK  270

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             GIP DKQDP  EA+E++++ELK+YGKRGV+KDTKL ++ GKI EKDG+LYNCA S+CDQG
Sbjct  271   GIPWDKQDPGEEAIESLSAELKLYGKRGVYKDTKLHEQDGKIFEKDGILYNCAFSLCDQG  330

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
             R LND+C+MQLIV PEN LH+Y++KGRVGD    +++LEE EN D AIKEF R+FEE+TG
Sbjct  331   RKLNDYCVMQLIVVPENSLHLYFKKGRVGDDPSAEERLEECENVDNAIKEFVRLFEEITG  390

Query  1761  NEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKIL  1582
             NEF S EREKK QKKP KFYP+D+ DG+EVRHG L LRQLGIAA H KL+PMVANFMK+L
Sbjct  391   NEFESWEREKKFQKKPLKFYPIDMDDGVEVRHGALGLRQLGIAATHCKLEPMVANFMKVL  450

Query  1581  CSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAE  1402
             CSQEIY+YALMEMGYD P++PIGM++++HL+RCE+ LL F+E++++ KE G + +A+W++
Sbjct  451   CSQEIYKYALMEMGYDSPDLPIGMVTNLHLKRCEEILLEFIEKVKTLKETGPKADAIWSD  510

Query  1401  FSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRY  1222
             FS KWFTLM STRPF  RD+ +IADHAA+  E VRDI  AS LI DMSGST+DDPL D Y
Sbjct  511   FSQKWFTLMHSTRPFIFRDYQEIADHAAAALEGVRDITLASHLIGDMSGSTIDDPLSDTY  570

Query  1221  VKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK  1042
              KLGCSI+ LEK+S+DY+MI+KYLEKTY+PV+VGDI YGVSVENIF VE SACPS  D+ 
Sbjct  571   KKLGCSITPLEKNSNDYEMIVKYLEKTYEPVKVGDIEYGVSVENIFTVESSACPSYADIV  630

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             K+PNKVLLWCG+RSSNLLRHL  GFLPA+CSLPVPGYMFGKAIVCSDAAAEAA+YGFTAV
Sbjct  631   KMPNKVLLWCGSRSSNLLRHLHKGFLPAICSLPVPGYMFGKAIVCSDAAAEAARYGFTAV  690

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
             DRPEGFLVLA+AS+G EI E  SPPEDT SLE+KK+G K  G+KKTDESEHFVWKDDIKV
Sbjct  691   DRPEGFLVLAIASLGNEITELKSPPEDTTSLEEKKVGVKGLGKKKTDESEHFVWKDDIKV  750

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             PCG +I  S+H +SP +YNEYAVYDP+QV I +LV VKY+E+     TAE
Sbjct  751   PCGSII-ASEHEDSPLEYNEYAVYDPKQVRISYLVGVKYEEKDAVIDTAE  799



>ref|XP_004149282.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Cucumis sativus]
 gb|KGN46958.1| hypothetical protein Csa_6G152930 [Cucumis sativus]
Length=815

 Score =  1092 bits (2824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/830 (64%), Positives = 665/830 (80%), Gaps = 17/830 (2%)
 Frame = -2

Query  3015  MKVHETRSH--THHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekk  2842
             MKVHETRSH  TH A +EE+++TRKQKA+SK  ++   P      KK K+       E +
Sbjct  1     MKVHETRSHSHTHGAGEEEKIMTRKQKAESKTHENEQSP------KKIKS-------EDE  47

Query  2841  aeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMF  2662
                 +GK+       EFE+FC+AT E LS+ QM++ILQ N QDS+G D  I  +CQ+++F
Sbjct  48    NGRANGKSEASDLTKEFEEFCKATRESLSIDQMKEILQMNDQDSTGPDYEIASKCQDLLF  107

Query  2661  YGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLS  2482
             YG ++ CPVC G L    G  Y C G  SEWS+C++ T++PPR+ E  ++PESV  +P+S
Sbjct  108   YGALETCPVCRGRL-VFDGKRYVCNGFLSEWSTCTFKTKDPPRRNETNKLPESVLNSPVS  166

Query  2481  DLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGV  2302
             DLIKK+Q+P  RP +    + KP SGM ISLSGRL+RTH YW+ +IEK+GG V NSVIGV
Sbjct  167   DLIKKYQNPSQRPKRNLGQSDKPFSGMTISLSGRLSRTHHYWRKEIEKHGGTVNNSVIGV  226

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
             +CLVVSPAERERGGSSKVAEAVERGI V+REAWL+DSIEK+E QPL+AYDV +D+AV+G+
Sbjct  227   SCLVVSPAERERGGSSKVAEAVERGIRVIREAWLLDSIEKQEAQPLEAYDVVTDLAVEGK  286

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             GIP DKQDPS EALE++T+ELK+YGKRGVHKDTKLQ++GG+I EKD +LYNCA S+CDQG
Sbjct  287   GIPWDKQDPSEEALESLTAELKLYGKRGVHKDTKLQEQGGEIFEKDRILYNCAFSLCDQG  346

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
             RGLN++CI QLI  P+  LH++Y+KG+VGD    +++LEEWENE  A+KEF R+F+E+TG
Sbjct  347   RGLNEYCITQLIKVPDKNLHLFYKKGKVGDDPNAEERLEEWENEGNAVKEFVRLFKEITG  406

Query  1761  NEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKIL  1582
             NEF   EREKK +KK   F+P+D+ DG++VRHGGL LRQLGIA VHSKL+P +ANFMK+L
Sbjct  407   NEFELWEREKKFEKKRGSFHPIDMDDGVDVRHGGLGLRQLGIATVHSKLEPEIANFMKVL  466

Query  1581  CSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAE  1402
             CSQEIY+YALMEM +D PE+P+GMLS  HLERCE+ LL F+E+++S KE G + EA+W +
Sbjct  467   CSQEIYKYALMEMAHDPPELPMGMLSKFHLERCEEILLEFIEKVKSMKETGFKAEAVWTD  526

Query  1401  FSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRY  1222
             +SN+WFTLM STRP   +D+ +IA+HAA+V E VRD+  AS LI DMSGST+DDPL DRY
Sbjct  527   YSNRWFTLMHSTRPLIFKDYQEIAEHAAAVLEGVRDVTVASHLIGDMSGSTIDDPLSDRY  586

Query  1221  VKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK  1042
              KLG S+S LEKDSDDYKMI+ YLEKTY+PV+VGDI YGV+V+NIF+VE +A PS  ++K
Sbjct  587   GKLGGSVSLLEKDSDDYKMIVNYLEKTYEPVKVGDIEYGVTVDNIFSVESAALPSYGEIK  646

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             K PNKVLLWCGTRSSNLLRHL  GFLPA+CSLPVPGYMFG+AIVCSDAAAEAA+YGFTAV
Sbjct  647   KQPNKVLLWCGTRSSNLLRHLHKGFLPAICSLPVPGYMFGRAIVCSDAAAEAARYGFTAV  706

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
             DRPEGFLVLA+ S+GEEI E +S PEDTK LE+KK+G K  GRKKTDESEHFVWKD+I+V
Sbjct  707   DRPEGFLVLAIVSLGEEITEITSLPEDTKLLEEKKMGVKALGRKKTDESEHFVWKDEIRV  766

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             PCG LI  S+H +SP +YNEYAVY+P+Q +IRFLV VKY+E+ V   T E
Sbjct  767   PCGPLI-TSEHKDSPLEYNEYAVYNPKQTNIRFLVGVKYEEKGVVMDTQE  815



>ref|XP_008458691.1| PREDICTED: putative poly [ADP-ribose] polymerase 3 [Cucumis melo]
Length=843

 Score =  1091 bits (2821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/822 (65%), Positives = 663/822 (81%), Gaps = 17/822 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHH--ANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekk  2842
             +KVH+TRSH+H   A +EE+++TRKQKA+SK  ++   P      KK K+       E +
Sbjct  29    LKVHDTRSHSHAHGAGEEEKIMTRKQKAESKTHENEQSP------KKVKS-------EDE  75

Query  2841  aeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMF  2662
                 +GK+       EFE+FC+AT E LS+ QM++ILQ N QDS+GSD  I  +CQ+++F
Sbjct  76    NGRANGKSEASDLTNEFEEFCKATRESLSIDQMKEILQMNDQDSTGSDYEIASKCQDLLF  135

Query  2661  YGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLS  2482
             YG ++ CPVC G L    G  Y C G  SEWS+C++ T++PPRK E  ++PESV  +P+S
Sbjct  136   YGALETCPVCRGRL-VFDGKRYFCNGFLSEWSTCTFKTKDPPRKNETNKLPESVLNSPVS  194

Query  2481  DLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGV  2302
             DLIKK Q+P  RP +    + KP S M ISLSGRL+RTH YW+ +IEK+GG V NSVIGV
Sbjct  195   DLIKKCQNPSQRPKRNLGQSDKPFSRMTISLSGRLSRTHHYWRKEIEKHGGTVNNSVIGV  254

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
             +CLVVSPAERERGGSSKVAEAVERGI V+REAWL+DSIEK+E QPL+AYDV +D+AV+G+
Sbjct  255   SCLVVSPAERERGGSSKVAEAVERGIRVIREAWLLDSIEKQEAQPLEAYDVVTDLAVEGK  314

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             GIP DKQDPS EALE++T+ELK+YGKRGVHKDTKLQ++GGKI EKDG+LYNCA S+CDQG
Sbjct  315   GIPWDKQDPSEEALESLTAELKLYGKRGVHKDTKLQEQGGKIFEKDGILYNCAFSLCDQG  374

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
             RGLN++CI QLI  P+  LH++Y+KG+VGD    +++LEEWENE+ A+KEF R+FEE+TG
Sbjct  375   RGLNEYCITQLIKVPDKNLHLFYKKGKVGDDPNAEERLEEWENEENAVKEFVRLFEEITG  434

Query  1761  NEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKIL  1582
             NEF   EREKK +KK   FYP+D+ DG++VRHGGL LRQLGIA VHSKL+P +ANFMK+L
Sbjct  435   NEFELWEREKKFEKKRLSFYPIDMDDGVDVRHGGLGLRQLGIATVHSKLEPEIANFMKVL  494

Query  1581  CSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAE  1402
             CSQEIY+YALMEM +D PE P+GMLS  HLERCE+ LL F+ +++S KE G + EA+W +
Sbjct  495   CSQEIYKYALMEMAHDPPEFPMGMLSKFHLERCEEVLLEFIGKVKSMKETGFKAEAVWTD  554

Query  1401  FSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRY  1222
             +SN+WFTLM STRP   +D+ +IA+HAA+V E VRD+  AS LI DMSGST+DDPL DRY
Sbjct  555   YSNRWFTLMHSTRPLIFKDYQEIAEHAAAVLEGVRDVTVASHLIGDMSGSTIDDPLSDRY  614

Query  1221  VKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK  1042
              KLG ++S LEKDSDDY+MI+ YLEKTY+PV+VGDI YGV+V+NIF+VE +A PS +++K
Sbjct  615   GKLGGTVSLLEKDSDDYRMIVNYLEKTYEPVKVGDIEYGVTVDNIFSVESAALPSYEEIK  674

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             K PNKVLLWCGTRSSNLLRHL  GFLPA+CSLPVPGYMFG+AIVCSDAAAEAA+YGFTAV
Sbjct  675   KQPNKVLLWCGTRSSNLLRHLHKGFLPAICSLPVPGYMFGRAIVCSDAAAEAARYGFTAV  734

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
             DRPEGFLVLA+ S+GEEI E +S PEDTKSLE+KK+G K  GRKKTDESEHFVWKD+I+V
Sbjct  735   DRPEGFLVLAIVSLGEEITEITSLPEDTKSLEEKKMGVKALGRKKTDESEHFVWKDEIRV  794

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
             PCG LI  S+H +SP +YNEYAVY+P+Q +IRFLV VKY+E+
Sbjct  795   PCGPLI-ASEHKDSPLEYNEYAVYNPKQTNIRFLVGVKYEEK  835



>ref|XP_008788145.1| PREDICTED: poly [ADP-ribose] polymerase 3 isoform X2 [Phoenix 
dactylifera]
Length=818

 Score =  1090 bits (2820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/832 (64%), Positives = 666/832 (80%), Gaps = 18/832 (2%)
 Frame = -2

Query  3015  MKVHETRSHTH---HANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdek  2845
             MKVHETRS TH      +E ++ TRKQKA+++  +   +   N   KKAK T+   GD  
Sbjct  1     MKVHETRSQTHAQSSTEEEGKVGTRKQKAENEGQESEQQASKN---KKAKVTNDENGDAN  57

Query  2844  kaeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIM  2665
                  D  A           FC+ T EHLS+++MR+IL+ N QDSSGSD+ IV RCQ++M
Sbjct  58    GKSAADVAAEFEE-------FCKTTREHLSIEEMRRILEANGQDSSGSDDAIVRRCQDMM  110

Query  2664  FYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL  2485
             FYGP ++CP+C G LEC+ G  Y C+G +SEW++C+Y+TR+ PRKE+ +++PE +    +
Sbjct  111   FYGPPERCPLCNGQLECT-GSNYSCRGAYSEWTTCTYATRDSPRKEQSVKVPEGIGDAMV  169

Query  2484  SDLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG  2305
              + + K QD + R  +E     KPL+G MISLSGRL+RTHQYW+ +IEK+GGKV+N+V G
Sbjct  170   QEWVNK-QDSRTRHQRELTPLDKPLAGTMISLSGRLSRTHQYWREEIEKHGGKVSNTVPG  228

Query  2304  VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDG  2125
             VTCLVVSPAERERGGSSKV EA+ER IPVVREAWL+DSI+K   QPLDAYD  SD+A +G
Sbjct  229   VTCLVVSPAERERGGSSKVIEAMERSIPVVREAWLIDSIQKHAAQPLDAYDALSDLAPEG  288

Query  2124  RGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQ  1945
             RGIP D+++PS EALE++T+ELK+YGKRGVHKD++LQ+ GG I EKDG+LYNCA S+CDQ
Sbjct  289   RGIPWDEREPSEEALESLTAELKLYGKRGVHKDSRLQESGGYIFEKDGILYNCAFSICDQ  348

Query  1944  GRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELT  1765
             GRGLN++CI QLI+ PENRLH+Y++KGRVGD  R  +++EEW  +D A+KEF R+FEELT
Sbjct  349   GRGLNEYCITQLIMVPENRLHLYFKKGRVGDDPRAQERVEEWSMDD-AVKEFVRLFEELT  407

Query  1764  GNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKI  1585
             GNEF   EREKK +KKP KFYP+D+ DG +VR+GGL LRQLG+AA H KL+  VANFMK+
Sbjct  408   GNEFEPWEREKKFKKKPRKFYPIDMDDGFDVRYGGLGLRQLGVAAAHCKLESSVANFMKV  467

Query  1584  LCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWA  1405
             LCSQEIYRYALMEMG D P++P+GMLSDVHL+RCE+ L  F E +RS  E+G +  ALW 
Sbjct  468   LCSQEIYRYALMEMGLDSPDLPMGMLSDVHLKRCEEVLFKFREELRSAAESGHKANALWV  527

Query  1404  EFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDR  1225
             +FSNKWFTLM STRPF +R+  ++ADHAA+  E+VRDIN ASRLI DM+G+T+DDPL+DR
Sbjct  528   DFSNKWFTLMHSTRPFIIRNLQELADHAAAALETVRDINVASRLIGDMTGATVDDPLFDR  587

Query  1224  YVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM  1045
             Y K+GCSI++L+K+SDDYKMILKYLEKTY+PV VGD+SYGVSV+NIFAVE SA PS DD+
Sbjct  588   YKKIGCSITSLDKESDDYKMILKYLEKTYEPVEVGDVSYGVSVDNIFAVESSAGPSYDDI  647

Query  1044  KKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTA  865
             KKLPNKVLLWCGTRSSNLLRHL  G LPA+CS+PVPGYMFGKAIVCSDAAAEAA+YGFTA
Sbjct  648   KKLPNKVLLWCGTRSSNLLRHLHKGLLPAICSIPVPGYMFGKAIVCSDAAAEAARYGFTA  707

Query  864   VDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQK-KLGAKFHGRKKTDESEHFVWKDDI  688
             +DRPEGFLVLAVAS+G++I E S+ PEDTK+LE++ ++G K  GRKK +ES HF WKDD+
Sbjct  708   IDRPEGFLVLAVASLGDQITEISNAPEDTKALEEEAEVGVKGLGRKKPEESGHFTWKDDV  767

Query  687   KVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             KVPCGRL+  S+  +SP +YNEYAVYDP+QVSIRFLV V+Y+EE +E   AE
Sbjct  768   KVPCGRLV-PSECKDSPLEYNEYAVYDPKQVSIRFLVGVRYEEENMEMDAAE  818



>ref|XP_010907127.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
3 [Elaeis guineensis]
Length=818

 Score =  1088 bits (2813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/831 (63%), Positives = 660/831 (79%), Gaps = 16/831 (2%)
 Frame = -2

Query  3015  MKVHETRSHTH---HANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdek  2845
             MKVHETRSH+H    A +E ++ TRKQKA++K  +       N   KKAK  +   GD  
Sbjct  1     MKVHETRSHSHAHSSAEEEGKVGTRKQKAENKGQESEQLASKN---KKAKVINDENGDAD  57

Query  2844  kaeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIM  2665
                  D  A           FC+A  EHLSV++MR+IL+ N QDS+GSD+ IV RCQ++M
Sbjct  58    GKSAADVAAEFEE-------FCKAMREHLSVEEMRRILEANGQDSAGSDDAIVRRCQDMM  110

Query  2664  FYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL  2485
             FYGP+++CP+C G LE  +G  Y C+G +SEW++C+++TR+ PRKE+ +++ E +    +
Sbjct  111   FYGPLERCPLCNGQLE-YTGSNYSCRGAYSEWTTCTFTTRDSPRKEQSIKVLEGIGDAVV  169

Query  2484  SDLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG  2305
              +    +QD + R  +E     KPL+GMMISLSGRL+RTHQ WK +IEK+GGKV+N+V G
Sbjct  170   LEWAN-NQDSRARHQRELTPLDKPLAGMMISLSGRLSRTHQCWKEEIEKHGGKVSNTVPG  228

Query  2304  VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDG  2125
             VTCLVVSPAERERGGSSKV EA+ER IPVVREAWL+DSI+K+  QPLDAY+  SD+A +G
Sbjct  229   VTCLVVSPAERERGGSSKVIEAMERSIPVVREAWLIDSIQKQAAQPLDAYEALSDLAPEG  288

Query  2124  RGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQ  1945
             RGIP DKQ+PS EALE++T+ELK+ GKRGV+KD++LQ++GG I EKDG+LYNCA S+CD 
Sbjct  289   RGIPWDKQEPSEEALESLTAELKLCGKRGVYKDSRLQEQGGYIFEKDGILYNCAFSICDM  348

Query  1944  GRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELT  1765
             GRG N++C  QLI+ PEN LH+YY+KGRVGD  R  +++EEW + D A+KEF R+FEELT
Sbjct  349   GRGQNEYCSTQLIMVPENHLHLYYKKGRVGDDPRAQERVEEWSSVDDAVKEFVRLFEELT  408

Query  1764  GNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKI  1585
             GNEF   EREKK QKKPH FYP+D+ DG +VR+GGL LRQLG+AA H KL+P VANFMK+
Sbjct  409   GNEFEPWEREKKFQKKPHMFYPIDMDDGFDVRYGGLGLRQLGVAAAHCKLEPSVANFMKV  468

Query  1584  LCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWA  1405
             LC QEIYRYALMEMG D P++P+GM+SDVHL+RCE+ LL F E +RS  ++G + +AL  
Sbjct  469   LCGQEIYRYALMEMGLDSPDLPMGMVSDVHLKRCEELLLKFREELRSVPDSGHKADALRM  528

Query  1404  EFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDR  1225
             +FSNKWFT M STRPF +R+  ++ADH A+  E+VRDIN ASRLI DM+G+T+DDPL+DR
Sbjct  529   DFSNKWFTQMHSTRPFIIRNLQELADHVAAALETVRDINVASRLIGDMTGATVDDPLFDR  588

Query  1224  YVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM  1045
             Y K+GCSI++L+K+S+DYKMILKYLEKTY+PV+VGD+SYGVSV+NIFAVE SA PS DD+
Sbjct  589   YKKMGCSITSLDKESEDYKMILKYLEKTYEPVKVGDVSYGVSVDNIFAVEASAGPSYDDI  648

Query  1044  KKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTA  865
             KKLPNKVLLW GTRSSNLLRHL  G LPA+CS+PVPGYMFGKAIV SDAAAEAA+YGFTA
Sbjct  649   KKLPNKVLLWYGTRSSNLLRHLHKGLLPAICSIPVPGYMFGKAIVWSDAAAEAARYGFTA  708

Query  864   VDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             +DRPEGFLVLAVAS+G++I E S+ PEDTK+LE++K+G K  GRKK +ESEHF WKD +K
Sbjct  709   IDRPEGFLVLAVASLGDQITEISNAPEDTKALEERKVGVKGLGRKKPEESEHFTWKDGVK  768

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             VPCGRL+  S+  +SP +YNEYAVYDP+QVSIRFLV VKY+E+ VE  TAE
Sbjct  769   VPCGRLV-PSECKDSPLEYNEYAVYDPKQVSIRFLVGVKYEEKNVEMDTAE  818



>ref|XP_006591922.1| PREDICTED: poly [ADP-ribose] polymerase 3 isoform X1 [Glycine 
max]
Length=777

 Score =  1087 bits (2810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/820 (63%), Positives = 647/820 (79%), Gaps = 54/820 (7%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKV ETRSH H   +EE+++TRKQKA+SK  +     + +SP KKAK         +K +
Sbjct  1     MKVQETRSHVHALGEEEKVMTRKQKAESKAHE-----VEHSP-KKAKV--------EKED  46

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                   ++   A E+++FC+AT+EHL ++QMR IL+ N  DSSGSD  I  RCQ+++FYG
Sbjct  47    GHINGKSETGVAEEYDEFCKATTEHLPLEQMRDILEANGLDSSGSDLEITRRCQDLLFYG  106

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              +DKC VC G+LE   G  Y C+G +SEW+SC++STRNPPRK+EP+++P+SVQ +  SD 
Sbjct  107   ALDKCSVCNGSLEFD-GRRYVCRGFYSEWASCTFSTRNPPRKQEPIKLPDSVQNSLASD-  164

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
                                                   YWK+ IEK+GGKVANS+IG TC
Sbjct  165   -------------------------------------HYWKTTIEKHGGKVANSIIGSTC  187

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LV SPAERERGG+SK+AEA+ER IPVVREAWL+DSIEK+E QPL+AYD+ SD++VDG+GI
Sbjct  188   LVASPAERERGGTSKLAEAMERSIPVVREAWLIDSIEKQEPQPLEAYDLVSDLSVDGKGI  247

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQDP  EA+E++++ELK+YGKRGV+KDTKLQ++GGKI E+DG+LYNCA SVCDQGRG
Sbjct  248   PWDKQDPGEEAIESLSAELKLYGKRGVYKDTKLQEQGGKIFERDGILYNCAFSVCDQGRG  307

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             LND+C+MQLIV PENRLH+Y++KGRVGD    +++LEEW+N DGA+KEF R+FEE+TGNE
Sbjct  308   LNDYCVMQLIVVPENRLHLYFKKGRVGDDPNAEERLEEWDNVDGALKEFVRLFEEITGNE  367

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKK QKKP KFYP+D+ DGIEVRHG L LRQLGIAA H KL+P+VANFMK+LCS
Sbjct  368   FEPWEREKKFQKKPLKFYPIDMDDGIEVRHGALGLRQLGIAATHCKLEPLVANFMKVLCS  427

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALMEMGYD P++PIGM++++HL++CED LL F+++++S KE G + EA+W +FS
Sbjct  428   QEIYKYALMEMGYDCPDLPIGMVTNLHLKKCEDVLLEFIDKVKSLKETGPKAEAVWTDFS  487

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
              +WFTLM STRPF  RD+ +IADHAA+  E VRDI  AS LI DM+GST+DDPL + Y K
Sbjct  488   QRWFTLMHSTRPFNFRDYQEIADHAAAALEGVRDITQASHLIGDMTGSTIDDPLSETYKK  547

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGCSISAL+K SDDY+MI+KYLEKTY+PV+VGDI YGVSVENIFAV+   CPS +D+ KL
Sbjct  548   LGCSISALDKSSDDYEMIVKYLEKTYEPVKVGDIEYGVSVENIFAVQTGGCPSYEDIIKL  607

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCG+RSSNLLRHLQ GFLPA+CSLP+PGYMFGKAIVCSDAAAEAA+YGFTAVDR
Sbjct  608   PNKVLLWCGSRSSNLLRHLQKGFLPAICSLPIPGYMFGKAIVCSDAAAEAARYGFTAVDR  667

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLA+AS+G EI E  +PPED  SLE+KK+G K  G+KKTDESEHFVWKDDIKVPC
Sbjct  668   PEGFLVLAIASLGNEITELKTPPEDASSLEEKKVGVKGPGKKKTDESEHFVWKDDIKVPC  727

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
             G+L+  S H +SP +YNEYAVYD ++  I +LV VKY+E+
Sbjct  728   GKLV-ASDHQDSPLEYNEYAVYDKKRARISYLVGVKYEEK  766



>ref|XP_006400753.1| hypothetical protein EUTSA_v10015477mg [Eutrema salsugineum]
 gb|ESQ42206.1| hypothetical protein EUTSA_v10015477mg [Eutrema salsugineum]
Length=802

 Score =  1087 bits (2810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/830 (62%), Positives = 661/830 (80%), Gaps = 28/830 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRSH H + DE++   RK KA+ K       P      KKAK          + +
Sbjct  1     MKVHETRSHAHMSGDEQKGNLRKHKAEGKL------PETGQSHKKAKP---------END  45

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                       AA+E+ +FC+A  E+LSV Q++++L+ N QD S  +ET++ +CQ++MFYG
Sbjct  46    NGRSVNGAGDAASEYNEFCKAVEENLSVDQIKEVLETNGQDCSAPEETLLAQCQDLMFYG  105

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              + KCP+C G L C +   + C G+ SEW SC +ST+NPPRK+EP+++P+S+  + +SDL
Sbjct  106   ALAKCPLCRGTLICDNEKRFICGGEISEWCSCVFSTKNPPRKDEPIKLPDSIMNSAISDL  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             IKKHQDPK+RP +E     KP +G+MISL GRLTRTHQYWK +IE++GGKV+N+V GVTC
Sbjct  166   IKKHQDPKSRPKRELTSADKPFTGVMISLMGRLTRTHQYWKKKIERHGGKVSNTVQGVTC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSPAERERGGSSK+ EA+E+GIPVV EAWL+DS+EK+E QPL+AYDV SD++V+G+GI
Sbjct  226   LVVSPAERERGGSSKLVEAMEQGIPVVSEAWLIDSVEKQEAQPLEAYDVVSDLSVEGKGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQDPS EA+E++ +ELK+YGKRGV+KDT LQ+ GGKI EKDGLLYNCA S+CD G+G
Sbjct  286   PWDKQDPSEEAIESLAAELKMYGKRGVYKDTNLQERGGKIFEKDGLLYNCAFSICDLGKG  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
              N++CIMQL+              ++GD    +++LEEWE+E+ AIKEF+R+FEE+TGNE
Sbjct  346   RNEYCIMQLVTR------------KIGDDPNAEERLEEWEDEEDAIKEFARLFEEITGNE  393

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   EREKKIQKKPHKF+P+D+ DGIEVR G L LRQLG+AA H KLDP VANF+K+LC 
Sbjct  394   FEPWEREKKIQKKPHKFFPIDMDDGIEVRSGALGLRQLGVAAAHCKLDPFVANFLKVLCG  453

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIY+YALME+G D P++P+GML+D+HL+RCE+ LL FV+++++TKE GQ+ EA+WA+FS
Sbjct  454   QEIYKYALMELGLDPPDLPMGMLTDIHLKRCEEVLLEFVDKLKTTKETGQKAEAMWADFS  513

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             ++WF+L+ +TRP  L DF ++ADHAAS FE+VRDIN ASRLI DM G TLDDPL DRY K
Sbjct  514   SRWFSLLHTTRPMRLHDFHELADHAASAFETVRDINTASRLIGDMRGDTLDDPLSDRYNK  573

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGC IS ++K+SDDYKM++KYL+ TY+PV+V D+ Y  +VEN+FAVE  A PSLDD+KKL
Sbjct  574   LGCKISMVDKESDDYKMVVKYLKTTYEPVKVSDVEYSATVENVFAVESDAIPSLDDIKKL  633

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSNLLRH+  GFLPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVDR
Sbjct  634   PNKVLLWCGTRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDR  693

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+GEE+ EF++ PEDTK+LE+KK+G K  GRKKT+ESEHF+W+DDIKVPC
Sbjct  694   PEGFLVLAVASLGEEVTEFTNLPEDTKTLEEKKVGVKGLGRKKTEESEHFMWRDDIKVPC  753

Query  675   GRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             GRL+  S+H +SP +YNEYAVYDP+Q SIRFLV VKY+E+  E    EP+
Sbjct  754   GRLV-PSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIIDVEPE  802



>ref|XP_008788139.1| PREDICTED: poly [ADP-ribose] polymerase 3 isoform X1 [Phoenix 
dactylifera]
Length=860

 Score =  1086 bits (2809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/832 (64%), Positives = 666/832 (80%), Gaps = 18/832 (2%)
 Frame = -2

Query  3015  MKVHETRSHTH---HANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdek  2845
             ++VHETRS TH      +E ++ TRKQKA+++  +   +   N   KKAK T+   GD  
Sbjct  43    LEVHETRSQTHAQSSTEEEGKVGTRKQKAENEGQESEQQASKN---KKAKVTNDENGDAN  99

Query  2844  kaeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIM  2665
                  D  A           FC+ T EHLS+++MR+IL+ N QDSSGSD+ IV RCQ++M
Sbjct  100   GKSAADVAAEFEE-------FCKTTREHLSIEEMRRILEANGQDSSGSDDAIVRRCQDMM  152

Query  2664  FYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL  2485
             FYGP ++CP+C G LEC+ G  Y C+G +SEW++C+Y+TR+ PRKE+ +++PE +    +
Sbjct  153   FYGPPERCPLCNGQLECT-GSNYSCRGAYSEWTTCTYATRDSPRKEQSVKVPEGIGDAMV  211

Query  2484  SDLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG  2305
              + + K QD + R  +E     KPL+G MISLSGRL+RTHQYW+ +IEK+GGKV+N+V G
Sbjct  212   QEWVNK-QDSRTRHQRELTPLDKPLAGTMISLSGRLSRTHQYWREEIEKHGGKVSNTVPG  270

Query  2304  VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDG  2125
             VTCLVVSPAERERGGSSKV EA+ER IPVVREAWL+DSI+K   QPLDAYD  SD+A +G
Sbjct  271   VTCLVVSPAERERGGSSKVIEAMERSIPVVREAWLIDSIQKHAAQPLDAYDALSDLAPEG  330

Query  2124  RGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQ  1945
             RGIP D+++PS EALE++T+ELK+YGKRGVHKD++LQ+ GG I EKDG+LYNCA S+CDQ
Sbjct  331   RGIPWDEREPSEEALESLTAELKLYGKRGVHKDSRLQESGGYIFEKDGILYNCAFSICDQ  390

Query  1944  GRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELT  1765
             GRGLN++CI QLI+ PENRLH+Y++KGRVGD  R  +++EEW  +D A+KEF R+FEELT
Sbjct  391   GRGLNEYCITQLIMVPENRLHLYFKKGRVGDDPRAQERVEEWSMDD-AVKEFVRLFEELT  449

Query  1764  GNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKI  1585
             GNEF   EREKK +KKP KFYP+D+ DG +VR+GGL LRQLG+AA H KL+  VANFMK+
Sbjct  450   GNEFEPWEREKKFKKKPRKFYPIDMDDGFDVRYGGLGLRQLGVAAAHCKLESSVANFMKV  509

Query  1584  LCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWA  1405
             LCSQEIYRYALMEMG D P++P+GMLSDVHL+RCE+ L  F E +RS  E+G +  ALW 
Sbjct  510   LCSQEIYRYALMEMGLDSPDLPMGMLSDVHLKRCEEVLFKFREELRSAAESGHKANALWV  569

Query  1404  EFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDR  1225
             +FSNKWFTLM STRPF +R+  ++ADHAA+  E+VRDIN ASRLI DM+G+T+DDPL+DR
Sbjct  570   DFSNKWFTLMHSTRPFIIRNLQELADHAAAALETVRDINVASRLIGDMTGATVDDPLFDR  629

Query  1224  YVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM  1045
             Y K+GCSI++L+K+SDDYKMILKYLEKTY+PV VGD+SYGVSV+NIFAVE SA PS DD+
Sbjct  630   YKKIGCSITSLDKESDDYKMILKYLEKTYEPVEVGDVSYGVSVDNIFAVESSAGPSYDDI  689

Query  1044  KKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTA  865
             KKLPNKVLLWCGTRSSNLLRHL  G LPA+CS+PVPGYMFGKAIVCSDAAAEAA+YGFTA
Sbjct  690   KKLPNKVLLWCGTRSSNLLRHLHKGLLPAICSIPVPGYMFGKAIVCSDAAAEAARYGFTA  749

Query  864   VDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQK-KLGAKFHGRKKTDESEHFVWKDDI  688
             +DRPEGFLVLAVAS+G++I E S+ PEDTK+LE++ ++G K  GRKK +ES HF WKDD+
Sbjct  750   IDRPEGFLVLAVASLGDQITEISNAPEDTKALEEEAEVGVKGLGRKKPEESGHFTWKDDV  809

Query  687   KVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             KVPCGRL+  S+  +SP +YNEYAVYDP+QVSIRFLV V+Y+EE +E   AE
Sbjct  810   KVPCGRLV-PSECKDSPLEYNEYAVYDPKQVSIRFLVGVRYEEENMEMDAAE  860



>gb|KDP37595.1| hypothetical protein JCGZ_07941 [Jatropha curcas]
Length=815

 Score =  1086 bits (2808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/830 (63%), Positives = 651/830 (78%), Gaps = 16/830 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHH-ANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
             MKVHE RS  H  A +E +++TRKQKA++K  +    P      KKAK+       E   
Sbjct  1     MKVHEKRSQAHAPAAEEGKIMTRKQKAENKGQEGEQSP------KKAKS-------ENDT  47

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
                    +    A EFE F +A  E LS+ QM++IL  N QDSSGSD  I  +CQ+++F 
Sbjct  48    SHSSNGKSKADIAKEFEDFSKAIREKLSIAQMKEILDLNDQDSSGSDGAITTKCQDLLFL  107

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             G + KCP+C   LE   G  Y C G +SEWSSC++ TRNPPR EEP+++P+SV  +P++D
Sbjct  108   GALGKCPLCDCKLEFD-GKRYSCSGFYSEWSSCTFKTRNPPRIEEPIKLPDSVLNSPIAD  166

Query  2478  LIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
             L+KK+Q+P  RP ++    VKP +GM++SLSGR +RTHQ+WK  IEKNGGKV+NSV+GV+
Sbjct  167   LLKKYQEPSRRPPQDLAAPVKPFAGMLVSLSGRPSRTHQFWKKSIEKNGGKVSNSVVGVS  226

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRG  2119
             CLV SPAERERGGSSK+ EA+ER IPVVRE WL++SIEK+E  PL+AYD+ SD+AV+GRG
Sbjct  227   CLVTSPAERERGGSSKLTEAMERSIPVVREEWLLESIEKQEPLPLEAYDIVSDLAVEGRG  286

Query  2118  IPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGR  1939
             IP DKQ+ S EALE+I++ELKVYGKRGVHKD KL D G +I E+DG+LYNCA S+CD GR
Sbjct  287   IPWDKQEQSEEALESISAELKVYGKRGVHKDAKLHDRGAQIFERDGILYNCAFSLCDMGR  346

Query  1938  GLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGN  1759
              +N++CI+QLI   E+ LH++Y+KG+ GD    +++LEE EN D AIKEF R+FEE+TGN
Sbjct  347   EINEYCIIQLITVSESNLHLFYKKGKAGDDPNAEERLEELENVDNAIKEFVRLFEEITGN  406

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKK +KK  KFYP+D+ DG++VR GGL LRQLG+AA H KL+P VANFMK+LC
Sbjct  407   EFEPWEREKKFEKKRLKFYPIDMDDGVDVRQGGLGLRQLGVAATHCKLEPKVANFMKVLC  466

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIYRYA+MEM  D P++P+GMLS+ HL+RCE+ LL FV  ++S K   Q+ EA+W+++
Sbjct  467   SQEIYRYAMMEMSLDPPDLPMGMLSNFHLKRCEEVLLQFVAAVKSMKGTEQKAEAVWSDY  526

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             S +WF LM STRP  LRD+ ++AD+ A+ FE+VRDI  AS LI DMSGSTLDDPL DRY 
Sbjct  527   SQRWFNLMHSTRPLILRDYDELADNVAAAFETVRDITVASHLIGDMSGSTLDDPLSDRYK  586

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGCSIS LEKDSD+YKMI+KYLEKTY+P++VGDI YGVSVENIFAVE SA PSLD++KK
Sbjct  587   KLGCSISPLEKDSDEYKMIVKYLEKTYEPIKVGDIDYGVSVENIFAVESSAWPSLDEIKK  646

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLRHLQ GFLPA CSLPVPGYMFGKAIVCSDAAAEAA+YGFTA+D
Sbjct  647   LPNKVLLWCGTRSSNLLRHLQKGFLPAACSLPVPGYMFGKAIVCSDAAAEAARYGFTAID  706

Query  858   RPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             RPEGFLVLAVAS+G++  E SS PEDTKS E+KK+G K  GRKKTDESEHF+W++DIKVP
Sbjct  707   RPEGFLVLAVASLGDQATEISSLPEDTKSFEEKKIGVKGLGRKKTDESEHFMWENDIKVP  766

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEP  529
             CG L + S+H +SP +YNEYAVYDP+Q  IRFLV VKY+E+ V   TAEP
Sbjct  767   CGSL-KLSEHKDSPLEYNEYAVYDPKQTCIRFLVGVKYEEKDVIMDTAEP  815



>ref|XP_010686033.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=814

 Score =  1081 bits (2795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/829 (63%), Positives = 663/829 (80%), Gaps = 16/829 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKV ETR+  H  + EE+M TRKQK +       ++  H SPTKKAK       +++   
Sbjct  1     MKV-ETRAQAHDHHAEEKMKTRKQKTN-------EQTEHQSPTKKAK------QEKENEN  46

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                      A++ E+++FC+   E+LS  Q+++ILQ N QD SG D++++ RCQ++++YG
Sbjct  47    GTQTNGTTTASSKEYQEFCKVIRENLSPDQIKEILQLNGQDPSGPDDSVISRCQDLLYYG  106

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              + +C VCGG L+   G +Y C G  SEWS+C+Y TRNPPRK++P+++P+SV K+ ++D 
Sbjct  107   ALLECKVCGGNLQFV-GNSYSCTGALSEWSTCTYKTRNPPRKQDPIKLPDSVLKSSVADF  165

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +KK+QDP  R  KE     KP +GM++ LSGRL+RTHQYWK +IEK+GGKVAN+ IGVTC
Sbjct  166   LKKYQDPSQRHQKEIPPADKPFTGMVMCLSGRLSRTHQYWKKEIEKHGGKVANTAIGVTC  225

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LVVSP ERERGGSSKV+EAVERGIPVVREAWL+DSIEK+E+QPL+AYD  SD +  G+GI
Sbjct  226   LVVSPMERERGGSSKVSEAVERGIPVVREAWLIDSIEKQELQPLEAYDCVSDRSSYGKGI  285

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DKQDPS EALE++T+ELK+YGKRGV+KDT LQ +GGKILEKDGLLYNCA S+CD GR 
Sbjct  286   PWDKQDPSEEALESLTAELKMYGKRGVYKDTMLQQQGGKILEKDGLLYNCAFSLCDLGRN  345

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             +N+  I QLI  PE +LH+YY++GRVGD  + D++LEEW+N + AIKEF+R+FEELTGNE
Sbjct  346   INEIVITQLITVPEKKLHLYYKRGRVGDDTKADERLEEWDNVEDAIKEFARLFEELTGNE  405

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             FL  E EKK QKKP KF+ +D+ DG+E+R+GGL +RQLG AAVH KLDPM+ANFMKILCS
Sbjct  406   FLPWETEKKFQKKPQKFHVIDMDDGVEIRYGGLGVRQLGTAAVHCKLDPMIANFMKILCS  465

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QEIYRYALMEMG D P++P+GM++D+HL+RCED LL F+E ++S ++ G + EALW+EFS
Sbjct  466   QEIYRYALMEMGLDSPDLPVGMVTDLHLKRCEDALLQFIENVKSQEQGGPKAEALWSEFS  525

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             +KWFTLM +TRPF  +D  ++ADHAAS  E+VRDI  AS LI DMSGSTLDDPL DRY K
Sbjct  526   SKWFTLMHTTRPFIFKDLQELADHAASPLETVRDITVASHLIGDMSGSTLDDPLSDRYKK  585

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             LGC I+ L+K+SDD+KMI+ YLEKTY+P++VG+ISY VSVENI AV+ SA PS +++KKL
Sbjct  586   LGCKITPLDKESDDFKMIINYLEKTYEPIKVGEISYDVSVENILAVDLSAGPSYEEIKKL  645

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSNLLRHLQ GFLP++CSLP  GYMFG+AIVCSDA+AEAA+YG+TA+DR
Sbjct  646   PNKVLLWCGTRSSNLLRHLQKGFLPSICSLPAAGYMFGRAIVCSDASAEAARYGYTAIDR  705

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPC  676
             PEGFLVLAVAS+G+EI+E +SPPEDTKSLE++K+G K  GRKKTDESEHFVWKDDIKVPC
Sbjct  706   PEGFLVLAVASLGDEIIEVTSPPEDTKSLEERKVGVKGIGRKKTDESEHFVWKDDIKVPC  765

Query  675   GRLIEES-QHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             G+L+  S +   S  D+NEYAVYDP QV I FLV VKY E+ V    AE
Sbjct  766   GKLVPASPEPKESILDFNEYAVYDPNQVKISFLVVVKYIEKDVVMDVAE  814



>gb|KHG11804.1| Poly [ADP-ribose] polymerase 3 [Gossypium arboreum]
Length=821

 Score =  1076 bits (2782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/828 (62%), Positives = 649/828 (78%), Gaps = 23/828 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHH--ANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekk  2842
             MK+HE RSH+H     DEE+++TRKQKAD  QL+ ++    N   KK K          K
Sbjct  1     MKLHEKRSHSHAHGTGDEEKIMTRKQKAD--QLKSNE---GNESPKKPKVEADNDQHNGK  55

Query  2841  aeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMF  2662
             A  E  K  +         FC++  EHLSV QMR+IL+ N QDSSGSD ++V +C +++F
Sbjct  56    ATTEVAKEFEE--------FCKSVREHLSVAQMREILEANGQDSSGSDASVVIKCLDMLF  107

Query  2661  YGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLS  2482
             YGP++KC +C G LE   G  Y CKG +SEWSSC Y TR+P RK+EP ++P+SV  +P++
Sbjct  108   YGPLEKCQICNGDLE-FDGNRYSCKGTYSEWSSCVYKTRSPARKQEPFKLPDSVLNSPVA  166

Query  2481  DLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGV  2302
              L+KK++DPK RP +   +T KP  GMMISL GRL+RTHQYWK++IEK+GG V+NSVIGV
Sbjct  167   GLVKKYEDPKLRPHRYVGVTDKPFLGMMISLMGRLSRTHQYWKTKIEKHGGTVSNSVIGV  226

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
             TCLV SPAERERGGSSK+ EA+ERG+ VV EAWL+DSIEK+E QPL+AYD+ +D+AVDG+
Sbjct  227   TCLVASPAERERGGSSKLVEAMERGVRVVSEAWLLDSIEKQEAQPLEAYDIVTDLAVDGK  286

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             GIP DKQ P   A+E++++ELK+YGKRGV+KDT+LQ++GG+I E+DG+LYNC  S+CDQG
Sbjct  287   GIPWDKQVPEEHAIESLSAELKLYGKRGVYKDTRLQEQGGQIFEEDGILYNCVFSLCDQG  346

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
               +N++CIMQL+  P++ LH+YY+KGRVGD     ++LEEW++  GA+KEF R+FEE+TG
Sbjct  347   GAINEYCIMQLVKVPDSNLHLYYKKGRVGDDPNAQERLEEWKDVVGAVKEFVRLFEEVTG  406

Query  1761  NEFLSREREKKIQKKPHKFYPLDVA------DGIEVRHGGLALRQLGIAAVHSKLDPMVA  1600
             NEF   EREKK QKKP KFYP+D+       DG++VR GGL LRQLG+AA H KL+PMVA
Sbjct  407   NEFEPWEREKKFQKKPLKFYPIDMFPCIDKDDGVDVRCGGLGLRQLGVAAAHCKLEPMVA  466

Query  1599  NFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV  1420
             NFMK+LCSQEIY+YALMEM  D P++P+GMLS+VHLERCE+ L  F+E+++S KE+G + 
Sbjct  467   NFMKVLCSQEIYKYALMEMDLDAPDLPMGMLSNVHLERCEEVLQEFIEKVKSMKESGPKA  526

Query  1419  EALWAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDD  1240
             EA+W++FS +WFTLM S+RPF  RD+ ++ADHAA+ FE VRDI  AS +I  M   TLDD
Sbjct  527   EAVWSDFSQRWFTLMHSSRPFIFRDYQELADHAAASFECVRDIVVASHMIGHMGDDTLDD  586

Query  1239  PLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACP  1060
             PL DRY K+GCSIS L+KDS+DYKMIL Y+EKTY+PV++ DI YG+SVENIF VE    P
Sbjct  587   PLSDRYKKIGCSISPLDKDSEDYKMILNYVEKTYEPVKLADIEYGISVENIFNVETKEGP  646

Query  1059  SLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAK  880
             S D++KKLPNK LLWCGTRSSNLLRHL  GFLPA CSLPVPGYMFGK IVCSDAAAEAA+
Sbjct  647   SFDEVKKLPNKRLLWCGTRSSNLLRHLHKGFLPASCSLPVPGYMFGKGIVCSDAAAEAAR  706

Query  879   YGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVW  700
             YGFTAVDRPEGFLVLAV S GEEIME  +PPEDTK LE+KK+  K  GRKK DESE+  W
Sbjct  707   YGFTAVDRPEGFLVLAVFSQGEEIMELKNPPEDTKPLEEKKVCVKGLGRKKPDESEYIDW  766

Query  699   KDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
             KDDIKVPCGRLI  S+H +SP +YNEY VYDP+QVS+RFLV VK++E+
Sbjct  767   KDDIKVPCGRLI-PSEHQDSPLEYNEYTVYDPKQVSMRFLVGVKFEEK  813



>ref|XP_009624068.1| PREDICTED: poly [ADP-ribose] polymerase 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=651

 Score =  1062 bits (2747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/650 (77%), Positives = 581/650 (89%), Gaps = 2/650 (0%)
 Frame = -2

Query  2478  LIKKHQDPK-NRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGV  2302
             LIKK+ DPK NRP K+     KP  GMMISL+GRLTRTHQYWKS+IEK GGKV NSVIGV
Sbjct  2     LIKKYGDPKKNRPPKKYSAPEKPFDGMMISLAGRLTRTHQYWKSKIEKYGGKVNNSVIGV  61

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
             TCLVVSPAER+RGGSSKVAEAVER IPVVREAWL DSIEK++ QPLDAYD+ASDIAV+GR
Sbjct  62    TCLVVSPAERDRGGSSKVAEAVERSIPVVREAWLSDSIEKEQAQPLDAYDIASDIAVEGR  121

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             GIPLDK DPS EALE IT+ELKV+GKRGVHKDTK+QDEG +ILEKDGLLYNCALSVC+Q 
Sbjct  122   GIPLDKMDPSEEALETITAELKVFGKRGVHKDTKMQDEGARILEKDGLLYNCALSVCNQK  181

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
               +NDFCIMQLI++PEN LHMY +KGR+GD+ R DDKLEEWE+ D AIKEF+R+F+ELTG
Sbjct  182   NQINDFCIMQLIMSPENCLHMYCKKGRIGDSIRADDKLEEWEDVDDAIKEFARLFQELTG  241

Query  1761  NEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKIL  1582
             NEF S EREKKIQKK HKF+P+DV DG+EVRHG L LRQLG +AVHSKLDPMVANFMK+L
Sbjct  242   NEFESWEREKKIQKKHHKFFPIDVDDGVEVRHGALGLRQLGSSAVHSKLDPMVANFMKVL  301

Query  1581  CSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAE  1402
             CSQEIYRYALME+G+D PE+PIGML+D+HL+RCE+TLL+FVE+++S KE GQ+ E +W +
Sbjct  302   CSQEIYRYALMELGHDSPEVPIGMLTDLHLKRCEETLLYFVEKVKSMKETGQEAEGVWYD  361

Query  1401  FSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRY  1222
             FS +WFTLMPS RPF  RD+ D+A+HAAS +E++RD+N ASR+I+DMSGSTLDDPL++RY
Sbjct  362   FSQRWFTLMPSIRPFTFRDYTDLAEHAASAYETIRDVNFASRIIQDMSGSTLDDPLFERY  421

Query  1221  VKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK  1042
              KLGC +S LEK+SDDYKMI+ YLEKTY+P+ VG++SYGVSVENIFAVE S+CPSLDD+K
Sbjct  422   KKLGCIVSPLEKESDDYKMIVNYLEKTYEPISVGEMSYGVSVENIFAVEVSSCPSLDDIK  481

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KLPNKVLLWCGTRSSNLLR+LQ GFLP+VCSLPV GYMFG+A+VCSDAAAEAA+YGFTA+
Sbjct  482   KLPNKVLLWCGTRSSNLLRYLQKGFLPSVCSLPVSGYMFGRAVVCSDAAAEAARYGFTAI  541

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
             DRPEGFLVLAVAS+GEE+ EFS+PPEDTK+LE+KK+G K  GRKKTDE EHFVWKDDIKV
Sbjct  542   DRPEGFLVLAVASLGEEVKEFSNPPEDTKALEEKKIGVKGLGRKKTDEKEHFVWKDDIKV  601

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             PCGRLI  S+H +S  +YNEYAVYDPQQVSIR+LVAVK+DE+ V Y T+E
Sbjct  602   PCGRLI-PSEHKDSVLEYNEYAVYDPQQVSIRYLVAVKFDEQGVVYDTSE  650



>gb|EPS73841.1| hypothetical protein M569_00904, partial [Genlisea aurea]
Length=819

 Score =  1060 bits (2741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/832 (63%), Positives = 651/832 (78%), Gaps = 17/832 (2%)
 Frame = -2

Query  3015  MKVHETRS-HTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekka  2839
              KVH+  + H H   +EERMVTRKQKA+ K ++   E    SP KK+K        E   
Sbjct  1     FKVHDRSTPHAHSGGNEERMVTRKQKAEGKSIESERE---QSP-KKSKV-------EDDE  49

Query  2838  eeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFY  2659
               ++ + +  A  A+FE FC+AT E LS++QMR+IL+ N QDSSGSD+ +V RCQ+++FY
Sbjct  50    NGKELEKSTEAVKADFENFCKATKERLSIKQMREILEANGQDSSGSDDAVVLRCQDVLFY  109

Query  2658  GPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSD  2479
             GP+D+CP+CGG LE  S  TY CKG +SEWSSC+Y++R+PPR+ EP+++P+S + + L D
Sbjct  110   GPLDRCPICGGMLELGSS-TYSCKGVYSEWSSCTYTSRDPPRRNEPIKLPDSFETSGLED  168

Query  2478  LIKKHQDPKNRPLKEQVITV-KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG-  2305
             L+K  Q  + R    ++ +  KP  GM+ISL+GRL+RTHQYWK++IEK+GGKVAN VIG 
Sbjct  169   LLKNRQHARPRHHNVELRSPEKPFKGMVISLAGRLSRTHQYWKTKIEKHGGKVANHVIGG  228

Query  2304  VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDG  2125
             V CLVVSPAERERGGSSK+ EA+ER IPVVREAWL DSIEKKE Q LD+YD+ SDI+V G
Sbjct  229   VNCLVVSPAERERGGSSKLVEAMERSIPVVREAWLTDSIEKKEPQLLDSYDIVSDISVGG  288

Query  2124  RGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQ  1945
             RGIPL  QD S EALE I +ELK+YGKR VH DTKL+D  G+ILEKDG+LYNCA +  D+
Sbjct  289   RGIPLFHQDSSEEALETIAAELKIYGKRAVHLDTKLRDVNGQILEKDGILYNCAFACSDR  348

Query  1944  GRGLNDFCIMQLIVAPENRLHMYYRKGRVG-DTARVDDKLEEWENEDGAIKEFSRIFEEL  1768
              RG+NDFC++QLI  P + L+ Y++KG++G D  +  ++LEE EN D  IKEF++ FEE 
Sbjct  349   ARGINDFCVIQLIKVPPDGLYFYHKKGKIGGDITKYYERLEERENVDDTIKEFAKTFEES  408

Query  1767  TGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMK  1588
             TGNEF   EREKKIQKK  KFYP+D+ DG EVR+G L LR+LG AA H KLDP VAN MK
Sbjct  409   TGNEFEPWEREKKIQKKLQKFYPIDLDDGFEVRYGALGLRKLGSAAAHCKLDPKVANLMK  468

Query  1587  ILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALW  1408
             ILCSQEIYRYA+MEMG D+PE+P+G+++D+HL+RCE+ LL  VE++    E G + EA+W
Sbjct  469   ILCSQEIYRYAMMEMGLDFPELPLGIVTDIHLKRCEEILLESVEKLLLNNETGMKGEAMW  528

Query  1407  AEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYD  1228
             ++FS + FTL+PSTRP+ LRDF D+A+H AS FE++RDIN ASRLI DMSGSTLDDPL++
Sbjct  529   SDFSQRIFTLLPSTRPYVLRDFNDVAEHGASAFETIRDINVASRLIGDMSGSTLDDPLFE  588

Query  1227  RYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDD  1048
              Y KL CS+S +EK+S DY MI KYLEKTY+PV+VG+ISY V+++N+FAVE SACPS D+
Sbjct  589   CYKKLCCSLSPVEKESSDYGMIAKYLEKTYEPVKVGEISYRVAIDNVFAVESSACPSHDE  648

Query  1047  MKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFT  868
             +KKLPNKVLLWCGTRSSNLLRHLQ GFLPAVC LPVPGYMFGKAIVCSDAAAEAA+YGFT
Sbjct  649   IKKLPNKVLLWCGTRSSNLLRHLQKGFLPAVCFLPVPGYMFGKAIVCSDAAAEAARYGFT  708

Query  867   AVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDI  688
             AVDRPEGFLVLAVAS+GE ++E S PPED K LE+KK      G+KKTDESEHF W DDI
Sbjct  709   AVDRPEGFLVLAVASLGESVIELSHPPEDPKQLEEKKQAVIGRGKKKTDESEHFTWTDDI  768

Query  687   KVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             KVPCG++I  S + +S  +YNEYAVY+PQQV I+FLVAVK +E  VE+   E
Sbjct  769   KVPCGKII-PSNYKDSSLEYNEYAVYNPQQVCIKFLVAVKLEEMGVEHDAGE  819



>ref|XP_007015851.1| Poly [ADP-ribose] polymerase 3, putative [Theobroma cacao]
 gb|EOY33470.1| Poly [ADP-ribose] polymerase 3, putative [Theobroma cacao]
Length=813

 Score =  1058 bits (2737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/831 (63%), Positives = 652/831 (78%), Gaps = 21/831 (3%)
 Frame = -2

Query  3015  MKVHETRSHTHH---ANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdek  2845
             MKVHETRSH+H     + EE+++ RKQKAD  +  +  E    SP KKAK         +
Sbjct  1     MKVHETRSHSHTHPTGDHEEKVMARKQKADQLKTNEGRE----SP-KKAKAEVDNDHSNE  55

Query  2844  kaeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIM  2665
             K+  +  K  +         F +A  EHLS  QMR+IL+ N QDSSGS  + V +C +++
Sbjct  56    KSASDVAKEFEE--------FSKAVREHLSDTQMREILEANGQDSSGSGTSAVIKCLDML  107

Query  2664  FYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL  2485
             FYGP++KCP+C G LE   G  Y CKG +SEWSSC Y  RNPPRK++P+++P+ V  +PL
Sbjct  108   FYGPLEKCPICSGDLEFH-GNRYSCKGSYSEWSSCVYKPRNPPRKQQPVKLPDFVLNSPL  166

Query  2484  SDLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG  2305
                IKK+QDP  RP +   +T KP  GMMISL GRL+RT+QYWKS+IEK+GGKV++SVIG
Sbjct  167   ---IKKYQDPSRRPHRFVGVTEKPFLGMMISLVGRLSRTYQYWKSKIEKHGGKVSSSVIG  223

Query  2304  VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDG  2125
             VTCLV SPAER+RGGSSK+ EA+ERG+ VV EAWL+DSIEK+E QPL+AYD+ SD+AVDG
Sbjct  224   VTCLVASPAERDRGGSSKLIEAMERGLRVVSEAWLLDSIEKQEAQPLEAYDIVSDLAVDG  283

Query  2124  RGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQ  1945
             +GIPLDKQDP   ALE++++ LK+YGKRGV+KD+KLQ++GG+I EKDG+LYNCA S+CDQ
Sbjct  284   KGIPLDKQDPEEAALESLSAVLKLYGKRGVYKDSKLQEQGGQIFEKDGILYNCAFSLCDQ  343

Query  1944  GRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELT  1765
             GRG+N++CIMQLI  PE+ LH+YY+KGRVGD    +++LEEW+N DGA+KEF R+FEE+T
Sbjct  344   GRGINEYCIMQLIKVPESNLHLYYKKGRVGDDPNAEERLEEWKNVDGAVKEFVRLFEEVT  403

Query  1764  GNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKI  1585
             GNEF   EREKK QKKP KFYP+D+ DG++VRHGG  LRQLG+AA HSKL+P+VANFMK+
Sbjct  404   GNEFEPWEREKKFQKKPLKFYPIDMDDGVDVRHGGFGLRQLGVAAAHSKLEPLVANFMKV  463

Query  1584  LCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWA  1405
             LCSQEIY+YALMEM  D P++P+GMLS+VHL+R E+ L  FVE+++S KE+G + EA+W+
Sbjct  464   LCSQEIYKYALMEMDLDAPDLPMGMLSNVHLKRSEEVLQEFVEKVKSVKESGPKAEAVWS  523

Query  1404  EFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDR  1225
             +FS +WFTLM STRPF  RD+ ++ADH A+  ESVRDI  AS +I D+S  TLDDPL+DR
Sbjct  524   DFSQRWFTLMHSTRPFVFRDYQELADHGAAALESVRDIVVASHVIGDISDDTLDDPLFDR  583

Query  1224  YVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM  1045
             Y ++GCSIS ++KDSDDYKMI+ Y+EKTY+ V++ DI YG+SV+NIFAVE +  PS D++
Sbjct  584   YKRIGCSISPVDKDSDDYKMIVNYMEKTYEHVKLADIEYGISVDNIFAVETNEGPSFDEV  643

Query  1044  KKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTA  865
             KKLPNK+LLWCG RSSNLLRHL  G LPA  SLPVPGYMFG+ IVCSDAAAEAA+YGFTA
Sbjct  644   KKLPNKILLWCGIRSSNLLRHLHRGLLPASWSLPVPGYMFGRGIVCSDAAAEAARYGFTA  703

Query  864   VDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             VDRP+GFL LAVAS GEEI+E   PPEDTKSLE+KK+G K  GRKK DESE   WK DIK
Sbjct  704   VDRPDGFLALAVASQGEEIVELKDPPEDTKSLEEKKVGVKGLGRKKPDESEFINWKGDIK  763

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             VPCG LI  S+H +SP +YNEY VY+ +QVSIRFLV VKYDE+ V   T E
Sbjct  764   VPCGLLI-PSEHKDSPLEYNEYTVYELKQVSIRFLVGVKYDEKGVVMDTEE  813



>gb|KHG11805.1| Poly [ADP-ribose] polymerase 3 [Gossypium arboreum]
Length=849

 Score =  1055 bits (2729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/856 (60%), Positives = 652/856 (76%), Gaps = 51/856 (6%)
 Frame = -2

Query  3015  MKVHETRSHTHH--ANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekk  2842
             MK+HE RSH+H     DEE+++TRKQKAD  QL+ ++    N   KK K         + 
Sbjct  1     MKLHEKRSHSHAHGTGDEEKIMTRKQKAD--QLKSNE---GNESPKKPKV--------EA  47

Query  2841  aeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQ----  2674
               ++    A    A EFE+FC++  EHLSV QMR+IL+ N QDSSGSD ++V +      
Sbjct  48    DNDQHNGKATTEVAKEFEEFCKSVREHLSVAQMREILEANGQDSSGSDASVVIKWLVSIL  107

Query  2673  ------------------------EIMFYGPVDKCPVCGGALECSSGGTYHCKGDFSEWS  2566
                                     +++FYGP++KC +C G LE   G  Y CKG +SEWS
Sbjct  108   SLFLLSLHANSFSNQITCIPIGSLDMLFYGPLEKCQICNGDLEFD-GNRYSCKGTYSEWS  166

Query  2565  SCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITVKPLSGMMISLS  2386
             SC Y TR+P RK+EP ++P+SV  +P++ L+KK++DPK RP +   +T KP  GMMISL 
Sbjct  167   SCVYKTRSPARKQEPFKLPDSVLNSPVAGLVKKYEDPKLRPHRYVGVTDKPFLGMMISLM  226

Query  2385  GRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERERGGSSKVAEAVERGIPVVREA  2206
             GRL+RTHQYWK++IEK+GG V+NSVIGVTCLV SPAERERGGSSK+ EA+ERG+ VV EA
Sbjct  227   GRLSRTHQYWKTKIEKHGGTVSNSVIGVTCLVASPAERERGGSSKLVEAMERGVRVVSEA  286

Query  2205  WLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEALENITSELKVYGKRGVHKD  2026
             WL+DSIEK+E QPL+AYD+ +D+AVDG+GIP DKQ P   A+E++++ELK+YGKRGV+KD
Sbjct  287   WLLDSIEKQEAQPLEAYDIVTDLAVDGKGIPWDKQVPEEHAIESLSAELKLYGKRGVYKD  346

Query  2025  TKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTA  1846
             T+LQ++GG+I E+DG+LYNC  S+CDQG  +N++CIMQL+  P++ LH+YY+KGRVGD  
Sbjct  347   TRLQEQGGQIFEEDGILYNCVFSLCDQGGAINEYCIMQLVKVPDSNLHLYYKKGRVGDDP  406

Query  1845  RVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVA------D  1684
                ++LEEW++  GA+KEF R+FEE+TGNEF   EREKK QKKP KFYP+D+       D
Sbjct  407   NAQERLEEWKDVVGAVKEFVRLFEEVTGNEFEPWEREKKFQKKPLKFYPIDMFPCIDKDD  466

Query  1683  GIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLS  1504
             G++VR GGL LRQLG+AA H KL+PMVANFMK+LCSQEIY+YALMEM  D P++P+GMLS
Sbjct  467   GVDVRCGGLGLRQLGVAAAHCKLEPMVANFMKVLCSQEIYKYALMEMDLDAPDLPMGMLS  526

Query  1503  DVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLRDFADIADH  1324
             +VHLERCE+ L  F+E+++S KE+G + EA+W++FS +WFTLM S+RPF  RD+ ++ADH
Sbjct  527   NVHLERCEEVLQEFIEKVKSMKESGPKAEAVWSDFSQRWFTLMHSSRPFIFRDYQELADH  586

Query  1323  AASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEK  1144
             AA+ FE VRDI  AS +I  M   TLDDPL DRY K+GCSIS L+KDS+DYKMIL Y+EK
Sbjct  587   AAASFECVRDIVVASHMIGHMGDDTLDDPLSDRYKKIGCSISPLDKDSEDYKMILNYVEK  646

Query  1143  TYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFL  964
             TY+PV++ DI YG+SVENIF VE    PS D++KKLPNK LLWCGTRSSNLLRHL  GFL
Sbjct  647   TYEPVKLADIEYGISVENIFNVETKEGPSFDEVKKLPNKRLLWCGTRSSNLLRHLHKGFL  706

Query  963   PAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPE  784
             PA CSLPVPGYMFGK IVCSDAAAEAA+YGFTAVDRPEGFLVLAV S GEEIME  +PPE
Sbjct  707   PASCSLPVPGYMFGKGIVCSDAAAEAARYGFTAVDRPEGFLVLAVFSQGEEIMELKNPPE  766

Query  783   DTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDP  604
             DTK LE+KK+  K  GRKK DESE+  WKDDIKVPCGRLI  S+H +SP +YNEY VYDP
Sbjct  767   DTKPLEEKKVCVKGLGRKKPDESEYIDWKDDIKVPCGRLI-PSEHQDSPLEYNEYTVYDP  825

Query  603   QQVSIRFLVAVKYDEE  556
             +QVS+RFLV VK++E+
Sbjct  826   KQVSMRFLVGVKFEEK  841



>ref|XP_009417034.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Musa acuminata subsp. 
malaccensis]
Length=1034

 Score =  1043 bits (2698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/825 (59%), Positives = 648/825 (79%), Gaps = 14/825 (2%)
 Frame = -2

Query  3021  PDMKVHETRSHTHHANDEERMVTR-KQKADSKQLQDHDEPLHNSPTKKAKTTdggagdek  2845
             P   VHETRSHT  + +EE  + + KQKA++       +    S  KKAK         +
Sbjct  218   PKPSVHETRSHTRSSAEEEGNIGKGKQKAENGGRDGEQQ--QASKNKKAKV--------E  267

Query  2844  kaeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIM  2665
                 +      V  A EFE+FC+AT +HLS+ +MR+IL+ N QD SGSD+ +VPRCQ++M
Sbjct  268   GENRDANGKPAVDVAVEFEEFCKATRQHLSINEMRRILEANEQDPSGSDDAVVPRCQDMM  327

Query  2664  FYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL  2485
             FYGP++KCPVC   ++CS G  Y C+G +SEWS+C Y+T +  R+++P+RIPE +    +
Sbjct  328   FYGPLEKCPVCRNQVDCS-GSNYLCRGAYSEWSTCIYTTTDARRRDQPVRIPEGIGDETV  386

Query  2484  SDLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG  2305
              + IKK Q+ ++ P +E   + KP +G++ISLSGRL+RTHQ W+ +IEK+GGKV+N++IG
Sbjct  387   EEWIKK-QESRSYPRRELTSSNKPFAGLVISLSGRLSRTHQTWREEIEKHGGKVSNNIIG  445

Query  2304  VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDG  2125
               CLVVSPAERERGGSS+VAEA+ER IPVV E WLVDSI+K++ QPLDAYDV SD+  +G
Sbjct  446   ANCLVVSPAERERGGSSRVAEAMERNIPVVSENWLVDSIQKQQAQPLDAYDVVSDLIPEG  505

Query  2124  RGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQ  1945
             RGIP DK DP+ EALE++T+ELK+ GKR V+KD+ LQ++GG I EKDG+LYNCA S+CD 
Sbjct  506   RGIPWDKMDPNEEALESLTAELKLSGKRCVYKDSMLQEQGGFIFEKDGILYNCAFSLCDL  565

Query  1944  GRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELT  1765
             GRG+N++C++QLI  PE  +H+YY+KGRVGD  + D+++EEW N D A+KEF R+F+E+T
Sbjct  566   GRGINEYCVLQLIQVPEKNVHLYYKKGRVGDDPKADERVEEWNNVDDALKEFVRLFKEVT  625

Query  1764  GNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKI  1585
             GNEF + EREKK QK   KFYP+D+ DGI+VRHGGL+ RQLG+AA H KL+P+VA FMK+
Sbjct  626   GNEFETWEREKKFQKMSLKFYPIDMDDGIDVRHGGLSARQLGVAAAHCKLEPLVAKFMKV  685

Query  1584  LCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWA  1405
             LCSQEIYRYA+MEMGYD P++P+GM++D+HLERCE+ LL+F E I+   ++  +   LW 
Sbjct  686   LCSQEIYRYAMMEMGYDCPDLPMGMVTDLHLERCEEELLNFREDIKKAPDSSDKANVLWL  745

Query  1404  EFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDR  1225
             +F+NKWFT M S RPF +++F ++ADH A+  E +RDIN ASRL+ DMSG+T+DDPL DR
Sbjct  746   DFTNKWFTFMHSVRPFIMKNFQELADHVAAGLECIRDINVASRLVGDMSGATVDDPLSDR  805

Query  1224  YVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM  1045
             Y +LGCS++ L+K+SDD+KMILKYLE TY+P++VGD++YGVSVENIFAVE  A PS +++
Sbjct  806   YGRLGCSVAPLDKESDDHKMILKYLETTYEPIKVGDVTYGVSVENIFAVESGAGPSYEEV  865

Query  1044  KKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTA  865
             KKLPNK+LLWCGTRSSNL+RHLQ G LP+VC +P PGYMFGKAIVCSDA+AEAA+YGFTA
Sbjct  866   KKLPNKILLWCGTRSSNLIRHLQKGLLPSVCQIPAPGYMFGKAIVCSDASAEAARYGFTA  925

Query  864   VDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             VDRP+GFL+LAV S+GE+I E S+ P+DTK LE++++  K  GRKK DES+HF W DD+K
Sbjct  926   VDRPDGFLLLAVVSLGEQITEMSTAPDDTKELEEEEVSVKGLGRKKPDESQHFKWVDDVK  985

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAV  550
             VPCGRL+  S+H + P +YNEYAVYDP+QV +RF+VAVKY+E+ V
Sbjct  986   VPCGRLV-ASEHADRPLEYNEYAVYDPKQVCMRFVVAVKYEEQNV  1029



>ref|XP_006424260.1| hypothetical protein CICLE_v10027891mg [Citrus clementina]
 gb|ESR37500.1| hypothetical protein CICLE_v10027891mg [Citrus clementina]
Length=734

 Score =  1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/744 (65%), Positives = 597/744 (80%), Gaps = 12/744 (2%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             MKVHETRSH H ++DEE+++TRKQKA++K  Q+  E    +P KK K       +     
Sbjct  1     MKVHETRSHAHASSDEEKVMTRKQKAENKT-QEATE----TPPKKTK------QENNDNG  49

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
                         AEFE+FC++    LS +QMR+IL+ N QDSSGSD  +V +C +++FYG
Sbjct  50    GHANGKRSGDVTAEFEEFCKSIEGQLSAEQMREILELNGQDSSGSDVAVVTKCLDMLFYG  109

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P+DKCPVC G LE   G  Y CKG +SEWS+C++ T++PPRK+EP ++P+SV  +P+SDL
Sbjct  110   PLDKCPVCNGNLEFD-GKRYSCKGMYSEWSTCTFRTKDPPRKQEPTKLPDSVLNSPISDL  168

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
              K++QDP +RP ++    VKP +GM ISL GRL+RTHQYW++ IEK+GGKVA S IG+TC
Sbjct  169   AKRYQDPSHRPRRDVGAAVKPFTGMTISLMGRLSRTHQYWRTTIEKHGGKVAASPIGLTC  228

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             LV SPAERERGGSSK+ EA+ERG  VV EAWL+DSIEK+E QPL+AYD+ +D+A D +GI
Sbjct  229   LVASPAERERGGSSKLVEAMERGTRVVSEAWLIDSIEKQEAQPLEAYDLVTDLAPDSKGI  288

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             P DK DPS EA+E+I +ELK+YGKRGV+KDTKLQ++GGK+LEKDG+LYNCA S+CDQGRG
Sbjct  289   PWDKMDPSEEAIESIAAELKLYGKRGVYKDTKLQEQGGKMLEKDGILYNCAFSLCDQGRG  348

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             +N +CIMQLI  P++ LH+YY+KG+VGD    +++LEEW   D AIKEF R+FEE+T NE
Sbjct  349   MNHYCIMQLITVPDSNLHLYYKKGKVGDDPNAEERLEEWTGVDNAIKEFVRLFEEVTDNE  408

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             F   E EKK QKKP KFYP+D+ DG+EVRHGGL +RQLG+AA HSKLDP+VANFMK+LCS
Sbjct  409   FEPWEGEKKFQKKPLKFYPIDMDDGVEVRHGGLGMRQLGVAAAHSKLDPVVANFMKVLCS  468

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
             QE+YRYALMEMG D P++PIGMLS+VHL RCE+ L  F+E ++STKE GQ+ EA+W +FS
Sbjct  469   QEVYRYALMEMGLDAPDLPIGMLSNVHLNRCEEVLQQFIEAVKSTKETGQKAEAIWTDFS  528

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             N+WFTLM S RPF  RD  +IADHAAS FE+VRDI  AS LI DMSGSTLDDPL D Y K
Sbjct  529   NRWFTLMHSLRPFIFRDNQEIADHAASSFEAVRDITVASHLIGDMSGSTLDDPLSDCYEK  588

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKL  1036
             L CSISALEKDSDDYKMI+ YLEKTY+PV++GDI YGVSV+ IF +E +A PSLD++KKL
Sbjct  589   LACSISALEKDSDDYKMIVNYLEKTYEPVKLGDIEYGVSVDKIFVIESNAQPSLDEIKKL  648

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PNKVLLWCGTRSSNLLRHLQ GFLPA CSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVDR
Sbjct  649   PNKVLLWCGTRSSNLLRHLQKGFLPASCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDR  708

Query  855   PEGFLVLAVASMGEEIMEFSSPPE  784
             PEGFLVLAVAS+G+++ E   PPE
Sbjct  709   PEGFLVLAVASLGDQVTELKKPPE  732



>ref|XP_007132419.1| hypothetical protein PHAVU_011G093100g [Phaseolus vulgaris]
 gb|ESW04413.1| hypothetical protein PHAVU_011G093100g [Phaseolus vulgaris]
Length=653

 Score =  1003 bits (2593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/652 (71%), Positives = 558/652 (86%), Gaps = 1/652 (0%)
 Frame = -2

Query  2487  LSDLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI  2308
             L  L+KK+QDP +RP K+  +  KP +GMMISL GRLTRTH YWK+ IEK+GGKVANS++
Sbjct  3     LPQLLKKYQDPSHRPHKDLGLAEKPFTGMMISLMGRLTRTHHYWKTAIEKHGGKVANSIL  62

Query  2307  GVTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVD  2128
             G TCLV SPAERERGG+SK+AEA+ERGIPVVREAWLVDSIEK+E QPL+AYD+ASD++V 
Sbjct  63    GATCLVASPAERERGGTSKLAEAMERGIPVVREAWLVDSIEKQEPQPLEAYDLASDLSVY  122

Query  2127  GRGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCD  1948
             G+GIP DKQDP  EA+E++++ELK+YGKRGV+KDTKLQ++GGKI E+DG+LYNCA S+CD
Sbjct  123   GKGIPQDKQDPGEEAIESLSAELKLYGKRGVYKDTKLQEQGGKIFERDGILYNCAFSLCD  182

Query  1947  QGRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEEL  1768
             QGRGLND+CIMQLIV PENRLHMY++KGRVGD    +++LEE +N D ++KEF+R+FEE+
Sbjct  183   QGRGLNDYCIMQLIVVPENRLHMYFKKGRVGDDPNAEERLEESDNVDSSLKEFARLFEEI  242

Query  1767  TGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMK  1588
             TGNEF   EREKK QKKP KFYP+D+ DG+EVRHG L LRQLGIA  H KL+PMVANFMK
Sbjct  243   TGNEFEPWEREKKFQKKPLKFYPIDMDDGVEVRHGALGLRQLGIAVTHCKLEPMVANFMK  302

Query  1587  ILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALW  1408
             +LCSQEIY+YALMEMGYD P++P+GM+++VHL+RCED LL F+++++S KE G + EA+W
Sbjct  303   VLCSQEIYKYALMEMGYDSPDLPVGMVTNVHLKRCEDVLLEFIDKVKSLKETGLKAEAVW  362

Query  1407  AEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYD  1228
              +FS +WFTLM STRPF  RD+ +IADHAA+  E  RDI  AS LI DM+GST+DDPL +
Sbjct  363   TDFSQRWFTLMHSTRPFNFRDYHEIADHAAAALEGARDITLASHLIGDMTGSTIDDPLSE  422

Query  1227  RYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDD  1048
              Y KLGCSIS L+K S+DY+MI+KYLE TY+PV+VGDI YGVSVENIFAV+   CPS ++
Sbjct  423   TYKKLGCSISPLDKSSNDYQMIVKYLETTYEPVKVGDIDYGVSVENIFAVQTGGCPSYEN  482

Query  1047  MKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFT  868
             + KLPNKVLLWCG+RSSNLLRHL  GFLPA+CSLPVPGYMFGKAIVCSDAAAEAA+YGFT
Sbjct  483   IVKLPNKVLLWCGSRSSNLLRHLHKGFLPAICSLPVPGYMFGKAIVCSDAAAEAARYGFT  542

Query  867   AVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDI  688
             AVDRPEGFLVLA+AS+G EI EF SPPEDT SLE+KKLG K  G+KKTDESEHFVWKDDI
Sbjct  543   AVDRPEGFLVLAIASLGNEITEFKSPPEDTSSLEEKKLGVKGLGKKKTDESEHFVWKDDI  602

Query  687   KVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             KVPCG+L+  S H +SP +YNEYAVYDP+Q  I +LV VKY+E+ VE  TAE
Sbjct  603   KVPCGKLV-ASDHQDSPLEYNEYAVYDPKQARISYLVGVKYEEKGVEIDTAE  653



>gb|EMS61650.1| Poly [ADP-ribose] polymerase 3 [Triticum urartu]
Length=824

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/832 (57%), Positives = 617/832 (74%), Gaps = 12/832 (1%)
 Frame = -2

Query  3009  VHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkaeee  2830
             VHETRS TH A +E +   ++QK + K+ +   E    S  KK    +     +K    E
Sbjct  2     VHETRSRTH-AAEEGKDAPKRQKEEHKEQEGGKE--RPSKNKKPAEPEAPTKTKKLKGGE  58

Query  2829  dgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPV  2650
                     +  E+  FC+A  EHLSV+ MR+IL+ N QD+SGS++ +VP C+++MFYGP+
Sbjct  59    SELDGKENSTKEYTDFCKAIREHLSVEDMRKILEANGQDASGSEDAVVPSCEDMMFYGPL  118

Query  2649  DKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK  2470
             +KCP CGG LEC  G  Y C G +SEW+SC +S+ NPPRK +P+++PE +    ++  +K
Sbjct  119   EKCPTCGGQLECK-GWKYKCTGKYSEWASCIFSSSNPPRKSDPIKVPEEINNDYVNKWLK  177

Query  2469  KHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLV  2290
             + Q+ K  P ++        SGMMI+LSGR++R+H Y+K QI  +GG+V NSV+GVTC+V
Sbjct  178   Q-QEGKGYPKRDVDEEAHIFSGMMIALSGRMSRSHAYFKEQILNHGGQVNNSVLGVTCVV  236

Query  2289  VSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPL  2110
              SPAER++GGS   AEA+ERG PVV E W+VDSI+KKE QPL AYD+ SD+  +GRG+PL
Sbjct  237   ASPAERDKGGSGGFAEALERGTPVVSENWIVDSIQKKEAQPLAAYDIVSDVVPEGRGLPL  296

Query  2109  DKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLN  1930
             DK DPS EA+E + +ELK+ GKR VHKD+KL  +GG I EKDG++YNCA SVCD G  +N
Sbjct  297   DKLDPSEEAIETLAAELKLAGKRSVHKDSKLDKDGGHIFEKDGIIYNCACSVCDLGSEMN  356

Query  1929  DFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENE-DGAIKEFSRIFEELTGNEF  1753
              FCIMQLI+ PE  LH++Y+KG +G     ++++E++ N  + AIKEF+R+FEE+TGNEF
Sbjct  357   QFCIMQLIMLPEKHLHLFYKKGPIGHDQMAEERVEDFGNRVNDAIKEFARLFEEVTGNEF  416

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
                EREKK +KK  K YPLD+  G +VRHGG ALRQLG AA H KLDP ++  +K LC Q
Sbjct  417   EPWEREKKFEKKSMKMYPLDMDVGFDVRHGGAALRQLGAAAAHCKLDPAISFLLKQLCGQ  476

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             EIYRYAL EM  D P++P+GML+D+HL+R E+ LL ++    +  E+G   +ALW E SN
Sbjct  477   EIYRYALTEMAQDLPDLPVGMLTDLHLKRGEEVLLEWIRDAEAVPESGPAADALWIEISN  536

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
             KWFTL P+TRP+ +R F  IAD+ AS FE++RDIN AS LI D+ GSTLDDPL + Y KL
Sbjct  537   KWFTLFPTTRPYIMRGFEQIADNVASGFETIRDINVASHLIGDVFGSTLDDPLSECYKKL  596

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLP  1033
             GCSI+++ +DSDDYKMI+KYLEKTY+PV+V D+ YGVSV+ I+AVE SA PS +++KKLP
Sbjct  597   GCSINSVPEDSDDYKMIVKYLEKTYEPVKVDDVVYGVSVDRIYAVESSAFPSYEEIKKLP  656

Query  1032  NKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRP  853
             NKVLLWCGTRSSNLLRHL  GF+PAVC LPVPGYMFG+AIVCSDAAAEAA+YG+TAVDRP
Sbjct  657   NKVLLWCGTRSSNLLRHLHKGFMPAVCHLPVPGYMFGRAIVCSDAAAEAARYGYTAVDRP  716

Query  852   EGFLVLAVASMGEEIMEFSSPP--EDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             EG+LVLAVAS+GEEI E +  P  ED KSLE+KKLG K  GRK TDESEH  W+DD+KVP
Sbjct  717   EGYLVLAVASLGEEIKEITGTPGAEDVKSLEEKKLGVKGVGRKTTDESEHLTWRDDVKVP  776

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDE  523
             CG+L+  S + + P +YNE+AVYDP+QVSI+FLV V+Y+E+ +E     PDE
Sbjct  777   CGKLV-PSGNEDGPLEYNEFAVYDPKQVSIQFLVGVRYEEQNMEVV---PDE  824



>ref|XP_006648689.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Oryza brachyantha]
Length=873

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/840 (57%), Positives = 619/840 (74%), Gaps = 20/840 (2%)
 Frame = -2

Query  3012  KVHETRSHTHHANDEE-RMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdgg--------  2860
             +VHETRS T  A+ E+ +   +KQK +SK+ ++ +    + P+K  K+ D          
Sbjct  41    EVHETRSRTLAASQEDGKADPKKQKTESKEQEEGE----DVPSKNKKSADNEVHDGEEEA  96

Query  2859  -agdekkaeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVP  2683
              +  +K   EE        A  EF +FC+AT EHL+V+ MR+ILQ N QD+SGS++ +VP
Sbjct  97    PSKSKKHKAEESDLNGKATAVKEFAEFCKATREHLTVEDMRKILQANEQDASGSEDAVVP  156

Query  2682  RCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPES  2503
             RC+++MFYGP+DKCPVCGG LEC  G  Y C G +SEW+SCSYST +P R+  P+++P+ 
Sbjct  157   RCEDVMFYGPLDKCPVCGGQLECK-GSKYKCTGTYSEWASCSYSTIDPLRRRGPIKVPDD  215

Query  2502  VQKTPLSDLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV  2323
             V+   +   +K+H+  K  P ++  I     SGMMI+LSGR++ +H Y+K QI K+GGKV
Sbjct  216   VKNDFVRKWLKQHEG-KKYPKRDMDIDAHIFSGMMIALSGRMSHSHAYFKEQILKHGGKV  274

Query  2322  ANSVIGVTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVAS  2143
              NSV+GVTC+V SPAER++GGS   AEA+ERG PVV E W++DSI+KKE QPL AYD+AS
Sbjct  275   NNSVVGVTCVVASPAERDQGGSGGFAEALERGTPVVSENWIIDSIQKKERQPLAAYDIAS  334

Query  2142  DIAVDGRGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCA  1963
             D+  +GRG+PL K DP+ EA+E + +E+K+ GKR V+KD+KL+ +GG I EKDG++YNCA
Sbjct  335   DVVPEGRGLPLGKLDPTEEAVETLAAEVKLTGKRAVYKDSKLEKDGGHIYEKDGIIYNCA  394

Query  1962  LSVCDQGRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENE-DGAIKEFS  1786
              S+CD G  +N FCIMQLI+ PENRLH+YY+KG +G     ++++E++ +  + AIKEF 
Sbjct  395   FSMCDLGCDINQFCIMQLIIIPENRLHLYYKKGPIGHDQMAEERVEDFGSRVNDAIKEFV  454

Query  1785  RIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPM  1606
             R+FEE+TGNEF   EREKK +KK  K +PLD+ DG++VRHGG+ALRQLG+ A H KLDP 
Sbjct  455   RLFEEITGNEFEPWEREKKFEKKSTKMFPLDMDDGVDVRHGGVALRQLGLTAAHCKLDPS  514

Query  1605  VANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQ  1426
             V   MK LCSQEIYRYAL EMG+D P++PIGML+D+HL+R E+ LL   +   S  E+G 
Sbjct  515   VTFIMKQLCSQEIYRYALTEMGHDLPDLPIGMLTDLHLKRGEEILLQSKQDAESVPESGP  574

Query  1425  QVEALWAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTL  1246
               +A W E SNKWFTL P+TRP+ +R +  IAD+ AS  E+VRDIN ASRLI D   STL
Sbjct  575   VADAFWIEMSNKWFTLFPTTRPYTIRGYEQIADNVASGLETVRDINVASRLIGDTFSSTL  634

Query  1245  DDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA  1066
             DDPL   Y KLGCSIS +  DSDDYKMILKYLEKTY+PV+V D+ YG +VE I+AVE SA
Sbjct  635   DDPLSQCYKKLGCSISRVADDSDDYKMILKYLEKTYEPVKVDDVVYGATVERIYAVESSA  694

Query  1065  CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEA  886
              PS  ++KK PNKVLLWCGTRSSNLLRHL  GFLPAVC LPVPGYMFGKAIVCSDAAAEA
Sbjct  695   LPSYGEIKKHPNKVLLWCGTRSSNLLRHLHQGFLPAVCHLPVPGYMFGKAIVCSDAAAEA  754

Query  885   AKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPP--EDTKSLEQKKLGAKFHGRKKTDESE  712
             A+YGFTAVDRPEG+LVLAVAS+G+EI E +  P  ED K +E+KK+G K  GRK TD SE
Sbjct  755   ARYGFTAVDRPEGYLVLAVASLGKEIQEITGTPGTEDVKRMEEKKMGVKGVGRKTTDASE  814

Query  711   HFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             HF W+D + VPCG+L+  S +   P +YNEYAVYDP+QVSI FLV VKY+E+ +E    E
Sbjct  815   HFTWRDGVTVPCGKLV-PSGNKGGPLEYNEYAVYDPKQVSIAFLVGVKYEEQNMEVVADE  873



>ref|XP_003575066.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Brachypodium distachyon]
Length=824

 Score =   963 bits (2489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/834 (56%), Positives = 617/834 (74%), Gaps = 16/834 (2%)
 Frame = -2

Query  3009  VHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTd--ggagdekkae  2836
             VHETRS TH A +E +   ++QKA++K+     E    +P K  K+ +       +K   
Sbjct  2     VHETRSRTHAA-EEGKAAPKRQKAENKE----QEGGQQAPAKNKKSVEPEASTKTKKLKA  56

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
             ++       +A  EF  FC+A  EHLS+  MR+IL+ N QD+SGS++ +VP C++++FYG
Sbjct  57    DQSELNGKDSATKEFMGFCKAIREHLSIDDMRKILEANEQDASGSEDAVVPSCEDMLFYG  116

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P++KCP+CGG LEC  G  Y C G +SEW+SC + T NPPRK  P+++P+ V    ++  
Sbjct  117   PLEKCPICGGQLECM-GWKYKCTGKYSEWASCVFRTNNPPRKGGPIKVPDDVSNDFVNKW  175

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +K+ Q+ K  P ++        SGMMI+LSGR++R+H Y++ QI K+GGKV+NSV+GVTC
Sbjct  176   LKQ-QEGKGYPKRDMDEEAHIFSGMMIALSGRMSRSHAYFREQIMKHGGKVSNSVLGVTC  234

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             +V SPAER+RGGS   AEA+ERG P+V E W+VDSI+KKE QPL AYD+ SD+  +G+G+
Sbjct  235   VVASPAERDRGGSGGFAEALERGTPIVSENWIVDSIQKKEAQPLAAYDIVSDVVPEGKGL  294

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             PLDK DPS EA+E + +ELK+ GKR VHKD+KL  +GG+I E DG++YNCA SVCD G  
Sbjct  295   PLDKLDPSEEAIETLAAELKLAGKRSVHKDSKLDKDGGRIFEDDGVIYNCAFSVCDLGSE  354

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENE-DGAIKEFSRIFEELTGN  1759
             +N FCIMQLI+ P+NRLH+YY+KG +G     ++++E++ +  + AIKEF R+FEE+TGN
Sbjct  355   MNQFCIMQLIMVPDNRLHLYYKKGPIGHDQMAEERVEDFGSRVNDAIKEFVRLFEEVTGN  414

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKK +KK  K YPLD+  G +VRHGG+ALR LG AA H KLDP ++  +K LC
Sbjct  415   EFEPWEREKKFEKKSMKMYPLDMDVGYDVRHGGVALRHLGSAAAHCKLDPSISFLLKQLC  474

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
             SQEIYRYAL EM  D P++P+GML+D+HL+R E+ LL ++       E+    +A W E 
Sbjct  475   SQEIYRYALTEMAQDLPDLPVGMLTDLHLKRGEEMLLQWIRDAEPAPESRPAADAFWIEI  534

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             SNKWFTL P+TRP+ +R F  IAD+ AS FE++RDIN AS LI D  GSTLDDPL + Y 
Sbjct  535   SNKWFTLFPTTRPYTMRGFEQIADNVASGFETIRDINVASHLIGDTFGSTLDDPLSECYK  594

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGCSI+ + +DS+DYKMI KYLEKTY+PV+V D+ YGVS++ I+AVE SA PS +D+K 
Sbjct  595   KLGCSINCVVEDSEDYKMIAKYLEKTYEPVKVDDVVYGVSIDRIYAVESSAFPSYNDIKN  654

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLRH+  GFLPAVC LPVPGYMFGKAIVCSDAAAEAA+YGFTAVD
Sbjct  655   LPNKVLLWCGTRSSNLLRHIHKGFLPAVCHLPVPGYMFGKAIVCSDAAAEAARYGFTAVD  714

Query  858   RPEGFLVLAVASMGEEIMEFSSPP--EDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             RPEG+LVLAVAS+GEEI E +  P  ED KS+E+KK+G K  GRK TD+SEH  W+DD+K
Sbjct  715   RPEGYLVLAVASLGEEIKEITGTPGAEDVKSMEEKKVGVKGVGRKTTDDSEHITWRDDVK  774

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDE  523
             VPCG+L+  S + + P +YNE+AVYDP+QVSI+FLV V+Y+E+ +E     PDE
Sbjct  775   VPCGKLV-PSGNKDGPLEYNEFAVYDPKQVSIQFLVGVRYEEQNMELV---PDE  824



>ref|NP_001047021.1| Os02g0530600 [Oryza sativa Japonica Group]
 sp|Q0E0Q3.1|PARP3_ORYSJ RecName: Full=Poly [ADP-ribose] polymerase 3; Short=PARP-3; AltName: 
Full=NAD(+) ADP-ribosyltransferase 3; Short=ADPRT-3; 
AltName: Full=Poly[ADP-ribose] synthase 3 [Oryza sativa Japonica 
Group]
 dbj|BAF08935.1| Os02g0530600 [Oryza sativa Japonica Group]
 dbj|BAG95668.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73311.1| hypothetical protein OsI_07496 [Oryza sativa Indica Group]
 gb|EEE57119.1| hypothetical protein OsJ_06997 [Oryza sativa Japonica Group]
Length=831

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/843 (58%), Positives = 624/843 (74%), Gaps = 27/843 (3%)
 Frame = -2

Query  3009  VHETRSHTHHANDEE-RMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdgg--------a  2857
             VHETRS T  A+ EE +   +KQK +SK+     E    +P+K  KT D          +
Sbjct  2     VHETRSRTLAASQEEGKAAPKKQKTESKE----QEGGQQAPSKNKKTADNEEHDGEQEPS  57

Query  2856  gdekkaeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRC  2677
              ++K   EE        A  EF +FC+A  EHL+++ MR+ILQ N QD+SGS++ +VPRC
Sbjct  58    KNKKLKAEESDLNGKATAVKEFSEFCKAIREHLTIEDMRKILQGNEQDASGSEDAVVPRC  117

Query  2676  QEIMFYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQ  2497
             +++MFYGP+DKCPVCGG LEC  G  Y+C G  SEW+ CS+ST NP R+  P+++P+ V+
Sbjct  118   EDVMFYGPLDKCPVCGGQLECK-GLKYNCTGTHSEWACCSFSTNNPSRRGGPIKVPDDVK  176

Query  2496  KTPLSDLIKKHQDPK--NRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV  2323
                +   +K+ +  K   R L ++ I     SGMMI+LSGR++R+H Y+K QI K+GGKV
Sbjct  177   NDFVRKWLKQQEGNKYPKRNLDDEGI----FSGMMIALSGRMSRSHGYFKEQIMKHGGKV  232

Query  2322  ANSVIGVTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVAS  2143
              NSVIGVTC+V SPAER +GGS   AEA+ERG PVV E W++DS++KKE QPL AYD+AS
Sbjct  233   NNSVIGVTCVVASPAERHQGGSGGFAEALERGTPVVSENWIIDSVQKKEKQPLAAYDIAS  292

Query  2142  DIAVDGRGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCA  1963
             D+  +GRG+PL   DP+ EA+E + +ELK+ GKR VHKD+KL+ +GG I EKDG++YNCA
Sbjct  293   DVVPEGRGLPLGNLDPTEEAIETLAAELKLAGKRAVHKDSKLEKDGGHIYEKDGIIYNCA  352

Query  1962  LSVCDQGRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENE-DGAIKEFS  1786
              SVCD G  +N  CIMQLI+ PEN LH+YY+KG +G     ++++E++ +  + AIKEF 
Sbjct  353   FSVCDLGGDINQLCIMQLIMVPENHLHLYYKKGPIGHDQMAEERVEDFGSRFNDAIKEFV  412

Query  1785  RIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPM  1606
             R+FEE+TGNEF   EREKK +KK  K YPLD+ DG++VRHGG+ALRQLG AA H KLDP 
Sbjct  413   RLFEEVTGNEFEPWEREKKFKKKCMKMYPLDMDDGVDVRHGGVALRQLGAAAAHCKLDPS  472

Query  1605  VANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQ  1426
             V   MK LCSQEIYRYAL EMG+D P++PIGML+D+HL+R E+TLL + + + S  E+G 
Sbjct  473   VTFIMKQLCSQEIYRYALTEMGHDVPDLPIGMLTDLHLKRGEETLLEWKQDVESAPESGP  532

Query  1425  QVEALWAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTL  1246
               +A W E SNKWFTL P+TRP+ ++ +  IAD+ AS  E+VRDIN ASRLI D+ GSTL
Sbjct  533   AADAFWMEISNKWFTLFPTTRPYTMKGYEQIADNVASGLETVRDINVASRLIGDVFGSTL  592

Query  1245  DDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA  1066
             DDPL   Y KLGCSI+ + +DS+DYKMILKYLEKTY+PV+VGD+ Y  +VE I+AVE SA
Sbjct  593   DDPLSQCYKKLGCSINRVVEDSEDYKMILKYLEKTYEPVKVGDVVYSATVERIYAVESSA  652

Query  1065  CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEA  886
              PS D++KKLPNKVLLWCGTRSSNLLRHL++GF+PAVC +PVPGYMFGKAIVCSDAAAEA
Sbjct  653   LPSYDEIKKLPNKVLLWCGTRSSNLLRHLRDGFVPAVCHIPVPGYMFGKAIVCSDAAAEA  712

Query  885   AKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPP--EDTKSLEQKKLGAKFHGRKKTDESE  712
             A YGFTAVDRPEG+LVLAVAS+G+EI E +  P  ED K +E+KK+G K  GRK TD SE
Sbjct  713   ALYGFTAVDRPEGYLVLAVASLGKEIQEITGTPGSEDVKRMEEKKMGVKGVGRKTTDPSE  772

Query  711   HFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAE  532
             HF W+D + VPCG+L+  S + + P +YNEYAVYDP+QVSI FLV VKY+E+ +E     
Sbjct  773   HFTWRDGVTVPCGKLV-PSTNKDGPLEYNEYAVYDPKQVSIAFLVGVKYEEQNMEVV---  828

Query  531   PDE  523
             PDE
Sbjct  829   PDE  831



>ref|XP_004952637.1| PREDICTED: poly [ADP-ribose] polymerase 3-like [Setaria italica]
Length=834

 Score =   956 bits (2471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/831 (57%), Positives = 614/831 (74%), Gaps = 14/831 (2%)
 Frame = -2

Query  3009  VHETRSHTHHANDEE-RMVTRKQKADSKQLQDHDEPLHNSPTKKAKT------Tdggagd  2851
             VHETRS  H A  EE +  ++KQK +SK  Q+  + + +   K A+       ++    +
Sbjct  2     VHETRSRAHAAAQEEGKAASKKQKTESKD-QERGQHVTSKNKKSAENKGQDGESEAPMKN  60

Query  2850  ekkaeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQE  2671
              K   EE        AA EF +FC+A  EHLSV+ MR+ILQ N QD+SGS++ +V RC++
Sbjct  61    RKLKAEESEPNGKGTAAREFTEFCKAIGEHLSVEDMRKILQANEQDASGSEDAVVARCED  120

Query  2670  IMFYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKT  2491
             +MFYGP+ KCP+CGG LE   G  Y C G++SEW+ C++ST +PPRK  P+ +PE ++  
Sbjct  121   MMFYGPLKKCPICGGQLEFK-GWKYKCTGNYSEWAHCTFSTNDPPRKSGPIEVPEDIKDD  179

Query  2490  PLSDLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSV  2311
              +   +K+ Q+ K  P ++        SGMMI+LSGR++R+H Y+K QI K+GGKV NSV
Sbjct  180   FVHKWLKQ-QEGKEFPKRDVDEEAHIFSGMMIALSGRMSRSHGYFKEQITKHGGKVNNSV  238

Query  2310  IGVTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAV  2131
             +GVTC+V SPAER++GGS   AEA+ERG PVV E W++DSIEKKEVQPL AYD+ASD+  
Sbjct  239   LGVTCVVASPAERDKGGSGGFAEALERGTPVVSENWIMDSIEKKEVQPLAAYDIASDVVP  298

Query  2130  DGRGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVC  1951
             +GRG+PL + DPS EA+E + +E+K+ GKR VHKD+KL+ +GG I EKDG++YNCA ++C
Sbjct  299   EGRGLPLGQLDPSEEAIETLAAEVKLAGKRAVHKDSKLEKDGGCIFEKDGIIYNCAFALC  358

Query  1950  DQGRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENE-DGAIKEFSRIFE  1774
             D G  +N  CIMQL++ PENRLH++Y+KG +G     ++++E++ +  + AIKEF R+FE
Sbjct  359   DLGCDMNQLCIMQLVMVPENRLHLFYKKGPIGHDQMAEERVEDFGSRVNDAIKEFVRLFE  418

Query  1773  ELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANF  1594
             E+TGNEF   EREKK +KK  K YPLD+  G++VRHGG ALRQLG AA H KLDP V+  
Sbjct  419   EVTGNEFEPWEREKKFEKKSMKMYPLDMDVGVDVRHGGAALRQLGTAAAHCKLDPAVSFL  478

Query  1593  MKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEA  1414
             +K LC QEIYRYALMEM  D P++PIGMLSD+HL R E+ LL       S  E+G + +A
Sbjct  479   VKQLCGQEIYRYALMEMAQDLPDLPIGMLSDLHLRRGEEMLLQMRRDAESVPESGPEADA  538

Query  1413  LWAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPL  1234
              W E S KWFTL P+TRP+ LR F  IAD+ AS  E++RDIN ASRLI D+ GSTLDDPL
Sbjct  539   FWTEISAKWFTLFPTTRPYVLRGFEQIADNVASGLETIRDINDASRLIGDVFGSTLDDPL  598

Query  1233  YDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSL  1054
              + Y KLGCSI+ + +DS+DYKMIL+YLE TY+PV+V D+ YGVSVE I+AVE S+ PS 
Sbjct  599   SECYKKLGCSINPVAEDSEDYKMILRYLETTYEPVKVDDVVYGVSVERIYAVESSSFPSY  658

Query  1053  DDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYG  874
             + +K LPNK+LLWCGTRSSNLLRHL  GFLPAVC LPVPGYMFGKAIVCSDAAAEAA+YG
Sbjct  659   EKIKNLPNKILLWCGTRSSNLLRHLHKGFLPAVCHLPVPGYMFGKAIVCSDAAAEAARYG  718

Query  873   FTAVDRPEGFLVLAVASMGEEIMEFSSPP--EDTKSLEQKKLGAKFHGRKKTDESEHFVW  700
             FTAVDRPEG+LVLAVAS+G EI E +  P  ED +  E+KK+G K  GRKKT+ESEH  W
Sbjct  719   FTAVDRPEGYLVLAVASLGNEITEVTGTPGAEDAQGFEEKKIGVKGVGRKKTNESEHLTW  778

Query  699   KDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVE  547
             +D +KVPCG+L+  S++ N P +Y+EYAVYDP+QVSI FLVAVKY+E+ +E
Sbjct  779   RDGVKVPCGKLV-PSRNKNGPLEYSEYAVYDPKQVSICFLVAVKYEEQNME  828



>gb|EMT09472.1| Poly (ADP-ribose) polymerase 3 [Aegilops tauschii]
Length=829

 Score =   955 bits (2468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/834 (56%), Positives = 617/834 (74%), Gaps = 12/834 (1%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             ++VHETRS TH A +E +   + QK + K+ +   E    S  KK    +     +K   
Sbjct  5     LEVHETRSRTH-AAEEGKNAPKGQKEEHKEQEGGKE--RPSKNKKPVEPEAPTKTKKLKG  61

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
              E        +  EFE FC+A  EHLSV+ MR+IL+ N QD+SG ++ +V  C+++MFYG
Sbjct  62    GESELDGKENSTKEFEDFCKAIREHLSVEDMRKILEANDQDASGPEDAVVQICEDMMFYG  121

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
             P++KCP+CGG LEC  G  Y C G +SEW+SC +S+ NPPR+ +P+++PE +    ++  
Sbjct  122   PLEKCPMCGGQLECK-GWKYKCTGKYSEWASCIFSSSNPPRRSDPIKVPEDISNDFVNKW  180

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTC  2296
             +K+ Q+ K  P ++        SGMMI+LSGR++R+H Y+K QI  +GGKV NSV+GVTC
Sbjct  181   LKQ-QEGKGYPKRDVDEEAHIFSGMMIALSGRMSRSHAYFKEQILNHGGKVNNSVLGVTC  239

Query  2295  LVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGI  2116
             +V SPAER++GGS   AEA+ERG PVV E W+VDSI+KKE QPL AYD+ SD+  +GRG+
Sbjct  240   VVASPAERDKGGSGGFAEALERGTPVVSENWIVDSIQKKEAQPLAAYDIVSDVVPEGRGL  299

Query  2115  PLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRG  1936
             PLDK DPS EA+E + +ELK+ GKR VHKD+KL  +GG I EKDG++YNCA S+C+ G  
Sbjct  300   PLDKLDPSEEAIETLAAELKLAGKRSVHKDSKLDKDGGHIFEKDGIIYNCACSICELGSE  359

Query  1935  LNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWEN-EDGAIKEFSRIFEELTGN  1759
             +N FCIMQLI+ PE +LH++Y+KG +G     ++++E++ N  + AIKEF+R+FEE+TGN
Sbjct  360   MNQFCIMQLIMLPEKQLHLFYKKGPIGHDQMAEERVEDFGNCVNDAIKEFARLFEEVTGN  419

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
             EF   EREKK +KK  K YPLD+  G +VRHGG ALRQLG AA H KLDP ++  +K LC
Sbjct  420   EFEPWEREKKFEKKSMKMYPLDMDVGFDVRHGGAALRQLGAAAAHCKLDPAISFLLKQLC  479

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
              QEIYRYAL EM  D P++P+GML+D+HL+R E+ LL ++    +  E+G   +ALW E 
Sbjct  480   GQEIYRYALTEMAQDLPDLPVGMLTDLHLKRGEEVLLEWIRDAEAAPESGPAADALWIEI  539

Query  1398  SNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYV  1219
             SNKWFTL P+TRP+ +R F  IAD+ AS FE++RDIN AS LI DM  STLDDPL + Y 
Sbjct  540   SNKWFTLFPTTRPYIMRGFEQIADNVASGFETIRDINVASHLIGDMFDSTLDDPLSECYK  599

Query  1218  KLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK  1039
             KLGCSI+++ +DS+DYKMI+KYLEKTY+PV+V D+ YGVSV+ I+AVE SA PS +++KK
Sbjct  600   KLGCSINSVPEDSEDYKMIVKYLEKTYEPVKVDDVVYGVSVDRIYAVESSAFPSYEEIKK  659

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             LPNKVLLWCGTRSSNLLRHL  GFLPAVC LPVPGYMFG+A+VCSDAAAEAA+YG+TAVD
Sbjct  660   LPNKVLLWCGTRSSNLLRHLHKGFLPAVCHLPVPGYMFGRALVCSDAAAEAARYGYTAVD  719

Query  858   RPEGFLVLAVASMGEEIMEFSSPP--EDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             RPEG+LVLAVAS+G+EI E +  P  ED KSLE+KKLG K  GRK TDESEH  W+D +K
Sbjct  720   RPEGYLVLAVASLGKEIKEITGTPGAEDVKSLEEKKLGVKGVGRKTTDESEHLTWRDGVK  779

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDE  523
             VPCG+L+  S + + P +YNE+AVYDP+QVSI+FLV V+Y+E+ +E     PDE
Sbjct  780   VPCGKLV-PSGNEHGPLEYNEFAVYDPKQVSIQFLVGVRYEEQNMEVV---PDE  829



>gb|ADK35366.1| poly(ADP-ribose) polymerase [Hordeum vulgare subsp. vulgare]
Length=824

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/832 (56%), Positives = 600/832 (72%), Gaps = 12/832 (1%)
 Frame = -2

Query  3009  VHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkaeee  2830
             VHETRS TH A +E +   +KQK + K+ +   E    S  KK    +     +K    E
Sbjct  2     VHETRSRTH-ATEEGKTAPKKQKEEHKEQEGGQE--RPSKNKKPVEPEAETKTKKHKGGE  58

Query  2829  dgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPV  2650
                     A  E+  FC+A  EHLS + MR+IL+ N QD+SGS++ +V  C+++MFYGP+
Sbjct  59    SELDGKDNATKEYTDFCKAIREHLSAEDMRKILEANGQDASGSEDAVVSSCEDMMFYGPL  118

Query  2649  DKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK  2470
             +KCP+CGG LEC  G  Y C G  SEW+SC +S+ +PPRK  P+++PE V    L+  +K
Sbjct  119   EKCPICGGQLECK-GWKYKCTGQNSEWASCIFSSNSPPRKSAPIKVPEDVSNDFLNKWLK  177

Query  2469  KHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLV  2290
             + Q+ K  P ++        SGMM++LSGR++R+H Y+K QI  +GG+V     GVTC+V
Sbjct  178   Q-QEGKGYPKRDVDEEAHIFSGMMVALSGRMSRSHAYFKEQILNHGGQVKIPCFGVTCVV  236

Query  2289  VSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPL  2110
              SPAER++GGS   AEA+ERG PVV E W+VDSI+KKE QPL AYD+ SD+  +GRG+PL
Sbjct  237   ASPAERDKGGSGGFAEALERGTPVVSENWIVDSIQKKEAQPLAAYDIVSDVVPEGRGLPL  296

Query  2109  DKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLN  1930
             DK DPS EA+E + +ELK+ GKR VHKD+KL  +GG I EKDG++YNCA S+CD G   N
Sbjct  297   DKLDPSEEAIETLAAELKLAGKRSVHKDSKLDKDGGCIFEKDGIIYNCACSICDLGSETN  356

Query  1929  DFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWE-NEDGAIKEFSRIFEELTGNEF  1753
               CIMQLI+ PE  LH++Y+KG +G     ++++E++  + + AI EF+R+F+E+TGN+F
Sbjct  357   QLCIMQLIMLPEEHLHLFYKKGPIGHDQMAEERVEDFGIHVNDAIMEFARLFKEVTGNDF  416

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
                EREKK +KK  K YPLD+  G +VRHGG ALRQLG AA H KLDP ++  +K LC Q
Sbjct  417   EPWEREKKFEKKSMKMYPLDMDVGFDVRHGGAALRQLGAAAAHCKLDPAISFLLKQLCGQ  476

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             EIYRYAL EM  D P++PIGML+DVHL+R E+ LL ++       E+    +A W E SN
Sbjct  477   EIYRYALTEMAQDLPDLPIGMLTDVHLKRGEEVLLEWIRDAEPAPESRLAADAFWIEISN  536

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
             KWFTL P+TRP+ +R F  IAD+ AS FE++RDIN AS LI D   STLDDPL + Y KL
Sbjct  537   KWFTLFPTTRPYIMRGFEQIADNVASGFETIRDINDASHLIGDAFASTLDDPLSECYKKL  596

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLP  1033
             GCSI+++ +DS+DYKMI+KYLEKTY+PV+V D+ YGVSV+ I+AVE SA PS  ++KKLP
Sbjct  597   GCSINSVPEDSEDYKMIVKYLEKTYEPVKVDDVVYGVSVDRIYAVESSAFPSYSEIKKLP  656

Query  1032  NKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRP  853
             NKVLLWCGTRSSNLLRHL  GFLPAVC LPVPGYMFG+AIVCSDAAAEAA+YG+TAVDRP
Sbjct  657   NKVLLWCGTRSSNLLRHLHRGFLPAVCHLPVPGYMFGRAIVCSDAAAEAARYGYTAVDRP  716

Query  852   EGFLVLAVASMGEEIMEFSSPP--EDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             EG+LVLAVAS+GEEI E +  P  ED KSLE+KK G K  GRK TDESEHF W+D +KVP
Sbjct  717   EGYLVLAVASLGEEIKEITGTPGAEDVKSLEEKKPGVKGVGRKTTDESEHFTWRDGVKVP  776

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTAEPDE  523
             CG+L+  S + + P +YNE+A+YDP+QVSI+FLV V+Y+E+ +E     PDE
Sbjct  777   CGKLV-PSGNEDGPLEYNEFALYDPKQVSIQFLVGVRYEEQNMEVV---PDE  824



>dbj|BAD25449.1| putative seed maturation protein [Oryza sativa Japonica Group]
Length=737

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/746 (61%), Positives = 576/746 (77%), Gaps = 14/746 (2%)
 Frame = -2

Query  2745  MRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDFSEWS  2566
             MR+ILQ N QD+SGS++ +VPRC+++MFYGP+DKCPVCGG LEC  G  Y+C G  SEW+
Sbjct  1     MRKILQGNEQDASGSEDAVVPRCEDVMFYGPLDKCPVCGGQLECK-GLKYNCTGTHSEWA  59

Query  2565  SCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK--NRPLKEQVITVKPLSGMMIS  2392
              CS+ST NP R+  P+++P+ V+   +   +K+ +  K   R L ++ I     SGMMI+
Sbjct  60    CCSFSTNNPSRRGGPIKVPDDVKNDFVRKWLKQQEGNKYPKRNLDDEGI----FSGMMIA  115

Query  2391  LSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERERGGSSKVAEAVERGIPVVR  2212
             LSGR++R+H Y+K QI K+GGKV NSVIGVTC+V SPAER +GGS   AEA+ERG PVV 
Sbjct  116   LSGRMSRSHGYFKEQIMKHGGKVNNSVIGVTCVVASPAERHQGGSGGFAEALERGTPVVS  175

Query  2211  EAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEALENITSELKVYGKRGVH  2032
             E W++DS++KKE QPL AYD+ASD+  +GRG+PL   DP+ EA+E + +ELK+ GKR VH
Sbjct  176   ENWIIDSVQKKEKQPLAAYDIASDVVPEGRGLPLGNLDPTEEAIETLAAELKLAGKRAVH  235

Query  2031  KDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRKGRVGD  1852
             KD+KL+ +GG I EKDG++YNCA SVCD G  +N  CIMQLI+ PEN LH+YY+KG +G 
Sbjct  236   KDSKLEKDGGHIYEKDGIIYNCAFSVCDLGGDINQLCIMQLIMVPENHLHLYYKKGPIGH  295

Query  1851  TARVDDKLEEWENE-DGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIE  1675
                 ++++E++ +  + AIKEF R+FEE+TGNEF   EREKK +KK  K YPLD+ DG++
Sbjct  296   DQMAEERVEDFGSRFNDAIKEFVRLFEEVTGNEFEPWEREKKFKKKCMKMYPLDMDDGVD  355

Query  1674  VRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVH  1495
             VRHGG+ALRQLG AA H KLDP V   MK LCSQEIYRYAL EMG+D P++PIGML+D+H
Sbjct  356   VRHGGVALRQLGAAAAHCKLDPSVTFIMKQLCSQEIYRYALTEMGHDVPDLPIGMLTDLH  415

Query  1494  LERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLRDFADIADHAAS  1315
             L+R E+TLL + + + S  E+G   +A W E SNKWFTL P+TRP+ ++ +  IAD+ AS
Sbjct  416   LKRGEETLLEWKQDVESAPESGPAADAFWMEISNKWFTLFPTTRPYTMKGYEQIADNVAS  475

Query  1314  VFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYD  1135
               E+VRDIN ASRLI D+ GSTLDDPL   Y KLGCSI+ + +DS+DYKMILKYLEKTY+
Sbjct  476   GLETVRDINVASRLIGDVFGSTLDDPLSQCYKKLGCSINRVVEDSEDYKMILKYLEKTYE  535

Query  1134  PVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAV  955
             PV+VGD+ Y  +VE I+AVE SA PS D++KKLPNKVLLWCGTRSSNLLRHL++GF+PAV
Sbjct  536   PVKVGDVVYSATVERIYAVESSALPSYDEIKKLPNKVLLWCGTRSSNLLRHLRDGFVPAV  595

Query  954   CSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPP--ED  781
             C +PVPGYMFGKAIVCSDAAAEAA YGFTAVDRPEG+LVLAVAS+G+EI E +  P  ED
Sbjct  596   CHIPVPGYMFGKAIVCSDAAAEAALYGFTAVDRPEGYLVLAVASLGKEIQEITGTPGSED  655

Query  780   TKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQ  601
              K +E+KK+G K  GRK TD SEHF W+D + VPCG+L+  S + + P +YNEYAVYDP+
Sbjct  656   VKRMEEKKMGVKGVGRKTTDPSEHFTWRDGVTVPCGKLV-PSTNKDGPLEYNEYAVYDPK  714

Query  600   QVSIRFLVAVKYDEEAVEYYTAEPDE  523
             QVSI FLV VKY+E+ +E     PDE
Sbjct  715   QVSIAFLVGVKYEEQNMEVV---PDE  737



>ref|XP_008645748.1| PREDICTED: poly [ADP-ribose] polymerase 3 [Zea mays]
 gb|AFW71667.1| hypothetical protein ZEAMMB73_751700 [Zea mays]
Length=836

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/838 (55%), Positives = 606/838 (72%), Gaps = 27/838 (3%)
 Frame = -2

Query  3009  VHETRSHTHHANDEE-RMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdgg---------  2860
             VHETRS  H A  EE ++ ++KQK D+    +  E   N P+K  K+ D           
Sbjct  2     VHETRSRVHAAAQEEGKLASKKQKPDN----ETKERGQNVPSKNKKSADNEGKDGEPEAP  57

Query  2859  agdekkaeeedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPR  2680
                +K   EE       AAA EF +FC+A  E LS++ MR+ILQ N QD+SGS++ +VPR
Sbjct  58    TKSKKLKAEESEPNGREAAAREFAEFCKAIGERLSLEDMRKILQANEQDASGSEDAVVPR  117

Query  2679  CQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESV  2500
             C+++MFYGP++KCPVC G LE      Y C G++SEW+ C++ST +P R+   + +P+ +
Sbjct  118   CEDMMFYGPLEKCPVCEGQLEFKEW-KYKCTGNYSEWARCTFSTNDPSRRSGSIEVPDDI  176

Query  2499  QKTPLSDLIKK---HQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGG  2329
             +     D I+K    Q+ K  P ++        SGMMI+LSGR++R+H Y+K QI K+GG
Sbjct  177   K----DDFIRKWLKQQEGKEFPKRDLDEEAHIFSGMMIALSGRMSRSHGYFKEQIMKHGG  232

Query  2328  KVANSVIGVTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDV  2149
             KV NSV+G TC+V SPAER++GGS   AEA+ERG PVV E W++DSIEKKE QP  AYD+
Sbjct  233   KVKNSVLGATCVVASPAERDKGGSGGFAEALERGTPVVSENWIIDSIEKKEAQPFAAYDI  292

Query  2148  ASDIAVDGRGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYN  1969
              +D+  +GRG+PL + DPS EA+E + +E+K+ GKR VHKD+KL  +GG + EKDG++YN
Sbjct  293   VTDVVPEGRGLPLGQLDPSEEAIETLAAEVKLAGKRSVHKDSKLDKDGGCVFEKDGIIYN  352

Query  1968  CALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENE-DGAIKE  1792
             CA +VCD G  +N+ CIMQL++ P NRLH++Y+KG +G     ++++E++ +  + AIKE
Sbjct  353   CAFAVCDLGCQMNELCIMQLVMVPGNRLHLFYKKGPIGHDQMAEERVEDFGSRVNDAIKE  412

Query  1791  FSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLD  1612
             F R+FEE+TGNEF   ER+KK +KK  K YPLD+  G++VRHGG ALRQLG AA H KLD
Sbjct  413   FVRLFEEVTGNEFEPWERQKKFEKKSMKMYPLDMDVGVDVRHGGAALRQLGSAAAHCKLD  472

Query  1611  PMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEA  1432
             P V+  +K LC QEIYRYALMEM  D P++PIGML+D+HL+R E+ LL       +  E+
Sbjct  473   PSVSFLLKQLCGQEIYRYALMEMAQDLPDLPIGMLTDLHLKRGEEMLLQMRRDAETVAES  532

Query  1431  GQQVEALWAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGS  1252
             G + +A W + S+KWFTL P+TRP+ +R F  IAD+ AS FE+VRDIN ASRLI D   S
Sbjct  533   GPEADAFWTDASSKWFTLFPTTRPYTMRGFEQIADNVASGFETVRDINDASRLIGDAFRS  592

Query  1251  T-LDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVE  1075
             T LDDPL + Y KLGC ISA+ + S+DYKM+LKYLEKTY+PV V D+ YGVSVE I+AVE
Sbjct  593   TLLDDPLSECYKKLGCCISAVAEGSEDYKMVLKYLEKTYEPVEVEDVVYGVSVERIYAVE  652

Query  1074  PSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAA  895
              SA P  ++++ LPNK+LLWCGTRSSNLLRHL  GFLPAVC LPVPGYMFGKAIVCSDAA
Sbjct  653   SSAFPLYEEIRNLPNKILLWCGTRSSNLLRHLHKGFLPAVCHLPVPGYMFGKAIVCSDAA  712

Query  894   AEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPP--EDTKSLEQKKLGAKFHGRKKTD  721
             AEAA+YGFTAVDRPEG+LVLAVAS+GEEI E +  P  E+ + LE+KK+G K  GRK TD
Sbjct  713   AEAARYGFTAVDRPEGYLVLAVASLGEEIEEVTGTPGAEEARVLEEKKVGVKGVGRKTTD  772

Query  720   ESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVE  547
             ESEHF W+D +KVPCG+L+  S + + P +YNEYAVYDP+QVSI FLV VKY+E+ +E
Sbjct  773   ESEHFSWRDGVKVPCGKLV-PSANKDGPLEYNEYAVYDPKQVSICFLVGVKYEEQNME  829



>emb|CAN64918.1| hypothetical protein VITISV_027338 [Vitis vinifera]
Length=856

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/841 (55%), Positives = 603/841 (72%), Gaps = 64/841 (8%)
 Frame = -2

Query  3015  MKVHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkae  2836
             +KVHETR   H   +EE+   +KQKA++K  +         P K+ K      G      
Sbjct  67    IKVHETRPQAHANAEEEKAGGKKQKAENKTHEAEQAQKKAKPEKEDKDNGQRNGKSAAEI  126

Query  2835  eedgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYG  2656
              ++ +            FC+ATS+HLS++QMR+IL+ N Q+ SGS + +VPRCQ++MFYG
Sbjct  127   AKEFEQ-----------FCKATSQHLSIKQMREILEANEQEPSGSADAVVPRCQDMMFYG  175

Query  2655  PVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDL  2476
              ++KCP C   LEC+ G  Y C G FSEWSSC+YSTR+P R++EP+++P+SV+++   +L
Sbjct  176   ALEKCPACDNTLECT-GDNYVCTGAFSEWSSCTYSTRDPVRRKEPVKLPDSVRESSAFEL  234

Query  2475  IKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTH--QYWKSQIEKNGGKVANSVIGV  2302
             IK HQ+  N P +    T KP +GM+I LSGRL+RTH    W S++    G VA   +  
Sbjct  235   IKNHQEQGNFPRRNLNPTGKPFTGMLICLSGRLSRTHVRLVWLSRLLSESG-VALPKLWK  293

Query  2301  TCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGR  2122
              C                    ERGIPVVREAWL DSIEK+E QPL+AYDV SD++V+G+
Sbjct  294   QCR-------------------ERGIPVVREAWLSDSIEKQEAQPLEAYDVVSDLSVEGK  334

Query  2121  GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQG  1942
             GIP DKQDPS EALE+I++E+K+YGKRGV+KD+KLQ++GGKI EKDG+ Y          
Sbjct  335   GIPWDKQDPSEEALESISAEIKLYGKRGVYKDSKLQEQGGKIFEKDGIFY----------  384

Query  1941  RGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTG  1762
                   CI+QLI+APEN+LH+YY+KGRVGD  R ++++EEW+N D A+KEF R+FEELTG
Sbjct  385   ------CILQLIIAPENQLHLYYKKGRVGDDTRAEERVEEWQNVDAAVKEFVRLFEELTG  438

Query  1761  NEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMK--  1588
             NEF   EREKK QKK  KFYP+D+ DG++VR+GGL LRQ G+A  H KL+P+VANFMK  
Sbjct  439   NEFEPWEREKKFQKKLLKFYPIDMDDGVDVRYGGLGLRQQGVAVAHCKLEPLVANFMKGC  498

Query  1587  -----ILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQ  1423
                  I+ S+   RYA+MEMG D P++P+GMLS +HL+RCE+ LL+F+E ++S KE   +
Sbjct  499   YGQWHIIISEP--RYAMMEMGLDSPDLPMGMLSSIHLKRCEEVLLNFIETVKSIKEMEIK  556

Query  1422  VEALWAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLD  1243
              +A W++FS +WFTL+ STRPF  RD  +IADHAA+  E+VRDI  AS L+ D++GSTLD
Sbjct  557   AKATWSDFSQRWFTLLHSTRPFIFRDHREIADHAAAALETVRDITVASHLVGDLTGSTLD  616

Query  1242  DPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSAC  1063
             DPL+DRY KLGCSIS LEKD+DDY+MILKYLEKTY+PV+VG+ISYGVSV+NIFAVEPSAC
Sbjct  617   DPLFDRYKKLGCSISPLEKDTDDYRMILKYLEKTYEPVKVGEISYGVSVDNIFAVEPSAC  676

Query  1062  PSLDDMKKLPNKVLLWCGTRSSNL-LRHLQNGFLPAVCSLPVPGYMFG---KAIVCSDAA  895
             PS D+MKKLP+KVLLWC        +RH +  F   +    +   MF    +AIVCSDAA
Sbjct  677   PSHDEMKKLPSKVLLWCVFNIYLFSIRHPKLKFDEVLEQRVLASDMFSPSPRAIVCSDAA  736

Query  894   AEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDES  715
             AEAA+YGFTAVDRPEGFLVLAV S+G+++ E+ +PPE+TKSLE+K+LG K  GRKK DE+
Sbjct  737   AEAARYGFTAVDRPEGFLVLAVVSLGDQVXEYKNPPEETKSLEEKQLGXKGLGRKKPDEN  796

Query  714   EHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEYYTA  535
             EH VW+DD+KVPCG LI  S++ +SP +YNEY VYDP+QVSIRFLV VKY+E  VE  TA
Sbjct  797   EHTVWEDDVKVPCGHLI-XSEYKDSPLEYNEYCVYDPKQVSIRFLVGVKYEERDVEMDTA  855

Query  534   E  532
             E
Sbjct  856   E  856



>dbj|BAK08221.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=746

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/742 (56%), Positives = 539/742 (73%), Gaps = 6/742 (1%)
 Frame = -2

Query  3009  VHETRSHTHHANDEERMVTRKQKADSKQLQDHDEPLHNSPTKKAKTTdggagdekkaeee  2830
             VHETRS TH A +E +   +KQK + K+ +   E    S  KK    +     +K    E
Sbjct  2     VHETRSRTH-ATEEGKTAPKKQKEEHKEQEGGQE--RPSKNKKPVEPEAETKTKKHKGGE  58

Query  2829  dgkaadvaaaaefeKFCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPV  2650
                     A  E+  FC+A  EHLS + MR+IL+ N QD+SGS++ +V  C+++MFYGP+
Sbjct  59    SELDGKDNATKEYTDFCKAIREHLSAEDMRKILEANGQDASGSEDAVVSSCEDMMFYGPL  118

Query  2649  DKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK  2470
             +KCP+CGG LEC  G  Y C G +SEW+SC +S+ +PPRK +P+++PE V    L+  +K
Sbjct  119   EKCPICGGQLECK-GWKYKCTGKYSEWASCIFSSNSPPRKSDPIKVPEDVSNDFLNKWLK  177

Query  2469  KHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLV  2290
             + Q+ K  P ++        SGMM++LSGR++R+H Y+K QI  +GG+V NSV+GVTC+V
Sbjct  178   Q-QEGKGYPKRDVDEEAHIFSGMMVALSGRMSRSHAYFKEQILNHGGQVNNSVLGVTCVV  236

Query  2289  VSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPL  2110
              SPAER++GGS   AEA+ERG PVV E W+VDS++KKE QPL AYD+ SD+  +GRG+PL
Sbjct  237   ASPAERDKGGSGGFAEALERGTPVVSENWIVDSMQKKEAQPLAAYDIVSDVVPEGRGLPL  296

Query  2109  DKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLN  1930
             DK DPS EA+E + +ELK+ GKR VHKD+KL  +GG I EKDG++YNCA S+CD G   N
Sbjct  297   DKLDPSEEAIETLAAELKLAGKRSVHKDSKLDKDGGCIFEKDGIIYNCACSICDLGSETN  356

Query  1929  DFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWE-NEDGAIKEFSRIFEELTGNEF  1753
               CIMQLI+ PE  LH++Y+KG +G     ++++E++    + AI EF+R+F+E+TGN+F
Sbjct  357   QLCIMQLIMLPEEHLHLFYKKGPIGHDQMAEERVEDFGIRVNDAIMEFARLFKEVTGNDF  416

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
                EREKK +KK  K YPLD+  G +VRHGG ALRQLG AA H KLDP ++  +K LC Q
Sbjct  417   EPWEREKKFEKKSMKMYPLDMDVGFDVRHGGAALRQLGAAAAHCKLDPAISFLLKQLCGQ  476

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             EIYRYAL EM  D P++PIGML+DVHL+R E+ LL ++       E+    +A W E SN
Sbjct  477   EIYRYALTEMAQDLPDLPIGMLTDVHLKRGEEVLLEWIRDAEPAPESRLAADAFWIEISN  536

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
             KWFTL P+TRP+ +R F  IAD+ AS FE++RDIN AS LI D   STLDDPL + Y KL
Sbjct  537   KWFTLFPTTRPYIMRGFEQIADNVASGFETIRDINDASHLIGDAFASTLDDPLSECYKKL  596

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLP  1033
             GCSI+++ +DS+DYKMI+KYLEKTY+PV+V D+ YGVSV+ I+AVE SA PS +++KKLP
Sbjct  597   GCSINSVPEDSEDYKMIVKYLEKTYEPVKVDDVVYGVSVDRIYAVESSAFPSYNEIKKLP  656

Query  1032  NKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRP  853
             NKVLLWCGTRSSNLLRHL  GFLPAVC LPVPGYMFG+AIVCSDAAAEAA+YG+TAVDRP
Sbjct  657   NKVLLWCGTRSSNLLRHLHRGFLPAVCHLPVPGYMFGRAIVCSDAAAEAARYGYTAVDRP  716

Query  852   EGFLVLAVASMGEEIMEFSSPP  787
             EG+LVLAVAS+GEEI E +  P
Sbjct  717   EGYLVLAVASLGEEIKEITGTP  738



>ref|XP_002983418.1| hypothetical protein SELMODRAFT_422701 [Selaginella moellendorffii]
 gb|EFJ15760.1| hypothetical protein SELMODRAFT_422701 [Selaginella moellendorffii]
Length=796

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/755 (44%), Positives = 490/755 (65%), Gaps = 17/755 (2%)
 Frame = -2

Query  2784  FCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSG  2605
             F      ++S ++ R IL +NAQ+   S  ++   C + M YGP++ CP CGGAL+ +  
Sbjct  47    FVEKLKSNVSEEEARAILSENAQEMDSSI-SVYEHCADQMMYGPLEPCPSCGGALKFAVH  105

Query  2604  GTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVI  2425
               Y C G  SEWS C +ST+N PRK+EPL+IP+ ++   ++   ++H D + RP++    
Sbjct  106   -EYTCTGYISEWSKCGFSTKNVPRKKEPLKIPKQLKNDYITKWEQEH-DTEKRPVRHTED  163

Query  2424  TVKP-----LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLVVSPAERERG  2263
             + KP      SGM I L+GR  R     +   EK+GGKVA+++  G+TCLVV+ ++   G
Sbjct  164   SAKPAPGKPFSGMHILLAGRTKRPQYKLRGDFEKHGGKVAHALKEGITCLVVAESDLSSG  223

Query  2262  GSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEA  2083
               +K+ +A  + IPVV+E+WL D + K EV     Y   +    D R     + D    A
Sbjct  224   VYAKIGDARSKNIPVVKESWLQDCLSKNEVLDFAPYLFGAQAEGDKRAAKKQQVDQGVAA  283

Query  2082  LENI------TSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
              +N+      T E+K+ GK+ VHKD++L  EGG++ E +G++YNCA S+CDQ  GLN   
Sbjct  284   DQNVDSSTYLTDEIKLAGKKYVHKDSELDKEGGRVFEHEGIVYNCAFSICDQTSGLNHCA  343

Query  1920  IMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRE  1741
               QL+  P+  L+ Y+++GR+     V+++++E  + + AI  F+ +F+E+TGNEF + E
Sbjct  344   AQQLVQVPDGTLYFYHKRGRLATGVPVNERMDEQTDVNKAIHNFAALFKEITGNEFEAWE  403

Query  1740  REKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYR  1561
             REKK  KK  KFYP+D+ D  + R GGL  +QLG+ AVH KLDP VA F K L SQ +YR
Sbjct  404   REKKFTKKRSKFYPVDMDDVCDARAGGLQDQQLGVVAVHCKLDPKVARFCKCLFSQAVYR  463

Query  1560  YALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFT  1381
             +A+ EMG + PE+P+G LS+ H +RCE+ LL F + +R   ++ +  E +  +FSNKWF+
Sbjct  464   HAMFEMGINSPELPLGSLSEFHFKRCEECLLEFADFLRKESDSKKH-EQMCLDFSNKWFS  522

Query  1380  LMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSI  1201
             L+PST P  + D A + +  ASV ES++ I+ AS +I DM+G TLDDPL DRY KL  ++
Sbjct  523   LVPSTHPTVISDIAHLTELGASVLESLKAISVASHIIGDMTGDTLDDPLSDRYAKLNSTM  582

Query  1200  SALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVL  1021
             + ++K+SDDYKM+ KYLEKTY+PV+  D+S  + +E +F VE SA PS +++ KL NKVL
Sbjct  583   TCVDKESDDYKMVQKYLEKTYEPVKYDDVSVSIVMEELFMVESSAGPSFEEVDKLKNKVL  642

Query  1020  LWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFL  841
             LWCGTR+ NL+  L  G  PA+ + PVPGYMFGK + C+DA+ +AA Y FT VDRPEGFL
Sbjct  643   LWCGTRTCNLISTLAQGMQPAIYNAPVPGYMFGKGLYCTDASCKAASYAFTGVDRPEGFL  702

Query  840   VLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIE  661
             +LAV  +G+ ++E   P ED    E++K+  K  G+K  D SE+F WK++I VPCG L +
Sbjct  703   MLAVVGLGDNVLELPKPEEDVAKYEREKVAIKALGKKLPDSSEYFKWKNNITVPCGAL-K  761

Query  660   ESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
              S  ++   DYNEY VYDP+QV ++++V V+Y+E+
Sbjct  762   SSGRDDCTLDYNEYVVYDPKQVKLQYIVQVRYEEK  796



>ref|XP_002960621.1| hypothetical protein SELMODRAFT_73333, partial [Selaginella moellendorffii]
 gb|EFJ38160.1| hypothetical protein SELMODRAFT_73333, partial [Selaginella moellendorffii]
Length=696

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/707 (45%), Positives = 462/707 (65%), Gaps = 16/707 (2%)
 Frame = -2

Query  2667  MFYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTP  2488
             M YGP++ CP CGGAL+ +    Y C G  SEWS C +ST+N PRK+EPL+IP+ ++   
Sbjct  3     MMYGPLEPCPSCGGALKFAVH-EYTCTGYISEWSKCGFSTKNVPRKKEPLKIPKQLKNDY  61

Query  2487  LSDLIKKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI  2308
             ++    +H +   +P        KP SGM I L+GR  R     +   EK+GGKVA+++ 
Sbjct  62    ITKRPVRHTEDSAKPAPG-----KPFSGMHILLAGRTKRPQYKLRGDFEKHGGKVAHALK  116

Query  2307  -GVTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAV  2131
              G+TCLVV+ ++   G  +K+ +A  + IPVV+E+WL D + K EV     Y   +    
Sbjct  117   EGITCLVVAESDLSSGVYAKIGDARSKNIPVVKESWLQDCLSKNEVLDFAPYLFGAQAEG  176

Query  2130  DGRGIPLDK--QDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALS  1957
             D R     +  Q P    L+     +K+ GK+ VHKD++L  EGG++ E +G++YNCA S
Sbjct  177   DKRAAKKQQVDQGPVVRFLQ-----IKLAGKKYVHKDSELDKEGGRVFEHEGIVYNCAFS  231

Query  1956  VCDQGRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIF  1777
             +CDQ  GLN     QL+  P+  L+ Y+++GR+     V+++++E  + + AI  F+ +F
Sbjct  232   ICDQTSGLNHCAAQQLVQVPDGTLYFYHKRGRLATGVPVNERMDEQTDVNKAIHNFAALF  291

Query  1776  EELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVAN  1597
             +E+TGNEF + EREKK  KK  KFYP+D+ D  + R GGL  +QLG+ AVH KLDP VA 
Sbjct  292   KEITGNEFEAWEREKKFTKKRSKFYPVDMDDVCDARAGGLQDQQLGVVAVHCKLDPKVAR  351

Query  1596  FMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVE  1417
             F K L SQ +YR+A+ EMG + PE+P+G LS+ H +RCE+ LL F + ++   ++ +  E
Sbjct  352   FCKCLFSQAVYRHAMFEMGINSPELPLGSLSEFHFKRCEECLLEFADFLQKESDSKKH-E  410

Query  1416  ALWAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDP  1237
              +  +FSNKWF+L+PST P  + D A + +  ASV ES++ I+ AS +I DM+G TLDDP
Sbjct  411   QMCLDFSNKWFSLVPSTHPTVISDIAHLTELGASVLESLKAISVASHIIGDMTGDTLDDP  470

Query  1236  LYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPS  1057
             L DRY KL  +++ ++K+SDDYKM+ KYLEKTY+PV+  D+S  + +E +F VE SA PS
Sbjct  471   LSDRYAKLNSTMTCVDKESDDYKMVQKYLEKTYEPVKYDDVSVSIVMEELFMVESSAGPS  530

Query  1056  LDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKY  877
              +++  L NKVLLWCGTR+ NL+  L  G  PA+ + PVPGYMFGK + C+DA+ +AA Y
Sbjct  531   FEEVDNLKNKVLLWCGTRTCNLISTLAQGMQPAIYNAPVPGYMFGKGLYCTDASCKAASY  590

Query  876   GFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWK  697
              FT VDRPEGFL+LAV  +G+ ++E   P ED    E++K+  K  G+K  D SE+F WK
Sbjct  591   AFTGVDRPEGFLMLAVVGLGDNVLELPKPEEDVAKYEREKVAIKALGKKLPDSSEYFKWK  650

Query  696   DDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYDEE  556
             ++I VPCG L + S  ++   DYNEY VYDP+QV ++++V V+Y+E+
Sbjct  651   NNITVPCGAL-KSSGRDDCTLDYNEYVVYDPKQVKLQYIVQVRYEEK  696



>dbj|BAC42749.1| unknown protein [Arabidopsis thaliana]
Length=388

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/387 (71%), Positives = 331/387 (86%), Gaps = 1/387 (0%)
 Frame = -2

Query  1686  DGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGML  1507
             DGIEVR G L LRQL IA+ H KLD  VANF+K+LC QEIY YALME+G D P++P+GML
Sbjct  3     DGIEVRSGALGLRQLVIASAHCKLDSFVANFIKVLCGQEIYNYALMELGLDPPDLPMGML  62

Query  1506  SDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLRDFADIAD  1327
             +D+HL+RCE+ LL FVE++++TKE GQ+ EA+WA+FS++WF+LM STRP  L D  ++AD
Sbjct  63    TDIHLKRCEEVLLEFVEKVKTTKETGQKAEAMWADFSSRWFSLMHSTRPMRLHDVNELAD  122

Query  1326  HAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLE  1147
             HAAS FE+VRDIN ASRLI DM G TLDDPL DRY KLGC IS ++K+S+DYKM++KYLE
Sbjct  123   HAASAFETVRDINTASRLIGDMRGDTLDDPLSDRYKKLGCKISVVDKESEDYKMVVKYLE  182

Query  1146  KTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGF  967
              TY+PV+V D+ YGVSV+N+FAVE  A PSLDD+KKLPNKVLLWCG+RSSNLLRH+  GF
Sbjct  183   TTYEPVKVSDVEYGVSVQNVFAVESDAIPSLDDIKKLPNKVLLWCGSRSSNLLRHIYKGF  242

Query  966   LPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPP  787
             LPAVCSLPVPGYMFG+AIVCSDAAAEAA+YGFTAVDRPEGFLVLAVAS+GEE+ EF+SPP
Sbjct  243   LPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDRPEGFLVLAVASLGEEVTEFTSPP  302

Query  786   EDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYD  607
             EDTK+LE KK+G K  GRKKT+ESEHF+W+DDIKVPCGRL+  S+H +SP +YNEYAVYD
Sbjct  303   EDTKTLEDKKIGVKGLGRKKTEESEHFMWRDDIKVPCGRLV-PSEHKDSPLEYNEYAVYD  361

Query  606   PQQVSIRFLVAVKYDEEAVEYYTAEPD  526
             P+Q SIRFLV VKY+E+  E    EP+
Sbjct  362   PKQTSIRFLVEVKYEEKGTEIVDVEPE  388



>ref|XP_001763226.1| predicted protein [Physcomitrella patens]
 gb|EDQ72103.1| predicted protein [Physcomitrella patens]
Length=865

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/800 (41%), Positives = 472/800 (59%), Gaps = 73/800 (9%)
 Frame = -2

Query  2784  FCRATSEHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVC-----GGAL  2620
             F     +  S++ +R I  +N  +S   D  ++    + +FYGP+  CP+C       AL
Sbjct  77    FVDKLKDECSIEDVRAIAVENGLNSLLPDNMLLHGVADQLFYGPLQTCPLCESHGTHAAL  136

Query  2619  ECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPL  2440
              C  G  Y C G  SEW+ C+Y+  +  R    L++P+ ++   L    K H   KN P 
Sbjct  137   ICD-GHQYKCSGFISEWTMCNYTAPSAERTNGCLKLPKKLKNEFLKQFEKSHDASKN-PK  194

Query  2439  KEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLVVSPAERERG  2263
             +      KP  GM I LSGRL+R     ++ IEK+GGKVAN++  GVTC++    +   G
Sbjct  195   RVLASGEKPFLGMTIVLSGRLSRKQGARRADIEKHGGKVANAIKPGVTCVIADARDASGG  254

Query  2262  G-SSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAE  2086
             G S+K A+A+   IPVVRE W+ D I++KE  PL+ YD+A++   + R +P DK  P AE
Sbjct  255   GGSTKSADAISLNIPVVREEWITDCIKQKEQLPLEKYDMAAEFPGE-RDVPWDKMSPQAE  313

Query  2085  ALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLI  1906
             A  ++ +E+K+ GKRGV+KDT+L++EGGKI E   ++YNCA S+         + IMQLI
Sbjct  314   AALSLMAEVKLVGKRGVYKDTELEEEGGKIFENKDIIYNCAFSI---------YAIMQLI  364

Query  1905  VAPENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKI  1726
               P   +++YY+KGRVGD     ++LEE ++   A++EF ++FE LTGN F   EREKK 
Sbjct  365   EMPNKAVYLYYKKGRVGDRLHNTERLEEMDSTRQAMREFVKLFETLTGNPFEPWEREKKF  424

Query  1725  QKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALME  1546
             +KKP KF+P+D+  G++ R GGL + QLG AA H+K++  VA  +K+L SQE+YR+A+ E
Sbjct  425   EKKPMKFFPVDMNSGVDARAGGLGVHQLGTAAAHTKMNSRVAQDLKVLMSQEVYRFAMTE  484

Query  1545  MGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPST  1366
             M  D P++P G L++ HLERC D L  F   +R  +E   + E +  +FSNKW++L+ +T
Sbjct  485   MAIDAPDLPSGNLTEFHLERCTDVLQQFAAYLREPEEDELKHERMCLDFSNKWWSLVHTT  544

Query  1365  RPFYLRDFADIADHAASVFESVRDINAASRLIEDMSG-STLDDPLYDRYVKLGCSISALE  1189
             RPF ++D   +A  AA   E+++ I+ AS+LI ++   STLDDPL DRY KLGC I+ L+
Sbjct  545   RPFVIKDIDQVAQMAAPTLEALKAISVASQLIGNLKDESTLDDPLADRYAKLGCQITPLD  604

Query  1188  KDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWC-  1012
              DS+DYKMI  YL KT  PV+  D  Y V+++    ++ +A PSL D+KK+ NK LLWC 
Sbjct  605   HDSEDYKMISNYLAKTIAPVKFMDSEYSVNLQEACLIDSAATPSLKDIKKMSNKQLLWCG  664

Query  1011  --------------------------------------------------GTRSSNLLRH  982
                                                               GTR+ NLL  
Sbjct  665   MVLVSWLSPVGCLGDDNCAHVSYFQNHWIFTCDYTTLEENSRDNHIEIHTGTRTCNLLAC  724

Query  981   LQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIME  802
             ++ G  PA    P  GYMFG+   CSD+AA AA++GFTAVDRPEG+L+LAV  +G+EI+E
Sbjct  725   MKVGMPPASIEAPASGYMFGEGWYCSDSAARAAQFGFTAVDRPEGYLILAVVGLGDEILE  784

Query  801   FSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNE  622
              + P ED    ++KK+  K  G+  TD   +  +++DI VPCG LI   +  +SP D+NE
Sbjct  785   LTKPEEDVSQYKKKKVAIKGLGKMTTDPDGYIKFEEDITVPCGPLIPGKE--DSPLDFNE  842

Query  621   YAVYDPQQVSIRFLVAVKYD  562
             + VYD  QV   +L+ V+Y+
Sbjct  843   FCVYDSMQVKPHYLLRVRYE  862



>ref|XP_006384625.1| hypothetical protein POPTR_0004s19480g, partial [Populus trichocarpa]
 gb|ERP62422.1| hypothetical protein POPTR_0004s19480g, partial [Populus trichocarpa]
Length=413

 Score =   518 bits (1335),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 282/543 (52%), Positives = 337/543 (62%), Gaps = 130/543 (24%)
 Frame = -2

Query  2226  IPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEALENITSELKVYG  2047
             +PVVRE WL+DSIEK+E                    P +K  P+   +    S   +YG
Sbjct  1     MPVVREEWLLDSIEKQE--------------------PRNKSSPNQRIMSVHCSSNYIYG  40

Query  2046  KRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK  1867
             KRGV+KDTKLQ+ GG+ILEKDG++Y                CIMQLI   E+ LH+YY+K
Sbjct  41    KRGVYKDTKLQERGGRILEKDGIVY----------------CIMQLITVLESNLHLYYKK  84

Query  1866  GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVA  1687
             G+                   AIKEF  +FEELTGNEF   EREKK +KK   FYP+D+ 
Sbjct  85    GK-----------------GNAIKEFGSLFEELTGNEFEPWEREKKFEKKRLSFYPIDMD  127

Query  1686  DGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGML  1507
             DG++ RHGGL LRQLG+AAVH +L+P +A FMKILCS+EIYRYA+ME G D P++P+GML
Sbjct  128   DGVDARHGGLRLRQLGVAAVHRRLEPKIAYFMKILCSREIYRYAMMEKGCDSPDLPMGML  187

Query  1506  SDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLRDFADIAD  1327
             S+ H+ERCED LL FVE  +STKE GQ+ EA                             
Sbjct  188   SNFHMERCEDVLLWFVEAGKSTKETGQKAEA-----------------------------  218

Query  1326  HAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLE  1147
               A+ FE+VRDIN A RLI DMSGS LDDPL DRY+                        
Sbjct  219   -GAAAFETVRDINVAPRLIGDMSGSALDDPLSDRYMNWAAQF------------------  259

Query  1146  KTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGF  967
                   RVGDI YGVSVENIF VEPSACP L ++KKLPNKV+LWCGTRSSN+LRHLQ GF
Sbjct  260   ------RVGDIDYGVSVENIFPVEPSACPPLVEIKKLPNKVVLWCGTRSSNMLRHLQKGF  313

Query  966   LPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPP  787
             LP+VCSLPVPG        CSDAAAEA +YGFTAVDRPEGFL LAVAS+G+++++  SP 
Sbjct  314   LPSVCSLPVPGDF------CSDAAAEAGRYGFTAVDRPEGFLALAVASLGDQVIKVESPL  367

Query  786   EDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYD  607
             E                RK TDESEHF+WKDDIKVPCGRLI  S H +SP +YNEYA+YD
Sbjct  368   E----------------RKTTDESEHFLWKDDIKVPCGRLI-PSVHKDSPLEYNEYAIYD  410

Query  606   PQQ  598
             P+Q
Sbjct  411   PKQ  413



>emb|CDP06936.1| unnamed protein product [Coffea canephora]
Length=284

 Score =   427 bits (1098),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 200/274 (73%), Positives = 237/274 (86%), Gaps = 1/274 (0%)
 Frame = -2

Query  1365  RPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEK  1186
             + F  RD  D+A+H A+ FE+VRDI AAS +I DMS   +DDPL+DRY KLGCSIS L++
Sbjct  9     KAFTFRDLGDLAEHGAAAFETVRDITAASYVIGDMSDGIVDDPLFDRYKKLGCSISTLDR  68

Query  1185  DSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNKVLLWCGT  1006
             DS DYKMI+ YLE+TY+P +VG+I+YGVSVENI+ VEPSACPSL+++KKLPNK+LLWCG+
Sbjct  69    DSSDYKMIVNYLERTYEPYKVGEINYGVSVENIYEVEPSACPSLEEIKKLPNKMLLWCGS  128

Query  1005  RSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVA  826
             RSSNLLRHL  GFLPAVCSLP PGYMFG+AIVC DAAAEAA+YGFTAVDRP+ FLVLAVA
Sbjct  129   RSSNLLRHLHKGFLPAVCSLPAPGYMFGRAIVCFDAAAEAARYGFTAVDRPDSFLVLAVA  188

Query  825   SMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHN  646
             S+GE+I+E SSPPEDT+SLE+KK G K  GRKKTDESEHFVWKDDIKVPCGRLI  S+H 
Sbjct  189   SLGEQILETSSPPEDTESLEEKKSGVKGLGRKKTDESEHFVWKDDIKVPCGRLI-PSEHK  247

Query  645   NSPFDYNEYAVYDPQQVSIRFLVAVKYDEEAVEY  544
             +S  +YNEYAVYDPQQV+IRFLV VKY+E+  +Y
Sbjct  248   DSLLEYNEYAVYDPQQVTIRFLVGVKYEEQDAQY  281



>ref|XP_006341445.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Solanum tuberosum]
Length=991

 Score =   371 bits (952),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 258/768 (34%), Positives = 404/768 (53%), Gaps = 82/768 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R++L+ N Q+SSGS+  +  RC + M +G + KCP+C G L  S GG Y C 
Sbjct  270   KHVSTGELREMLEANDQESSGSELDLRDRCADAMHFGALPKCPLCSGHLRYS-GGMYRCH  328

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNR----------PLK  2437
             G  SEWS CSYS  +  R +   +IPE   KT    L+K ++  K++          P K
Sbjct  329   GYLSEWSKCSYSVTDIKRDKGKWKIPE---KTSNEFLLKWYKGQKSKKPERILLPATPSK  385

Query  2436  EQVITV----------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLV  2290
             E V             + L  + ++L G L+   + WKS+IE+ GG+V   +   T CLV
Sbjct  386   ESVSQAANGLSQSSKGENLEDLKVALIG-LSIDSRNWKSKIEEAGGRVHAKLKKDTDCLV  444

Query  2289  VSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPL  2110
             V     ++   S++ +A    +PVVRE +LVDSI +K+  P   Y + ++          
Sbjct  445   VIGTWNDQ--DSEIKKARRLKVPVVREDYLVDSINRKKKLPFGLYKLEAN----------  492

Query  2109  DKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLN  1930
                    ++++ +    KV G+  VH+ +KL+D G  ILE    +YN  L++ D   G+N
Sbjct  493   ----GETQSMKTV----KVKGRSAVHESSKLEDTG-HILEDKTSIYNTTLNMSDLSSGIN  543

Query  1929  DFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEF  1753
              + I+Q+I   +      +RK GRVG+     +KLEE    D AI+ F R+F E TGN +
Sbjct  544   SYYILQIIEEDKGSDCYVFRKWGRVGNEKIGGNKLEEMSKSD-AIQHFKRLFLEKTGNSW  602

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
              + E++K  QK+P +FYPLD+  G++ +       +  I   +SKL P +   MKIL + 
Sbjct  603   EAWEQKKNFQKQPGRFYPLDIDYGVDKK----PTSKSNINDTNSKLAPPLMELMKILFNV  658

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             E YR A+ME   +  E+P+G LS  ++++  + L        ST       E L  + SN
Sbjct  659   ETYRAAMMEFEINMSEMPLGKLSKRNIQKGFEALTEIQNLFSSTNHDPTVKETLLVDASN  718

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIE-DMSGSTLDDPLYDRYVK  1216
             ++FT++PS  P  ++D  D       + E+++DI  ASRL+  D+     DD L ++Y K
Sbjct  719   RFFTVIPSIHPHVIKDEDDFK-LKIKMLEALQDIEIASRLVGFDIDN---DDSLDEKYKK  774

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK--  1042
             L C IS L   S+DY++I KYL+ T+ P       + + VE++F++E       D  K  
Sbjct  775   LQCDISPLPHQSEDYRVIEKYLQNTHAPTHK---DWVLEVEDVFSLERKG--EFDKFKPC  829

Query  1041  --KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFT  868
               KL N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT
Sbjct  830   KEKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFT  889

Query  867   AVDRPEGFLVLAVASMGEEIMEFSS------PPEDTKSLEQKKLGAKFHGRKKTDESEHF  706
                 P GF++L+  ++G E+ E  +      PP+   S        K  G+   + S+  
Sbjct  890   DHKNPVGFMLLSEVALG-EVYELKAAKYMDKPPKGKHS-------TKGLGKTVPERSDFV  941

Query  705   VWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              W+D++ VPCG+ +  S   NS   YNEY VYD  QV ++FLV V+++
Sbjct  942   NWRDEVVVPCGKPV-TSNVKNSELLYNEYIVYDAAQVKLQFLVKVRFN  988



>ref|XP_004235864.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Solanum 
lycopersicum]
Length=992

 Score =   369 bits (947),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 253/768 (33%), Positives = 403/768 (52%), Gaps = 81/768 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R++L+ N Q+SSGS+  +  RC + M +G + KCP+C G L   SGG Y C 
Sbjct  270   KHVSTGELREMLEANDQESSGSELDLRDRCADAMHFGGLPKCPLCSGHLR-YSGGMYRCH  328

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNR---------PLKE  2434
             G  SEWS CSYS  +  R +   +IPE   KT    L+K ++  K++          L +
Sbjct  329   GYLSEWSKCSYSVTDIKRDKGKWKIPE---KTSNEFLLKWYKGQKSKKPERILLPATLSK  385

Query  2433  QVITV-----------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLV  2290
             + ++            + L  + ++L+G    + + WKS+IE+ GG+V   +   T CLV
Sbjct  386   ETVSQAGNGLSQSSKGENLGDLKVALTGLSRDSRENWKSKIEEAGGQVHAKLKKDTDCLV  445

Query  2289  VSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPL  2110
             V     ++   S++ +A    + VVRE +LVDSI +K+  P D Y + ++          
Sbjct  446   VIGTWNDQ--DSEIKKARRLKVSVVREDYLVDSINRKKKLPFDLYKLEAN----------  493

Query  2109  DKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLN  1930
                    ++++ +    KV G+  VH+ ++LQD G  ILE+   +YN  L++ D   G+N
Sbjct  494   ----SETQSMKTV----KVKGRSAVHESSRLQDTG-HILEEKTSIYNTTLNMSDLSSGIN  544

Query  1929  DFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEF  1753
              + I+Q+I   +      +RK GRVG+     DKLEE    D AI+ F R+F E TGN +
Sbjct  545   SYYILQIIEEDKGSDCYVFRKWGRVGNEKIGGDKLEEMSKSD-AIQHFKRLFLEKTGNSW  603

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
              + E++K  QK+P +FYPLD+  G++ +       +      + KL P +   MKIL + 
Sbjct  604   EAWEQKKDFQKQPGRFYPLDIDYGVDKK----TTSKRNFNDTNCKLAPPLMELMKILFNV  659

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             E YR A+ME   +  E+P+G LS  ++++  + L      +  T       E L  + SN
Sbjct  660   ETYRAAMMEFEINMSEMPLGKLSKRNIQKGFEALTEIQNLLSGTNHDPTVKETLLVDASN  719

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIE-DMSGSTLDDPLYDRYVK  1216
             ++FT++PS  P  ++D  D       + E+++DI  ASRL+  D+     DD L ++Y K
Sbjct  720   RFFTVIPSIHPHVIKDEDDFK-LKIKMLEALQDIEIASRLVGFDIDN---DDSLDEKYKK  775

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK--  1042
             L C IS L   S+DY++I KYL+ T+ P       + + VE +F++E       D  K  
Sbjct  776   LQCDISPLPHQSEDYRVIEKYLQNTHAPTHK---EWVLEVEEVFSLERKG--EYDKFKPC  830

Query  1041  --KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFT  868
               KL NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT
Sbjct  831   RDKLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFT  890

Query  867   AVDRPEGFLVLAVASMGEEIMEFSS------PPEDTKSLEQKKLGAKFHGRKKTDESEHF  706
                 P GF++L+  ++G E+ E  +      PP+   S        K  G+   + SE  
Sbjct  891   DRKNPVGFMLLSEVALG-EVYELKAAKYMDKPPKGKHS-------TKGLGKTVPERSEFV  942

Query  705   VWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              W+D++ VPCG+ +  S   NS   YNEY VY+  QV ++FLV V+++
Sbjct  943   NWRDEVVVPCGKPV-TSNVKNSELLYNEYIVYEAAQVKLQFLVKVRFN  989



>gb|KDP21330.1| hypothetical protein JCGZ_21801 [Jatropha curcas]
Length=982

 Score =   369 bits (946),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 250/762 (33%), Positives = 390/762 (51%), Gaps = 73/762 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +++++ ++RQ+L+ N QDSSGS+  +  RC + M +G +  CP+C G L   SGGTY C 
Sbjct  262   KNVTMVELRQMLEVNGQDSSGSELDLRDRCADGMMFGALGLCPICHGFLR-YSGGTYRCN  320

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPL-----------  2440
             G  SEWS CSYSTR P R +   ++PE  +   LS   K  +  K   L           
Sbjct  321   GFLSEWSKCSYSTREPERLKGKWKVPEDTKNEYLSRWFKSQKSKKPVRLLPPPSSDNTSG  380

Query  2439  ------KEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
                   +   +  + L  + +S+SG    + + WKS+IE  GG+V   +   T C V   
Sbjct  381   SPTANSQSSSLKSENLRDLKVSISGLPKESVEEWKSKIEGVGGQVHGKIKKDTNCFVCGV  440

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
              +RE    +++ +A    +P+VRE +LVD  +K++  P D Y V    AV G        
Sbjct  441   LDRE---DAEMRKARRMKLPIVREDYLVDCFKKQKRLPFDLYKVE---AVGG--------  486

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
                     +    +KV G+  VH+ + LQ E G ILE    +YN  L++ D   G+N + 
Sbjct  487   -------SSSMVTVKVKGQSAVHEASGLQ-ETGHILEDGKSIYNTTLNMSDLSTGVNSYY  538

Query  1920  IMQLIVAPENR-LHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +    H++ + GRVG+      KL+E    D AI EF R+F E TGN + + 
Sbjct  539   ILQIIQDDKGSDCHVFRKWGRVGNEKIGGIKLDEMSKSD-AICEFKRLFLEKTGNSWEAW  597

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QKKP KF+PLD+  G+  +     L     ++  S+L P +   MK+L + E Y
Sbjct  598   EQKSNFQKKPGKFFPLDIDYGVNKQ-----LTTKNRSSADSQLAPPLMELMKMLFNVEAY  652

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      + +        E+L  + SN++F
Sbjct  653   RAAMMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLNNNTYDPSIKESLMVDASNRFF  712

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     +  D+   D+Y KL C 
Sbjct  713   TVIPSIHPHIIRDEDDFKSKV-KMLEALQDIEIASRLVG--FDADTDESFDDKYRKLRCD  769

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             I+ L  DS+DY++I KYL  T+ P       + + +E +F++E      +D      KKL
Sbjct  770   INPLPHDSEDYQLIEKYLNITHAPTHT---DWSLELEEVFSLEREG--EIDKFAPYRKKL  824

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT    
Sbjct  825   KNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTDKKN  884

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDD  691
             P G ++L+  ++GE       M    PP       Q K   K  G+K   ESE   W++D
Sbjct  885   PVGLMLLSEVALGEVYELKNAMYMDKPP-------QGKHSTKGLGKKVPQESEFVKWRND  937

Query  690   IKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + VPCG+ +  S+   S   YNEY VY   QV ++FL+ V++
Sbjct  938   VTVPCGKPV-PSKVKASELMYNEYIVYSTAQVKMQFLLKVRF  978



>ref|XP_010318682.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Solanum 
lycopersicum]
Length=998

 Score =   369 bits (946),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 254/774 (33%), Positives = 404/774 (52%), Gaps = 87/774 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R++L+ N Q+SSGS+  +  RC + M +G + KCP+C G L  S GG Y C 
Sbjct  270   KHVSTGELREMLEANDQESSGSELDLRDRCADAMHFGGLPKCPLCSGHLRYS-GGMYRCH  328

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNR---------PLKE  2434
             G  SEWS CSYS  +  R +   +IPE   KT    L+K ++  K++          L +
Sbjct  329   GYLSEWSKCSYSVTDIKRDKGKWKIPE---KTSNEFLLKWYKGQKSKKPERILLPATLSK  385

Query  2433  QVITV-----------KPLSGMMISLSGRLTRTHQYWKSQIEKNGG----KVANSVIGVT  2299
             + ++            + L  + ++L+G    + + WKS+IE+ GG    K+   V G+ 
Sbjct  386   ETVSQAGNGLSQSSKGENLGDLKVALTGLSRDSRENWKSKIEEAGGQVHAKLKKEVFGLA  445

Query  2298  ---CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVD  2128
                CLVV     ++   S++ +A    + VVRE +LVDSI +K+  P D Y + ++    
Sbjct  446   DTDCLVVIGTWNDQ--DSEIKKARRLKVSVVREDYLVDSINRKKKLPFDLYKLEAN----  499

Query  2127  GRGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCD  1948
                          ++++ +    KV G+  VH+ ++LQD G  ILE+   +YN  L++ D
Sbjct  500   ----------SETQSMKTV----KVKGRSAVHESSRLQDTG-HILEEKTSIYNTTLNMSD  544

Query  1947  QGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEE  1771
                G+N + I+Q+I   +      +RK GRVG+     DKLEE    D AI+ F R+F E
Sbjct  545   LSSGINSYYILQIIEEDKGSDCYVFRKWGRVGNEKIGGDKLEEMSKSD-AIQHFKRLFLE  603

Query  1770  LTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFM  1591
              TGN + + E++K  QK+P +FYPLD+  G++ +       +      + KL P +   M
Sbjct  604   KTGNSWEAWEQKKDFQKQPGRFYPLDIDYGVDKK----TTSKRNFNDTNCKLAPPLMELM  659

Query  1590  KILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEAL  1411
             KIL + E YR A+ME   +  E+P+G LS  ++++  + L      +  T       E L
Sbjct  660   KILFNVETYRAAMMEFEINMSEMPLGKLSKRNIQKGFEALTEIQNLLSGTNHDPTVKETL  719

Query  1410  WAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIE-DMSGSTLDDPL  1234
               + SN++FT++PS  P  ++D  D       + E+++DI  ASRL+  D+     DD L
Sbjct  720   LVDASNRFFTVIPSIHPHVIKDEDDFK-LKIKMLEALQDIEIASRLVGFDIDN---DDSL  775

Query  1233  YDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSL  1054
              ++Y KL C IS L   S+DY++I KYL+ T+ P       + + VE +F++E       
Sbjct  776   DEKYKKLQCDISPLPHQSEDYRVIEKYLQNTHAPTHK---EWVLEVEEVFSLERKG--EY  830

Query  1053  DDMK----KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEA  886
             D  K    KL NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++
Sbjct  831   DKFKPCRDKLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKS  890

Query  885   AKYGFTAVDRPEGFLVLAVASMGEEIMEFSS------PPEDTKSLEQKKLGAKFHGRKKT  724
             A+Y FT    P GF++L+  ++G E+ E  +      PP+   S        K  G+   
Sbjct  891   AQYCFTDRKNPVGFMLLSEVALG-EVYELKAAKYMDKPPKGKHS-------TKGLGKTVP  942

Query  723   DESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             + SE   W+D++ VPCG+ +  S   NS   YNEY VY+  QV ++FLV V+++
Sbjct  943   ERSEFVNWRDEVVVPCGKPV-TSNVKNSELLYNEYIVYEAAQVKLQFLVKVRFN  995



>ref|XP_007199702.1| hypothetical protein PRUPE_ppa000811mg [Prunus persica]
 gb|EMJ00901.1| hypothetical protein PRUPE_ppa000811mg [Prunus persica]
Length=997

 Score =   369 bits (946),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 248/762 (33%), Positives = 390/762 (51%), Gaps = 72/762 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +  RC + M +G + +CP+C G L  S GG Y C 
Sbjct  276   KHVTTAELREMLEANVQDSTGSELDLRERCADGMMFGALSRCPICSGFLRYS-GGMYRCH  334

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK----------NRPLK  2437
             G  SEWS CSYST  P R E   ++PE      L+   K  +  K          N+P  
Sbjct  335   GYISEWSKCSYSTEEPERLEWTWKVPEDTDNQYLNKWFKSQKVEKPVRILPPSTPNKPSG  394

Query  2436  EQVITVKP-------LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
              Q    +        L+ + ++  G    + + W  QIE   G V + +   T CLVVS 
Sbjct  395   SQAFNGQSQSSNSASLADLKVAFRGLPKESMEEWSRQIEGVAGLVHSKIKKDTNCLVVSG  454

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             A  ++    + A  ++  +P+VRE +LVD  +K++  P D Y V                
Sbjct  455   ALDDKDAEMRKARRMK--LPIVREDYLVDCFKKQKKLPFDLYKV----------------  496

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
                   + +    +KV G+  VH+ + LQD    ILE +  +YN  LS+ D   G+N + 
Sbjct  497   --EVVGVASSMVTVKVKGRSAVHESSGLQDTC-HILEDEKSIYNTTLSMSDLSTGVNSYY  553

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   ++     +RK GRVG+     +KLE+    D AI EF R+F E TGN + + 
Sbjct  554   ILQIIQDDKSSDCYVFRKWGRVGNDKIGGNKLEDMSKSD-AICEFKRLFLEKTGNSWEAW  612

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E+++  QK+P +F+PLD+  G+  +   ++ +    AA  SKL P +A  MK+L + E Y
Sbjct  613   EQKQNFQKQPGRFFPLDIDYGVNKQ---VSKKNQNNAA--SKLAPPLAELMKMLFNVETY  667

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      + S   A    E+L  + SN++F
Sbjct  668   RAAMMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLNSNGHAPSMKESLIVDASNRFF  727

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     +  DD L ++Y KL C 
Sbjct  728   TVIPSIHPHVIRDEDDFKSK-VKMLEALQDIEIASRLVG--FDADTDDSLDEKYRKLRCD  784

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             I  +  DS+D+++I KYL  T+ P       + + +E +FA+E       D      KKL
Sbjct  785   IDPIPHDSEDFQLIKKYLLTTHAPTHT---DWSLELEEVFALEREG--EFDKFAPYRKKL  839

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    
Sbjct  840   NNRMLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKN  899

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDD  691
             P G ++L+  ++GE     +      PP+   S        K  G+K   ESE+  WKDD
Sbjct  900   PVGLMLLSEVALGEVHELKKATYMDKPPKGKHS-------TKGLGKKIPQESEYVKWKDD  952

Query  690   IKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + VPCG+ +  S    S   YNEY VYD  QV ++FL+ V++
Sbjct  953   VIVPCGKPV-PSNIKASELMYNEYIVYDKAQVKMQFLLKVRF  993



>ref|XP_009367708.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=966

 Score =   364 bits (934),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 244/759 (32%), Positives = 387/759 (51%), Gaps = 70/759 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  +MR++L+ N QDS+GS+  +  RC + M +G +  CP+C G+L  S G  Y C 
Sbjct  249   KHVTNAEMREMLEANDQDSTGSELDLRERCADGMMFGALKSCPLCSGSLRYSEG-MYRCH  307

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQ--------------DPKN  2449
             G  S WS CSYST+ P R E   +IPE  +   L    K  +               P  
Sbjct  308   GYLSAWSKCSYSTQEPERLEGKWKIPEDTENQYLKKWFKSQKLAKPVRILPPLTPSKPSG  367

Query  2448  RPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSPAER  2272
              P +        L+ + ++  G    + + W  +I+   G V + +   T CLVVS A  
Sbjct  368   SPGQSHSSNSTSLADLKVAFRGLPKESMEEWSRKIDGAAGAVHSKIKKDTNCLVVSGAFD  427

Query  2271  ERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPS  2092
             +    +++ +A    +P+VRE +LVD  ++++  P D Y V                +  
Sbjct  428   D---DAEMRKARRMKLPIVREDYLVDCFKRQKKLPFDMYKV----------------EAV  468

Query  2091  AEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQ  1912
              E+   +T  +KV G+  VH+ + LQD G  ILE    +YN  LS+ D   G+N + I+Q
Sbjct  469   GESSSMVT--VKVKGRSAVHESSGLQDTG-HILEDGKSIYNTTLSMSDLSTGVNSYYILQ  525

Query  1911  LIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRERE  1735
             +I   ++     +RK GRVG+     +KLE+    D AI+EF R+F E TGN + + E++
Sbjct  526   IIQDDKSSDCYVFRKWGRVGNDKIGGNKLEDMSKSD-AIREFKRLFLEKTGNSWEAWEQK  584

Query  1734  KKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYA  1555
             +  QK+  KF+PLD+  G+  +     + +       SKL P +A  MK+L + E YR A
Sbjct  585   QNFQKQAGKFFPLDIDYGVNKQ-----VSKKNQNNGDSKLAPQLAELMKMLFNVETYRAA  639

Query  1554  LMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLM  1375
             +ME   +  E+P+G LS  ++++  + L      + +   A    E+L  + SN++FT++
Sbjct  640   MMEFEINMSEMPLGKLSKANIQKGFEALTEIQNLLNNNGHAPSIKESLIIDASNRFFTVI  699

Query  1374  PSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISA  1195
             PS  P  +RD  D       + E+++DI  ASRL+   + S  DD L ++Y KL C I  
Sbjct  700   PSIHPRVIRDEDDFKSKV-KMLEALQDIEIASRLVGFDADS--DDSLDEKYKKLQCDIDP  756

Query  1194  LEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKLPNK  1027
             +  DS+DY++I KYL  T+ P       + + +E +FA+E       D      KKL N+
Sbjct  757   IPHDSEDYRLIEKYLRATHAPTHT---DWSLELEEVFALEREG--EFDKFAPYRKKLKNR  811

Query  1026  VLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEG  847
             +LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    P G
Sbjct  812   MLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNPVG  871

Query  846   FLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
              ++L+  ++GE     +      PP+   S        K  G+K   ESE+  WKDD+ V
Sbjct  872   LMLLSEVALGEVYELKKAAYMDKPPKGKHS-------TKGLGKKIPQESEYVKWKDDVIV  924

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             PCG+ +  S    S   YNEY VYD  QV +++L+ V++
Sbjct  925   PCGKPV-PSNVKASELMYNEYIVYDTAQVKMQYLLKVRF  962



>ref|XP_009367706.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=966

 Score =   364 bits (934),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 244/759 (32%), Positives = 387/759 (51%), Gaps = 70/759 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  +MR++L+ N QDS+GS+  +  RC + M +G +  CP+C G+L  S G  Y C 
Sbjct  249   KHVTNAEMREMLEANDQDSTGSELDLRERCADGMMFGALKSCPLCSGSLRYSEG-MYRCH  307

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQ--------------DPKN  2449
             G  S WS CSYST+ P R E   +IPE  +   L    K  +               P  
Sbjct  308   GYLSAWSKCSYSTQEPERLEGKWKIPEDTENQYLKKWFKSQKLAKPVRILPPLTPSKPSG  367

Query  2448  RPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSPAER  2272
              P +        L+ + ++  G    + + W  +I+   G V + +   T CLVVS A  
Sbjct  368   SPGQSHSSNSTSLADLKVAFRGLPKESMEEWSRKIDGAAGGVHSKIKKDTNCLVVSGAFD  427

Query  2271  ERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPS  2092
             +    +++ +A    +P+VRE +LVD  ++++  P D Y V                +  
Sbjct  428   D---DAEMRKARRMKLPIVREDYLVDCFKRQKKLPFDMYKV----------------EAV  468

Query  2091  AEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQ  1912
              E+   +T  +KV G+  VH+ + LQD G  ILE    +YN  LS+ D   G+N + I+Q
Sbjct  469   GESSSMVT--VKVKGRSAVHESSGLQDTG-HILEDGKSIYNTTLSMSDLSTGVNSYYILQ  525

Query  1911  LIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRERE  1735
             +I   ++     +RK GRVG+     +KLE+    D AI+EF R+F E TGN + + E++
Sbjct  526   IIQDDKSSDCYVFRKWGRVGNDKIGGNKLEDMSKSD-AIREFKRLFLEKTGNSWEAWEQK  584

Query  1734  KKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYA  1555
             +  QK+  KF+PLD+  G+  +     + +       SKL P +A  MK+L + E YR A
Sbjct  585   QNFQKQAGKFFPLDIDYGVNKQ-----VSKKNQNNGDSKLAPQLAELMKMLFNVETYRAA  639

Query  1554  LMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLM  1375
             +ME   +  E+P+G LS  ++++  + L      + +   A    E+L  + SN++FT++
Sbjct  640   MMEFEINMSEMPLGKLSKANIQKGFEALTEIQNLLNNNGHAPSIKESLIIDASNRFFTVI  699

Query  1374  PSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISA  1195
             PS  P  +RD  D       + E+++DI  ASRL+   + S  DD L ++Y KL C I  
Sbjct  700   PSIHPRVIRDEDDFKSKV-KMLEALQDIEIASRLVGFDADS--DDSLDEKYKKLQCDIDP  756

Query  1194  LEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKLPNK  1027
             +  DS+DY++I KYL  T+ P       + + +E +FA+E       D      KKL N+
Sbjct  757   IPHDSEDYRLIEKYLRATHAPTHT---DWSLELEEVFALEREG--EFDKFAPYRKKLKNR  811

Query  1026  VLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEG  847
             +LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    P G
Sbjct  812   MLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNPVG  871

Query  846   FLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
              ++L+  ++GE     +      PP+   S        K  G+K   ESE+  WKDD+ V
Sbjct  872   LMLLSEVALGEVYELKKAAYMDKPPKGKHS-------TKGLGKKIPQESEYVKWKDDVIV  924

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             PCG+ +  S    S   YNEY VYD  QV +++L+ V++
Sbjct  925   PCGKPV-PSNVKASELMYNEYIVYDTAQVKMQYLLKVRF  962



>ref|XP_008235714.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Prunus mume]
Length=992

 Score =   364 bits (934),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 247/762 (32%), Positives = 389/762 (51%), Gaps = 72/762 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +  RC + M +G + +CP+C G L   SGG Y C 
Sbjct  271   KHVTTAELREMLEANVQDSTGSELDLRERCADGMMFGALSRCPICSGFLR-YSGGMYRCH  329

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK----------NRPLK  2437
             G  SEWS CSYST  P R +   +IPE      L+   K  +  K          N+P  
Sbjct  330   GYISEWSKCSYSTEEPERLKWKWKIPEDTDNQYLNKWFKSQKVEKPVRILPPLTPNKPSG  389

Query  2436  EQVITVKP-------LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
              Q    +        L+ + ++  G    + + W  +IE   G V + +   T CLVVS 
Sbjct  390   SQAFNGQSQSSNSASLADLKVAFRGLPKESMEEWSRKIEDVAGLVHSKIKKDTNCLVVSG  449

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             A  ++    + A  ++  +P+VRE +LVD  +K++  P D Y V                
Sbjct  450   ALDDKDAEMRKARRMK--LPIVREDYLVDCFKKQKKLPFDLYKV----------------  491

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
                   + +    +KV G+  VH+ + LQD    ILE +  +YN  LS+ D   G+N + 
Sbjct  492   --EVVGVASSMVTVKVKGRSAVHESSGLQDTC-HILEDEKSIYNTTLSMSDLSTGVNSYY  548

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   ++     +RK GRVG+     +KLEE    D AI EF R+F E TGN + + 
Sbjct  549   ILQIIQDDKSSDCYVFRKWGRVGNDKIGGNKLEEMLKSD-AICEFKRLFLEKTGNSWEAW  607

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E+++  QK+P +F+PLD+  G+  +   ++ +    AA  SKL P +A  MK+L + E Y
Sbjct  608   EQKQNFQKQPGRFFPLDIDYGVNKQ---VSKKNQNNAA--SKLAPPLAELMKMLFNVETY  662

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      + S        E+L  + SN++F
Sbjct  663   RAAMMEFEINMSEMPLGKLSKSNIQKGFEALTELQNLLNSNGHPPSMKESLIVDASNRFF  722

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     +  DD L ++Y KL C 
Sbjct  723   TVIPSIHPRVIRDEDDFKSKV-KMLEALQDIEIASRLVG--FDADTDDSLDEKYRKLRCD  779

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             I  +  DS+D+++I KYL  T+ P       + + +E +FA+E       D      KKL
Sbjct  780   IDPIPHDSEDFRLIKKYLLTTHAPTHT---DWSLELEEVFALEREG--EFDKFAPYRKKL  834

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    
Sbjct  835   NNRMLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKN  894

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDD  691
             P G ++L+  ++GE     +      PP+   S        K  G+K   ESE+  WKDD
Sbjct  895   PVGLMLLSEVALGEVHELKKATYMDKPPKGKHS-------TKGLGKKIPQESEYVKWKDD  947

Query  690   IKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + VPCG+ +  S    S   YNEY VYD  QV ++FL+ V++
Sbjct  948   VIVPCGKPV-PSNIKASELMYNEYIVYDKAQVKMQFLLKVRF  988



>ref|XP_011080022.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sesamum indicum]
Length=995

 Score =   363 bits (933),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 248/765 (32%), Positives = 393/765 (51%), Gaps = 78/765 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++++  ++R++L+ N QDS GS+  +  RC + M +G + KCP+C G+L  SS   Y C 
Sbjct  274   KYVTTSELREMLEANEQDSRGSELDLRERCADGMLFGALVKCPMCSGSLHYSSS-MYRCG  332

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK---------------  2452
             G  SEWS CSYST  P R +   +IPE      L    K  +  K               
Sbjct  333   GYLSEWSKCSYSTTEPQRVKAKWKIPEETGNEYLLKWFKSQKMKKPERMLPPTTPGGSSG  392

Query  2451  ----NRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVV  2287
                 N P   Q   V+ +  + +S++G    + + WK +IE  GG+V   +   T CLVV
Sbjct  393   SKAANGP--RQSSMVENIGDLKVSIAGVPNGSMEEWKHKIEGAGGQVHMKIKKETNCLVV  450

Query  2286  SPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLD  2107
                  +     K A  ++  IP+VRE +LVD I++++  P D Y V +     G      
Sbjct  451   CGVLDDSAAEMKKARRMK--IPIVREDYLVDCIKRQKKLPFDLYLVETTEKTHG------  502

Query  2106  KQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLND  1927
                          + +KV G+  VH+ + LQD  G ILE    +YN  L++ D   G+N 
Sbjct  503   ------------MATVKVKGQSAVHESSGLQD-SGHILEDGKSIYNTTLNMSDLSTGVNS  549

Query  1926  FCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFL  1750
             + I+Q+I   ++     +RK GRVG+     +KLEE    D AI EF R+F E TGN + 
Sbjct  550   YYILQIIQDDKSSDCYVFRKWGRVGNEKIGGNKLEEMSKSD-AIHEFKRLFLEKTGNSWE  608

Query  1749  SREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQE  1570
             S E +K   K+P +FYPLD+  G++        +QL  ++  S+L P +   MK+L + E
Sbjct  609   SWEDKKDFHKQPGRFYPLDIDYGVKDLS---KKKQLNFSS--SQLAPQLVELMKMLFNVE  663

Query  1569  IYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNK  1390
              YR A+ME   +  E+P+G LS  ++++  + L      +  T  A    E+L  + SN+
Sbjct  664   TYRAAMMEFEINLSEMPLGKLSKSNIQKGFEALTQIQNLLNGTAYAPNVKESLLVDASNR  723

Query  1389  WFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLG  1210
             +FT++PS  P  ++D  D       + E+++DI  ASRL+   + S  D+ + ++Y KL 
Sbjct  724   FFTVIPSIHPHVIKD-EDEFKAKVKMLEALQDIEIASRLVGFDADS--DESIDEKYSKLR  780

Query  1209  CSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMK----  1042
             C IS L  DS+D+++I KYL  T+ P       + + +E +F++E      +D  +    
Sbjct  781   CQISPLSHDSEDFQLIEKYLNTTHAPTHT---EWALELEEVFSLEREG--EVDKYQPYRA  835

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KL N++LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y +T  
Sbjct  836   KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCYTDR  895

Query  861   DRPEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVW  700
               P G ++L+  ++G E+ E +       PP+   S        K  G+K   ESEH  W
Sbjct  896   KNPVGLMLLSEVALG-EVYELTKSQYMDKPPKGKHS-------TKGLGKKVPLESEHVKW  947

Query  699   KDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             KD++ VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  948   KDEVVVPCGKPV-ASKVKTSELMYNEYIVYNTAQVKMQFLLKVRF  991



>ref|XP_008461881.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X3 [Cucumis 
melo]
Length=932

 Score =   356 bits (914),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 255/766 (33%), Positives = 392/766 (51%), Gaps = 81/766 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDSSGS+  +  RC + M +G + KCP+C G+L  S G  Y C 
Sbjct  212   KHVTTAELREMLESNDQDSSGSELDLRDRCADGMMFGALAKCPICFGSLHYSRG-MYRCH  270

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK----------  2437
             G  S W+ CSYST  P R     ++PE      LS   K  +  K  P++          
Sbjct  271   GYQSAWTKCSYSTCEPQRLRGKWKVPEETGNQYLSKWFKSQKGAK--PIRLLPPPTSSTA  328

Query  2436  ---------EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVV  2287
                       Q  + + L+ + +S  G L  +   WK +IE  GG V   +   T CLVV
Sbjct  329   NGNQTSSSQSQSSSSENLAELRVSFYG-LKDSMGEWKRKIEVEGGAVHAKIKKDTNCLVV  387

Query  2286  SPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLD  2107
                  E     K A  ++  IP+VRE +LVD   K++  P D Y V              
Sbjct  388   GGYVDEYNPEMKKARRMK--IPIVREEYLVDCFRKQKKLPYDRYKV--------------  431

Query  2106  KQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLND  1927
               + + E+   +T  +KV G+  VH+ + LQD G  ILE    +YN  L++ D   G+N 
Sbjct  432   --EATGESTSLVT--VKVKGRSAVHESSGLQDTG-HILEDKKSIYNTTLNMSDLSTGINS  486

Query  1926  FCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFL  1750
             + I+Q+I   ++     +RK GRVG+      KL+E    D AI+EF R+F E TGN + 
Sbjct  487   YYILQIIQDDKSSDCYVFRKWGRVGNEKIGGVKLDEMTKSD-AIQEFKRLFLEKTGNPWE  545

Query  1749  SREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQE  1570
             + E++   +K+P +F+PLD+  G+   +  L  +    +A  +KL P +A  MK+L + E
Sbjct  546   AWEQKLNFEKQPGRFFPLDIDYGV---NKDLPKKPKNYSA--TKLAPQLAQLMKMLFNVE  600

Query  1569  IYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNK  1390
              YR A+ME   +  E+P+G LS  ++++  + L      + S+       E+L  + SN+
Sbjct  601   TYRAAMMEFEINMSEMPLGKLSRSNIQKGFEALTEIQNLLNSSMHDPSVKESLIIDASNR  660

Query  1389  WFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLG  1210
             +FT++PS  P  +RD  D       + E+++DI  ASRL+     S  D+ L D+Y KL 
Sbjct  661   FFTVIPSIHPHIIRDEDDFKSKL-KMLEALQDIEIASRLVGFDVDS--DESLDDKYKKLH  717

Query  1209  CSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----K  1042
             C I+ +  +SDDYK+I KYL  T+ P       + + +E +F++E       D      +
Sbjct  718   CDIAPISHESDDYKLIEKYLLNTHAPTHT---DWALELEEVFSLEREG--EFDKFVPFRQ  772

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KL NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T  
Sbjct  773   KLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDR  832

Query  861   DRPEGFLVLAVASMGE-------EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV  703
               P GF++L+  ++GE       E ME   PP       + K   K  G+K  D SEH  
Sbjct  833   KNPIGFMILSEVALGEVYELKKAEYME--KPP-------RGKHSTKGLGKKVPDVSEHVK  883

Query  702   WKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             WK+D+ VPCG+ +  S    S   YNEY VYD  QV ++FL+ V++
Sbjct  884   WKEDVVVPCGKPV-ASNVKASELMYNEYIVYDTVQVKMQFLLKVRF  928



>ref|XP_009354923.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Pyrus x bretschneideri]
Length=966

 Score =   356 bits (914),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 248/762 (33%), Positives = 387/762 (51%), Gaps = 76/762 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  +MR++L+ N QDS+GS+  +  RC + M +G +  CP+C G L   SGG Y C+
Sbjct  249   KHVTNAEMREMLEVNNQDSTGSELDLRERCADGMMFGALKSCPLCSGFLR-YSGGMYRCQ  307

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITVKP--  2413
             G  S WS CSYST+ P R +   +IP+      L+   K  +  K   +   +   KP  
Sbjct  308   GYLSAWSKCSYSTQEPERLDGKWKIPKDKDNHYLNKWFKSQKLAKPVRILPPLTPSKPSG  367

Query  2412  ------------LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSPAER  2272
                         L+ + ++  G    + + W  +IE   G V + +   T CLVVS A  
Sbjct  368   SQGQSQSSNSTSLADLKVAFRGLPKESTEEWCRKIEGVAGVVHSKIKKDTNCLVVSGAFD  427

Query  2271  ERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPS  2092
             +    +++ +A    +P+VRE +LVD  E+++  P D Y V                   
Sbjct  428   D---DAEMRKARRMKLPIVREDYLVDCFERQKKLPFDIYKV-------------------  465

Query  2091  AEALENITS--ELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCI  1918
              EAL   +S   +KV G+  VH+ + LQD G  ILE    +YN  LS+ D   G+N + I
Sbjct  466   -EALRESSSLITVKVKGRSAVHESSGLQDTG-HILEDGKSIYNTTLSMSDLSTGVNSYYI  523

Query  1917  MQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRE  1741
             +Q+I   ++     +RK GRVG+      KLE+    D AI EF R+F E TGN + + E
Sbjct  524   LQIIQDDKSSDCSVFRKWGRVGNDKIGGSKLEDMSKSD-AIHEFKRLFLEKTGNPWEAWE  582

Query  1740  REKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYR  1561
             +++  QK+  +F+PLD+  G+  +     +         SKL P +A  MK+L + E YR
Sbjct  583   QKQNFQKQAGRFFPLDIDYGVNKQ-----VSNKNQNNADSKLAPQLAELMKMLFNVETYR  637

Query  1560  YALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFT  1381
              A+ME   +  E+P+G LS  ++++  + L      + +   A    E+L  + SN++FT
Sbjct  638   AAMMEFEINMSEMPLGKLSKANIQKGFEALTEIQNLLNNNGHAPSTKESLIIDASNRFFT  697

Query  1380  LMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSI  1201
             ++PS  P  +RD  D       + E+++DI  ASRL+   + S  DD L ++Y KL C I
Sbjct  698   VIPSIHPRVIRD-EDNFKSKVKMLEALQDIEIASRLVGFDADS--DDSLDEKYKKLRCDI  754

Query  1200  SALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMKKL  1036
               +  DS+DY++I KYL  T+ P       + + +E +FA+E         P     KKL
Sbjct  755   DPIPHDSEDYQLIEKYLLTTHAPTHT---DWSLELEEVFALEREGEFNKFAPY---QKKL  808

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    
Sbjct  809   KNKMLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKN  868

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDD  691
             P G ++L+  ++GE     +      PP+   S        K  G+K   ESE+  WKDD
Sbjct  869   PVGLMLLSEVALGEVYELKKAAYMDKPPKGKHS-------TKGLGKKIPQESEYVKWKDD  921

Query  690   IKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + VPCG+ +  S    S   YNEY VYD  QV +++L+ V++
Sbjct  922   VIVPCGKPV-PSNIKASELMYNEYIVYDTAQVKMQYLLKVRF  962



>ref|XP_008461880.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Cucumis 
melo]
Length=979

 Score =   356 bits (914),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 255/766 (33%), Positives = 392/766 (51%), Gaps = 81/766 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDSSGS+  +  RC + M +G + KCP+C G+L  S G  Y C 
Sbjct  259   KHVTTAELREMLESNDQDSSGSELDLRDRCADGMMFGALAKCPICFGSLHYSRG-MYRCH  317

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK----------  2437
             G  S W+ CSYST  P R     ++PE      LS   K  +  K  P++          
Sbjct  318   GYQSAWTKCSYSTCEPQRLRGKWKVPEETGNQYLSKWFKSQKGAK--PIRLLPPPTSSTA  375

Query  2436  ---------EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVV  2287
                       Q  + + L+ + +S  G L  +   WK +IE  GG V   +   T CLVV
Sbjct  376   NGNQTSSSQSQSSSSENLAELRVSFYG-LKDSMGEWKRKIEVEGGAVHAKIKKDTNCLVV  434

Query  2286  SPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLD  2107
                  E     K A  ++  IP+VRE +LVD   K++  P D Y V              
Sbjct  435   GGYVDEYNPEMKKARRMK--IPIVREEYLVDCFRKQKKLPYDRYKV--------------  478

Query  2106  KQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLND  1927
               + + E+   +T  +KV G+  VH+ + LQD G  ILE    +YN  L++ D   G+N 
Sbjct  479   --EATGESTSLVT--VKVKGRSAVHESSGLQDTG-HILEDKKSIYNTTLNMSDLSTGINS  533

Query  1926  FCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFL  1750
             + I+Q+I   ++     +RK GRVG+      KL+E    D AI+EF R+F E TGN + 
Sbjct  534   YYILQIIQDDKSSDCYVFRKWGRVGNEKIGGVKLDEMTKSD-AIQEFKRLFLEKTGNPWE  592

Query  1749  SREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQE  1570
             + E++   +K+P +F+PLD+  G+   +  L  +    +A  +KL P +A  MK+L + E
Sbjct  593   AWEQKLNFEKQPGRFFPLDIDYGV---NKDLPKKPKNYSA--TKLAPQLAQLMKMLFNVE  647

Query  1569  IYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNK  1390
              YR A+ME   +  E+P+G LS  ++++  + L      + S+       E+L  + SN+
Sbjct  648   TYRAAMMEFEINMSEMPLGKLSRSNIQKGFEALTEIQNLLNSSMHDPSVKESLIIDASNR  707

Query  1389  WFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLG  1210
             +FT++PS  P  +RD  D       + E+++DI  ASRL+     S  D+ L D+Y KL 
Sbjct  708   FFTVIPSIHPHIIRDEDDFKSKL-KMLEALQDIEIASRLVGFDVDS--DESLDDKYKKLH  764

Query  1209  CSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----K  1042
             C I+ +  +SDDYK+I KYL  T+ P       + + +E +F++E       D      +
Sbjct  765   CDIAPISHESDDYKLIEKYLLNTHAPTHT---DWALELEEVFSLEREG--EFDKFVPFRQ  819

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KL NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T  
Sbjct  820   KLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDR  879

Query  861   DRPEGFLVLAVASMGE-------EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV  703
               P GF++L+  ++GE       E ME   PP       + K   K  G+K  D SEH  
Sbjct  880   KNPIGFMILSEVALGEVYELKKAEYME--KPP-------RGKHSTKGLGKKVPDVSEHVK  930

Query  702   WKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             WK+D+ VPCG+ +  S    S   YNEY VYD  QV ++FL+ V++
Sbjct  931   WKEDVVVPCGKPV-ASNVKASELMYNEYIVYDTVQVKMQFLLKVRF  975



>ref|XP_008461878.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cucumis 
melo]
 ref|XP_008461879.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cucumis 
melo]
Length=980

 Score =   356 bits (914),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 255/766 (33%), Positives = 392/766 (51%), Gaps = 81/766 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDSSGS+  +  RC + M +G + KCP+C G+L  S G  Y C 
Sbjct  260   KHVTTAELREMLESNDQDSSGSELDLRDRCADGMMFGALAKCPICFGSLHYSRG-MYRCH  318

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK----------  2437
             G  S W+ CSYST  P R     ++PE      LS   K  +  K  P++          
Sbjct  319   GYQSAWTKCSYSTCEPQRLRGKWKVPEETGNQYLSKWFKSQKGAK--PIRLLPPPTSSTA  376

Query  2436  ---------EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVV  2287
                       Q  + + L+ + +S  G L  +   WK +IE  GG V   +   T CLVV
Sbjct  377   NGNQTSSSQSQSSSSENLAELRVSFYG-LKDSMGEWKRKIEVEGGAVHAKIKKDTNCLVV  435

Query  2286  SPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLD  2107
                  E     K A  ++  IP+VRE +LVD   K++  P D Y V              
Sbjct  436   GGYVDEYNPEMKKARRMK--IPIVREEYLVDCFRKQKKLPYDRYKV--------------  479

Query  2106  KQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLND  1927
               + + E+   +T  +KV G+  VH+ + LQD G  ILE    +YN  L++ D   G+N 
Sbjct  480   --EATGESTSLVT--VKVKGRSAVHESSGLQDTG-HILEDKKSIYNTTLNMSDLSTGINS  534

Query  1926  FCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFL  1750
             + I+Q+I   ++     +RK GRVG+      KL+E    D AI+EF R+F E TGN + 
Sbjct  535   YYILQIIQDDKSSDCYVFRKWGRVGNEKIGGVKLDEMTKSD-AIQEFKRLFLEKTGNPWE  593

Query  1749  SREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQE  1570
             + E++   +K+P +F+PLD+  G+   +  L  +    +A  +KL P +A  MK+L + E
Sbjct  594   AWEQKLNFEKQPGRFFPLDIDYGV---NKDLPKKPKNYSA--TKLAPQLAQLMKMLFNVE  648

Query  1569  IYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNK  1390
              YR A+ME   +  E+P+G LS  ++++  + L      + S+       E+L  + SN+
Sbjct  649   TYRAAMMEFEINMSEMPLGKLSRSNIQKGFEALTEIQNLLNSSMHDPSVKESLIIDASNR  708

Query  1389  WFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLG  1210
             +FT++PS  P  +RD  D       + E+++DI  ASRL+     S  D+ L D+Y KL 
Sbjct  709   FFTVIPSIHPHIIRDEDDFKSKL-KMLEALQDIEIASRLVGFDVDS--DESLDDKYKKLH  765

Query  1209  CSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----K  1042
             C I+ +  +SDDYK+I KYL  T+ P       + + +E +F++E       D      +
Sbjct  766   CDIAPISHESDDYKLIEKYLLNTHAPTHT---DWALELEEVFSLEREG--EFDKFVPFRQ  820

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KL NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T  
Sbjct  821   KLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDR  880

Query  861   DRPEGFLVLAVASMGE-------EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV  703
               P GF++L+  ++GE       E ME   PP       + K   K  G+K  D SEH  
Sbjct  881   KNPIGFMILSEVALGEVYELKKAEYME--KPP-------RGKHSTKGLGKKVPDVSEHVK  931

Query  702   WKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             WK+D+ VPCG+ +  S    S   YNEY VYD  QV ++FL+ V++
Sbjct  932   WKEDVVVPCGKPV-ASNVKASELMYNEYIVYDTVQVKMQFLLKVRF  976



>ref|XP_010679215.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=983

 Score =   355 bits (912),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 244/760 (32%), Positives = 394/760 (52%), Gaps = 68/760 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++RQ+L+ N Q +SGS+  +  RC + M +G +  CP+C G L  S G TY C 
Sbjct  262   KHVSNVELRQMLEANDQSTSGSELVLRDRCADGMMFGALKSCPMCSGHLSYS-GSTYKCH  320

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK---------------  2452
             G  SEWS CSYST  P R +   +IPE      L    K  +  K               
Sbjct  321   GFISEWSKCSYSTTQPERIKGKWKIPEESDNQYLVKWFKSQKAAKPVRILPPSTPNTSAG  380

Query  2451  NRPLKEQVITVK--PLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
             N+  KEQ+ + K   L  + ++++G    T + ++S+IE  GG+V   +   T CLVV  
Sbjct  381   NQTAKEQLKSSKDEKLGDLRVAITGLPKETVEEFRSKIEGAGGQVHAKIKKDTNCLVVGG  440

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                ++  +S++ +A    IPVVRE +L + I+K++  P D Y                K 
Sbjct  441   GLSDQ--NSELKKARRMKIPVVREEYLANCIQKQKKLPTDLY----------------KM  482

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             + + E+   +T  +KV G+  VH+ + LQD  G ILE+   +YN  LS+ D   G+N + 
Sbjct  483   EATVESSSLVT--VKVKGRSAVHEASGLQD-SGHILEEGPSIYNTTLSLSDLSSGINSYY  539

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   ++     +RK GRVG+     +K+EE    D AI+EF R+F E TGN + + 
Sbjct  540   ILQIIQDDKSSECYVFRKWGRVGNDKIGGNKIEEMSKSD-AIQEFKRLFLEKTGNPWEAW  598

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
               ++  QK P +F+PLD+  G+  +       +  I   +S L P + + +K+L + E Y
Sbjct  599   VHKQNFQKHPGRFFPLDIDYGVSKQ-----APKKNIDDKNSTLAPALKDLIKMLFNVETY  653

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      + +T       E+L  + SN++F
Sbjct  654   RAAMMEFEINLSEMPLGKLSKSNIQKGFEALTQIQNLLENTALQTTAKESLIIDASNRFF  713

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     S  DDPL  +Y KL C 
Sbjct  714   TVIPSIHPHVIRDEDDFKSK-VKMLEALQDIEIASRLVGFDVDS--DDPLDAKYKKLRCD  770

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPS--LDDMKKLPN  1030
             ++ L  DS+DY++I KYL  T+ P       + + +E +F++E            +KL N
Sbjct  771   MAPLPHDSEDYQLIEKYLLTTHAPTHT---DWRLELEEVFSLEREGEHDKFASQREKLGN  827

Query  1029  KVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPE  850
             ++LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y +T    P 
Sbjct  828   RMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCYTDRKNPV  887

Query  849   GFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             G ++L+  ++G+     +      PP    S        K  G+K   E+    WKD++ 
Sbjct  888   GLMLLSEVALGQVHELKKAQYMEKPPRGKHS-------TKGLGKKVPAEAGFAKWKDEVV  940

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             VPCG+ + +S+  +S   YNEY VYD  QV ++FL+ V++
Sbjct  941   VPCGKPV-DSKVKSSELMYNEYIVYDTAQVKMQFLLKVRF  979



>ref|XP_004493762.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cicer arietinum]
Length=998

 Score =   355 bits (911),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 248/763 (33%), Positives = 389/763 (51%), Gaps = 76/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +  RC + M +G +  C +C G L  S GG Y C 
Sbjct  279   KHVTTAELREMLETNGQDSTGSELDLRDRCADGMMFGGLSHCSLCSGFLRYS-GGMYRCT  337

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD---------PKNRPLKE  2434
             G  SEWS CS ST  P R E   RIP+      L    K  +          P +R   E
Sbjct  338   GFISEWSKCSNSTCEPKRTEGKWRIPKETDNQYLKKWFKSQKGKKPIRIMPPPSSRTSAE  397

Query  2433  QVITV--------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
               I+         + L+ + +++SG    + + WK +I+  GG +   V   T CLVVS 
Sbjct  398   SQISAGQHQSSHSESLADLKVAISGLPKDSFEDWKRKIDGVGGVLHAKVKKDTNCLVVSG  457

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             A ++    +++ +A    IP+VRE +LVD +E+K+  P D Y V                
Sbjct  458   ALKDE---AEMRKARRMKIPIVREDYLVDCMERKKKLPFDMYKV----------------  498

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             +   EA   +T  +KV G   VH  + LQD  G ILE+   +YN  L++ D   G+N + 
Sbjct  499   EMIGEASSMVT--IKVKGHSAVHDASGLQD-SGHILEEGKSIYNTTLNMSDLSTGVNSYY  555

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+      KLEE    D AI+EF R+F E TGN + + 
Sbjct  556   ILQIIEEDKGSDCYVFRKWGRVGNEKIGGFKLEEMSKSD-AIREFKRLFFEKTGNPWEAW  614

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E +K IQK+P +F+PL++  G+  +     + +       SKL P +   MKIL + E Y
Sbjct  615   E-QKTIQKQPGRFFPLEIDYGVNKQ-----VSKKNKNNADSKLPPPLIELMKILFNVETY  668

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L       + +       E+L  + SN++F
Sbjct  669   RAAMMEFEINMSEMPLGKLSKSNIQKGFEALTDIQNLFKISNPDPSARESLLIDASNRFF  728

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+   + +  DD + D Y KL C 
Sbjct  729   TMIPSIHPHIIRDEDDFKSK-VKMLEALQDIEIASRLVGFDANN--DDSIDDNYKKLHCG  785

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMKK  1039
             IS L  DS+D++++ KYL  T+ P  V    + + +E +F++E         P  D   K
Sbjct  786   ISPLPHDSEDFRLVEKYLHTTHAPTHV---DWSLELEEVFSLEREGEFDKFAPYRD---K  839

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             L N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T   
Sbjct  840   LGNRMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKK  899

Query  858   RPEGFLVLAVASMG-----EEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
              P G ++L+  ++G     ++      PPE   S        K  G+K   ESE+  W+ 
Sbjct  900   NPVGLMLLSEVALGNVYELKKAKYMDKPPEGKHS-------TKGLGKKMPLESEYVKWRG  952

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S    S   YNE+ VY+  QV ++FL+ V++
Sbjct  953   DVVVPCGKPV-SSNVKASELMYNEFIVYNTAQVKLQFLLKVRF  994



>ref|XP_006293618.1| hypothetical protein CARUB_v10022570mg [Capsella rubella]
 gb|EOA26516.1| hypothetical protein CARUB_v10022570mg [Capsella rubella]
Length=985

 Score =   355 bits (910),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 247/763 (32%), Positives = 392/763 (51%), Gaps = 77/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +++S  ++R++L+ N Q + GS+  +  +C + M +GP+  CP+C G L  S GG Y C 
Sbjct  267   KYVSTAELREMLELNEQSTRGSELDLRDKCADGMMFGPLALCPICSGHLSFS-GGMYRCH  325

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVIT-----  2422
             G  SEWS CS+ST +P R +   +IPE  +   L    K  +  K + L   V +     
Sbjct  326   GYISEWSKCSHSTLDPDRIKGKWKIPEETENQYLLKWNKSQKSVKPKRLLRPVPSGETSQ  385

Query  2421  ------------VKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSP  2281
                          + LS + +S++G  T+  Q WK +IE+ G +  AN   G +CLVV  
Sbjct  386   GQGSNDAVDSSRSEKLSDLKVSIAGD-TKERQAWKKRIEEAGAEFHANVKKGTSCLVVCG  444

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                 R   +++++A    + +VRE +LVDS++K+   PLD Y +                
Sbjct  445   LTDIR--VAEMSKARRMKVAIVREDYLVDSLKKQRKLPLDKYKI----------------  486

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             + S+E+L  +    KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N + 
Sbjct  487   EDSSESLVTV----KVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGINSYY  541

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +K+EE    D A+ EF R+F E TGN + S 
Sbjct  542   ILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKVEEMSKSD-AVHEFKRLFLEKTGNSWESW  600

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P KF PLD+  G+  +     + +     + S L P +   MK+L   E Y
Sbjct  601   EQKTNFQKQPGKFLPLDIDYGVNKQ-----VAKKEPVQISSNLAPPLIELMKMLFDVETY  655

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L    + +  +       E+L  + SN++F
Sbjct  656   RSAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQKLLTESNPQPSIRESLLVDASNRFF  715

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     ST  + L D+Y KL C 
Sbjct  716   TMIPSIHPHIIRDDDDFKS-KVKMLEALQDIEIASRLVGFDVDST--ESLDDKYKKLHCE  772

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      +KL
Sbjct  773   ISPLAHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPYREKL  827

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T  + 
Sbjct  828   GNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTGKEN  887

Query  855   PEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
             P G ++L+  ++G EI E +       PP    S        K  G+K   +S+   W+ 
Sbjct  888   PVGLMLLSEVALG-EIHELTKAKYMDKPPRGKHS-------TKGLGKKVPQDSDFAKWRG  939

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  940   DVTVPCGKPV-SSKVKASELMYNEYIVYNTAQVKLQFLLKVRF  981



>ref|XP_004289918.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Fragaria vesca 
subsp. vesca]
Length=988

 Score =   354 bits (909),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 239/761 (31%), Positives = 388/761 (51%), Gaps = 74/761 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  +MR++L+ NAQ S+GS+  +   C + M +G + KCP+C G L  S G  Y C 
Sbjct  271   KHVTTVEMRKMLEANAQSSTGSELDLRDLCADGMMFGALSKCPLCSGHLHYS-GAMYRCH  329

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD--------------PKN  2449
             G  + W+ CSYST+ P R +   ++PE  +   L    K  +               P  
Sbjct  330   GFLTAWTKCSYSTQEPERLKGKWKVPEDTENQFLQKWFKSQKVGKPARILPPPSSNCPGG  389

Query  2448  RPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSPAER  2272
             + L  Q  +   L+ + +S  G    + + W   IE   G V   +   T CLVV     
Sbjct  390   QALNGQPQSSASLADLKVSFRGLPKESMEKWNKDIEGVTGSVHAKIKKDTNCLVVGGEPD  449

Query  2271  ERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPS  2092
              +   +++ +A    IP+VRE +LV+  ++K+  P D Y V                   
Sbjct  450   AK--DAEIKKARRMKIPIVREDYLVECFKRKKKLPFDLYKV-------------------  488

Query  2091  AEALENITS--ELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCI  1918
              EA+   +S   +KV G+  VH+ + LQD G  ILE    +YN  LS+ D   G+N + I
Sbjct  489   -EAVGETSSMVTVKVKGRSAVHESSGLQDTG-HILEDGKSIYNTTLSMSDLSTGVNSYYI  546

Query  1917  MQLIVAPEN-RLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRE  1741
             +Q+I   ++   H++ + GRVG+      KL++    D AI +F R+F E TGN + + E
Sbjct  547   LQIIQDDKSSECHVFRKWGRVGNDKIGGTKLDQMSKYD-AISDFKRLFLEKTGNSWEAWE  605

Query  1740  REKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYR  1561
             +++  QK+P KF+PLD+  G+        + +       SKL P +A  MK+L + E YR
Sbjct  606   QKQDFQKQPGKFFPLDIDYGVNKE-----VSKKNQNNAPSKLPPQLAELMKMLFNVETYR  660

Query  1560  YALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFT  1381
              A+ME   +  E+P+G LS  ++++  + L   ++ +  +  A    ++L  + SN++FT
Sbjct  661   AAMMEFEINMSEMPLGKLSKSNIQKGFEALTE-IQNLLKSDGASSIKDSLIVDASNRFFT  719

Query  1380  LMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSI  1201
             ++PS  P  +RD  D       + E+++DI  ASRL+   + S  DD L ++Y KL C +
Sbjct  720   VIPSIHPHIIRDEDDFKSKL-KMLEALQDIEIASRLVGFDADS--DDSLDEKYKKLRCCM  776

Query  1200  SALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKLP  1033
             + L  DS+DY++I KYL  T+ P       + + +E +F++E       D      K L 
Sbjct  777   NPLPHDSEDYQLIEKYLLTTHAPTHT---DWSLELEEVFSLEREG--EFDKYAPYRKTLK  831

Query  1032  NKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRP  853
             N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    P
Sbjct  832   NRMLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNP  891

Query  852   EGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDI  688
              G ++L+  ++GE     +      PP+   S        K  G+KK +ES++  W+DD+
Sbjct  892   VGLMLLSEVALGEIHELKKATYMDKPPKGKHS-------TKGLGKKKPEESDYVKWRDDV  944

Query  687   KVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              VPCG+ + +S    S   YNEY VYD  QV ++FL+ VK+
Sbjct  945   TVPCGKPV-DSHVRASELMYNEYIVYDTAQVKMQFLLKVKF  984



>ref|XP_009781597.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Nicotiana 
sylvestris]
Length=995

 Score =   354 bits (909),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 252/764 (33%), Positives = 391/764 (51%), Gaps = 73/764 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R++L+ N Q+S+GS+  +  RC + M +G + KCP+C G L  S GG Y C 
Sbjct  273   KHVSTGELREMLEANDQESTGSELDLRDRCADGMLFGALPKCPLCSGHLRYS-GGMYKCH  331

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL-----SDLIKKHQD--PKNRPLKEQV  2428
             G  S WS CSYS  +  R +   +IPE      L     S  +K+ +   P   P K  V
Sbjct  332   GYLSAWSKCSYSATDIKRVKGKWKIPEETSNEYLLKWNKSQKLKRPERILPPATPSKASV  391

Query  2427  ITV----------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
                          + L  + ++L+G    + + WKS+IE+ GG++   +   T CLVV  
Sbjct  392   SQAANGLSQSSKGENLGDLKVALAGSSEESRENWKSKIEEAGGQLHAKIKKDTNCLVVIG  451

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                ++   S++ +A    +P+VRE +LVDSIE+K+  P D Y                K 
Sbjct  452   MLDDQ--DSEIKKARRMKVPIVREDYLVDSIERKKKLPFDLY----------------KL  493

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             +   E    +T  +KV G+  VH+ + LQD  G ILE    +YN  L++ D   G+N + 
Sbjct  494   EAYGETRSMVT--VKVKGRSAVHESSGLQD-SGHILEDKTSIYNTTLNMSDLSSGVNSYY  550

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +KLEE    D AI+EF R+F E TGN + + 
Sbjct  551   ILQIIEEDKGSECYVFRKWGRVGNEKIGGNKLEEMSKSD-AIQEFKRLFLEKTGNSWEAW  609

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P +FYPLD+  G++         +  +    SKL P +   MK+L + E Y
Sbjct  610   EQKTNFQKQPGRFYPLDIDYGVDKN----PTTKRNLNDTDSKLAPPLIALMKMLFNVETY  665

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      +  T       E L  + SN++F
Sbjct  666   RAAMMEFEINMSEMPLGKLSKRNIQKGFEALTEIQNLLSGTNHDPAVKETLLVDASNRFF  725

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  ++D  D       + E+++DI  ASRL+     +       D+Y KL C 
Sbjct  726   TVIPSIHPHVIKDEDDF-KLKIKMLEALQDIEIASRLVGFDIDNDDSL--DDKYKKLQCD  782

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS +   S+DY++I KYL+ T+ P       + + VE +F++E       D      +KL
Sbjct  783   ISPIPHHSEDYRVIEKYLQSTHAPTHK---DWVLEVEEVFSLEREG--EFDKFAPHREKL  837

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT    
Sbjct  838   KNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKN  897

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV-WKD  694
             P GF++L+  ++GE     +      PP+   S   K LG      K   ES  FV W+D
Sbjct  898   PVGFMLLSEVALGEVYELKKAKYMDKPPKGKHS--TKGLG------KTVPESSEFVKWRD  949

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             ++ VPCG+ +  S   NS   YNEY VYD  QV ++FLV V+++
Sbjct  950   EVVVPCGKPV-PSNIKNSELLYNEYIVYDTCQVKLQFLVKVRFN  992



>ref|XP_009781599.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X3 [Nicotiana 
sylvestris]
Length=994

 Score =   354 bits (909),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 252/764 (33%), Positives = 391/764 (51%), Gaps = 73/764 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R++L+ N Q+S+GS+  +  RC + M +G + KCP+C G L  S GG Y C 
Sbjct  272   KHVSTGELREMLEANDQESTGSELDLRDRCADGMLFGALPKCPLCSGHLRYS-GGMYKCH  330

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL-----SDLIKKHQD--PKNRPLKEQV  2428
             G  S WS CSYS  +  R +   +IPE      L     S  +K+ +   P   P K  V
Sbjct  331   GYLSAWSKCSYSATDIKRVKGKWKIPEETSNEYLLKWNKSQKLKRPERILPPATPSKASV  390

Query  2427  ITV----------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
                          + L  + ++L+G    + + WKS+IE+ GG++   +   T CLVV  
Sbjct  391   SQAANGLSQSSKGENLGDLKVALAGSSEESRENWKSKIEEAGGQLHAKIKKDTNCLVVIG  450

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                ++   S++ +A    +P+VRE +LVDSIE+K+  P D Y                K 
Sbjct  451   MLDDQ--DSEIKKARRMKVPIVREDYLVDSIERKKKLPFDLY----------------KL  492

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             +   E    +T  +KV G+  VH+ + LQD  G ILE    +YN  L++ D   G+N + 
Sbjct  493   EAYGETRSMVT--VKVKGRSAVHESSGLQD-SGHILEDKTSIYNTTLNMSDLSSGVNSYY  549

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +KLEE    D AI+EF R+F E TGN + + 
Sbjct  550   ILQIIEEDKGSECYVFRKWGRVGNEKIGGNKLEEMSKSD-AIQEFKRLFLEKTGNSWEAW  608

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P +FYPLD+  G++         +  +    SKL P +   MK+L + E Y
Sbjct  609   EQKTNFQKQPGRFYPLDIDYGVDKN----PTTKRNLNDTDSKLAPPLIALMKMLFNVETY  664

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      +  T       E L  + SN++F
Sbjct  665   RAAMMEFEINMSEMPLGKLSKRNIQKGFEALTEIQNLLSGTNHDPAVKETLLVDASNRFF  724

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  ++D  D       + E+++DI  ASRL+     +       D+Y KL C 
Sbjct  725   TVIPSIHPHVIKDEDDF-KLKIKMLEALQDIEIASRLVGFDIDNDDSL--DDKYKKLQCD  781

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS +   S+DY++I KYL+ T+ P       + + VE +F++E       D      +KL
Sbjct  782   ISPIPHHSEDYRVIEKYLQSTHAPTHK---DWVLEVEEVFSLEREG--EFDKFAPHREKL  836

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT    
Sbjct  837   KNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKN  896

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV-WKD  694
             P GF++L+  ++GE     +      PP+   S   K LG      K   ES  FV W+D
Sbjct  897   PVGFMLLSEVALGEVYELKKAKYMDKPPKGKHS--TKGLG------KTVPESSEFVKWRD  948

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             ++ VPCG+ +  S   NS   YNEY VYD  QV ++FLV V+++
Sbjct  949   EVVVPCGKPV-PSNIKNSELLYNEYIVYDTCQVKLQFLVKVRFN  991



>ref|XP_009781598.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Nicotiana 
sylvestris]
Length=995

 Score =   354 bits (908),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 252/764 (33%), Positives = 391/764 (51%), Gaps = 73/764 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R++L+ N Q+S+GS+  +  RC + M +G + KCP+C G L  S GG Y C 
Sbjct  273   KHVSTGELREMLEANDQESTGSELDLRDRCADGMLFGALPKCPLCSGHLRYS-GGMYKCH  331

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL-----SDLIKKHQD--PKNRPLKEQV  2428
             G  S WS CSYS  +  R +   +IPE      L     S  +K+ +   P   P K  V
Sbjct  332   GYLSAWSKCSYSATDIKRVKGKWKIPEETSNEYLLKWNKSQKLKRPERILPPATPSKASV  391

Query  2427  ITV----------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
                          + L  + ++L+G    + + WKS+IE+ GG++   +   T CLVV  
Sbjct  392   SQAANGLSQSSKGENLGDLKVALAGSSEESRENWKSKIEEAGGQLHAKIKKDTNCLVVIG  451

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                ++   S++ +A    +P+VRE +LVDSIE+K+  P D Y                K 
Sbjct  452   MLDDQ--DSEIKKARRMKVPIVREDYLVDSIERKKKLPFDLY----------------KL  493

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             +   E    +T  +KV G+  VH+ + LQD  G ILE    +YN  L++ D   G+N + 
Sbjct  494   EAYGETRSMVT--VKVKGRSAVHESSGLQD-SGHILEDKTSIYNTTLNMSDLSSGVNSYY  550

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +KLEE    D AI+EF R+F E TGN + + 
Sbjct  551   ILQIIEEDKGSECYVFRKWGRVGNEKIGGNKLEEMSKSD-AIQEFKRLFLEKTGNSWEAW  609

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P +FYPLD+  G++         +  +    SKL P +   MK+L + E Y
Sbjct  610   EQKTNFQKQPGRFYPLDIDYGVDKN----PTTKRNLNDTDSKLAPPLIALMKMLFNVETY  665

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      +  T       E L  + SN++F
Sbjct  666   RAAMMEFEINMSEMPLGKLSKRNIQKGFEALTEIQNLLSGTNHDPAVKETLLVDASNRFF  725

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  ++D  D       + E+++DI  ASRL+     +       D+Y KL C 
Sbjct  726   TVIPSIHPHVIKDEDDF-KLKIKMLEALQDIEIASRLVGFDIDNDDSL--DDKYKKLQCD  782

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS +   S+DY++I KYL+ T+ P       + + VE +F++E       D      +KL
Sbjct  783   ISPIPHHSEDYRVIEKYLQSTHAPTHK---DWVLEVEEVFSLEREG--EFDKFAPHREKL  837

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT    
Sbjct  838   KNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKN  897

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV-WKD  694
             P GF++L+  ++GE     +      PP+   S   K LG      K   ES  FV W+D
Sbjct  898   PVGFMLLSEVALGEVYELKKAKYMDKPPKGKHS--TKGLG------KTVPESSEFVKWRD  949

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             ++ VPCG+ +  S   NS   YNEY VYD  QV ++FLV V+++
Sbjct  950   EVVVPCGKPV-PSNIKNSELLYNEYIVYDTCQVKLQFLVKVRFN  992



>ref|XP_004151977.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cucumis sativus]
 ref|XP_004160262.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cucumis sativus]
 gb|KGN57935.1| hypothetical protein Csa_3G398930 [Cucumis sativus]
Length=980

 Score =   353 bits (907),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 253/766 (33%), Positives = 392/766 (51%), Gaps = 81/766 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +  RC + M +G + KCP+C G+L C S G Y C 
Sbjct  260   KHVTTSELREMLESNDQDSTGSELDLRDRCADGMMFGALAKCPICFGSL-CYSRGMYRCH  318

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK----------  2437
             G  S WS CSYST  P R     ++PE      LS   K  +  K  P++          
Sbjct  319   GYQSAWSKCSYSTCEPERLRGKWKVPEETGNLYLSKWFKSQKGAK--PIRLLPPPTSSTT  376

Query  2436  ---------EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVV  2287
                       Q    + L+ + +S  G L  +   WK +IE  GG V   +   T CLVV
Sbjct  377   NSNQTSNGQSQSSNSENLAELRVSFYG-LKDSMGEWKRKIEGEGGAVHAKIKKDTNCLVV  435

Query  2286  SPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLD  2107
             S    E     K A  ++  IP+VRE +LVD   K++  P D Y V              
Sbjct  436   SGYVDEYNPEMKKARRMK--IPIVREEYLVDCFRKQKKLPYDRYKV--------------  479

Query  2106  KQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLND  1927
               + ++E+   +T  +KV G+  VH+ + LQD G  ILE    +YN  L++ D   G+N 
Sbjct  480   --EATSESTSLVT--VKVKGRSAVHESSGLQDTG-HILEDKKSIYNTTLNMSDLLTGINS  534

Query  1926  FCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFL  1750
             + I+Q+I   ++     +RK GRVG+      KLEE    D AI+EF R+F E TGN + 
Sbjct  535   YYILQIIQDDKSSDCYVFRKWGRVGNEKIGGVKLEEMTKSD-AIREFKRLFLEKTGNPWE  593

Query  1749  SREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQE  1570
             + E++   +K+P +F+PLD+  G+   +  +  +     A  +KL P +A  MK+L + E
Sbjct  594   AWEQKLNFEKQPGRFFPLDIDYGV---NKDMPKKPKNYPA--TKLAPQLAELMKMLFNVE  648

Query  1569  IYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNK  1390
              YR A+ME   +  E+P+G LS  ++++  + L      + S+       E+L  + SN+
Sbjct  649   TYRAAMMEFEINMSEMPLGKLSRSNIQKGFEALTEIQNLLNSSVHDPYMKESLIIDASNR  708

Query  1389  WFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLG  1210
             +FT++PS  P  +RD  D       + E+++DI  ASRL+    G +  + L D+Y KL 
Sbjct  709   FFTVIPSIHPHIIRDEDDFKSKL-KMLEALQDIEIASRLV-GFDGDS-HESLDDKYKKLH  765

Query  1209  CSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----K  1042
             C I+ +  +S+DYK+I KYL  T+ P       + + +E +F++E       D      +
Sbjct  766   CDIAPISHESEDYKLIEKYLLNTHAPTHT---DWALELEEVFSLEREG--EFDKFVPFRQ  820

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KL NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T  
Sbjct  821   KLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDR  880

Query  861   DRPEGFLVLAVASMGE-------EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV  703
             + P GF++L+  ++GE       E ME   PP       + K   K  G+K     EH  
Sbjct  881   NNPIGFMILSEVALGEVYELKKAEYME--KPP-------RGKHSTKGLGKKVPAALEHVK  931

Query  702   WKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             WK+D+ VPCG+ +  S    S   YNEY VYD  QV ++FL+ V++
Sbjct  932   WKEDVVVPCGKPV-ASNVKASELMYNEYIVYDTAQVKMQFLLKVRF  976



>gb|EPS63698.1| hypothetical protein M569_11084 [Genlisea aurea]
Length=981

 Score =   353 bits (906),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 244/765 (32%), Positives = 400/765 (52%), Gaps = 81/765 (11%)
 Frame = -2

Query  2760  LSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGD  2581
             +S  ++R++L+ N QDS GS+  +  RC + M +G + KCP+C G+L+ S+G  Y C G 
Sbjct  261   VSTSELREMLEGNGQDSRGSELDLRERCADGMLFGALTKCPMCSGSLQYSAG-MYRCCGF  319

Query  2580  FSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITVKPLSG-  2404
              +EWS CSYST  P R +   +IPE      L +  K  +  ++    E+++  K  SG 
Sbjct  320   LTEWSKCSYSTSKPDRMKGKWKIPEGTSNNYLLNWYKSQKLKRS----ERLLPPKSPSGP  375

Query  2403  --------------------MMISLSGRLTRTHQYWKSQIEKNGGKVANSV-IGVTCLVV  2287
                                 + + + G    + + WK +IE  GG+V   +     CLVV
Sbjct  376   SVSQGSIGSSSSSKIRSIGELKVVVVGVPIESLEEWKKKIEMAGGQVYAEIGKDANCLVV  435

Query  2286  SPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLD  2107
             S    E   ++++ +A  R +P+VRE +LV+ I+K+++ P D Y V +     G      
Sbjct  436   SGDLIE--NAAEIRKARRRKLPIVREDYLVECIKKQKMLPFDLYRVETTEKKHG------  487

Query  2106  KQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLND  1927
                         T+ +KV G+  VH+ + LQD  G ILE+   +YN  LS+ D   G+N 
Sbjct  488   ------------TATVKVKGQSAVHESSGLQD-SGHILEEGSSIYNTTLSLSDLSTGINS  534

Query  1926  FCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFL  1750
             + I+Q+I   ++     +RK GRVG+      K++E   +  AI+EF R+F E TGN + 
Sbjct  535   YYIIQVIEDDKSFDCYVFRKWGRVGNEKIGGTKIDEM-TKSAAIQEFKRLFLEKTGNTWE  593

Query  1749  SREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQE  1570
             + E++K   K+P KFYPLD+  G++     L  R+L + A  S+L P +   M++L + E
Sbjct  594   AWEQKKGFCKQPGKFYPLDIDYGVK----DLPKRRL-LDATSSQLAPQLVELMRMLFNVE  648

Query  1569  IYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSN  1393
              YR A+ME   +  E+P+G LS  ++++  + L    +   +       + E+L  + SN
Sbjct  649   AYRAAMMEFEINLSEMPLGKLSKTNIQKGFEALTQIQDLFHNAAYYDPDLKESLLVDASN  708

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
             ++FT++PS  P  +RD  +       + E+++DI  ASR++   + +  D+ + ++YVKL
Sbjct  709   RFFTVIPSIHPHIIRDDEEFKSKV-KMLEALQDIEIASRVVGFDADN--DETIDEKYVKL  765

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAV--EPSACPSLDDMKK  1039
              C+I  L   ++D+K+I KYL+KT+         + + +E +F++  E          KK
Sbjct  766   HCNIIPLAHTTEDFKLINKYLQKTHAATHT---EWTLELEEVFSLDREGETDKYAPFRKK  822

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             L N++LLW G+R +N +  L  G   A    PV GYMFGK I  +D  +++A+Y FT  D
Sbjct  823   LSNRMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGIYFADLVSKSAQYCFTDPD  882

Query  858   RPEGFLVLAVASMGE-------EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVW  700
              P G ++L+  ++GE       + ME   PP+   S        K  G+    ESE   W
Sbjct  883   NPVGLMLLSEVALGEMYELTKSQYME--KPPKGKHS-------TKGLGKNVPLESEFMQW  933

Query  699   KDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             +D + VPCG+ +  S   +S   YNEY VYD  QV ++FL+ V++
Sbjct  934   RDGVVVPCGKAV-TSGVKSSELMYNEYIVYDSAQVKMQFLLKVRF  977



>ref|XP_010918778.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Elaeis guineensis]
Length=947

 Score =   352 bits (903),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 243/762 (32%), Positives = 386/762 (51%), Gaps = 72/762 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+   ++R++L+ N QDS+GS+  +  RC + M +G + KCP+C G+L  S GG Y C 
Sbjct  226   KHVMTAELREMLEANGQDSAGSEYDLRDRCADGMLFGALGKCPICSGSLHYS-GGQYRCH  284

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK-NRPLKEQVITVK--  2416
             G  S WS CSYST NP R +E  ++PE      L    K  +  K NR L          
Sbjct  285   GYVSAWSRCSYSTTNPLRLKEKWKVPEETSNRYLLKWFKSQKAKKPNRVLPSPSSNKSSC  344

Query  2415  ------------PLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSPAE  2275
                          L  + +++ G   + ++ WK + E+ GGK+   +   T CLV+    
Sbjct  345   SAGMQSHPSNGDKLESLKVAVVGEPQKANE-WKHRFEEAGGKIHAKIKKDTNCLVLIGEM  403

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDP  2095
              ++   S++ +A    IP+VRE +L + I K++  P D Y V                + 
Sbjct  404   VDK--DSEIRKARRMKIPIVREDYLHECISKQKKIPFDLYKV----------------EA  445

Query  2094  SAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIM  1915
             ++E        +KV G+  VH+ + LQD G  ILE    +YN  L++ D   G+N + I+
Sbjct  446   ASETSRGGMVTVKVKGRSAVHEASGLQDVG-HILEDGNSIYNTTLNMSDLSTGINSYYIL  504

Query  1914  QLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRER  1738
             Q+I   +      +RK GRVG+      KLEE    D AI+EF R+F E TGN + + E+
Sbjct  505   QIIQEDKGSACFVFRKWGRVGNDKIGGTKLEEMSRSD-AIQEFKRLFLEKTGNPWEAWEQ  563

Query  1737  EKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRY  1558
             +K  +K+P +F+PLD+  G++        ++   A + S L P +   MK+L   E YR 
Sbjct  564   KKNFEKQPGRFFPLDIDYGVK-----QVSKKKDSANIKSLLAPQLIELMKMLFDVETYRA  618

Query  1557  ALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSNKWFT  1381
             A++E   +  E+P+G LS +++++  + L      + +  +    V E+L  + SN++FT
Sbjct  619   AMLEFEINMSEMPLGKLSKMNIQKGFEALTEIQNLLNNNAKHDPVVKESLIVDASNRFFT  678

Query  1380  LMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSI  1201
             L+PS  P  +RD  D       + E+++DI  ASRL+   SG+  D+ L  +Y KL C I
Sbjct  679   LIPSIHPHVIRDEDDFK-AKVKMLEALQDIEIASRLVGFDSGN--DESLDVKYKKLQCDI  735

Query  1200  SALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMKKL  1036
             + L  DS+DYK++ KYL  T+ P       + + +E +FA+E         P  D   KL
Sbjct  736   TPLPHDSEDYKLVEKYLLNTHAPTHK---EWSLELEEVFALEREGEYDKYTPYRD---KL  789

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  +  G   A    P  GYMFGK I  +D  +++A+Y +     
Sbjct  790   QNKMLLWHGSRLTNFVGIISQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYVDKKN  849

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDD  691
             P G ++L+  ++GE     +      PP+   S        K  G+    ES+   W+D 
Sbjct  850   PVGLMLLSEVALGEIYELKKATYMEKPPKGKHS-------TKGLGKTVPLESDFVKWQDQ  902

Query  690   IKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + VPCG+ +  S    S   YNEY VYD  QV ++FL+ V++
Sbjct  903   VVVPCGKPVPSSIR-ASELLYNEYIVYDTAQVKLQFLLKVRF  943



>gb|EYU46476.1| hypothetical protein MIMGU_mgv1a000724mg [Erythranthe guttata]
Length=1002

 Score =   353 bits (905),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 242/763 (32%), Positives = 392/763 (51%), Gaps = 73/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +++   ++R +L+ N QDS GS+  +  RC + MF+G +DKCP+C G L  SSG  Y C 
Sbjct  280   KYVVTSELRAMLEANEQDSKGSEFDLRERCADGMFFGALDKCPMCSGWLRYSSG-MYRCG  338

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-------KHQDPKNRPLK---  2437
             G  SEW+ CSYST  PPR     +IPE      L +  K       K   P N P     
Sbjct  339   GYLSEWTKCSYSTTEPPRVNGKWKIPEETGNHYLLEWFKSQKVNKPKRVLPPNSPFGPSG  398

Query  2436  --------EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLVVS  2284
                      Q   V+ +  + ++++G    + + WK +IE  GG+    +  G  C VV+
Sbjct  399   SGQPSNELSQSFKVESIGDLQVAIAGIPKESMEEWKKKIEGAGGQFHVKIKKGTNCFVVN  458

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDK  2104
                 +   +++V +A    +P+VR  +L++  ++++  P  +Y V S     G       
Sbjct  459   GMLDD--NAAEVKKARRMKLPIVRVEYLIECFKRQQKLPFASYLVESIEKTHGVS-----  511

Query  2103  QDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDF  1924
                        T ++KV G+  VH  + LQD  G IL     +YN  L++ D   G+N +
Sbjct  512   -----------TVKVKVKGQSAVHGSSGLQD-SGHILHDGKSIYNTTLNMSDLSTGVNSY  559

Query  1923  CIMQLIVAPEN-RLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLS  1747
              I+Q+I   +N   H++ + GRVG+      KLE+  ++  AI+EF R+F E TGN + +
Sbjct  560   YILQIIQDDKNSNCHVFRKWGRVGNEKIGGTKLEQM-SKTCAIQEFKRLFLEKTGNSWEA  618

Query  1746  REREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEI  1567
              E +K  +K+P +FYPLD+  G++     L+ +QL  ++  SKL P +A  MK+L + E 
Sbjct  619   WEDKKDFRKQPGRFYPLDIDYGVK----DLSRKQLNFSS--SKLAPQLAELMKMLFNVET  672

Query  1566  YRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKW  1387
             YR A+ME   +  E+P+G LS  ++++  + L    + + ST  A    E L  + SNK+
Sbjct  673   YRAAMMEFEINLSEMPLGKLSKSNIQKGFEALTQIQDLLSSTAYAPSIRENLIVDASNKF  732

Query  1386  FTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGC  1207
             FT++PS  P  ++D  D       + E+++DI  AS L+   + +       D+Y KL C
Sbjct  733   FTVIPSIHPRVIKDEDDFKSK-VKMLEALQDIEIASSLVGLDTDNDDSV--DDKYQKLRC  789

Query  1206  SISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KK  1039
              IS L +DS+++++I KYL  T+ P       + + +E +F++E      +D       K
Sbjct  790   DISPLSRDSEEFQLIEKYLNSTHAPTHT---EWALELEEVFSLERQG--EMDKYAPYRAK  844

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             L NK+LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y FT   
Sbjct  845   LKNKMLLWHGSRLTNFIGILSQGLRIAPPEAPSTGYMFGKGVYFADLVSKSAQYCFTDRK  904

Query  858   RPEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
              P G ++L+  ++GE     +      PP+   S        K  G+K   ESE+  W+ 
Sbjct  905   NPVGLMLLSEVALGEVHELTKAQYMDKPPKGKHS-------TKGLGKKVPLESEYVEWR-  956

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  957   DVVVPCGKPV-ASKVKASELMYNEYIVYNTAQVKMQFLLKVRF  998



>ref|XP_009617762.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=977

 Score =   352 bits (904),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 251/764 (33%), Positives = 392/764 (51%), Gaps = 73/764 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R++L+ N Q+S+GS+  +  RC + M +G + KCP+C G L  S GG Y C 
Sbjct  255   KHVSTGELREMLEANDQESTGSELDLRDRCADRMLFGALPKCPLCSGYLRYS-GGMYKCH  313

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL-----SDLIKKHQD--PKNRPLKEQV  2428
             G  S WS CSYS  +  R +   +IP+      L     S  +KK +   P   P K  V
Sbjct  314   GYLSAWSKCSYSATDIKRVKGKWKIPDETSNEYLLKWNKSQKLKKPERILPPATPSKASV  373

Query  2427  ITV----------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
                          + L  + ++L+G    + + WKS+IE+ GG++   +   T CLVV  
Sbjct  374   SQAANGLSQSSKGENLGDLKVALAGSSEESRENWKSKIEEAGGQLHAKIKKDTNCLVVIG  433

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                ++   S++ +A    +P+VRE +LVDSIE+K+  P D Y                K 
Sbjct  434   MLDDQ--DSEIKKARRMKVPIVREDYLVDSIERKKKLPFDLY----------------KL  475

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             +   E    +T  +KV G+  VH+ + LQD  G ILE    +YN  L++ D   G+N + 
Sbjct  476   EAYGETGSMVT--VKVKGRSAVHESSGLQD-SGHILEDKTSIYNTTLNMSDLSSGINSYY  532

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +KLEE    D AI+EF R+F E TGN + + 
Sbjct  533   ILQIIEEDKGSECYVFRKWGRVGNEKIGGNKLEEMSKSD-AIQEFKRLFLEKTGNSWEAW  591

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P +FYPLD+  G++ +       +  +   +SKL P +   MK+L + E Y
Sbjct  592   EQKTNFQKQPGRFYPLDIDYGVDKK----PTTKRNLNDTNSKLAPPLIELMKMLFNVETY  647

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      +  T       E L  + SN++F
Sbjct  648   RAAMMEFEINMSEMPLGKLSKRNIQKGFEALTEIQNLLSGTNHDPAVKETLLVDASNRFF  707

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  ++D  D       + E+++DI  ASRL+     +       D+Y KL C 
Sbjct  708   TVIPSIHPHVIKDEDDF-KLKIKMLEALQDIEIASRLVGFDIDNDDSL--DDKYKKLHCD  764

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS +   S+DY++I KYL+ T+ P       + + VE +F++E       D      +KL
Sbjct  765   ISPIPHHSEDYRVIEKYLQSTHAPTHK---DWVLEVEEVFSLEREG--EFDKFAPHREKL  819

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT    
Sbjct  820   KNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKN  879

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV-WKD  694
             P GF++L+  ++GE     +      PP+   S   K LG      K   ES  FV W+D
Sbjct  880   PVGFMLLSEVALGEVYELKKAKYIDKPPKGKHS--TKGLG------KTVPESSEFVKWRD  931

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             ++ VP G+ +  S   NS   YNEY VYD  QV ++FLV V+++
Sbjct  932   EVVVPHGKPV-PSNVKNSELLYNEYIVYDTAQVKLQFLVKVRFN  974



>ref|XP_010652358.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Vitis vinifera]
 emb|CBI37089.3| unnamed protein product [Vitis vinifera]
Length=996

 Score =   352 bits (904),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 243/766 (32%), Positives = 391/766 (51%), Gaps = 80/766 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +  RC + M +G +  CP+C  +L   SGG Y C+
Sbjct  275   KHVTTAELREMLEANGQDSTGSELDLRDRCADGMLFGALGHCPLCSSSLR-YSGGMYRCQ  333

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKN-RPLKEQVITV---  2419
             G  S WS CSYST  P R +   +IPE      L    K  +  K  R +  Q   V   
Sbjct  334   GYLSAWSKCSYSTVEPERIKGKWKIPEETSNQYLRKWFKSQKGKKPVRVMPPQSSNVSCG  393

Query  2418  ------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSPA  2278
                         + LS + ++++G   +    WKS+IE  GG     +   T C VV   
Sbjct  394   KQAASPSQSSKSENLSDLRVAIAGYSKQCVGEWKSKIEGVGGSFHAKIKEDTNCFVV---  450

Query  2277  ERERGG-----SSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIP  2113
                 GG      +K+  A +  +PV+RE +LVD  + ++  P D Y +            
Sbjct  451   ----GGMLDAEDAKMRRARKMKLPVLREDYLVDCFKSQKKLPFDKYKI------------  494

Query  2112  LDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGL  1933
                 + S E    +T  +KV G+  VH+ + LQD  G ILE    +YN  L++ D   G+
Sbjct  495   ----EASGETSSMVT--VKVKGRSAVHEASGLQD-SGHILEDGKSIYNTTLNMSDLSTGV  547

Query  1932  NDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             N + I+Q+I          +RK GRVG+     +KL+E    D AI+EF R+F E TGN 
Sbjct  548   NSYYILQIIQEDRGSNCYVFRKWGRVGNDKIGGNKLDEMPKSD-AIQEFKRLFLEKTGNP  606

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             + + ER++  QK+P +F+PLD+  G+  +      ++  ++ V+S+L P V   MK+L +
Sbjct  607   WEAWERKQNFQKQPGRFFPLDIDYGVNKQ----VSKKNNLSNVNSQLAPQVVELMKMLFN  662

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
              E YR A+ME   +  E+P+G LS  ++++  + L      + S        E+L  + S
Sbjct  663   VETYRSAMMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLNSNAHDPSFKESLIVDAS  722

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             N++FT++PS  P  +RD  D       + E+++DI  ASRL+     S     L D+Y K
Sbjct  723   NRFFTVIPSIHPHVIRDEDDFKSK-VKMLEALQDIEIASRLVGFDVDSDDS--LDDKYKK  779

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM---  1045
             L C I+ L  DS++Y++I KYL  T+ P     + + + +E +F++E       D     
Sbjct  780   LCCDIAPLPHDSEEYRLIEKYLLTTHAPTH---MDWTLELEEVFSLEREG--EFDKFASY  834

Query  1044  -KKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFT  868
              +KL N++LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y +T
Sbjct  835   REKLQNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCYT  894

Query  867   AVDRPEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV  703
                 P G ++L+  ++GE     + M    PPE   S        K  G+KK  +SE+  
Sbjct  895   DRKNPVGLMLLSEVALGEVYELRKAMYMDKPPEGKHS-------TKGLGKKKPQDSEYVK  947

Query  702   WKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             W+D++ VPCG+ +  S   ++   YNEY VY+  QV ++FL+ V++
Sbjct  948   WRDEVVVPCGKPV-PSNVKSTELMYNEYIVYNTAQVKMQFLLKVRF  992



>emb|CDY24761.1| BnaC04g13660D [Brassica napus]
Length=918

 Score =   350 bits (899),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 244/763 (32%), Positives = 385/763 (50%), Gaps = 77/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N Q + GS+  +  +C + M +GP+  CPVC G +  S GG Y C 
Sbjct  200   KHVTTAELREMLEINEQSTRGSELDLRDKCADGMMFGPLALCPVCSGHVSFS-GGIYRCN  258

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQV-------  2428
             G  SEWS CS++T +P R +   +IPE  +   L    K  +  K   +   +       
Sbjct  259   GYISEWSKCSHATSDPVRIKGKWKIPEETENQFLVKWNKSQKSVKPERILNPISPAGTSQ  318

Query  2427  ----------ITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLVVSP  2281
                       +  + L  + +S++G  ++  Q WK +IE+ G +    V  G +CLVV  
Sbjct  319   GQGSKAAADSLRSEKLDDLRVSIAGS-SKERQAWKKKIEEAGAEFHAKVKKGTSCLVVCG  377

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                     S++ +A    + VVRE +LVD  +K+   P D Y                K 
Sbjct  378   QTDME--DSEMRKARRMKVAVVREDYLVDCFKKQRKLPFDKY----------------KL  419

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             + + E +  +    KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N + 
Sbjct  420   EDAGEGMVTV----KVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGINSYY  474

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +KLEE E  D A+ EF R+F E T N + S 
Sbjct  475   ILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKLEEMEKSD-AVHEFKRLFLEKTANTWESW  533

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++K  QK+P KF PLD+  G+  +      ++  +  + S L P +   MKIL   E Y
Sbjct  534   EQKKNFQKQPGKFLPLDIDYGVNKQ----VAKKEPVQTI-SSLAPPLVELMKILFDVETY  588

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      +  +       E L  + SN++F
Sbjct  589   RTAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQRLLTESDPQSSIKENLLVDASNRFF  648

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+   + ST  + L D+Y KL C 
Sbjct  649   TMIPSVHPHIIRDEDDFKS-KVKMLEALQDIEIASRLVGFDTDST--ESLDDKYKKLHCD  705

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      +KL
Sbjct  706   ISPLSHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPHREKL  760

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T+ + 
Sbjct  761   GNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTSKEN  820

Query  855   PEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
             P G ++L+  ++G EI E +       PP    S        K  G+K   +SE   W+D
Sbjct  821   PVGLMLLSEVALG-EIHELTKAKYMDKPPRGKHS-------TKGLGKKVPQDSEFAKWRD  872

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  873   DVTVPCGKPV-PSKAKASELMYNEYIVYNTAQVKLQFLLKVRF  914



>ref|XP_009617761.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Nicotiana 
tomentosiformis]
Length=994

 Score =   352 bits (903),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 251/764 (33%), Positives = 392/764 (51%), Gaps = 73/764 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R++L+ N Q+S+GS+  +  RC + M +G + KCP+C G L  S GG Y C 
Sbjct  272   KHVSTGELREMLEANDQESTGSELDLRDRCADRMLFGALPKCPLCSGYLRYS-GGMYKCH  330

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL-----SDLIKKHQD--PKNRPLKEQV  2428
             G  S WS CSYS  +  R +   +IP+      L     S  +KK +   P   P K  V
Sbjct  331   GYLSAWSKCSYSATDIKRVKGKWKIPDETSNEYLLKWNKSQKLKKPERILPPATPSKASV  390

Query  2427  ITV----------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
                          + L  + ++L+G    + + WKS+IE+ GG++   +   T CLVV  
Sbjct  391   SQAANGLSQSSKGENLGDLKVALAGSSEESRENWKSKIEEAGGQLHAKIKKDTNCLVVIG  450

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                ++   S++ +A    +P+VRE +LVDSIE+K+  P D Y                K 
Sbjct  451   MLDDQ--DSEIKKARRMKVPIVREDYLVDSIERKKKLPFDLY----------------KL  492

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             +   E    +T  +KV G+  VH+ + LQD  G ILE    +YN  L++ D   G+N + 
Sbjct  493   EAYGETGSMVT--VKVKGRSAVHESSGLQD-SGHILEDKTSIYNTTLNMSDLSSGINSYY  549

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +KLEE    D AI+EF R+F E TGN + + 
Sbjct  550   ILQIIEEDKGSECYVFRKWGRVGNEKIGGNKLEEMSKSD-AIQEFKRLFLEKTGNSWEAW  608

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P +FYPLD+  G++ +       +  +   +SKL P +   MK+L + E Y
Sbjct  609   EQKTNFQKQPGRFYPLDIDYGVDKK----PTTKRNLNDTNSKLAPPLIELMKMLFNVETY  664

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      +  T       E L  + SN++F
Sbjct  665   RAAMMEFEINMSEMPLGKLSKRNIQKGFEALTEIQNLLSGTNHDPAVKETLLVDASNRFF  724

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  ++D  D       + E+++DI  ASRL+     +       D+Y KL C 
Sbjct  725   TVIPSIHPHVIKDEDDF-KLKIKMLEALQDIEIASRLVGFDIDNDDSL--DDKYKKLHCD  781

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS +   S+DY++I KYL+ T+ P       + + VE +F++E       D      +KL
Sbjct  782   ISPIPHHSEDYRVIEKYLQSTHAPTHK---DWVLEVEEVFSLEREG--EFDKFAPHREKL  836

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT    
Sbjct  837   KNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKN  896

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV-WKD  694
             P GF++L+  ++GE     +      PP+   S   K LG      K   ES  FV W+D
Sbjct  897   PVGFMLLSEVALGEVYELKKAKYIDKPPKGKHS--TKGLG------KTVPESSEFVKWRD  948

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             ++ VP G+ +  S   NS   YNEY VYD  QV ++FLV V+++
Sbjct  949   EVVVPHGKPV-PSNVKNSELLYNEYIVYDTAQVKLQFLVKVRFN  991



>gb|KEH23887.1| poly(ADP-ribose) polymerase domain protein [Medicago truncatula]
Length=1006

 Score =   352 bits (903),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 246/763 (32%), Positives = 389/763 (51%), Gaps = 76/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  +MR++L  N QDS+GS+  +  RC + M +G +  C +C G L  S GG Y C 
Sbjct  287   KHVTTAEMREMLDANGQDSTGSELDLRDRCADGMMFGGLSPCSLCDGFLRYS-GGMYRCT  345

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD---------PKNRPLKE  2434
             G  SEWS CSYST  P R +   +IP+      L    K  +          P +R   E
Sbjct  346   GYISEWSKCSYSTCEPKRAQGKWKIPKETDNQYLKKWFKSQKGKKPTRILPPPSSRTSAE  405

Query  2433  QVITV--------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
               I+         + L+ + +++SG    +   WK +I+  GG +   V   T CLVVS 
Sbjct  406   SQISAGQHQPSNSETLADLRVAISGLPEDSIVEWKRKIDAVGGVLHAKVKKDTNCLVVSG  465

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             A ++     ++ +A    IP+VRE +LVD +E+K+  P D Y V                
Sbjct  466   ALKDE---VEMRKARRMKIPIVREDYLVDCMERKKKLPFDMYKV----------------  506

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             +   EA   +T  +KV G+  VH  + LQD  G ILE+   +YN  L++ D   G+N + 
Sbjct  507   EMIGEASSMVT--IKVKGQSAVHDASGLQD-SGHILEEGKSIYNTTLNMSDLSTGINSYY  563

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I          +RK GRVG+     +KLEE    D AI+EF R+F E TGN + + 
Sbjct  564   ILQIIEEDNGSDCYVFRKWGRVGNDKIGGNKLEEMSKSD-AIREFKRLFFEKTGNPWEAW  622

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E +K IQK+P +F+PL++  G+  +     + +       SKL P +   +K+L + E Y
Sbjct  623   E-QKTIQKQPGRFFPLEIDYGVNKQ-----VVKKSKNNADSKLPPPLIELIKMLFNVETY  676

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L       +S+       ++L  + SN++F
Sbjct  677   RSAMMEFEINMSEMPLGKLSKSNIQKGFEALTDIQNLFKSSNADPSVRDSLLIDASNRFF  736

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+   + +  DD + D Y KL C 
Sbjct  737   TVIPSIHPHIIRDEDDFKSKV-KMLEALQDIEIASRLVGFDANN--DDSIDDNYKKLHCD  793

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMKK  1039
             IS L  DS+D++++ K+L  T+ P       + + +E +F++E         P  D   K
Sbjct  794   ISPLPHDSEDFRLVEKFLHTTHAPTHT---DWSLELEEVFSLEREGEFDKYAPYRD---K  847

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             + N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT   
Sbjct  848   VGNRMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTDKK  907

Query  858   RPEGFLVLAVASMG-----EEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
              P G ++L+  ++G     ++      PP       Q K   K  G+K   ESE+  W+D
Sbjct  908   NPVGLMLLSEVALGNVYELKKAKYMDKPP-------QGKHSTKGLGKKMPLESEYAKWRD  960

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S    S   YNEY VY+  QV ++FL+ V++
Sbjct  961   DVVVPCGKPV-SSNVKASELMYNEYIVYNTAQVKLQFLLKVRF  1002



>ref|XP_010038006.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Eucalyptus grandis]
 gb|KCW49804.1| hypothetical protein EUGRSUZ_K03285 [Eucalyptus grandis]
Length=1000

 Score =   352 bits (902),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 244/766 (32%), Positives = 391/766 (51%), Gaps = 81/766 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  +MR++L+ N QDS+GS+  +  +C + M +G +  CPVC G+L   SGG Y C+
Sbjct  280   KHVTTSEMREMLEANNQDSTGSELDLRDKCADGMLFGALACCPVCAGSLR-YSGGMYRCQ  338

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK----------NRPLK  2437
             G  S WS CSYSTR P R +   +IPE      L    K  +  K            PL+
Sbjct  339   GYQSAWSKCSYSTREPERVQGKWKIPEGTDNQYLKKWFKSQKGKKPIRILPPPSAASPLR  398

Query  2436  EQV------ITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSPA  2278
              Q+         + L  + +++ G    +   WKS+IE+ GG+V   +   T CLVV   
Sbjct  399   GQLGCQSQSSRTESLGDLKVAIVGSAKESLTEWKSKIEEAGGQVHAKIRKDTNCLVVGGV  458

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
               ++    + A  ++  IPVVRE +LVDS ++++    D Y V                 
Sbjct  459   LDDQEAEMRKARRMK--IPVVREDYLVDSFKRQKKLSFDLYRV-----------------  499

Query  2097  PSAEALENITS--ELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDF  1924
                EAL   +    +KV G+  VH+ + +QD  G ILE    +YN  L++ D   G+N +
Sbjct  500   ---EALGKASGVVTVKVKGRSAVHEASGMQD-SGHILEDGKSIYNTTLNMSDLSTGVNSY  555

Query  1923  CIMQLIVAPENR---LHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEF  1753
              I+Q+I   E+R    +++ + GRVG+      KLEE    D AI +F R+F E TGN +
Sbjct  556   YILQII--QEDRGSDCYLFRKWGRVGNEKIGGSKLEELSKSD-AIHQFKRLFLEKTGNPW  612

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
              + E ++  QK+P +FYPLD+  G+  +    A ++    A  S+L P +   M++L + 
Sbjct  613   EAWESKENFQKQPGRFYPLDIDYGVSKQ----ATKKTSDDA-DSQLAPPLKELMRMLFNV  667

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             E YR A+ME   +  E+P+G LS +++ +  + L      +          E+L  + SN
Sbjct  668   ETYRSAMMEFEINMSEMPLGKLSKINIRKGFEALTDIQNLLNGGTHDPSVKESLLIDASN  727

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIE-DMSGSTLDDPLYDRYVK  1216
             ++FT++PS  P  ++D  D       + E+++DI  ASRL+  D+     DD L ++Y K
Sbjct  728   RFFTVIPSIHPHVIKDEDDFQSKV-KMLEALQDIEIASRLVGFDVDN---DDSLDEKYKK  783

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM---  1045
             L C++  L  DS++Y++I KYL KT+ P       + + +E++F++E       D     
Sbjct  784   LRCNVDPLPHDSEEYQLIKKYLHKTHAPTHT---DWTLELEDVFSLEREG--EFDKFAPF  838

Query  1044  -KKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFT  868
              + L N++LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y FT
Sbjct  839   RQNLRNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGLYFADMVSKSAQYCFT  898

Query  867   AVDRPEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFV  703
                 P G ++L+  ++GE     +      PP    S        K  G+    ESE+  
Sbjct  899   DKKNPVGLMLLSEVALGEVHELKKAKYIDKPPGGKHS-------TKGLGKTVPLESEYLK  951

Query  702   WKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             WKDD+ VPCG+ +  S    S   YNEY VY+  QV ++FL+ V++
Sbjct  952   WKDDVIVPCGKPV-SSNVKASELLYNEYIVYNTAQVKMQFLLKVRF  996



>ref|XP_006443872.1| hypothetical protein CICLE_v10018683mg [Citrus clementina]
 ref|XP_006479562.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Citrus sinensis]
 gb|ESR57112.1| hypothetical protein CICLE_v10018683mg [Citrus clementina]
Length=996

 Score =   351 bits (900),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 242/761 (32%), Positives = 383/761 (50%), Gaps = 70/761 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +   C + M +G + +CP+C G L  S GG Y C+
Sbjct  275   KHVTTAELREMLEANGQDSTGSELDLRDHCADGMMFGALGRCPICSGPLRYS-GGIYRCR  333

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK----------NRPLK  2437
             G  S WS CSYSTR P R +   +IPE      L    K  +  K          N P  
Sbjct  334   GYQSAWSKCSYSTREPERLKGKWKIPEETNSQYLVKWFKSQRTKKPIRVLPPRTSNSPAS  393

Query  2436  EQVITV-------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
              Q           + L  + +S S     + + WK +I + GG V   +   T CLV+  
Sbjct  394   SQASKSPCQSSKSENLGDLRVSFSRLPKESKEEWKRKIGEVGGVVHAKINKETNCLVLGG  453

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                +     + A  ++  +P+VRE +LVD  ++++  P D Y V                
Sbjct  454   VPDDPDAEMRKARKMK--VPIVREDYLVDCFKRQKKLPFDLYKV----------------  495

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             +   E+   +T  +KV G+  VH+ + +QD G  ILE    +YN  L++ D   G+N + 
Sbjct  496   EAVGESSSMVT--IKVKGQSAVHEASGMQDTG-HILEDGKSVYNTTLNMSDLSTGVNSYY  552

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+      KLEE+  ED A+ EF R+F E TGN + + 
Sbjct  553   ILQIIQDDKGSDCYVFRKWGRVGNDKIGGSKLEEFSKED-AVCEFKRLFLEKTGNPWEAW  611

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E+++  QKKP KF+PLD+  G+  +       ++G  A  S+L P +   MK+L + E Y
Sbjct  612   EQKQNFQKKPGKFFPLDIDYGVNKQ----VSEKIGTDA-DSQLAPALVELMKMLFNVETY  666

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      + +        E+L  + SN++F
Sbjct  667   RAAMMEFDINMSEMPLGKLSKNNIQKGFEALTEIQNLLNNGAYDPSVKESLIIDASNRFF  726

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     S  DD L ++Y KL C 
Sbjct  727   TVIPSIHPHVIRDEDDFKSKV-KMLEALQDIEIASRLVGFDVDS--DDSLDEKYKKLRCD  783

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             I+ L  DS+DY++I KYL  T+ P       + + +E +F++E       D      +KL
Sbjct  784   IAPLPHDSEDYQLIEKYLHTTHAPTHT---DWSLELEEVFSLEREG--EFDKFSSYQRKL  838

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT    
Sbjct  839   KNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTDKKN  898

Query  855   PEGFLVLAVASMGE----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDI  688
             P G ++L+   +GE    +  ++   P D K         K  G+    ES+   W+DD+
Sbjct  899   PVGLMLLSEVGLGEVYELKKAKYMDKPPDGKH------STKGLGKTVPQESDFVKWRDDV  952

Query  687   KVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              VPCG+    S    S   YNEY VY+  QV ++FL+ V++
Sbjct  953   TVPCGKPA-PSNVRASELMYNEYIVYNTAQVKMQFLLKVRF  992



>ref|XP_009144226.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Brassica 
rapa]
Length=966

 Score =   348 bits (894),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 244/766 (32%), Positives = 388/766 (51%), Gaps = 83/766 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N Q + GS+  +  +C + M +GP+  CPVC G +  S GG Y C 
Sbjct  248   KHVTTAELREMLEINEQSTRGSELDLRDKCADGMMFGPLALCPVCSGHVSFS-GGIYRCN  306

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITVKP--  2413
             G  SEWS CS+++ +P R +   +IPE  +      L+K ++  K+   K  +  + P  
Sbjct  307   GYISEWSKCSHASSDPDRIKGKWKIPEETEN---QFLVKWNKSQKSVKPKRILNPISPAG  363

Query  2412  ------------------LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLV  2290
                               L  + +S++G  ++  Q WK +IE+ G +    V  G +CLV
Sbjct  364   TSQGQGSKAAADSSRSEKLEDLRVSIAGS-SKERQAWKKKIEEAGAEFHAKVKKGTSCLV  422

Query  2289  VSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPL  2110
             V           + A  ++  + VVRE +LVD   K+   P D Y +             
Sbjct  423   VCGQTDMEDAEMRKARRMK--VAVVREDYLVDCFTKQRKLPFDKYKIE------------  468

Query  2109  DKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLN  1930
                    +A E + + +KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N
Sbjct  469   -------DAGEGMVT-VKVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGIN  519

Query  1929  DFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEF  1753
              + I+Q+I   +      +RK GRVG+     +KLEE E  D A+ EF R+F E T N +
Sbjct  520   SYYILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKLEEMEKSD-AVHEFKRLFLEKTANTW  578

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
              S E++   QK+P KF PLD+  G+  +      ++  +  + S L P +   MKIL   
Sbjct  579   ESWEQKTNFQKQPGKFLPLDIDYGVNKQ----VAKKESVQTI-SNLAPPLVELMKILFDV  633

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             E YR A+ME   +  E+P+G LS  ++++  + L    + +  +       E L  + SN
Sbjct  634   ETYRTAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQKLLTESDPQPSVKENLLVDASN  693

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
             ++FT++PS  P  +RD  D       + E+++DI  ASRL+   + ST  + L D+Y KL
Sbjct  694   RFFTMIPSVHPHIIRDEDDFKS-KVKMLEALQDIEIASRLVGFDTDST--ESLDDKYKKL  750

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----  1045
              C IS L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      
Sbjct  751   HCDISPLSHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPHR  805

Query  1044  KKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTA  865
             +KL NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT+
Sbjct  806   EKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTS  865

Query  864   VDRPEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFV  703
              + P G ++L+  ++G EI E +       PP       + K   K  G+K   +SE   
Sbjct  866   KENPVGLMLLSEVALG-EIHELTKAKYMDKPP-------RGKHSTKGLGKKVPQDSEFAK  917

Query  702   WKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             W+DD+ VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  918   WRDDVTVPCGKPV-PSKAKASELMYNEYIVYNTAQVKLQFLLKVRF  962



>ref|XP_009144225.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Brassica 
rapa]
Length=967

 Score =   348 bits (894),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 244/766 (32%), Positives = 388/766 (51%), Gaps = 83/766 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N Q + GS+  +  +C + M +GP+  CPVC G +  S GG Y C 
Sbjct  249   KHVTTAELREMLEINEQSTRGSELDLRDKCADGMMFGPLALCPVCSGHVSFS-GGIYRCN  307

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITVKP--  2413
             G  SEWS CS+++ +P R +   +IPE  +      L+K ++  K+   K  +  + P  
Sbjct  308   GYISEWSKCSHASSDPDRIKGKWKIPEETEN---QFLVKWNKSQKSVKPKRILNPISPAG  364

Query  2412  ------------------LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLV  2290
                               L  + +S++G  ++  Q WK +IE+ G +    V  G +CLV
Sbjct  365   TSQGQGSKAAADSSRSEKLEDLRVSIAGS-SKERQAWKKKIEEAGAEFHAKVKKGTSCLV  423

Query  2289  VSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPL  2110
             V           + A  ++  + VVRE +LVD   K+   P D Y +             
Sbjct  424   VCGQTDMEDAEMRKARRMK--VAVVREDYLVDCFTKQRKLPFDKYKIE------------  469

Query  2109  DKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLN  1930
                    +A E + + +KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N
Sbjct  470   -------DAGEGMVT-VKVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGIN  520

Query  1929  DFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEF  1753
              + I+Q+I   +      +RK GRVG+     +KLEE E  D A+ EF R+F E T N +
Sbjct  521   SYYILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKLEEMEKSD-AVHEFKRLFLEKTANTW  579

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
              S E++   QK+P KF PLD+  G+  +      ++  +  + S L P +   MKIL   
Sbjct  580   ESWEQKTNFQKQPGKFLPLDIDYGVNKQ----VAKKESVQTI-SNLAPPLVELMKILFDV  634

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             E YR A+ME   +  E+P+G LS  ++++  + L    + +  +       E L  + SN
Sbjct  635   ETYRTAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQKLLTESDPQPSVKENLLVDASN  694

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
             ++FT++PS  P  +RD  D       + E+++DI  ASRL+   + ST  + L D+Y KL
Sbjct  695   RFFTMIPSVHPHIIRDEDDFKSKV-KMLEALQDIEIASRLVGFDTDST--ESLDDKYKKL  751

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----  1045
              C IS L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      
Sbjct  752   HCDISPLSHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPHR  806

Query  1044  KKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTA  865
             +KL NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT+
Sbjct  807   EKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTS  866

Query  864   VDRPEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFV  703
              + P G ++L+  ++G EI E +       PP       + K   K  G+K   +SE   
Sbjct  867   KENPVGLMLLSEVALG-EIHELTKAKYMDKPP-------RGKHSTKGLGKKVPQDSEFAK  918

Query  702   WKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             W+DD+ VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  919   WRDDVTVPCGKPV-PSKAKASELMYNEYIVYNTAQVKLQFLLKVRF  963



>ref|XP_010274828.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nelumbo nucifera]
Length=987

 Score =   347 bits (891),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 234/761 (31%), Positives = 384/761 (50%), Gaps = 72/761 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R +L+ N QD++GS+  +  RC + M +G +  CP+C G+L  S GG Y C 
Sbjct  262   KHVTTAELRVMLEANNQDTAGSELDLRDRCADGMLFGALASCPICSGSLHYS-GGEYRCH  320

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD---------PKNRPLKE  2434
             G  S WS CSYST  P R++   +IPE      L    K  +          P +    +
Sbjct  321   GYLSAWSKCSYSTTEPERQKGKWKIPEETSNEYLCKWFKSQKAKKPVRVLPPPSSNKSSQ  380

Query  2433  QVITVKP------LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG--VTCLVVSPA  2278
               I +        L  + +++ G  T + + WK +IE +G  V ++ I     CLV+S  
Sbjct  381   AAIGLSQQSKGERLEDLKVAIVGLSTESMEEWKRKIEGSGA-VFHAKIKKDSNCLVLSGE  439

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
               ++    ++ +A    IP+VRE +LV+ I++++  P + Y + +               
Sbjct  440   MDDQ--DPEIRKARRMKIPIVREDYLVECIKRQKKLPFEQYKIET---------------  482

Query  2097  PSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCI  1918
                 +   +T  +KV G+  VH+ + LQD  G ILE    +YN  L++ D   G+N + I
Sbjct  483   --VGSSSMVT--VKVKGRSAVHEXSGLQD-SGHILEDGKSIYNTTLNMSDLSTGINSYYI  537

Query  1917  MQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRE  1741
             +Q+I   +      +RK GRVG+      KLEE    D A +EF R+F E TGN + + E
Sbjct  538   LQIIQEDKGSGFYVFRKWGRVGNDKIGGSKLEEMSKSD-ATQEFKRLFLEKTGNPWEAWE  596

Query  1740  REKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYR  1561
             ++   QK+P +FYPLD+  G+  +      ++      +S+L P +   MKIL + E YR
Sbjct  597   QKHNFQKQPGRFYPLDIDYGVNKQ----VSQKKNWNGANSQLAPPLVELMKILFNVETYR  652

Query  1560  YALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFT  1381
              A+ME   +  E+P+G LS  ++++  + L      +  +       E+L  + SN++FT
Sbjct  653   AAMMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLNGSNHEPSVRESLIVDASNRFFT  712

Query  1380  LMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSI  1201
             L+PS  P  +RD  D       + E+++DI  ASRL+             ++Y KL C+I
Sbjct  713   LIPSIHPHVIRDEEDFKSK-VKMLEALQDIEIASRLVGFDVDDDDSL--DEKYKKLRCNI  769

Query  1200  SALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKLP  1033
             + L  DS+DY+++ KYL  T+ P       + + +E +F +E       D      +KL 
Sbjct  770   TPLPHDSEDYRLVEKYLLTTHAPTHK---DWSLELEEVFTLERDG--EFDKFAPYREKLK  824

Query  1032  NKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRP  853
             N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    P
Sbjct  825   NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGIYFADLVSKSAQYCYTDKKNP  884

Query  852   EGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDI  688
              G ++L+  ++GE     + +    PP+   S        K  G KK  ESE+  W+DD+
Sbjct  885   VGLMILSEVALGEVYELKKALYMEKPPKGKHS-------TKGLGMKKPQESEYAKWRDDV  937

Query  687   KVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              VPCG+ +  S   +S   YNEY VY+  QV ++FL+ V++
Sbjct  938   IVPCGKPV-SSNVKSSELMYNEYIVYNTAQVKMQFLLKVRF  977



>ref|XP_002881169.1| hypothetical protein ARALYDRAFT_902162 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57428.1| hypothetical protein ARALYDRAFT_902162 [Arabidopsis lyrata subsp. 
lyrata]
Length=979

 Score =   347 bits (890),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 245/764 (32%), Positives = 390/764 (51%), Gaps = 79/764 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +++   ++R++L+ N Q + GS+  +  +C + M +GP+  CP+C G L  S GG Y C 
Sbjct  261   KYVKSAELREMLEVNEQSTRGSELDLRDKCADGMMFGPLALCPICSGHLSFS-GGLYRCH  319

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVIT-----  2422
             G  SEWS CS+ST +P R +E  +IP   +   L    K     K + +   V +     
Sbjct  320   GYISEWSKCSHSTLDPDRIKEKWKIPGETENQFLLKWNKSQNSVKPKRILHPVSSGETSQ  379

Query  2421  ------------VKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSP  2281
                          + L+ + +S++G +T+  Q WK +IE+ GG+  AN   G +CLVV  
Sbjct  380   GQGSKDATDSSRSEKLADLKVSITG-VTKERQAWKKRIEEAGGEFHANVKKGTSCLVVCG  438

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                 R    + A  ++  + +VRE +LVD  +K+   P D + +                
Sbjct  439   LTDIRDAELRKARRMK--VAIVREDYLVDCFKKQRKLPFDKFKI----------------  480

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             + ++E+L  +    KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N + 
Sbjct  481   EDTSESLVTV----KVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGINSYY  535

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +K+EE    D A+ EF R+F E TGN + S 
Sbjct  536   ILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKVEEMSKSD-AVHEFKRLFLEKTGNTWESW  594

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P KF PLD+  G+  +   +A ++   A+  S L P +   MK+L   E Y
Sbjct  595   EQKTNFQKQPGKFLPLDIDYGVNKQ---VAKKEPCPAS--SNLAPPLIELMKMLFDVETY  649

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L    + +  +       E+L  + SN++F
Sbjct  650   RSAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQKLLTESDPQPSIKESLLVDASNRFF  709

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     ST  + L D+Y KL C 
Sbjct  710   TMIPSIHPHIIRDEEDFKS-KVKMLEALQDIEIASRLVGFDVDST--ESLDDKYKKLHCD  766

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMKK  1039
             IS L  DS+DY++I KYL  T+ P       + + +E +FA+E         P  D   K
Sbjct  767   ISPLPHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREGEFDKYAPHRD---K  820

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             L NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T   
Sbjct  821   LGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKK  880

Query  858   RPEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWK  697
              P G ++L+  ++G EI E +       PP+   S        K  G+K   +SE   W+
Sbjct  881   NPVGLMLLSEVALG-EIHELTKAKYMDKPPKGKHS-------TKGLGKKVPQDSEFAKWR  932

Query  696   DDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              D+ VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  933   GDVTVPCGKPV-ASKVKASELMYNEYIVYNTAQVKLQFLLKVRF  975



>ref|XP_007050348.1| Poly(ADP-ribose) polymerase 2 isoform 2 [Theobroma cacao]
 gb|EOX94505.1| Poly(ADP-ribose) polymerase 2 isoform 2 [Theobroma cacao]
Length=991

 Score =   347 bits (891),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 238/755 (32%), Positives = 391/755 (52%), Gaps = 62/755 (8%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QD++GS+  +   C + M +G + KCP+C G+L  S GG Y C 
Sbjct  274   KHVTTGELREMLEANGQDATGSELDLRDHCADGMMFGALGKCPMCSGSLRFS-GGMYRCH  332

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK----------  2437
             G  S WS CSYS+  P   +   ++P+      L    K  +  K  P++          
Sbjct  333   GYLSAWSKCSYSSYEPEHVKGKWKVPDETNNEFLRKWFKSQKIKK--PVRILPPSASSSQ  390

Query  2436  -----EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSPAE  2275
                   Q   V+ L+ + +S++G    + + WK +I+  GG V   +   T C VVS  E
Sbjct  391   AANGQSQTSKVESLADLKVSIAGLPQESMEEWKGKIKGAGGIVHAKIKKDTNCFVVS-GE  449

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDP  2095
              + G  ++V +A    +P+VRE +LVD  ++++  P D Y V                + 
Sbjct  450   LD-GHDAEVRKARRMKLPIVREDYLVDCFKRQKKLPFDLYKV----------------EA  492

Query  2094  SAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIM  1915
               EA   +T  +KV G+  VH+ + LQD    ILE    +YN  L++ D   G+N + ++
Sbjct  493   IGEASSMVT--VKVKGRSAVHEASGLQD-SCHILEDGRSIYNTTLNMSDLSTGVNSYYVL  549

Query  1914  QLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRER  1738
             Q+I   +      +RK GRVG+     +KLEE    D AI EF R+F E TGN + + E+
Sbjct  550   QIIQEDKASDCYVFRKWGRVGNEKIGGNKLEEMSKLD-AISEFKRLFLEKTGNTWEAWEQ  608

Query  1737  EKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRY  1558
             ++  QK+P +F+PLD+  G+  +     + +   +   S+L P + + MK+L + E YR 
Sbjct  609   KQNFQKQPGRFFPLDIDYGVNKQ-----VSKNKHSDADSRLPPPLLDLMKMLFNVETYRA  663

Query  1557  ALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTL  1378
             A+ME   +  E+P+G LS  ++++  + L      + S        E+L  + SN++FT+
Sbjct  664   AMMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLNSNAYDPSVKESLIIDASNRFFTV  723

Query  1377  MPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSIS  1198
             +PS  P  +RD  D       + E++ DI  ASR++   + S  DD L ++Y KL C + 
Sbjct  724   IPSIHPHVIRDEDDFKSKV-KMLEALEDIEIASRIVGFDNNS--DDSLDEKYKKLNCDVV  780

Query  1197  ALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKLPN  1030
              L  DS++Y++I KYL  T+ P       + + +E +F++E       D      +KL N
Sbjct  781   PLPHDSEEYRLIEKYLLTTHAPTHT---DWTLELEEVFSLEREG--EFDKFAPYREKLIN  835

Query  1029  KVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPE  850
             ++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    P 
Sbjct  836   RMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTHKQSPV  895

Query  849   GFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGR  670
             G ++L+  ++G E+ E +      K L + K   K  G+K   ESE   WKD+I VPCG+
Sbjct  896   GLMLLSEVALG-EVYELTKAKYIEK-LPKGKHSTKGLGKKVPQESEFVKWKDNIIVPCGK  953

Query  669   LIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  954   PV-SSRVKASELMYNEYIVYNTAQVKMQFLLKVRF  987



>ref|XP_010522166.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Tarenaya hassleriana]
Length=986

 Score =   347 bits (891),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 241/764 (32%), Positives = 390/764 (51%), Gaps = 78/764 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++++  ++R++L++N Q + GS+  +  +C + M +GP+DKCP+C   +   SGG Y C 
Sbjct  263   KYVTTAELREMLEENEQSTKGSELDLRDQCADGMMFGPLDKCPICSSHIS-YSGGIYRCH  321

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESV-----------QKTPLSDLIKKHQDPKNRPL  2440
             G  SEWS CSYST  P R +   +IPE +           QKT     I +     N   
Sbjct  322   GYISEWSKCSYSTSEPLRIKGKWKIPEELENQFVVKWYNSQKTVKPKRILRLASSSNGGA  381

Query  2439  KEQVI-------TVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVS  2284
               QV        + + L  + +S++G  ++  + WK +IE+ GG+V A +  G  CLVV 
Sbjct  382   PGQVSKDASDSPSGEKLGNLRVSIAGS-SKECESWKKKIEEAGGEVHAKAKKGTNCLVVC  440

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDK  2104
                  +    + A  ++  IP+VRE +LVD  +K+   P   Y                K
Sbjct  441   GQLDMQNAEMRKARRMK--IPIVREDYLVDCFKKQRKLPFQLY----------------K  482

Query  2103  QDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDF  1924
              + + E++  +    KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N +
Sbjct  483   FEDTGESMVTV----KVKGRSAVHEASGLQ-EYCHILEDGNSIYNTTLSMSDLSTGINSY  537

Query  1923  CIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLS  1747
              I+Q+I          +RK GRVG+     +KL+E    D AI EF R+F E TGN +  
Sbjct  538   YILQIIQEDRGSDCYVFRKWGRVGNEKIGGNKLDEMSKSD-AIHEFKRLFLEKTGNTWEE  596

Query  1746  REREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEI  1567
              E++K  +K P +F+PLD+  G+  +     + +   A + S L P +   MK+L   E 
Sbjct  597   WEQKKDFRKHPGRFFPLDIDYGVNKQ-----VVKAPTADISSNLAPPLIELMKMLFDVET  651

Query  1566  YRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKW  1387
             YR A+ME   +  E+P+G LS   +++  + L    + +  +       E+L  + SN++
Sbjct  652   YRAAMMEFEINMSEMPLGKLSKHDIQKGFEALTEIQKLLTDSDHQPSIKESLLVDASNRF  711

Query  1386  FTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGC  1207
             FT++PS  P  +RD  D       + E+++DI  ASRL+   + +T  + L D+Y KL C
Sbjct  712   FTMIPSIHPHIIRDEHDFKS-KVKMLEALQDIEIASRLVGFDADNT--ESLDDKYKKLRC  768

Query  1206  SISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KK  1039
              I +L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      +K
Sbjct  769   EILSLPPDSEDYRLIEKYLHTTHAPTHT---EWSLELEEVFALEREG--EFDKFAPYREK  823

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             L NK+LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y +T+ +
Sbjct  824   LGNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCYTSKE  883

Query  858   RPEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWK  697
              P G ++L+  ++G E+ E +       PP       + K   K  G+K   E +   W+
Sbjct  884   NPVGLMLLSEVALG-EVYELTKAKYMDKPP-------RGKHSTKGLGKKVPHEQDFVKWR  935

Query  696   DDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             DD+ VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  936   DDVTVPCGKPV-ASKVKASELMYNEYIVYNTAQVKLQFLLKVRF  978



>ref|XP_008794292.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Phoenix dactylifera]
Length=981

 Score =   346 bits (888),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 241/759 (32%), Positives = 386/759 (51%), Gaps = 66/759 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +  RC + M +G + KCP+C G+L   SGG Y C 
Sbjct  260   KHVTTAELREMLEANGQDSAGSEYDLRDRCADGMLFGALGKCPICSGSLH-YSGGQYRCH  318

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK-NRPL--------KE  2434
             G  S WS CS S  +P R +E  +IP+      L    K  +  K  R L          
Sbjct  319   GYVSAWSKCSCSMTDPVRLKEKWKIPDETSNQYLLKWFKSQKAKKPTRVLPPSSCKSSSS  378

Query  2433  QVITVKPLSG-----MMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERE  2269
              ++  +P +G     + +++ G   +  + WK + E+ GGK+   +   T  +V   E +
Sbjct  379   TLMQSQPSNGDNLENLKVAIVGESQKAIEDWKHRFEEAGGKIHAKIKKDTNCLVLIGEMD  438

Query  2268  RGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSA  2089
                 S++ +A    IP++RE +L + I K++  P D Y V                + ++
Sbjct  439   -DDDSEIRKARRMKIPIMREDYLHECIRKQKKIPFDLYKV----------------EAAS  481

Query  2088  EALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQL  1909
             E   +    +KV G+  VH+ + LQD G  ILE    +YN  L++ D   G+N + I+Q+
Sbjct  482   ETSRSDMVTVKVKGRSAVHEASGLQDTG-HILEGGNSIYNTTLNMSDLSTGVNSYYILQI  540

Query  1908  IVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREK  1732
             I   +      +RK GRVG+      KLEE    D A+KEF R+F E TGN + + E++K
Sbjct  541   IQEDKGSACYVFRKWGRVGNDKIGGTKLEEMPKSD-AVKEFKRLFLEKTGNPWEAWEQKK  599

Query  1731  KIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYAL  1552
               +K+P KF+PLD+  G++      A ++   A   S L P +   MK+L   E YR A+
Sbjct  600   NFEKQPGKFFPLDIDYGVKQ-----ASKKEDSANTKSLLAPQLIELMKMLFDVETYRAAM  654

Query  1551  MEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSNKWFTLM  1375
             ME   +  E+P+G LS  ++++  + L      + +  +    V E+L  + SN++FTL+
Sbjct  655   MEFEINMSEMPLGKLSKTNIQKGFEALTVIQNLLNNNAKHDPVVKESLIVDASNRFFTLI  714

Query  1374  PSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISA  1195
             PS  P  +RD  D       + E+++DI  ASRL+   SG+  D+ L + Y KL C I+ 
Sbjct  715   PSIHPHVIRDEDDFK-AKVKMLEALQDIEIASRLVGFDSGN--DESLDETYKKLRCDITP  771

Query  1194  LEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA----CPSLDDMKKLPNK  1027
             L  DS+D+K++ KYL  T+ P       + + +E +FA+E         S  D  KL NK
Sbjct  772   LPHDSEDFKLVEKYLLNTHAPTHK---DWSLQLEEVFALEREGEYDKYASYRD--KLHNK  826

Query  1026  VLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEG  847
             +LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +     P G
Sbjct  827   MLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYVDKKNPVG  886

Query  846   FLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
              ++L+  ++GE     +      PP+   S        K  G+    ESE   W+D + V
Sbjct  887   LMLLSEVALGEIYELKKATYIEKPPKGKHS-------TKGLGKTAPLESEFVKWRDQVVV  939

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             PCG+ +  S    S   YNEY VY+  QV ++FL+ V++
Sbjct  940   PCGKPVPSSIR-ASELLYNEYIVYNTAQVKLQFLLKVRF  977



>emb|CDP03723.1| unnamed protein product [Coffea canephora]
Length=986

 Score =   346 bits (888),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 241/762 (32%), Positives = 383/762 (50%), Gaps = 72/762 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R++L+ N+QDS+GS+  +  RC + M +G + KCP+C G L    G  Y C 
Sbjct  266   KHVSTVELREMLEINSQDSTGSELDLRERCADGMHFGALAKCPLCSGRLRYLEG-MYRCH  324

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK---------------  2452
             G  SEWS CSYS   P R +   +IP+      L    K  +  K               
Sbjct  325   GYLSEWSKCSYSMTEPVRVKGKWKIPKETSNEYLLKWFKSQKSKKPARIMPPSTPTGPSG  384

Query  2451  ----NRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVV  2287
                 NR L  Q    + L  + +++ G L  + + WKS+I++ GG+V   +   T CLVV
Sbjct  385   NQAANRIL--QASKSESLGDLRVAIVGELKASLEEWKSRIKEAGGQVHLKIKNDTNCLVV  442

Query  2286  SPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLD  2107
                  ++   +++ +A    +P+V+E +LVD I++++  P + Y +              
Sbjct  443   GGPLSDQ--DTEIKKARRMKLPIVQEQYLVDCIKRRKKLPFELYKI--------------  486

Query  2106  KQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLND  1927
               +   E    +T  +KV G+  VH+ + LQD  G ILE+   +YN  LS+ D   G+N 
Sbjct  487   --EAVGETHSMVT--VKVKGRSAVHESSGLQD-SGHILEEGKSIYNTTLSMSDLSTGVNS  541

Query  1926  FCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFL  1750
             + I+Q+I   +      +RK GRVG+     +K+EE    D A+ EF R+F E TGN + 
Sbjct  542   YYILQIIQDDQGSDCYLFRKWGRVGNEKIGGNKIEELAKSD-ALSEFKRLFLEKTGNPWE  600

Query  1749  SREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQE  1570
             + E+ K  +K+P +FYPLD+  G+         ++    +  S+L P +   M +L + E
Sbjct  601   AWEQRKNFRKQPGRFYPLDIDYGVNKNLS----KKKSFDSTTSRLPPALVELMMMLFNVE  656

Query  1569  IYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNK  1390
              YR A+ME   +  E+P+G LS  ++++    L      + ST     + E+L    SN+
Sbjct  657   TYRSAMMEFEINMSEMPLGKLSKRNIQKGFGALTEIQNLLSSTAHDPARRESLIIAASNR  716

Query  1389  WFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLG  1210
             +FT++PS  P  +RD  D       + E+++DI  ASRL+             D+Y KL 
Sbjct  717   FFTMIPSIHPHVIRDEDDFKSKV-KMLEALQDIEIASRLVGFGGDDGDSL--DDKYKKLR  773

Query  1209  CSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----K  1042
             C IS L  DS+DY +I KYL  T+ P       + + +E +FA+E       D      +
Sbjct  774   CDISPLPHDSEDYLLIEKYLHSTHAPTHT---LWSLELEEVFALEREG--EYDKFAPYRE  828

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KL NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT  
Sbjct  829   KLGNKMLLWHGSRLTNFVGILSQGLRIAPPEAPASGYMFGKGIYFADLVSKSAQYCFTDK  888

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLG---AKFHGRKKTDESEHFVWKDD  691
               P G ++L+  ++G E+ E +    + K +E+   G    K  G+    ES    W+ D
Sbjct  889   KNPVGLMLLSEVALG-EVYELT----NAKYMEKPPAGKHSTKGLGKNVPQESGFLKWQGD  943

Query  690   IKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + VPCGR +  S    S   YNEY VY+  QV ++FL+ V++
Sbjct  944   VVVPCGRPV--STLKPSELLYNEYIVYNTAQVKLQFLLKVRF  983



>gb|KFK31229.1| hypothetical protein AALP_AA6G085200 [Arabis alpina]
Length=984

 Score =   345 bits (884),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 241/763 (32%), Positives = 389/763 (51%), Gaps = 77/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++++  ++R++L+ N Q + GS+  +  +C + M +GP+  CP+C G L  S GGTY C 
Sbjct  266   KYVTTAELREMLEANEQSTRGSELDLRDKCADGMMFGPLTLCPLCTGHLSFS-GGTYRCH  324

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQV-------  2428
             G  SEWS CS+ T +P R +   +IPE  +   L    K  +  K + +   V       
Sbjct  325   GYVSEWSKCSHCTSDPDRIKGKWKIPEETENQFLLKWNKSQKSVKPKRILNPVSPGGMSQ  384

Query  2427  ----------ITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLVVSP  2281
                       +  + L  + +S++G  ++  Q WK +IE+ G +   +V  G +CLVV  
Sbjct  385   GQGSKDGTGSLRSEKLEDLRVSIAGP-SKERQAWKKKIEEAGAEFHTTVKKGTSCLVVCD  443

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                 R    + A  ++  + +VRE +LVD  +K+   P D Y +  D+   G G+     
Sbjct  444   VTDMREAEMRKARRMK--VAIVREDYLVDCFKKQRKLPFDKYKI-EDV---GEGV-----  492

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
                      +T  +KV G+  VH+ + LQ E   ILE    +YN  LS  D   G+N + 
Sbjct  493   ---------VT--VKVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSQSDLSTGVNSYY  540

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+      KLEE    D A++EF R+F E TGN + + 
Sbjct  541   ILQIIQEDKGSDCYVFRKWGRVGNENIGSTKLEEMSKSD-AVQEFKRLFLEKTGNTWETW  599

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E+++  QK+P KF PLD+  G+  +     + +      +SKL P +   MK+L   E Y
Sbjct  600   EKKENFQKRPGKFLPLDIDYGVNKQ-----VAKKEPVQTNSKLAPSLMELMKMLFDVETY  654

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      +  +       E+L  + SN++F
Sbjct  655   RSAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQRLLTESNPQPSIKESLLVDASNRFF  714

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+   + +T  + + ++Y KL C 
Sbjct  715   TMIPSIHPHIIRDEDDFKSKV-KMLEALQDIEIASRLVGFDADNT--ESIDEKYEKLHCD  771

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             I+ L  DS+DY +I +YL  T+ P       + + +E +FA+E       D      +KL
Sbjct  772   IAPLPHDSEDYLLIEEYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPYREKL  826

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT+   
Sbjct  827   GNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTSKKD  886

Query  855   PEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
             P G ++L+  ++G EI E +       PP       + K   K  G+K   ESE   W+D
Sbjct  887   PVGLMLLSEVALG-EIHELTKAKYMDKPP-------RGKHSTKGLGKKVPQESEFAKWRD  938

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  939   DVTVPCGKPV-SSKVKASELMYNEYIVYNTSQVKLQFLLKVRF  980



>ref|NP_850165.1| poly [ADP-ribose] polymerase 2 [Arabidopsis thaliana]
 sp|Q9ZP54.2|PARP1_ARATH RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Arabidopsis thaliana]
 emb|CAA10482.1| poly(ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AAM13882.1| putative poly (ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AAN12901.1| putative poly(ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AEC08527.1| poly [ADP-ribose] polymerase 2 [Arabidopsis thaliana]
Length=983

 Score =   345 bits (884),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 242/763 (32%), Positives = 385/763 (50%), Gaps = 77/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++++  ++R++L+ N Q + GS+  +  +C + M +GP+  CP+C G L  S GG Y C 
Sbjct  265   KYVTSAELREMLEVNEQSTRGSELDLRDKCADGMMFGPLALCPMCSGHLSFS-GGLYRCH  323

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVIT-----  2422
             G  SEWS CS+ST +P R +   +IP+  +   L    K  +  K + +   V++     
Sbjct  324   GYISEWSKCSHSTLDPDRIKGKWKIPDETENQFLLKWNKSQKSVKPKRILRPVLSGETSQ  383

Query  2421  ------------VKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSP  2281
                          + L+ + +S++G  T+  Q WK +IE+ G +  AN   G +CLVV  
Sbjct  384   GQGSKDATDSSRSERLADLKVSIAGN-TKERQPWKKRIEEAGAEFHANVKKGTSCLVVCG  442

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                 R    + A  ++  + +VRE +LVD  +K+   P D Y +                
Sbjct  443   LTDIRDAEMRKARRMK--VAIVREDYLVDCFKKQRKLPFDKYKI----------------  484

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             + ++E+L  +    KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N + 
Sbjct  485   EDTSESLVTV----KVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGINSYY  539

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +K+EE    D A+ EF R+F E TGN + S 
Sbjct  540   ILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKVEEMSKSD-AVHEFKRLFLEKTGNTWESW  598

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P KF PLD+  G+  +       Q       S L P +   MK+L   E Y
Sbjct  599   EQKTNFQKQPGKFLPLDIDYGVNKQVAKKEPFQ-----TSSNLAPSLIELMKMLFDVETY  653

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      +  +       E+L  + SN++F
Sbjct  654   RSAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQRLLTESDPQPTMKESLLVDASNRFF  713

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASR++     ST  + L D+Y KL C 
Sbjct  714   TMIPSIHPHIIRDEDDFKS-KVKMLEALQDIEIASRIVGFDVDST--ESLDDKYKKLHCD  770

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      +KL
Sbjct  771   ISPLPHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPHREKL  825

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    
Sbjct  826   GNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKN  885

Query  855   PEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
             P G ++L+  ++G EI E +       PP       + K   K  G+K   +SE   W+ 
Sbjct  886   PVGLMLLSEVALG-EIHELTKAKYMDKPP-------RGKHSTKGLGKKVPQDSEFAKWRG  937

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S+   S   YNEY VYD  QV ++FL+ V++
Sbjct  938   DVTVPCGKPV-SSKVKASELMYNEYIVYDTAQVKLQFLLKVRF  979



>gb|AAD20677.1| putative poly (ADP-ribose) polymerase [Arabidopsis thaliana]
Length=1009

 Score =   345 bits (885),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 242/763 (32%), Positives = 385/763 (50%), Gaps = 77/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++++  ++R++L+ N Q + GS+  +  +C + M +GP+  CP+C G L  S GG Y C 
Sbjct  291   KYVTSAELREMLEVNEQSTRGSELDLRDKCADGMMFGPLALCPMCSGHLSFS-GGLYRCH  349

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITVKP--  2413
             G  SEWS CS+ST +P R +   +IP+  +   L    K  +  K + +   V++ +   
Sbjct  350   GYISEWSKCSHSTLDPDRIKGKWKIPDETENQFLLKWNKSQKSVKPKRILRPVLSGETSQ  409

Query  2412  ---------------LSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSP  2281
                            L+ + +S++G  T+  Q WK +IE+ G +  AN   G +CLVV  
Sbjct  410   GQGSKDATDSSRSERLADLKVSIAGN-TKERQPWKKRIEEAGAEFHANVKKGTSCLVVCG  468

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                 R    + A  ++  + +VRE +LVD  +K+   P D Y +                
Sbjct  469   LTDIRDAEMRKARRMK--VAIVREDYLVDCFKKQRKLPFDKYKI----------------  510

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             + ++E+L  +    KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N + 
Sbjct  511   EDTSESLVTV----KVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGINSYY  565

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +K+EE    D A+ EF R+F E TGN + S 
Sbjct  566   ILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKVEEMSKSD-AVHEFKRLFLEKTGNTWESW  624

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P KF PLD+  G+  +       Q       S L P +   MK+L   E Y
Sbjct  625   EQKTNFQKQPGKFLPLDIDYGVNKQVAKKEPFQ-----TSSNLAPSLIELMKMLFDVETY  679

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      +  +       E+L  + SN++F
Sbjct  680   RSAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQRLLTESDPQPTMKESLLVDASNRFF  739

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASR++     ST  + L D+Y KL C 
Sbjct  740   TMIPSIHPHIIRDEDDFKS-KVKMLEALQDIEIASRIVGFDVDST--ESLDDKYKKLHCD  796

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      +KL
Sbjct  797   ISPLPHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPHREKL  851

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    
Sbjct  852   GNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKN  911

Query  855   PEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
             P G ++L+  ++G EI E +       PP       + K   K  G+K   +SE   W+ 
Sbjct  912   PVGLMLLSEVALG-EIHELTKAKYMDKPP-------RGKHSTKGLGKKVPQDSEFAKWRG  963

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S+   S   YNEY VYD  QV ++FL+ V++
Sbjct  964   DVTVPCGKPV-SSKVKASELMYNEYIVYDTAQVKLQFLLKVRF  1005



>ref|XP_002521021.1| poly [ADP-ribose] polymerase, putative [Ricinus communis]
 gb|EEF41438.1| poly [ADP-ribose] polymerase, putative [Ricinus communis]
Length=982

 Score =   344 bits (883),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 244/762 (32%), Positives = 381/762 (50%), Gaps = 72/762 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             + ++  ++RQ+L+ N QD+SGS+  +  RC + M +G +  CP C G L   SGG Y C 
Sbjct  261   KQVTTVELRQMLEANGQDNSGSELDLRDRCADGMIFGALGLCPTCSGFLR-YSGGMYRCT  319

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK----------NRPLK  2437
             G  SEWS CSYST  P RK+   ++PE      L +  K  +  K          + P  
Sbjct  320   GFLSEWSKCSYSTCEPERKKGKWKVPEDTDNQFLRNWFKTQKSKKPIRALPSPSFDNPSG  379

Query  2436  EQVITVKP-------LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
              +  + +        L  + ++ SG    + + WK +IE  GG+V   +   T C +VS 
Sbjct  380   SKAASGQSPSSEGESLGDLKVAFSGLSKESVEEWKGKIEGAGGQVHAKIKKDTNCYIVSG  439

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             A        + A  ++  +PVVRE +LVD  +K +  P   Y V    AV G        
Sbjct  440   ALDHDDVEMRKARRMK--LPVVREDYLVDCFKKHKKLPFSFYKVE---AVSG--------  486

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
                  A   IT  +KV G+  VH+ + LQD G  ILE    +YN  L++ D   G+N + 
Sbjct  487   -----ASSVIT--VKVKGRSAVHEASGLQDTG-HILEDGNSIYNTTLNMSDLSTGVNSYY  538

Query  1920  IMQLIVAPENR-LHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +    H++ + GRVG+      KL+E    D AI EF R+F E TGN + + 
Sbjct  539   ILQIIQDDKGSDCHVFRKWGRVGNEKIGGKKLDEMSKLD-AICEFKRLFLEKTGNSWEAW  597

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E+++  QK+P KF+PLD+  G+  +     L +      +S+L   +   MK+L + E Y
Sbjct  598   EQKQNFQKRPGKFFPLDIDYGVNKQ-----LTRKPRNDANSQLAQPLVELMKMLFNVEAY  652

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      + S        E L  + SN++F
Sbjct  653   RAAMMEFEINMSEMPLGKLSKNNIQKGFEALTEIQNLLNSNSHDPSIRENLIVDASNRFF  712

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASR +   + +       D+Y KL C 
Sbjct  713   TVIPSIHPHVIRDEYDFKSKV-KMLEALQDIEIASRFLGFDADNDDS--FDDKYRKLRCD  769

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             I+ L  DS+DY++I KYL  T+ P       + + +E +F++E      +D      +KL
Sbjct  770   ITPLSHDSEDYQLIEKYLHTTHAPTHT---DWSLELEEVFSLEREG--EIDKFAPYRRKL  824

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    
Sbjct  825   KNRMLLWHGSRLTNYVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKN  884

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDD  691
             P G ++L+  ++GE       M    PPE   S        K  G+K   ESE   W+D+
Sbjct  885   PVGLMLLSEVALGEVYELKNAMYMDKPPEGKHS-------TKGLGKKVPQESEFVKWRDE  937

Query  690   IKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + VPCGR +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  938   VTVPCGRPV-PSKVKASELMYNEYIVYNTAQVKMQFLLKVRF  978



>ref|XP_010933094.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1-like [Elaeis guineensis]
Length=985

 Score =   344 bits (882),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 239/764 (31%), Positives = 387/764 (51%), Gaps = 76/764 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +  RC + M +G + KCP+C G+L   SGG Y C 
Sbjct  264   KHVTTVELREMLEANGQDSAGSEYDLRDRCADGMLFGALGKCPICSGSLH-YSGGQYRCH  322

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK-NRPL--------KE  2434
             G  S WS CSYST +P R +E  +IP+      L    K  +  K NR L          
Sbjct  323   GYVSAWSKCSYSTTDPVRLKEKWKIPDETSNQYLLKWFKSQKAKKPNRALPPSSNKSSSS  382

Query  2433  QVITVKPLSG-----MMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERE  2269
              ++  +P +G     + +++ G   +  + WK + E+ GGK+   +   T  +V   E +
Sbjct  383   TLVQSQPSNGDKLENLKVAIVGESRKAIEDWKHKFEEAGGKIHAKIKKDTNCLVLIGEMD  442

Query  2268  RGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSA  2089
                 S++ +A     P++RE +L + I K++  P D Y V +                  
Sbjct  443   -DDDSEIKKARRMKTPIMREDYLHECIRKQKKIPFDLYKVEA------------------  483

Query  2088  EALENITSEL---KVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCI  1918
              A E   S++   KV G+  VH+ + LQD G  ILE    +YN  L++ D   G+N + I
Sbjct  484   -AFETSRSDMVTVKVKGRSAVHEASGLQDTG-HILEDGNSIYNTTLNMSDLSTGINSYYI  541

Query  1917  MQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRE  1741
             +Q+I   +      +RK GRVG       KLEE    D AI+EF R+F E TGN + + E
Sbjct  542   LQIIQEDKGSDCYVFRKWGRVGSDKIGGTKLEEMSKSD-AIQEFKRLFLEKTGNPWEAWE  600

Query  1740  REKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYR  1561
             ++K  QK+P +F+PLD+  G++        +++  A   S L P +   MK+L   E YR
Sbjct  601   QKKNFQKQPGRFFPLDIDYGVKQ-----VSKKVESANTKSLLAPQLIELMKMLFDVETYR  655

Query  1560  YALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV--EALWAEFSNKW  1387
              A++E   +  E+P+G LS  ++++  + L   ++ + +   A   V  E+L  + SN++
Sbjct  656   AAMLEFEINMSEMPLGKLSKTNIQKGFEALTE-IQNLLNNNAAHDPVIKESLIVDASNRF  714

Query  1386  FTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGC  1207
             FTL+PS  P  +RD  D       + E+++DI  ASRL+    G   D+ L ++Y KL C
Sbjct  715   FTLIPSIHPHVIRDEDDFK-AKVKMLEALQDIEIASRLV-GFDGEN-DESLDEKYKKLRC  771

Query  1206  SISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMK  1042
              I+ L  DS+D+K++ K L  T+ P       + + +E +FA+E         P  D   
Sbjct  772   DITPLPHDSEDFKLVEKXLLNTHAPTHK---DWSLELEEVFALEREGEYDKYAPYRD---  825

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KL NK+LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y +   
Sbjct  826   KLRNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGLYFADLVSKSAQYCYVDK  885

Query  861   DRPEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWK  697
               P G ++L+  ++GE     +      PP+   S        K  G+    E+E   W+
Sbjct  886   KNPVGLMLLSEVALGEIYELKKATYMEKPPKGKHS-------TKGLGKTVPLETEFVKWR  938

Query  696   DDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D + +PCG+ +  S    S   YNEY VY+  QV ++FL+ V++
Sbjct  939   DQVVLPCGKPVPSSIR-ASELLYNEYIVYNTAQVKLQFLLKVRF  981



>emb|CDY10794.1| BnaA05g11420D [Brassica napus]
Length=1322

 Score =   348 bits (893),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 244/766 (32%), Positives = 388/766 (51%), Gaps = 83/766 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N Q + GS+  +  +C + M +GP+  CPVC G +  S GG Y C 
Sbjct  604   KHVTTAELREMLEINEQSTRGSELDLRDKCADGMMFGPLALCPVCSGHVSFS-GGIYRCN  662

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITVKP--  2413
             G  SEWS CS+++ +P R +   +IPE  +      L+K ++  K+   K  +  + P  
Sbjct  663   GYISEWSKCSHASSDPDRIKGKWKIPEETEN---QFLVKWNKSQKSVKPKRILNPISPAG  719

Query  2412  ------------------LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLV  2290
                               L  + +S++G  ++  Q WK +IE+ G +    V  G +CLV
Sbjct  720   TSQGQGSKAAADSSRSEKLEDLRVSIAGS-SKERQAWKKKIEEAGAEFHAKVKKGTSCLV  778

Query  2289  VSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPL  2110
             V           + A  ++  + VVRE +LVD   K+   P D Y +             
Sbjct  779   VCGQTDMEDAEMRKARRMK--VAVVREDYLVDCFTKQRKLPFDKYKIE------------  824

Query  2109  DKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLN  1930
                    +A E + + +KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N
Sbjct  825   -------DAGEGMVT-VKVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGIN  875

Query  1929  DFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEF  1753
              + I+Q+I   +      +RK GRVG+     +KLEE E  D A+ EF R+F E T N +
Sbjct  876   SYYILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKLEEMEKSD-AVHEFKRLFLEKTANTW  934

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
              S E++   QK+P KF PLD+  G+  +      ++  +  + S L P +   MKIL   
Sbjct  935   ESWEQKTNFQKQPGKFLPLDIDYGVNKQ----VAKKESVQTI-SNLAPPLVELMKILFDV  989

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             E YR A+ME   +  E+P+G LS  ++++  + L    + +  +       E L  + SN
Sbjct  990   ETYRTAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQKLLTESDPQPSVKENLLVDASN  1049

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
             ++FT++PS  P  +RD  D       + E+++DI  ASRL+   + ST  + L D+Y KL
Sbjct  1050  RFFTMIPSVHPHIIRDEDDFKSKV-KMLEALQDIEIASRLVGFDTDST--ESLDDKYKKL  1106

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----  1045
              C IS L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      
Sbjct  1107  HCDISPLSHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPHR  1161

Query  1044  KKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTA  865
             +KL NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT+
Sbjct  1162  EKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTS  1221

Query  864   VDRPEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFV  703
              + P G ++L+  ++G EI E +       PP       + K   K  G+K   +SE   
Sbjct  1222  KENPVGLMLLSEVALG-EIHELTKAKYMDKPP-------RGKHSTKGLGKKVPQDSEFAK  1273

Query  702   WKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             W+DD+ VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  1274  WRDDVTVPCGKPV-PSKAKASELMYNEYIVYNTAQVKLQFLLKVRF  1318


 Score = 82.4 bits (202),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 85/177 (48%), Gaps = 19/177 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N Q + GS+  +  +C + M +GP+  CPVC G +   SGG Y C 
Sbjct  241   KHVTTAELREMLEINEQSTRGSELDLRDKCADGMMFGPLALCPVCSGHVSF-SGGIYRCN  299

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQV-------  2428
             G  SEWS CS++T +P R +   +IPE  +   L    K  +  K   +   +       
Sbjct  300   GYISEWSKCSHATSDPVRIKGKWKIPEETENQFLVKWNKSQKSVKPERILNPISPAGTSQ  359

Query  2427  ----------ITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVV  2287
                       +  + L  + +S++G  ++  Q WK +IE+ G +    V    C  V
Sbjct  360   GQGSKAAADSLRSEKLDDLRVSIAGS-SKERQAWKKKIEEAGAEFHAKVKKEYCSFV  415



>ref|XP_010510210.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Camelina sativa]
Length=985

 Score =   343 bits (879),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 241/763 (32%), Positives = 387/763 (51%), Gaps = 77/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++++  ++R++L+ N Q + GS+  +  +C + M +GP+  CP+C G L  S GG Y C 
Sbjct  267   KYVTSAELREMLEINEQSTRGSELDLRDKCADGMMFGPLALCPICSGHLSFS-GGLYRCH  325

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVIT-----  2422
             G  SEWS CS+ST +P   +   +IPE  +   L    K  +  K + +   V +     
Sbjct  326   GYISEWSKCSHSTLDPDHIKGKWKIPEGTENQFLLKWNKSQKSVKPKRILRPVSSGETSQ  385

Query  2421  ------------VKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSP  2281
                          + LS + +S+ G  T+  Q WK++IE+ G +  AN   G +CLVV  
Sbjct  386   GQGSKDAADSSRSEKLSDLKVSVDGD-TKERQAWKNKIEEAGAEFHANVKKGTSCLVVCG  444

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                 R    + A  ++  + +VRE +LVD ++K+   PLD Y +                
Sbjct  445   PTGVRDAEMRKARRMK--VAIVREDYLVDCLKKQRKLPLDKYKI----------------  486

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             + ++E+L  +    KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N + 
Sbjct  487   EDTSESLVTV----KVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGINSYY  541

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +K+EE    D A+ EF R+F E TGN + S 
Sbjct  542   ILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKMEEMSKSD-AVHEFKRLFLEKTGNSWESW  600

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P +F PLD+  G+  +     + +       S L P +   MK+L   E Y
Sbjct  601   EQKTNFQKQPGRFLPLDIDYGVNKQ-----VAKKEPVQTSSNLAPPLIELMKMLFDVETY  655

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L    + +  +       E+L  + SN++F
Sbjct  656   RSAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQKLLTESYPQPSTKESLLVDASNRFF  715

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     ST  + L D+Y KL C 
Sbjct  716   TMIPSIHPRIIRDEDDFKS-KVKMLEALQDIEIASRLVGFDVDST--ESLDDKYKKLHCD  772

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      +KL
Sbjct  773   ISPLPHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPYREKL  827

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    
Sbjct  828   GNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKN  887

Query  855   PEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
             P G ++L+  ++G EI E +       PP       + K   K  G+K   +SE   W+ 
Sbjct  888   PVGLMLLSEVALG-EIHELTKATYMDKPP-------RGKHSTKGLGKKVPQDSEFAKWRG  939

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S+   S   YNEY VY+  QV +++L+ V++
Sbjct  940   DVTVPCGKPV-SSKVKASELMYNEYIVYNTAQVKLQYLLKVRF  981



>ref|XP_003521279.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Glycine 
max]
Length=997

 Score =   343 bits (879),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 243/764 (32%), Positives = 383/764 (50%), Gaps = 77/764 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDSSGS+  +  RC + M +G +  CP+C G L   SGG Y C 
Sbjct  277   KHVTTTELREMLEANGQDSSGSEIDLRDRCADGMMFGALGLCPICSGFLR-YSGGMYRCH  335

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK----------NRPLK  2437
             G  SEWS CSYST  P R E   +IPE      L    K  +  K           +  +
Sbjct  336   GYISEWSKCSYSTCEPNRIEGKWKIPEETNNQYLKKWFKSQKGKKPVRILPLPSPRKSAE  395

Query  2436  EQVITVK--------PLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVS  2284
              Q+I  +         L  + +++ G    +   WK +I+  GG     V   T CLVV 
Sbjct  396   SQMIASQHHHSSNSENLRDLKVAICGLPNDSIAEWKRKIDGIGGVFHAKVNKDTNCLVVV  455

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDK  2104
              +  +    +++ +A     P+VRE +L+D IE+K+  P D Y V               
Sbjct  456   GSLNDE---AEMRKARRMKKPIVREDYLIDCIERKKRLPFDMYKV---------------  497

Query  2103  QDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDF  1924
              +   E    +T  +KV G+  VH+ + LQD  G ILE+   +YN  L++ D   G N +
Sbjct  498   -EMIGETSSMVT--IKVKGRSAVHEASGLQD-SGHILEEGKSIYNTTLNMSDLSTGTNSY  553

Query  1923  CIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLS  1747
              I+Q+I   +      +RK GRVG+      KLEE    D AI EF R+F E TGN + +
Sbjct  554   YILQIIEEDKGSDCYVFRKWGRVGNDKIGGTKLEEMSKSD-AICEFKRLFYEKTGNPWEA  612

Query  1746  REREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEI  1567
              E +K IQK+P +F+PLD+  G+  +     + +       SKL P +   MK+L + E 
Sbjct  613   WE-QKTIQKQPGRFFPLDIDYGVNKQ-----VPKNKKNDADSKLPPPLIELMKMLFNVET  666

Query  1566  YRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKW  1387
             YR A+ME   +  E+P+G LS  ++++  + L      ++ +       E+L    SN++
Sbjct  667   YRAAMMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLKISNPDPSVKESLLINASNRF  726

Query  1386  FTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGC  1207
             FT++PS  P  +RD  D       + E+++DI  ASRL+   + +  DD + D Y KL C
Sbjct  727   FTMIPSIHPHIIRDEDDFKSKV-KMLEALQDIEIASRLVGFDANN--DDSIDDNYKKLHC  783

Query  1206  SISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMK  1042
              IS L  DS+++ +I K+L+ T+ P       + + +E +F++E         P  D   
Sbjct  784   DISPLPHDSEEFCLIEKFLQNTHAPTHT---DWSLELEEVFSLEREGESDKFAPYRD---  837

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KL N++LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y FT  
Sbjct  838   KLGNRMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTDK  897

Query  861   DRPEGFLVLAVASMG-----EEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWK  697
               P G ++L+  ++G     ++      PPE   S        K  G+K   ESE+  W+
Sbjct  898   KNPVGLMLLSEVALGNVYELKKAKYMDKPPEGKHS-------TKGLGKKMPQESEYVKWR  950

Query  696   DDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              ++ VPCG+ +  S   +S   YNEY VY+  QV ++FL+ V++
Sbjct  951   GNVTVPCGKPV-PSNVKSSELMYNEYIVYNTAQVKMQFLLKVRF  993



>ref|XP_010414140.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelina sativa]
Length=985

 Score =   342 bits (877),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 242/763 (32%), Positives = 387/763 (51%), Gaps = 77/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++++  ++R++L+ N Q + GS+  +  +C + M +GP+  CP+C G L  S GG Y C 
Sbjct  267   KYVTTAELREMLELNEQSTRGSELDLRDKCADGMMFGPLALCPICSGHLSFS-GGLYRCH  325

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVIT-----  2422
             G  SEWS CS+ST +P   +   +IPE  +   L    K  +  K + +   V +     
Sbjct  326   GYISEWSKCSHSTLDPDHIKGKWKIPEGTENQFLLKWNKSQKSVKPKRILRPVSSGETSQ  385

Query  2421  ------------VKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSP  2281
                          + LS + +S+ G  T+  Q WK +IE+ G +  AN   G +CLVV  
Sbjct  386   GQGSKDAADSSRSEKLSDLKVSIDGD-TKERQAWKKKIEEAGAEFHANVKKGTSCLVVCG  444

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                 R    + A  ++  + +VRE +LVD + K+   PLD Y +                
Sbjct  445   TTGIRDAEMRKARRMK--VAIVREDYLVDCLIKQRKLPLDKYKI----------------  486

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             + ++E+L  +    KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N + 
Sbjct  487   EDTSESLVTV----KVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGINSYY  541

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +K+EE    D A+ EF R+F E TGN + S 
Sbjct  542   ILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKVEEMSKSD-AVHEFKRLFLEKTGNSWESW  600

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P KF PLD+  G+  +      ++  +  + S L P +   MK+L   E Y
Sbjct  601   EQKTNFQKQPGKFLPLDIDYGVNKQ----VAKKEPVQTI-SNLAPPLIELMKMLFDVETY  655

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L    + +  +       E+L  + SN++F
Sbjct  656   RSAMMEFEINMSEMPLGKLSKHNIQKGFEVLTEIQKLLTESYPQPSIKESLLVDASNRFF  715

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     ST  + L D+Y KL C 
Sbjct  716   TMIPSIHPHIIRDEDDFKS-KVKMLEALQDIEIASRLVGFDVDST--ESLDDKYKKLHCD  772

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      +KL
Sbjct  773   ISPLPHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPYREKL  827

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    
Sbjct  828   GNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKN  887

Query  855   PEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
             P G ++L+  ++G EI E +       PP       + K   K  G+K   +SE   W+ 
Sbjct  888   PVGLMLLSEVALG-EIHELTKATYMDKPP-------RGKHSTKGLGKKVPQDSEFAKWRG  939

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S+   S   YNEY VY+  QV +++L+ V++
Sbjct  940   DVSVPCGKPV-SSKVKASELMYNEYIVYNTAQVKLQYLLKVRF  981



>ref|XP_010469693.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Camelina sativa]
Length=985

 Score =   342 bits (876),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 242/763 (32%), Positives = 388/763 (51%), Gaps = 77/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++++  ++R++L+ N Q + GS+  +  +C + M +GP+  CP+C G L  S GG Y C 
Sbjct  267   KYVTTAELREMLELNEQSTRGSELDLRDKCADGMMFGPLALCPICSGHLSFS-GGLYRCH  325

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVIT-----  2422
             G  SEWS CS+ST +P   +   +IPE  +   L    K  +  K + +   V +     
Sbjct  326   GYISEWSKCSHSTLDPDHIKGKWKIPEGTENQFLLKWNKSQKSVKPKRILRPVSSGETAQ  385

Query  2421  ------------VKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSP  2281
                          + LS + +S+ G  T+  Q WK +IE+ G +  AN   G +CLVV  
Sbjct  386   GQGSKDAADSSRSEKLSDLKVSVDGD-TKERQAWKKKIEEAGVEFHANVKKGTSCLVVCG  444

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                 R    + A  ++  + +VRE ++VD ++K+   PLD Y +                
Sbjct  445   PTGIRDAEMRKARRMK--VAIVREDYMVDCLKKQRKLPLDKYKI----------------  486

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             + ++E+L  +    KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N + 
Sbjct  487   EDTSESLVTV----KVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGINSYY  541

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+     +K+EE    D A+ EF R+F E TGN + S 
Sbjct  542   ILQIIQEDKGSDCYVFRKWGRVGNEKIGGNKVEELSKSD-AVHEFKRLFLEKTGNSWESW  600

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P KF PLD+  G+  +H     ++  +  + S L P +   MK+L   E Y
Sbjct  601   EQKTTFQKQPGKFLPLDIDYGVN-KH---VAKKEPVQTI-SNLAPPLIELMKMLFDVETY  655

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++ +  + L    + +  +       E+L  + SN++F
Sbjct  656   RSAMMEFEINMSEMPLGKLSKHNIHKGFEALTEIQKLLTESDPQPSTKESLLVDASNRFF  715

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     ST  + L D+Y KL C 
Sbjct  716   TMIPSIHPHIIRDEDDFKS-KVKMLEALQDIEIASRLVGFEVDST--ESLDDKYKKLHCD  772

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             IS L  DS+DY++I KYL  T+ P       + + +E +FA+E       D      +KL
Sbjct  773   ISPLPHDSEDYRLIEKYLNTTHAPTHT---EWSLELEEVFALEREG--EFDKYAPYREKL  827

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    
Sbjct  828   GNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKN  887

Query  855   PEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
             P G ++L+  ++G EI E +       PP       + K   K  G+K   +SE   W+ 
Sbjct  888   PVGLMLLSEVALG-EIHELTKATYMDKPP-------RGKHSTKGLGKKVPQDSEFAKWRG  939

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             D+ VPCG+ +  S+   S   YNEY VY+  QV +++L+ V++
Sbjct  940   DVTVPCGKPV-SSKVKASELMYNEYIVYNTAQVKLQYLLKVRF  981



>ref|XP_003554282.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Glycine max]
 gb|KHN02523.1| Poly [ADP-ribose] polymerase 1 [Glycine soja]
Length=996

 Score =   342 bits (876),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 243/767 (32%), Positives = 385/767 (50%), Gaps = 84/767 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ + QDS+GS+  +  RC + M +G +D CP+C G L   SGG Y C 
Sbjct  277   KHVTTTELREMLEASGQDSTGSELDLRDRCADGMMFGALDLCPICSGFLR-YSGGMYRCH  335

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK----------NRPLK  2437
             G  SEWS CSYST  P R E   +IP+      L    K  +  K           +  +
Sbjct  336   GYISEWSKCSYSTCEPKRIEGKWKIPKETNNQYLKKWFKSQKGKKPVRILPLPSPRKSAE  395

Query  2436  EQVITVK-------PLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
              Q+I  +        L  + +++ G    +   WK +I+   G     V   T CLVV  
Sbjct  396   SQMIASQHQSSNSGNLRDLKVAICGLPNDSIAEWKCKIDGICGMFHAKVNKDTNCLVV--  453

Query  2280  AERERGGS----SKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIP  2113
                  GGS    +++ +A    IP+VRE +L+D + +K+  P D Y V            
Sbjct  454   -----GGSLNYEAEMRKARRMKIPIVREDYLIDCLARKKRLPFDMYKV------------  496

Query  2112  LDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGL  1933
                 +   EA   +T  +KV G   VH+ + LQD  G ILE+   +YN  L++ D   G+
Sbjct  497   ----EMIGEASSMVT--IKVKGHSAVHEASGLQD-SGHILEEGKSIYNTTLNMSDLSTGI  549

Query  1932  NDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNE  1756
             N + I+Q+I   +      +RK GRVG+      KLEE    D A+ EF R+F E TGN 
Sbjct  550   NSYYILQIIQEDKGSDCYVFRKWGRVGNDKIGGTKLEEMSKSD-AVCEFKRLFYEKTGNP  608

Query  1755  FLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCS  1576
             + + E +K IQK+P +F+PLD+  G+  +     + +     V SKL P +   MK+L +
Sbjct  609   WDAWE-QKTIQKQPGRFFPLDIDYGVNKQ-----VSKKEKNDVDSKLPPPLIELMKMLFN  662

Query  1575  QEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFS  1396
              E YR A+ME   +  E+P+G LS  ++++  + L      ++ +       E+L    S
Sbjct  663   VETYRAAMMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLKISNPDPSVKESLLINAS  722

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             N++FT++PS  P  +RD  D       + E+++DI  ASRL+   + +  DD + D Y K
Sbjct  723   NRFFTMIPSVHPHIIRDEDDFKSK-VKMLEALQDIEIASRLVGFDANN--DDSIDDNYKK  779

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLD  1051
             L C IS L  DS+++ +I K+L  T+ P       + + +E +F++E         P  D
Sbjct  780   LHCDISPLPHDSEEFCLIEKFLHNTHAPTHT---DWSLELEEVFSLEREGEFDKFAPYRD  836

Query  1050  DMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGF  871
                KL N++LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y F
Sbjct  837   ---KLGNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCF  893

Query  870   TAVDRPEGFLVLAVASMG-----EEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHF  706
             T    P G ++L+  ++G     ++      PPE   S        K  G+K   ESE+ 
Sbjct  894   TDKKNPVGLMLLSEVALGNVYELKKAKYMDKPPEGKHS-------TKGLGKKMPQESEYV  946

Query  705   VWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              W+ ++ VPCG+ +  S   +S   YNEY VY+  QV ++FL+ V++
Sbjct  947   KWRGNVTVPCGKPV-PSNVKSSELMYNEYIVYNTAQVKMQFLLKVRF  992



>gb|EEC81908.1| hypothetical protein OsI_25738 [Oryza sativa Indica Group]
Length=977

 Score =   340 bits (872),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 242/760 (32%), Positives = 389/760 (51%), Gaps = 67/760 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R +L+ N QD+SG +  ++ RC + M +G +  CPVC   L    GG YHC 
Sbjct  255   KHVSTAELRNMLEANGQDTSGPERHLLDRCADGMLFGALGTCPVCSSFL-YYHGGQYHCS  313

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK-NRPL----------  2440
             G  SEWS C+YST  P R ++  +IP+ +    L+   K  +  K  R L          
Sbjct  314   GYVSEWSKCTYSTTEPVRSKKKWKIPDEMDNGYLTKWFKSQKAKKPERVLPPMSPEKSLC  373

Query  2439  ----KEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLVV-SPA  2278
                 + +    + L  + +S+ G+       WK +++  G     +V    +CLV+ S  
Sbjct  374   QSTQQNRSFLSEGLDKLRVSIVGQSKDVVDEWKQKLKDAGANFNATVTKDSSCLVLCSEL  433

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
             E E   +++V +A    IP++RE +L + I K  V P D Y V                +
Sbjct  434   ESE---NAEVKKARRLKIPILREGYLGECIRKNRVLPFDLYKV----------------E  474

Query  2097  PSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCI  1918
              + E+ +  T  +KV G+  VH+ + LQD G  ILE    +YN  L++ D  RG+N + I
Sbjct  475   AALESSKGGTMTVKVKGRSAVHESSGLQDTG-HILEDGKSIYNTTLNMSDLTRGVNSYYI  533

Query  1917  MQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRE  1741
             +Q+I          +RK GRVG+      KLEE    D AI+EF R+F E TGN + + E
Sbjct  534   LQVIEEDNGSDCYVFRKWGRVGNEKIGGTKLEEMSKID-AIQEFRRLFLEKTGNPWEAWE  592

Query  1740  REKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYR  1561
             ++   QK+P KFYPLD+  G  VR G    ++  I  + S L P +   M +L + E YR
Sbjct  593   QKTNFQKQPGKFYPLDIDYG--VRQGP---KRKDIDKMKSSLPPQLLELMNMLFNIETYR  647

Query  1560  YALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSNKWF  1384
              A++E   +  E+P+G LS  ++++  + L      + +T      V E+L    SN++F
Sbjct  648   AAMLEFKINMSEMPLGKLSKENIQKGFEALTEIQNLLGNTNNQELAVRESLIVAASNRFF  707

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             TL+PS  P  ++D  D+      + E+++DI  AS+L+   S +  D+ L D+Y KL C+
Sbjct  708   TLIPSIHPHVIQDEDDLM-VKVKMLEALQDIEIASKLVGFDSDN--DESLDDKYKKLRCA  764

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK--LPN  1030
             I+ L  D +DYK++ KYL  T+ P       + + +E +F+++     +     K  L N
Sbjct  765   ITPLPHDCEDYKLVEKYLLNTHAPTHK---EWSLELEEVFSLDRDGEFNKYSRYKNNLHN  821

Query  1029  KVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPE  850
             K+LLW G+R +N +  L  G   A    PV GYMFGK +  +D  +++A+Y +     P 
Sbjct  822   KMLLWHGSRLTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRKNPV  881

Query  849   GFLVLAVASMGE--EIMEFSS---PPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             G ++L+  ++G+  E+ + +S   PP    S        K  G+    ESE   W+DD+ 
Sbjct  882   GLMLLSEVALGDMYELKKATSMDKPPRGKHS-------TKGLGKTVPLESEFAKWRDDVV  934

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             VPCG+ +  S    S   YNEY VY+  QV +++L+ V++
Sbjct  935   VPCGKPVPASI-KTSELMYNEYIVYNTSQVKMQYLLKVRF  973



>ref|XP_010111892.1| Poly [ADP-ribose] polymerase 1 [Morus notabilis]
 gb|EXC31926.1| Poly [ADP-ribose] polymerase 1 [Morus notabilis]
Length=1022

 Score =   340 bits (873),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 240/757 (32%), Positives = 380/757 (50%), Gaps = 75/757 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +  RC + M +G +  CP+C G L C S   Y C 
Sbjct  279   KHVTTAELREMLEANGQDSTGSELDLRDRCADGMMFGALSSCPLCSGCL-CYSASMYRCH  337

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNR----PLK------  2437
             G  S WS CS+STR P R +   ++PE      LS  +K     K      PL       
Sbjct  338   GYLSAWSKCSFSTREPERLKAKWKVPEDTNNQYLSKWLKSQDVGKPARILPPLSPTSYCG  397

Query  2436  EQVITVKP-------LSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSP  2281
              Q I  +        L+ + ++ SG      + WK +++  GG V A       CLVVS 
Sbjct  398   SQAINGQSQSSNGGRLADLKVAFSGLAEENMEEWKRKVKAAGGDVHAKLKKDTNCLVVSG  457

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             ++ +   S+++ +A    IP+VRE +LVD  ++++  P D Y V                
Sbjct  458   SDDQ---SAEIRKARRMKIPIVREDYLVDCFKRQKKLPFDLYKV----------------  498

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             +   E+   +T  ++V G+  V++ + +QD  G ILE    +YN  L++ D   G+N + 
Sbjct  499   EAIGESSSMVT--VRVKGRSAVNECSGMQD-SGHILEDGKSIYNTTLNMSDLSTGINSYY  555

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   ++     +RK GRVG+     DK+EE    D AI EF R+F E TGN + + 
Sbjct  556   ILQIIQDDKSSDCYVFRKWGRVGNEKIGGDKIEEMSKSD-AISEFKRLFLEKTGNPWEAW  614

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E++   QK+P +F+PLD+  G+  +     + +       SKL P +A  MK+L + E Y
Sbjct  615   EQKHNFQKQPGRFFPLDIDYGVNKQ-----VSKKNQTKEESKLAPPLAELMKMLFNVETY  669

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      + S        E+L  + SN++F
Sbjct  670   RAAMMEFEINMSEMPLGKLSRNNIQKGFEALTEIQNLLNSNTRDPSIKESLIVDASNRFF  729

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+     +     L D+Y+KLGC 
Sbjct  730   TVIPSIHPHVIRDEDDFKSK-VKMLEALQDIEIASRLVGFDVDNDDS--LDDKYMKLGCD  786

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKL  1036
             I  L  DSDDY++I KYL  T+ P       + + +E +F++E       D      +KL
Sbjct  787   IVPLPHDSDDYQLIEKYLLTTHAPTHT---DWSLELEEVFSLERQG--EYDKFHPHRQKL  841

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    
Sbjct  842   GNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDTKN  901

Query  855   PEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
               G ++L+  ++G E+ E +       PPE   S        K  G+K   +SE+  W+D
Sbjct  902   SVGLILLSEVALG-EVYELTKAKYMDKPPEGKHS-------TKGLGKKVPQKSEYVKWRD  953

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRF  583
             D+ VP G+ +  S    S   YNEY VY+  Q    F
Sbjct  954   DVVVPAGKPV-GSNVRASELMYNEYIVYNTAQCGCVF  989



>ref|XP_002459755.1| hypothetical protein SORBIDRAFT_02g009900 [Sorghum bicolor]
 gb|EER96276.1| hypothetical protein SORBIDRAFT_02g009900 [Sorghum bicolor]
Length=931

 Score =   338 bits (868),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 234/759 (31%), Positives = 388/759 (51%), Gaps = 68/759 (9%)
 Frame = -2

Query  2763  HLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKG  2584
             H+S  ++R +L+ N QD SG +  ++ RC + M +G +  CPVC   L   +G  Y C G
Sbjct  211   HVSAAELRDMLEANGQDISGPERHLLDRCADGMLFGALGPCPVCASGLYYYNG-QYQCSG  269

Query  2583  DFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK-NRPL-----------  2440
             + SEWS C+YST  P R ++  ++P+  +   L    K  +  K  R L           
Sbjct  270   NVSEWSKCTYSTTEPVRIKK-WQVPDGTKNDYLMKWFKSQKVKKPERVLPPMSPEKSGSK  328

Query  2439  ---KEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERE  2269
                +   ++ K L  +  S+ G+       W  +++  G      V+     ++S  E +
Sbjct  329   ATQRTSSLSSKGLDKLRFSVVGQSKEVANEWIEKLKLAGANFYARVVKDIDCLISCGELD  388

Query  2268  RGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSA  2089
                +++V +A    IP+VRE ++ + I+K  + P D Y + + I                
Sbjct  389   -NENAEVRKARRLKIPIVREGYIGECIKKNRMLPFDLYKLENTI----------------  431

Query  2088  EALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQL  1909
             E+ +  T  +KV G+  VH+ + LQD    ILE    +YN  L++ D   G+N + I+Q+
Sbjct  432   ESSKGGTVTVKVKGRSAVHESSGLQDTA-HILEDGKSIYNTTLNMSDLALGVNSYYILQI  490

Query  1908  IVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREK  1732
             I   +      +RK GRVG+      KLEE    D AIKEF R+F E TGN + + ER+ 
Sbjct  491   IEEDDGSECYVFRKWGRVGNEKIGGKKLEEMSKTD-AIKEFKRLFLEKTGNPWEAWERKT  549

Query  1731  KIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYAL  1552
               +K+P +FYPLD+  G++      A ++  I+ + S L P +   MK+L + E YR A+
Sbjct  550   NFRKQPGRFYPLDIDYGVKQ-----APKRKDISEMKSSLAPQLLELMKMLFNVETYRAAM  604

Query  1551  MEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSNKWFTLM  1375
             ME   +  E+P+G LS  ++++  + L      ++ T +    V E+L    SN++FTL+
Sbjct  605   MEFEINMSEMPLGKLSKENIQKGFEALTEIQNLLKDTADQALAVRESLIVAASNRFFTLI  664

Query  1374  PSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISA  1195
             PS  P  +RD  D+    A + E+++DI  AS+L+   S +  D+ L D+Y+KL C+I+ 
Sbjct  665   PSIHPHIIRDEDDLM-IKAKMLEALQDIEIASKLVGFDSDN--DESLDDKYMKLHCNITP  721

Query  1194  LEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK----LPNK  1027
             L+ DS+DYK+I +YL  T+ P       + + +E +F+++      L+   +    L NK
Sbjct  722   LDHDSEDYKLIEQYLLNTHAPTHK---DWSLELEEVFSLDRDG--ELNKYSRYKNNLHNK  776

Query  1026  VLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEG  847
             +LLW G+R +N +  L  G   A    PV GYMFGK +  +D  +++A+Y     + P G
Sbjct  777   MLLWHGSRLTNFVGILSQGLRIAPPEAPVSGYMFGKGLYFADLVSKSAQYCNVDRNNPVG  836

Query  846   FLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
              ++L+  ++G+     +      PP       + K   K  G+    ESE   W+DD+ V
Sbjct  837   LMILSEVALGDMNELKKATYMDKPP-------RGKHSTKGLGKTVPLESEFVKWRDDVVV  889

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             PCG+ +  S   +S   YNEY VY+  QV ++FL+ V++
Sbjct  890   PCGKPVPSSIR-SSELMYNEYIVYNTSQVKMQFLLKVRF  927



>ref|NP_001059453.1| Os07g0413700 [Oryza sativa Japonica Group]
 sp|Q7EYV7.1|PARP1_ORYSJ RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Oryza sativa Japonica 
Group]
 dbj|BAC84104.1| putative poly(ADP)-ribose polymerase [Oryza sativa Japonica Group]
 dbj|BAF21367.1| Os07g0413700 [Oryza sativa Japonica Group]
 gb|EEE67019.1| hypothetical protein OsJ_23951 [Oryza sativa Japonica Group]
Length=977

 Score =   338 bits (868),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 242/760 (32%), Positives = 390/760 (51%), Gaps = 67/760 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R +L+ N QD+SG +  ++ RC + M +G +  CPVC   L    GG YHC 
Sbjct  255   KHVSTAELRNMLEANGQDTSGPERHLLDRCADGMLFGALGTCPVCSSFL-YYHGGQYHCS  313

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK-NRPL----------  2440
             G  SEWS C+YST  P R ++  +IP+ +    L+   K  +  K  R L          
Sbjct  314   GYVSEWSKCTYSTTEPVRSKKKWKIPDEMDNGYLTKWFKSQKAKKPERVLPPMSPEKSLC  373

Query  2439  ----KEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLVV-SPA  2278
                 + +    + L  + +S+ G+       WK +++  G     +V    +CLV+ S  
Sbjct  374   QSTQQNRSFLSEGLDKLRVSIVGQSKDVVDGWKQKLKDAGANFNATVTKDSSCLVLCSEL  433

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
             E E   +++V +A    IP++RE +L + I K  V P D Y V                +
Sbjct  434   ESE---NAEVKKARRLKIPILREGYLGECIRKNRVLPFDLYKV----------------E  474

Query  2097  PSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCI  1918
              + E+ +  T  +KV G+  VH+ + LQD G  ILE    +YN  L++ D  RG+N + I
Sbjct  475   AALESSKGGTMTVKVKGRSAVHESSGLQDTG-HILEDGKSIYNTTLNMSDLTRGVNSYYI  533

Query  1917  MQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRE  1741
             +Q+I          +RK GRVG+      KLEE  ++  AI+EF R+F E TGN + + E
Sbjct  534   LQVIEEDNGSDCYVFRKWGRVGNEKIGGTKLEEM-SKIHAIQEFRRLFLEKTGNPWEAWE  592

Query  1740  REKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYR  1561
             ++   QK+P KFYPLD+  G  VR G    ++  I  + S L P +   M +L + E YR
Sbjct  593   QKTNFQKQPGKFYPLDIDYG--VRQGP---KRKDIDKMKSSLPPQLLELMNMLFNIETYR  647

Query  1560  YALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSNKWF  1384
              A++E   +  E+P+G LS  ++++  + L      + +T      V E+L    SN++F
Sbjct  648   AAMLEFKINMSEMPLGKLSKENIQKGFEALTEIQNLLGNTNNQELAVRESLIVAASNRFF  707

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             TL+PS  P  ++D  D+      + E+++DI  AS+L+   S +  D+ L D+Y KL C+
Sbjct  708   TLIPSIHPHIIQDEDDLM-VKVKMLEALQDIEIASKLVGFDSDN--DESLDDKYKKLRCA  764

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK--LPN  1030
             I+ L  D +DYK++ KYL  T+ P       + + +E +F+++     S     K  L N
Sbjct  765   ITPLPHDCEDYKLVEKYLLNTHAPTHK---EWSLELEEVFSLDRDGEFSKYSRYKNNLHN  821

Query  1029  KVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPE  850
             K+LLW G+R +N +  L  G   A    PV GYMFGK +  +D  +++A+Y +     P 
Sbjct  822   KMLLWHGSRLTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRKNPV  881

Query  849   GFLVLAVASMGE--EIMEFSS---PPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             G ++L+  ++G+  E+ + +S   PP    S        K  G+    ESE   W+DD+ 
Sbjct  882   GLMLLSEVALGDMYELKKATSMDKPPRGKHS-------TKGLGKTVPLESEFAKWRDDVV  934

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             VPCG+ +  S    S   YNEY VY+  QV +++L+ V++
Sbjct  935   VPCGKPVPASI-KTSELMYNEYIVYNTSQVKMQYLLKVRF  973



>ref|XP_001769461.1| predicted protein [Physcomitrella patens]
 gb|EDQ65830.1| predicted protein [Physcomitrella patens]
Length=989

 Score =   337 bits (863),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 239/775 (31%), Positives = 379/775 (49%), Gaps = 96/775 (12%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             EH+S+ ++R++L  N QD++GS+  +  RC + M +G + KCP+C G +E   GG+Y C+
Sbjct  266   EHVSIVELREMLAANNQDTTGSEYDVRERCADGMMFGVLAKCPLCEGYME-YQGGSYRCR  324

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPL------KEQVI  2425
             G  S WS C+++T  P R      I E+     L    K     K   L       E  I
Sbjct  325   GYLSAWSKCTFTTLTPERTTAKWEIGEACDNDYLLGWYKTQSKMKGERLLVPASQAEPTI  384

Query  2424  TVKP-------LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSV-----IGVTCLVVSP  2281
               KP       L G   ++ GRL+ TH                SV     + V  ++ S 
Sbjct  385   AEKPRNCSESFLEGCEFAVIGRLSITH--------------VTSVPSPLFVHVNLILTSS  430

Query  2280  AERERGGSSKVAEAV------------ERGIPVVREAWLVDSIEKKEVQPLDAY--DVAS  2143
                         E V             R +P+V+E +L+D  EKKE  P+D Y  ++ S
Sbjct  431   GMVTAVTCVVTTENVVEDEKHRRDLEYARAVPIVKEQYLLDCFEKKEKLPVDGYRLEIGS  490

Query  2142  DIAVDGRGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCA  1963
               ++                      ++KV G+  VH+D+ LQD G  I+E+  ++Y   
Sbjct  491   KPSI---------------------VKVKVKGRGAVHEDSGLQDTG-HIVEEGKVIYTTT  528

Query  1962  LSVCDQGRGLNDFCIMQLIVAPENR-LHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFS  1786
             L+  +   G+N F ++QLI     + +H+Y + GRVG+     DK+E+    DG IKEF 
Sbjct  529   LNRSELATGINSFYVLQLIEEDAKKTVHLYRKWGRVGNDRIGGDKIEKLSKADG-IKEFK  587

Query  1785  RIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGI-EVRHGGLALRQLGIAAVHSKLDP  1609
             R+F+E TGN++ S    +  +K+P KFYPLD+  G+ EV     AL         S+L P
Sbjct  588   RLFKEKTGNDWESWVNREDFEKQPGKFYPLDIDYGVDEVPKPDKAL-----VGSKSRLHP  642

Query  1608  MVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAG  1429
              V N MK+L   E Y+ A+ME   +  E+P+G LS  H+ER  + L   ++ I      G
Sbjct  643   RVINLMKMLFDLETYKAAMMEFEINMSEMPLGKLSKRHIERGYEVLTE-IQNILKEAVHG  701

Query  1428  QQVEALWAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDM--SG  1255
              + + L  + SN++FTL+P+  P  + D   +      + +++RDI  AS  +      G
Sbjct  702   PREQGLLVDASNRFFTLIPTVHPMIISDEQTLKS-KIHMLDALRDIEIASEFLGSKVEEG  760

Query  1254  STLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVE  1075
             +  +DPL   Y KL C I  +  DS D+K++ KYL++T+ P       + + +E++FAV+
Sbjct  761   TEEEDPLDTHYKKLHCDIRPIPHDSGDFKLVEKYLKQTHAPTHT---DWALELEDVFAVD  817

Query  1074  PSA-CPSLDDMKK-LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSD  901
                   S    K  L N +LLW G+R++N +  L  G   A    PV GYMFGK +  +D
Sbjct  818   REGEADSFAPFKMCLDNHMLLWHGSRTTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFAD  877

Query  900   AAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFH---GRK  730
               +++A+Y +T    P G ++L+  ++G+     ++  +  K +E+   G       G+ 
Sbjct  878   LVSKSAQYCYTTKKNPTGLMLLSEVALGK-----TNNLKSAKYMEKPLRGTNSTLGLGKT  932

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             K  E+E   ++ D+ VPCG+ +       S   YNEY VYD  QV +RFL+ V +
Sbjct  933   KPLETEFKKFEGDVTVPCGQPVPSGIR--SDLMYNEYIVYDTAQVKLRFLLKVNF  985



>ref|XP_003557295.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Brachypodium distachyon]
Length=975

 Score =   335 bits (858),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 233/758 (31%), Positives = 382/758 (50%), Gaps = 65/758 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R +L+ N QD  G++  ++ RC + M +G +  CPVC   L    GG Y C 
Sbjct  255   KHVTTAELRDMLEANGQDPCGAERHLLERCADGMLFGALGPCPVCTSCLY-YYGGQYQCS  313

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD-------PKNRPLK---  2437
             G  SEWS C+Y+T  P R ++  +IP+ ++   L+   K  +        P   P K   
Sbjct  314   GYVSEWSKCTYTTTEPARIKKKWKIPDKIKNDYLTKWFKSQKLKKPERALPPMSPQKYVG  373

Query  2436  ---EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERER  2266
                +Q +  + L  + +S+ G+       WK +++  G      V   T  +VS  E + 
Sbjct  374   QSTQQSLIGEALDKLRVSVVGQSKDVADEWKQKLKFAGVNSNGRVTKDTNCLVSCGELD-  432

Query  2265  GGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAE  2086
               +++V +A    +P++RE +L + I+K  V P D+Y + + +                E
Sbjct  433   NENAEVRKARRLNVPILREDYLAECIKKNRVLPFDSYRLETTL----------------E  476

Query  2085  ALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLI  1906
             + +  T  +KV G+  VH+ + LQD    ILE    +YN  L++ D  +G+N + I+Q+I
Sbjct  477   SSKGSTVTVKVKGQSAVHEASGLQDTC-HILEDGKSIYNTTLNMSDMTQGVNSYYILQVI  535

Query  1905  VAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKK  1729
                       +RK GRVG       KLEE    D AIK+F ++F E TGN +   E++  
Sbjct  536   EEDSGSECYVFRKWGRVGSEKIGGTKLEEMSKTD-AIKQFKKLFLEKTGNPWGVWEQKTN  594

Query  1728  IQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALM  1549
              QK+P KFYPLD+  G  VR G    ++  I+   S L P +   M +L + E YR A+M
Sbjct  595   FQKQPGKFYPLDIDYG--VRQGP---KRKDISRTKSSLAPQLLELMMVLFNVETYRAAMM  649

Query  1548  EMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV---EALWAEFSNKWFTL  1378
             E   +  E+P+G LS  ++ +  + L      + +T    Q++   E+L    SN++FTL
Sbjct  650   EFEINMSEMPLGKLSKENIHKGFEALTEIQNLLDNT--GNQELALRESLIVAASNRFFTL  707

Query  1377  MPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSIS  1198
             +PS  P  + D  D+    A + E+++DI  ASRL+   + +  D+ L ++Y KL C+I+
Sbjct  708   IPSVHPHIICDKDDLT-MKAKMLEALQDIEIASRLVGFDNDN--DESLDEKYKKLHCNIT  764

Query  1197  ALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK--LPNKV  1024
              L  DS+DYK++ KYL  T+ P       + + +E +F ++     +     K  L NK+
Sbjct  765   TLAHDSEDYKLVEKYLLNTHAPTHK---DWSLELEEVFVLDRDGESNKYSRYKNNLHNKM  821

Query  1023  LLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGF  844
             LLW G+R +N +  L  G   A    P+ GYMFGK +  +D  +++A+Y +   + P G 
Sbjct  822   LLWHGSRLTNFVGILSQGLRIAPPEAPMTGYMFGKGLYFADLVSKSAQYCYADKNNPTGL  881

Query  843   LVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             ++L+  ++G+     + M    PP    S        K  G+    ESE   W D + VP
Sbjct  882   MLLSEVALGDMHELKKAMPMDKPPRGKHS-------TKGLGKTVPLESEFVEWSDGVVVP  934

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             CG+ +  S    S   YNEY VY+  QV +RFL+ V++
Sbjct  935   CGKPVPASIR-ASELLYNEYIVYNTSQVKMRFLLKVRF  971



>ref|XP_002302058.2| poly (ADP-ribose) polymerase family protein [Populus trichocarpa]
 gb|EEE81331.2| poly (ADP-ribose) polymerase family protein [Populus trichocarpa]
Length=996

 Score =   335 bits (858),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 239/761 (31%), Positives = 379/761 (50%), Gaps = 70/761 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R +L+ N+Q S+GS+  +  RC + M +G +  CP+C G+L   SGG Y C 
Sbjct  274   KHVTTVELRALLEANSQISNGSELDLRDRCADGMVFGALGGCPMCSGSLH-YSGGMYRCG  332

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK----------  2437
             G  SEWS CSYSTR P R +   +IP+      L    K  +  +N+P++          
Sbjct  333   GYLSEWSKCSYSTREPARLKGKWKIPDDTDNQYLIKWFKSQK--RNKPVRILPPPSSNNL  390

Query  2436  ---------EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVV  2287
                       Q    + L  + +++SG    + + WK +IE  GG++   +   T C VV
Sbjct  391   SGSQATSSQSQSSKSENLGDLKVAVSGLPKESLKEWKGKIEAAGGQLHAKIKKDTNCFVV  450

Query  2286  SPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLD  2107
             S          + A  ++  +P+VRE +LVD  ++++  P D+Y V +   V        
Sbjct  451   SGVMSSEDADMRKARRMK--LPIVREDYLVDCFKRQKKLPFDSYKVEASGGVSS------  502

Query  2106  KQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLND  1927
                            +KV G+  VH+ + +QD G  ILE    +YN  L++ D   G+N 
Sbjct  503   ------------MVTVKVKGRSAVHEASAMQDTG-HILEDGKSIYNTTLNMSDLSTGVNS  549

Query  1926  FCIMQLIVAPENRLHMY-YRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEF  1753
             F I+Q I+  +  L  Y +RK GRVG+     +KLEE    D AI EF R+F E TGN +
Sbjct  550   FYILQ-IIQDDKVLECYVFRKWGRVGNEKIGGNKLEEMSKSD-AIHEFKRLFLEKTGNPW  607

Query  1752  LSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQ  1573
              + E++K  QKKP +F+PLD+  G+  +     + +   +   SKL P +   MK+L   
Sbjct  608   EAWEQKKDFQKKPGRFFPLDIDYGVNRQ-----VTKKTRSDADSKLAPPLVELMKMLFDV  662

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSN  1393
             E YR A++E   +  E+P+G LS  ++++  + L      + S        E+L  + SN
Sbjct  663   ETYRAAMVEFEINMSEMPLGKLSKNNIQKGFEALTEIQNLLSSNAHDPSIKESLIIDASN  722

Query  1392  KWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
             ++FT++PS  P  +RD  D       + E+++DI  ASRL+     S     L D+Y KL
Sbjct  723   RFFTVIPSIHPHAIRDEDDFKSKV-KMLEALQDIEIASRLVGFDVDSDDS--LDDKYKKL  779

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLP  1033
              C I  L  DS+DY++I KYL  T+ P    D S  +    +              + L 
Sbjct  780   HCDICPLPHDSEDYQLIEKYLLTTHAPTHT-DWSLELEEVFLLERRGEFDRFARYRETLK  838

Query  1032  NKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRP  853
             N++LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y FT    P
Sbjct  839   NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADLVSKSAQYCFTDKKNP  898

Query  852   EGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDI  688
              G ++L+  ++GE     +      PPE   S        K  G+K  +ES +  W++D+
Sbjct  899   VGLMLLSEVALGEVYELKKATYMEKPPEGKHS-------TKGLGKKVPEESGYVKWRNDV  951

Query  687   KVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              VPCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  952   IVPCGKPV-SSKVKASELMYNEYIVYNTAQVKMQFLLKVRF  991



>ref|XP_011028774.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Populus euphratica]
Length=996

 Score =   333 bits (855),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 238/759 (31%), Positives = 376/759 (50%), Gaps = 67/759 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R +L+ N Q S+GS+  +  RC + M +G +  CP+C G+L   SGG Y C 
Sbjct  275   KHVTTVELRAMLEANNQISNGSELDLRDRCADGMVFGALGGCPMCSGSLH-YSGGMYRCS  333

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK----------  2437
             G  SEWS CSYSTR P R +   +IPE      L+   K  +  +N+P++          
Sbjct  334   GYLSEWSKCSYSTREPARLKGKWKIPEETDNQYLNKWFKSQR--RNKPVRILPPPSSNNL  391

Query  2436  --------EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVS  2284
                      Q    + L  + +++SG    + + WK +IE  GG++   +   T C VVS
Sbjct  392   FGSQATSQSQSSKSESLGDLKVAVSGLPNESLKEWKGKIEAVGGQLHAKIKKDTNCFVVS  451

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDK  2104
                       + A  ++  +P+VRE +LVD  ++++  P D+Y V +   V         
Sbjct  452   GVMSSEDADMRKARRMK--LPIVREGYLVDCFKRQKKLPFDSYKVEASGGVSS-------  502

Query  2103  QDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDF  1924
                           +KV G+  VH+ + +QD G  ILE    +Y+  L++ D   G+N F
Sbjct  503   -----------MVTVKVKGRSAVHEASGMQDTG-HILEDGKSIYSTTLNMSDLSTGVNSF  550

Query  1923  CIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLS  1747
              I+Q+I   +      +RK GRVG+      KLEE    D AI EF R+F E TGN + +
Sbjct  551   YILQIIQDDKGLECYVFRKWGRVGNEKIGGSKLEEMSKSD-AIHEFKRLFLEKTGNPWEA  609

Query  1746  REREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEI  1567
              E++K  QKKP +F+PLD+  G+  +      ++ G  A  +KL P +   MK+L   E 
Sbjct  610   WEQKKDFQKKPGRFFPLDIDYGVNRQ----VTKKTGSDA-DNKLAPSLVKLMKMLFDVET  664

Query  1566  YRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKW  1387
             YR A++E   +  E+P+G LS  ++++  + L      + S        E+L  + SN++
Sbjct  665   YRAAMVEFEINMSEMPLGKLSKNNIQKGFEALTEIQNLLSSNAHDPSIKESLIIDASNRF  724

Query  1386  FTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGC  1207
             FT++PS  P  +RD  D       + E+++DI  ASRL+     S     L D+Y KL C
Sbjct  725   FTVIPSIHPHVIRDEDDFKSK-VKMLEALQDIEIASRLVGFDVDSDDS--LDDKYKKLHC  781

Query  1206  SISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKKLPNK  1027
              I  L  DS+DY++I KYL  T+ P    D S  +    +              + L N+
Sbjct  782   DICPLPHDSEDYQLIEKYLITTHAPTHT-DWSLELEEVFLLERRGEFDRFAPYRETLKNR  840

Query  1026  VLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEG  847
             +LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y FT    P G
Sbjct  841   MLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADLVSKSAQYCFTDKKNPVG  900

Query  846   FLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKV  682
              ++L+  ++GE     +      PPE   S        K  G+K  +ES    W++D+ V
Sbjct  901   LMLLSEVALGEVYELKKATYMEKPPEGKHS-------TKGLGKKVPEESGCVKWRNDVIV  953

Query  681   PCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             PCG+ +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  954   PCGKPV-SSKVKASELMYNEYIVYNTAQVKMQFLLKVRF  991



>gb|KHN10726.1| Poly [ADP-ribose] polymerase 1 [Glycine soja]
Length=1526

 Score =   337 bits (865),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 241/757 (32%), Positives = 376/757 (50%), Gaps = 76/757 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H +  ++R++L+ N QDSSGS+  +  RC + M +G +  CP+C G L   SGG Y C 
Sbjct  808   KHGTTTELREMLEANGQDSSGSEIDLRDRCADGMMFGALGLCPICSGFLR-YSGGMYRCH  866

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK----------NRPLK  2437
             G  SEWS CSYST  P R E   +IPE      L    K  +  K           +  +
Sbjct  867   GYISEWSKCSYSTCEPNRIEGKWKIPEETNNQYLKKWFKSQKGKKPVRILPLPSPRKSAE  926

Query  2436  EQVITVK--------PLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVS  2284
              Q+I  +         L  + +++ G    +   WK +I+  GG     V   T CLVV 
Sbjct  927   SQMIASQHHHSSNSENLRDLKVAICGLPNDSIAEWKRKIDGIGGVFHAKVNKDTNCLVVV  986

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDK  2104
              +  +    +++ +A     P+VRE +L+D IE+K+  P D Y V               
Sbjct  987   GSLNDE---AEMRKARRMKKPIVREDYLIDCIERKKRLPFDMYKV---------------  1028

Query  2103  QDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDF  1924
              +   E    +T  +KV G+  VH+ + LQD G  ILE+   +YN  L++ D   G N +
Sbjct  1029  -EMIGETSSMVT--IKVKGRSAVHEASGLQDSG-HILEEGKSIYNTTLNMSDLSTGTNSY  1084

Query  1923  CIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLS  1747
              I+Q+I   +      +RK GRVG+      KLEE    D AI EF R+F E TGN + +
Sbjct  1085  YILQIIEEDKGSDCYVFRKWGRVGNDKIGGTKLEEMSKSD-AICEFKRLFYEKTGNPWEA  1143

Query  1746  REREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEI  1567
              E +K IQK+P +F+PLD+  G+  +     + +       SKL P +   MK+L + E 
Sbjct  1144  WE-QKTIQKQPGRFFPLDIDYGVNKQ-----VPKNKKNDADSKLPPPLIELMKMLFNVET  1197

Query  1566  YRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKW  1387
             YR A+ME   +  E+P+G LS  ++++  + L      ++ +       E+L    SN++
Sbjct  1198  YRAAMMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLKISNPDPSVKESLLINASNRF  1257

Query  1386  FTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGC  1207
             FT++PS  P  +RD  D       + E+++DI  ASRL+   + +  DD + D Y KL C
Sbjct  1258  FTMIPSIHPHIIRDEDDFKSKVVKMLEALQDIEIASRLVGFDANN--DDSIDDNYKKLHC  1315

Query  1206  SISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMK  1042
              IS L  DS+++ +I K+L+ T+ P       + + +E +F++E         P  D   
Sbjct  1316  DISPLPHDSEEFCLIEKFLQNTHAPTHT---DWSLELEEVFSLEREGEFDKFAPYRD---  1369

Query  1041  KLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
             KL N++LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y FT  
Sbjct  1370  KLGNRMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTDK  1429

Query  861   DRPEGFLVLAVASMG-----EEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWK  697
               P G ++L+  ++G     ++      PPE   S        K  G+K   ESE+  W+
Sbjct  1430  KNPVGLMLLSEVALGNVYELKKAKYMDKPPEGKHS-------TKGLGKKMPQESEYVKWR  1482

Query  696   DDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIR  586
              ++ VPCG+ +  S   +S   YNEY VY+  QVS +
Sbjct  1483  GNVTVPCGKPV-PSNVKSSELMYNEYIVYNTAQVSFK  1518



>ref|XP_007162524.1| hypothetical protein PHAVU_001G159200g [Phaseolus vulgaris]
 gb|ESW34518.1| hypothetical protein PHAVU_001G159200g [Phaseolus vulgaris]
Length=1002

 Score =   330 bits (845),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 238/763 (31%), Positives = 378/763 (50%), Gaps = 75/763 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++++  ++R++L+ N QDS+GS+  +  RC + M +G +  CP+C G L   SGG Y C 
Sbjct  282   KNVTTPELREMLEANDQDSTGSELDLRDRCADGMMFGALGLCPICSGFLR-HSGGMYRCN  340

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD---------PKNRPLKE  2434
             G  SEWS CSYST    R E   +IPE  +   L    K  +          P  R   E
Sbjct  341   GYISEWSKCSYSTCESKRVEGKWKIPEETKNQYLKKWFKSQKGKKPVRILPLPSPRKSAE  400

Query  2433  QVITV--------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSP  2281
               IT         +    + +++ G    T + WKS+I   GG     V   T CLVV  
Sbjct  401   SQITASQHQSSHSENFRDIKVAICGLANDTIKEWKSKISAMGGMFHAKVKKDTNCLVVGG  460

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
                +    +++ +A    IP+VRE +L+D I++K+  P D Y V                
Sbjct  461   VLNDE---AEMGKARRMKIPIVREDYLIDCIQRKKRLPFDMYKV----------------  501

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             +   EA   +T  +KV G+  VH+ + LQ E G IL +   +YN  L++ D   G+N + 
Sbjct  502   EMIGEASSMVT--IKVKGQSAVHEASGLQ-ESGHILVEGKSIYNTTLNMSDLSTGINSYY  558

Query  1920  IMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             I+Q+I   +      +RK GRVG+      KL    ++  AI EF R+F   TGN + + 
Sbjct  559   ILQIIQEDKGSDCSVFRKWGRVGNDKIGGSKLVNEMSKSDAICEFKRLFFVKTGNPWEAW  618

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             E +K IQK+P +F+PLD+  G+  +     + +       SKL   +   +K+L + E Y
Sbjct  619   E-QKTIQKQPGRFFPLDIDYGVNKQ-----MSKKKRNDNDSKLPVPLIELIKMLFNVETY  672

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             R A+ME   +  E+P+G LS  ++++  + L      +++T       E+L    SN++F
Sbjct  673   RSAMMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLKTTSPDPSVKESLLINASNRFF  732

Query  1383  TLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCS  1204
             T++PS  P  +RD  D       + E+++DI  ASRL+   + +  +D + D Y KL C 
Sbjct  733   TMIPSIHPHIIRDEDDFKSKV-KMLEALQDIEIASRLVGFDANN--EDSIDDSYKKLHCD  789

Query  1203  ISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMKK  1039
             IS L  DS+D+ +I K+L  T+ P       + + +E +F++E         P  D   K
Sbjct  790   ISPLPHDSEDFCLIEKFLHNTHAPTHT---DWSLELEEVFSLEREGEFDKFAPYRD---K  843

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             L N++LLW G+R +N +  L  G   A    P  GYMFGK +  +D  +++A+Y FT   
Sbjct  844   LGNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTDKK  903

Query  858   RPEGFLVLAVASMG-----EEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKD  694
              P G ++L+  ++G     ++      PPE   S        K  G+K   ESE   W+ 
Sbjct  904   NPIGLMLLSEVALGNIYELKKAKYMDKPPEGKHS-------TKGLGKKMPQESECAKWRG  956

Query  693   DIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             ++ VPCG+ +  S    S   YNEY VY+  QV ++FL+ V++
Sbjct  957   NVTVPCGKPV-PSNVKASELMYNEYIVYNTAQVKMQFLLKVRF  998



>tpg|DAA39431.1| TPA: hypothetical protein ZEAMMB73_927988 [Zea mays]
Length=969

 Score =   329 bits (843),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 233/760 (31%), Positives = 386/760 (51%), Gaps = 69/760 (9%)
 Frame = -2

Query  2763  HLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKG  2584
             H+S  ++R +L+ N QD+SG +  ++ RC + M +G +  CPVC   +   +G  Y C G
Sbjct  248   HVSAAELRDMLEANGQDTSGPERHLLDRCADGMLFGALGPCPVCANGMYYYNG-QYQCSG  306

Query  2583  DFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK-NRPL-----------  2440
             + SEWS C+YS   P R ++  +IP   +   L    K  +  K  R L           
Sbjct  307   NVSEWSKCTYSATEPVRVKKKWQIPHGTKNDYLMKWFKSQKVKKPERVLPPMSPEKSGSK  366

Query  2439  ---KEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSPAER  2272
                +  +++ K L  +  S+ G+       W  +++  G    A  V  + CL+      
Sbjct  367   ATQRTSLLSSKGLDKLRFSVVGQSKEAANEWIEKLKLAGANFYARVVKDIDCLIACGELD  426

Query  2271  ERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPS  2092
                 +++V +A    IP+VRE ++ + ++K ++ P D Y                K + +
Sbjct  427   NE--NAEVRKARRLKIPIVREGYIGECVKKNKMLPFDLY----------------KLENA  468

Query  2091  AEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQ  1912
              E+ +  T  +KV G+  VH+ + LQD    ILE    +YN  L++ D   G+N + ++Q
Sbjct  469   LESSKGSTVTVKVKGRSAVHESSGLQDTA-HILEDGKSIYNATLNMSDLALGVNSYYVLQ  527

Query  1911  LIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRERE  1735
             +I   +      +RK GRVG       KLEE    + AIKEF R+F E TGN + + E +
Sbjct  528   IIEQDDGSECYVFRKWGRVGSEKIGGQKLEEMSKTE-AIKEFKRLFLEKTGNSWEAWECK  586

Query  1734  KKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYA  1555
                +K+P +FYPLDV  G++      A ++  I+ + S L P +   MK+L + E YR A
Sbjct  587   TNFRKQPGRFYPLDVDYGVKK-----APKRKDISEMKSSLAPQLLELMKMLFNVETYRAA  641

Query  1554  LMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSNKWFTL  1378
             +ME   +  E+P+G LS  ++E+  + L      ++ T +    V E+L    SN++FTL
Sbjct  642   MMEFEINMSEMPLGKLSKENIEKGFEALTEIQNLLKDTADQALAVRESLIVAASNRFFTL  701

Query  1377  MPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSIS  1198
             +PS  P  +RD  D+    A + E+++DI  AS+++   S S     L D+Y+KL C I+
Sbjct  702   IPSIHPHIIRDEDDLMIK-AKMLEALQDIEIASKIVGFDSDSDES--LDDKYMKLHCDIT  758

Query  1197  ALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK----LPN  1030
              L  DS+DYK+I +YL  T+ P       + + +E +F+++      L+   +    L N
Sbjct  759   PLAHDSEDYKLIEQYLLNTHAPTHK---DWSLELEEVFSLDRDG--ELNKYSRYKNNLHN  813

Query  1029  KVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPE  850
             K+LLW G+R +N +  L  G   A    PV GYMFGK +  +D  +++A+Y +   + P 
Sbjct  814   KMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRNNPV  873

Query  849   GFLVLAVASMGE--EIMEFSS---PPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             G ++L+  ++G+  E+ + +S   PP    S        K  G+    ESE   W+DD+ 
Sbjct  874   GLMLLSEVALGDMYELKKATSMDKPPRGKHS-------TKGLGKTVPLESEFVKWRDDVV  926

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             VPCG+ +  S   +S   YNEY VY+  QV ++FL+ V++
Sbjct  927   VPCGKPVPSSIR-SSELMYNEYIVYNTSQVKMQFLLKVRF  965



>emb|CAA10889.1| poly(ADP-ribose) polymerase [Zea mays]
Length=969

 Score =   329 bits (843),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 233/760 (31%), Positives = 386/760 (51%), Gaps = 69/760 (9%)
 Frame = -2

Query  2763  HLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKG  2584
             H+S  ++R +L+ N QD+SG +  ++ RC + M +G +  CPVC   +   +G  Y C G
Sbjct  248   HVSAAELRDMLEANGQDTSGPERHLLDRCADGMIFGALGPCPVCANGMYYYNG-QYQCSG  306

Query  2583  DFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK-NRPL-----------  2440
             + SEWS C+YS   P R ++  +IP   +   L    K  +  K  R L           
Sbjct  307   NVSEWSKCTYSATEPVRVKKKWQIPHGTKNDYLMKWFKSQKVKKPERVLPPMSPEKSGSK  366

Query  2439  ---KEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSPAER  2272
                +  +++ K L  +  S+ G+       W  +++  G    A  V  + CL+      
Sbjct  367   ATQRTSLLSSKGLDKLRFSVVGQSKEAANEWIEKLKLAGANFYARVVKDIDCLIACGELD  426

Query  2271  ERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPS  2092
                 +++V +A    IP+VRE ++ + ++K ++ P D Y                K + +
Sbjct  427   NE--NAEVRKARRLKIPIVREGYIGECVKKNKMLPFDLY----------------KLENA  468

Query  2091  AEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQ  1912
              E+ +  T  +KV G+  VH+ + LQD    ILE    +YN  L++ D   G+N + ++Q
Sbjct  469   LESSKGSTVTVKVKGRSAVHESSGLQDTA-HILEDGKSIYNATLNMSDLALGVNSYYVLQ  527

Query  1911  LIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRERE  1735
             +I   +      +RK GRVG       KLEE    + AIKEF R+F E TGN + + E +
Sbjct  528   IIEQDDGSECYVFRKWGRVGSEKIGGQKLEEMSKTE-AIKEFKRLFLEKTGNSWEAWECK  586

Query  1734  KKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYA  1555
                +K+P +FYPLDV  G++      A ++  I+ + S L P +   MK+L + E YR A
Sbjct  587   TNFRKQPGRFYPLDVDYGVKK-----APKRKDISEMKSSLAPQLLELMKMLFNVETYRAA  641

Query  1554  LMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSNKWFTL  1378
             +ME   +  E+P+G LS  ++E+  + L      ++ T +    V E+L    SN++FTL
Sbjct  642   MMEFEINMSEMPLGKLSKENIEKGFEALTEIQNLLKDTADQALAVRESLIVAASNRFFTL  701

Query  1377  MPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSIS  1198
             +PS  P  +RD  D+    A + E+++DI  AS+++   S S     L D+Y+KL C I+
Sbjct  702   IPSIHPHIIRDEDDLMIK-AKMLEALQDIEIASKIVGFDSDSDES--LDDKYMKLHCDIT  758

Query  1197  ALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK----LPN  1030
              L  DS+DYK+I +YL  T+ P       + + +E +F+++      L+   +    L N
Sbjct  759   PLAHDSEDYKLIEQYLLNTHAPTHK---DWSLELEEVFSLDRDG--ELNKYSRYKNNLHN  813

Query  1029  KVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPE  850
             K+LLW G+R +N +  L  G   A    PV GYMFGK +  +D  +++A+Y +   + P 
Sbjct  814   KMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRNNPV  873

Query  849   GFLVLAVASMGE--EIMEFSS---PPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             G ++L+  ++G+  E+ + +S   PP    S        K  G+    ESE   W+DD+ 
Sbjct  874   GLMLLSEVALGDMYELKKATSMDKPPRGKHS-------TKGLGKTVPLESEFVKWRDDVV  926

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             VPCG+ +  S   +S   YNEY VY+  QV ++FL+ V++
Sbjct  927   VPCGKPVPSSIR-SSELMYNEYIVYNTSQVKMQFLLKVRF  965



>ref|NP_001288538.1| poly [ADP-ribose] polymerase 1 [Zea mays]
 sp|Q9ZSV1.1|PARP1_MAIZE RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Zea mays]
 gb|AAC79704.1| poly(ADP)-ribose polymerase [Zea mays]
 tpg|DAA39432.1| TPA: poly [ADP-ribose] polymerase 1(NAD(+) ADP-ribosyltransferase 
1) [Zea mays]
Length=980

 Score =   329 bits (843),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 232/760 (31%), Positives = 385/760 (51%), Gaps = 69/760 (9%)
 Frame = -2

Query  2763  HLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKG  2584
             H+S  ++R +L+ N QD+SG +  ++ RC + M +G +  CPVC   +   +G  Y C G
Sbjct  259   HVSAAELRDMLEANGQDTSGPERHLLDRCADGMLFGALGPCPVCANGMYYYNG-QYQCSG  317

Query  2583  DFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK-NRPL-----------  2440
             + SEWS C+YS   P R ++  +IP   +   L    K  +  K  R L           
Sbjct  318   NVSEWSKCTYSATEPVRVKKKWQIPHGTKNDYLMKWFKSQKVKKPERVLPPMSPEKSGSK  377

Query  2439  ---KEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKV-ANSVIGVTCLVVSPAER  2272
                +  +++ K L  +  S+ G+       W  +++  G    A  V  + CL+      
Sbjct  378   ATQRTSLLSSKGLDKLRFSVVGQSKEAANEWIEKLKLAGANFYARVVKDIDCLIACGELD  437

Query  2271  ERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPS  2092
                 +++V +A    IP+VRE ++ + ++K ++ P D Y                K + +
Sbjct  438   NE--NAEVRKARRLKIPIVREGYIGECVKKNKMLPFDLY----------------KLENA  479

Query  2091  AEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQ  1912
              E+ +  T  +KV G+  VH+ + LQD    ILE    +YN  L++ D   G+N + ++Q
Sbjct  480   LESSKGSTVTVKVKGRSAVHESSGLQDTA-HILEDGKSIYNATLNMSDLALGVNSYYVLQ  538

Query  1911  LIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRERE  1735
             +I   +      +RK GRVG       KLEE    + AIKEF R+F E TGN + + E +
Sbjct  539   IIEQDDGSECYVFRKWGRVGSEKIGGQKLEEMSKTE-AIKEFKRLFLEKTGNSWEAWECK  597

Query  1734  KKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYA  1555
                +K+P +FYPLDV  G++      A ++  I+ + S L P +   MK+L + E YR A
Sbjct  598   TNFRKQPGRFYPLDVDYGVKK-----APKRKDISEMKSSLAPQLLELMKMLFNVETYRAA  652

Query  1554  LMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSNKWFTL  1378
             +ME   +  E+P+G LS  ++E+  + L      ++ T +    V E+L    SN++FTL
Sbjct  653   MMEFEINMSEMPLGKLSKENIEKGFEALTEIQNLLKDTADQALAVRESLIVAASNRFFTL  712

Query  1377  MPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSIS  1198
             +PS  P  +RD  D+    A + E+++DI  AS+++   S S       D+Y+KL C I+
Sbjct  713   IPSIHPHIIRDEDDLMIK-AKMLEALQDIEIASKIVGFDSDSDESL--DDKYMKLHCDIT  769

Query  1197  ALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK----LPN  1030
              L  DS+DYK+I +YL  T+ P       + + +E +F+++      L+   +    L N
Sbjct  770   PLAHDSEDYKLIEQYLLNTHAPTHK---DWSLELEEVFSLDRDG--ELNKYSRYKNNLHN  824

Query  1029  KVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPE  850
             K+LLW G+R +N +  L  G   A    PV GYMFGK +  +D  +++A+Y +   + P 
Sbjct  825   KMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRNNPV  884

Query  849   GFLVLAVASMGE--EIMEFSS---PPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIK  685
             G ++L+  ++G+  E+ + +S   PP    S        K  G+    ESE   W+DD+ 
Sbjct  885   GLMLLSEVALGDMYELKKATSMDKPPRGKHS-------TKGLGKTVPLESEFVKWRDDVV  937

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             VPCG+ +  S   +S   YNEY VY+  QV ++FL+ V++
Sbjct  938   VPCGKPVPSSIR-SSELMYNEYIVYNTSQVKMQFLLKVRF  976



>gb|KDO68484.1| hypothetical protein CISIN_1g035625mg [Citrus sinensis]
Length=954

 Score =   327 bits (839),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 233/756 (31%), Positives = 370/756 (49%), Gaps = 62/756 (8%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +   C + M +G + +CP+C G L   SGG Y C+
Sbjct  235   KHVTTAELREMLEANGQDSTGSELDLRDHCADGMMFGALGRCPICSGPLR-YSGGIYRCR  293

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPK----------NRPLK  2437
             G  S WS CSYSTR P R +   +IPE      L    K  +  K          N P  
Sbjct  294   GYQSAWSKCSYSTREPERLKGKWKIPEETNSQYLVKWFKSQRTKKPIRVLPPRTSNSPAS  353

Query  2436  EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERERGGS  2257
              Q  +  P         G L  +      + +     + N      CLV+     +    
Sbjct  354   SQA-SKSPCQSSKSENLGDLRVSFSRLPKESKCVSCCLINESAETNCLVLGGVPDDPDAE  412

Query  2256  SKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEALE  2077
              + A  ++  +P+VRE +LVD  ++++  P D Y V                +   E+  
Sbjct  413   MRKARKMK--VPIVREDYLVDCFKRQKKLPFDLYKV----------------EVVGESSS  454

Query  2076  NITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAP  1897
              +T  +KV G+  VH+ + +QD G  ILE    +YN  L++ D   G+N + I+Q+I   
Sbjct  455   MVT--IKVKGRSAVHEASGMQDTG-HILEDGKSVYNTTLNMSDLSTGVNSYYILQIIQDD  511

Query  1896  ENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQK  1720
             +      +RK GRVG+      KLEE   ED A+ EF R+F E TGN + + E+++  QK
Sbjct  512   KGSDCYVFRKWGRVGNDKIGGSKLEECSKED-AVCEFKRLFLEKTGNPWEAWEQKQNFQK  570

Query  1719  KPHKFYPLDVADGIEVRHGGLALR---QLGIAAVHSKLDPMVANFMKILCSQEIYRYALM  1549
             KP K  P        +   G+  +   ++G  A  S+L P +   MK+L + E YR A+M
Sbjct  571   KPGKILPTGYCTSYSLSDYGVNKQVSEKIGTDA-DSQLAPALVELMKMLFNVETYRAAMM  629

Query  1548  EMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPS  1369
             E   +  E+P+G LS  ++++  + L      + +        E+L  + SN++FT++PS
Sbjct  630   EFDINMSEMPLGKLSKNNIQKGFEALTEIQNLLNNGAYDPSVKESLIIDASNRFFTVIPS  689

Query  1368  TRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALE  1189
               P  +RD  D       + E+++DI  ASRL+     S  DD L ++Y KL C I+ L 
Sbjct  690   IHPHVIRDEDDFKSKV-KMLEALQDIEIASRLVGFDVDS--DDSLDEKYKKLCCDIAPLP  746

Query  1188  KDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKLPNKVL  1021
              DS+DY++I KYL  T+ P       + + +E +F++E       D      +KL N++L
Sbjct  747   HDSEDYQLIEKYLHATHAPTHT---DWSLELEEVFSLEREG--EFDKFSSYQRKLKNRML  801

Query  1020  LWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFL  841
             LW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y FT    P G +
Sbjct  802   LWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTDKKNPVGLM  861

Query  840   VLAVASMGE----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCG  673
             +L+   +GE    +  ++   P D K         K  G+    ES+   W+DD+ VPCG
Sbjct  862   LLSEVGLGEVYELKKAKYMDKPPDGKH------STKGLGKTVPQESDFVKWRDDVTVPCG  915

Query  672   RLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + +  S    S   YNEY VY+  QV ++FL+ V++
Sbjct  916   KPV-PSNVRASELMYNEYIVYNTAQVKMQFLLKVRF  950



>ref|XP_006410264.1| hypothetical protein EUTSA_v10016190mg [Eutrema salsugineum]
 gb|ESQ51717.1| hypothetical protein EUTSA_v10016190mg [Eutrema salsugineum]
Length=966

 Score =   327 bits (837),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 235/755 (31%), Positives = 377/755 (50%), Gaps = 81/755 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++++  ++R++L+ N Q + GS+  +  +C + M +GP+  CP+C G L  S GG Y C 
Sbjct  259   KYVTTAELREMLEVNEQSTRGSELDLRDKCADGMMFGPLALCPICSGHLSFS-GGIYQCH  317

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVIT-----  2422
             G  SEWS CS+ST +P R +   +IPE  +   L    K     K + +   + +     
Sbjct  318   GYISEWSKCSHSTSDPDRIKGKWKIPEETENQFLLKWNKSQTSVKPKRILNPISSGGTSQ  377

Query  2421  ----------VKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI-GVTCLVV-SPA  2278
                        + L  + +S++G  ++  Q WK +IE+ G +   SV  G +CLVV  P 
Sbjct  378   GSKSAAGSSRSEKLDDLKVSIAGS-SKERQAWKKKIEEAGAEYHASVKKGTSCLVVCGPT  436

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
             +      +++ +A    +  VRE +LV+  +K+     D Y +                 
Sbjct  437   DMH---DAELRKARRLKVATVREDYLVECFKKQRKLSFDKYKIE----------------  477

Query  2097  PSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCI  1918
                +A E+I + +KV G+  VH+ + LQ E   ILE    +YN  LS+ D   G+N + I
Sbjct  478   ---DAGESIVT-VKVKGRSAVHEASGLQ-EHCHILEDGNSIYNTTLSMSDLSTGVNSYYI  532

Query  1917  MQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRE  1741
             +Q+I   +      +RK GRVG+     +KLEE    D A+ EF R+F E TGN + S E
Sbjct  533   LQIIQEDKGSDCYVFRKWGRVGNEKIGGNKLEEMPKSD-AVHEFKRLFLEKTGNTWESWE  591

Query  1740  REKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYR  1561
             +    QK+P KF PLD+  G+  +     + +       S L P +   MK+L   E YR
Sbjct  592   QRTNFQKQPGKFLPLDIDYGVNKQ-----VAKKEPVQTTSNLAPPLVELMKMLFDVETYR  646

Query  1560  YALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFT  1381
              A+ME   +  E+P+G LS  ++++  + L    + +  +       E L  + SN++FT
Sbjct  647   AAMMEFEINMSEMPLGKLSKHNIQKGFEALTEIQKLLTESDPQSSIKENLLVDASNRFFT  706

Query  1380  LMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLD--DPLYDRYVKLGC  1207
             ++PS  P  +RD  D       + E+++DI  ASRL+    G  +D  + L D+Y KL C
Sbjct  707   MIPSIHPHIIRDEDDFKSKV-KMLEALQDIEIASRLV----GFDVDSSESLDDKYKKLQC  761

Query  1206  SISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KK  1039
              IS L  DS+DY++I KYL  T+ P       + + +E +F +E       D      +K
Sbjct  762   DISPLPHDSNDYRLIEKYLNTTHAPTHT---EWSLELEEVFTLEREG--EFDKYSPYREK  816

Query  1038  LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVD  859
             L NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T  +
Sbjct  817   LGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKE  876

Query  858   RPEGFLVLAVASMGEEIMEFS------SPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWK  697
              P G ++L+  ++G E+ E +       PP       + K   K  G+K   +S+   W+
Sbjct  877   NPVGLMLLSEVALG-EVHELTKAKYMDKPP-------RGKHSTKGLGKKVPQDSDFAKWR  928

Query  696   DDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVS  592
             DD+ VPCG+ +  S+   S   YNEY VY+  QV+
Sbjct  929   DDVTVPCGKPV-SSKVKASELMYNEYIVYNTAQVT  962



>ref|XP_009398035.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=959

 Score =   325 bits (833),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 229/762 (30%), Positives = 376/762 (49%), Gaps = 73/762 (10%)
 Frame = -2

Query  2763  HLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKG  2584
             H++  ++R++L+ N QDS GS+  +  RC + M +G +  CP+C G+L C SGG Y C G
Sbjct  238   HVTTAELREMLEANGQDSMGSEYDLRDRCADGMLFGALGTCPICSGSL-CYSGGQYRCHG  296

Query  2583  DFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK-----------  2437
               S WS CSY+T  P R +   +IP+      L    K  +   N+P +           
Sbjct  297   YLSAWSKCSYTTTEPVRLKAKWKIPKETSNGYLIKWFKSQK--ANKPGRVLPPPSTSKSS  354

Query  2436  -------EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                     Q    + L  + ++++G         K+++E  G K    +   T  ++   
Sbjct  355   GRHATNLSQPSNDEKLENLKVAIAGGSAEDFADLKTKLEAAGVKFHMKIAKDTSCLIWVG  414

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
             E +    S++ +A    +P+VR  +L + + K++  P D Y + +       GI      
Sbjct  415   EVD-NDDSEMRKARRMKLPIVRVDYLQECMRKQKKLPFDLYKIENFAETSRSGI------  467

Query  2097  PSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCI  1918
                         ++V G+  VH+ + LQD G  ILE    +YN  L++ D   G+N + I
Sbjct  468   ----------VTVRVKGRSAVHEASGLQDTG-HILEDGKSIYNTTLNMSDLSTGINSYYI  516

Query  1917  MQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRE  1741
             +Q+I   +      +RK GRVG+      KL+     D AI+EF R+F E TGN + + E
Sbjct  517   LQIIQEDKGSGCYVFRKWGRVGNNKIGGTKLDGMSKSD-AIQEFKRLFLEKTGNPWEAWE  575

Query  1740  REKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYR  1561
             +++  +K+P +FYPLD+  GI+        ++  +    S+L P + + MK+L + E YR
Sbjct  576   QKRNFEKQPGRFYPLDIDYGIKQ-----VPKKKDLTNKKSQLAPQLMDLMKMLFNVETYR  630

Query  1560  YALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFT  1381
              A++E   +  E+P+G L+  ++++  + L      + ++       E+L  + SN++FT
Sbjct  631   AAMLEFEINMSEMPLGKLTKKNIQKGFEALTEIQNLVCNSDYDPAIKESLIIDASNRFFT  690

Query  1380  LMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSI  1201
             L+PS  P  +R   D+      + E+++DI  ASRL+        D+ L D+Y KL C I
Sbjct  691   LIPSIHPHVIRHEDDVK-AKVKMLEALQDIEIASRLV--CFDGDDDESLDDKYKKLRCDI  747

Query  1200  SALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMKKL  1036
             + L  DS+DY+++ KYL  T+ P       + + +E +FA+E         P  D    L
Sbjct  748   TPLLHDSEDYQLVEKYLLNTHAPTHK---DWTLELEEVFALEREGEFDKFAPRRDT---L  801

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +     
Sbjct  802   QNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYVDKKD  861

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDD  691
             P G ++L+  ++GE     +      PP+        KL  K  G+    ESEH  WKD+
Sbjct  862   PVGLMLLSEVALGEIYELKKATYMDKPPKG-------KLSTKGLGKTVPLESEHVKWKDE  914

Query  690   IKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + VPCGR +  S    S   YNEY VYD  QV ++FL+ V++
Sbjct  915   VVVPCGRPVPSSVR-ASELLYNEYIVYDTAQVKMQFLLKVRF  955



>ref|XP_009398034.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =   325 bits (834),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 229/762 (30%), Positives = 376/762 (49%), Gaps = 73/762 (10%)
 Frame = -2

Query  2763  HLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKG  2584
             H++  ++R++L+ N QDS GS+  +  RC + M +G +  CP+C G+L C SGG Y C G
Sbjct  261   HVTTAELREMLEANGQDSMGSEYDLRDRCADGMLFGALGTCPICSGSL-CYSGGQYRCHG  319

Query  2583  DFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK-----------  2437
               S WS CSY+T  P R +   +IP+      L    K  +   N+P +           
Sbjct  320   YLSAWSKCSYTTTEPVRLKAKWKIPKETSNGYLIKWFKSQK--ANKPGRVLPPPSTSKSS  377

Query  2436  -------EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                     Q    + L  + ++++G         K+++E  G K    +   T  ++   
Sbjct  378   GRHATNLSQPSNDEKLENLKVAIAGGSAEDFADLKTKLEAAGVKFHMKIAKDTSCLIWVG  437

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
             E +    S++ +A    +P+VR  +L + + K++  P D Y + +       GI      
Sbjct  438   EVD-NDDSEMRKARRMKLPIVRVDYLQECMRKQKKLPFDLYKIENFAETSRSGI------  490

Query  2097  PSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCI  1918
                         ++V G+  VH+ + LQD G  ILE    +YN  L++ D   G+N + I
Sbjct  491   ----------VTVRVKGRSAVHEASGLQDTG-HILEDGKSIYNTTLNMSDLSTGINSYYI  539

Query  1917  MQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRE  1741
             +Q+I   +      +RK GRVG+      KL+     D AI+EF R+F E TGN + + E
Sbjct  540   LQIIQEDKGSGCYVFRKWGRVGNNKIGGTKLDGMSKSD-AIQEFKRLFLEKTGNPWEAWE  598

Query  1740  REKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYR  1561
             +++  +K+P +FYPLD+  GI+        ++  +    S+L P + + MK+L + E YR
Sbjct  599   QKRNFEKQPGRFYPLDIDYGIKQ-----VPKKKDLTNKKSQLAPQLMDLMKMLFNVETYR  653

Query  1560  YALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFT  1381
              A++E   +  E+P+G L+  ++++  + L      + ++       E+L  + SN++FT
Sbjct  654   AAMLEFEINMSEMPLGKLTKKNIQKGFEALTEIQNLVCNSDYDPAIKESLIIDASNRFFT  713

Query  1380  LMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSI  1201
             L+PS  P  +R   D+      + E+++DI  ASRL+        D+ L D+Y KL C I
Sbjct  714   LIPSIHPHVIRHEDDVK-AKVKMLEALQDIEIASRLV--CFDGDDDESLDDKYKKLRCDI  770

Query  1200  SALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-----CPSLDDMKKL  1036
             + L  DS+DY+++ KYL  T+ P       + + +E +FA+E         P  D    L
Sbjct  771   TPLLHDSEDYQLVEKYLLNTHAPTHK---DWTLELEEVFALEREGEFDKFAPRRDT---L  824

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              NK+LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +     
Sbjct  825   QNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYVDKKD  884

Query  855   PEGFLVLAVASMGE-----EIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDD  691
             P G ++L+  ++GE     +      PP+        KL  K  G+    ESEH  WKD+
Sbjct  885   PVGLMLLSEVALGEIYELKKATYMDKPPKG-------KLSTKGLGKTVPLESEHVKWKDE  937

Query  690   IKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + VPCGR +  S    S   YNEY VYD  QV ++FL+ V++
Sbjct  938   VVVPCGRPVPSSVR-ASELLYNEYIVYDTAQVKMQFLLKVRF  978



>ref|XP_006657714.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Oryza brachyantha]
Length=976

 Score =   325 bits (833),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 235/758 (31%), Positives = 377/758 (50%), Gaps = 63/758 (8%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H+S  ++R +L  N QD+SG +  ++ RC + M +G +  CPVC   L    GG YHC 
Sbjct  254   KHVSTAELRNMLDANGQDTSGPERHLLDRCADGMLFGALGHCPVCSSFL-YYHGGQYHCS  312

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD-------PKNRPLKEQV  2428
             G  SEWS C+YST  P R ++  +IP+ +    L+   K  +        P   P K   
Sbjct  313   GYVSEWSKCTYSTTEPVRSKKKWKIPDEMDNDYLTKWFKSQKVKKPERVLPPMSPEKSSS  372

Query  2427  ITVKP--------LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAER  2272
              + +         L  + +S+  +       WK ++   G     +V   +  +V   E 
Sbjct  373   QSTQQNRSSVGDGLDKLRVSIVAQSKDVVDGWKQKLRDAGANFNATVTKDSSCLVLCGEL  432

Query  2271  ERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPS  2092
             E   +++V +A    IP++RE +L + I K  V P D Y V + +               
Sbjct  433   E-NENAEVRKARRLKIPILREGYLGECIRKNRVLPFDLYKVETAL---------------  476

Query  2091  AEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQ  1912
              E+ +  T  +KV G+  VH+ + LQD    ILE    +YN  L++ D  RG+N + I+Q
Sbjct  477   -ESTKGGTITVKVKGRSAVHESSGLQDTC-HILEDGKSIYNTTLNMSDLTRGVNSYYILQ  534

Query  1911  LIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRERE  1735
             +I          +RK GRVG+      KLEE    + AI+EF R+F E TGN + + E++
Sbjct  535   VIEEDNGSDCYVFRKWGRVGNEKIGGTKLEEMSKTE-AIQEFRRLFLEKTGNPWEAWEQK  593

Query  1734  KKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYA  1555
                QK+P KFYPLD+  G  VR G    ++  I  + S L P + + M  L + E YR A
Sbjct  594   TNFQKQPGKFYPLDIDYG--VRQGP---KRKDINNMKSSLAPQLLDLMNTLFNVETYRAA  648

Query  1554  LMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSNKWFTL  1378
             ++E   +  E+P+G LS  ++++  + L      + +T      + E+L    SN++FTL
Sbjct  649   MLEFEINMSEMPLGKLSKENIQKGFEALTDIQNLLGNTDNQELALRESLIVAASNRFFTL  708

Query  1377  MPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSIS  1198
             +PS  P  +RD  D+      + E+++DI  AS+L+   S         D+Y KL C+I+
Sbjct  709   IPSIHPHIIRDEDDLM-VKVKMLEALQDIEIASKLVGFDSDDDESL--DDKYKKLRCAIT  765

Query  1197  ALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK--LPNKV  1024
              L  D++DYK++ KYL  T+ P       + + +E +F ++     +     K  L NK+
Sbjct  766   PLPHDTEDYKLVEKYLLNTHAPTHK---DWSLELEEVFLLDRDGEFNKYSRYKNNLHNKM  822

Query  1023  LLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGF  844
             LLW G+R +N +  L  G   A    PV GYMFGK +  +D  +++A+Y +     P G 
Sbjct  823   LLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRKNPVGL  882

Query  843   LVLAVASMGE--EIMEFSS---PPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             ++L+  ++G+  E+ + +S   PP    S        K  GR    ESE   W+DD+ VP
Sbjct  883   MLLSEVALGDMYELKKATSMDKPPRGKHS-------TKGLGRTVPLESEFAKWRDDVVVP  935

Query  678   CGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             CG+ +  +    S   YNEY VY+  QV ++FL+ V++
Sbjct  936   CGKPV-PANIKASELLYNEYIVYNTSQVKMQFLLKVRF  972



>ref|XP_007050347.1| Poly(ADP-ribose) polymerase 2 isoform 1 [Theobroma cacao]
 gb|EOX94504.1| Poly(ADP-ribose) polymerase 2 isoform 1 [Theobroma cacao]
Length=976

 Score =   324 bits (831),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 232/755 (31%), Positives = 381/755 (50%), Gaps = 77/755 (10%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QD++GS+  +   C + M +G + KCP+C G+L  S GG Y C 
Sbjct  274   KHVTTGELREMLEANGQDATGSELDLRDHCADGMMFGALGKCPMCSGSLRFS-GGMYRCH  332

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK----------  2437
             G  S WS CSYS+  P   +   ++P+      L    K  +  K  P++          
Sbjct  333   GYLSAWSKCSYSSYEPEHVKGKWKVPDETNNEFLRKWFKSQKIKK--PVRILPPSASSSQ  390

Query  2436  -----EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSPAE  2275
                   Q   V+ L+ + +S++G    + + WK +I+  GG V   +   T C VVS  E
Sbjct  391   AANGQSQTSKVESLADLKVSIAGLPQESMEEWKGKIKGAGGIVHAKIKKDTNCFVVS-GE  449

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDP  2095
              + G  ++V +A    +P+VRE +LVD  ++++  P D Y V                + 
Sbjct  450   LD-GHDAEVRKARRMKLPIVREDYLVDCFKRQKKLPFDLYKV----------------EA  492

Query  2094  SAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIM  1915
               EA   +T  +KV G+  VH+ + LQD    ILE    +YN  L++ D   G+N + ++
Sbjct  493   IGEASSMVT--VKVKGRSAVHEASGLQD-SCHILEDGRSIYNTTLNMSDLSTGVNSYYVL  549

Query  1914  QLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRER  1738
             Q+I   +      +RK GRVG+     +KLEE    D AI EF R+F E TGN + + E+
Sbjct  550   QIIQEDKASDCYVFRKWGRVGNEKIGGNKLEEMSKLD-AISEFKRLFLEKTGNTWEAWEQ  608

Query  1737  EKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRY  1558
             ++  QK+P +F+PLD+  G+  +     + +   +   S+L P  A              
Sbjct  609   KQNFQKQPGRFFPLDIDYGVNKQ-----VSKNKHSDADSRLPPPAA--------------  649

Query  1557  ALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTL  1378
              +ME   +  E+P+G LS  ++++  + L      + S        E+L  + SN++FT+
Sbjct  650   -MMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLNSNAYDPSVKESLIIDASNRFFTV  708

Query  1377  MPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSIS  1198
             +PS  P  +RD  D       + E++ DI  ASR++   + S  DD L ++Y KL C + 
Sbjct  709   IPSIHPHVIRDEDDFKSKV-KMLEALEDIEIASRIVGFDNNS--DDSLDEKYKKLNCDVV  765

Query  1197  ALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKLPN  1030
              L  DS++Y++I KYL  T+ P       + + +E +F++E       D      +KL N
Sbjct  766   PLPHDSEEYRLIEKYLLTTHAPTHT---DWTLELEEVFSLEREG--EFDKFAPYREKLIN  820

Query  1029  KVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPE  850
             ++LLW G+R +N +  L  G   A    P  GYMFGK I  +D  +++A+Y +T    P 
Sbjct  821   RMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTHKQSPV  880

Query  849   GFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGR  670
             G ++L+  ++G E+ E +      K L + K   K  G+K   ESE   WKD+I VPCG+
Sbjct  881   GLMLLSEVALG-EVYELTKAKYIEK-LPKGKHSTKGLGKKVPQESEFVKWKDNIIVPCGK  938

Query  669   LIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              +  S+   S   YNEY VY+  QV ++FL+ V++
Sbjct  939   PV-SSRVKASELMYNEYIVYNTAQVKMQFLLKVRF  972



>emb|CAN75718.1| hypothetical protein VITISV_037618 [Vitis vinifera]
Length=1016

 Score =   319 bits (818),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 236/790 (30%), Positives = 382/790 (48%), Gaps = 124/790 (16%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QDS+GS+  +  RC + M +G +  CP+C  +L   SGG Y C+
Sbjct  261   KHVTTAELREMLEANGQDSTGSELDLRDRCADGMLFGALGHCPLCSSSLR-YSGGMYRCQ  319

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKN-RPLKEQVITV---  2419
             G  S WS CSYST  P R +   +IPE      L    K  +  K  R +  Q   V   
Sbjct  320   GYLSAWSKCSYSTVEPERIKGKWKIPEETSNQYLRKWFKSQKGKKPVRVMPPQSSNVSCG  379

Query  2418  ------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
                         + LS + ++++G   +    WKS+IE          +   C VV    
Sbjct  380   KQAASPSQSSKSENLSDLRVAIAGYSKQCVGEWKSKIEG---------VDTNCFVV----  426

Query  2274  RERGG-----SSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPL  2110
                GG      +K+  A +  +PV+RE +LVD  + ++  P D Y +             
Sbjct  427   ---GGMLDAEDAKMRRARKMKLPVLREDYLVDCFKSQKKLPFDKYKI-------------  470

Query  2109  DKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLN  1930
                + S E    +T  +KV G+  VH+ + LQD  G ILE    +YN  L++ D   G+N
Sbjct  471   ---EASGETSSMVT--VKVKGRSAVHEASGLQD-SGHILEDGKSIYNTTLNMSDLSTGVN  524

Query  1929  DFCI----------MQLI------------------------VAPENR---LHMYYRKGR  1861
              F            + LI                        +  E+R    +++ + GR
Sbjct  525   RFISRVPKYFFQPRLLLIWTRTLPSLESRSDGIRKWKVRLKKIIQEDRGSNCYVFRKWGR  584

Query  1860  VGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADG  1681
             VG+     +KL+E    D AI+EF R+F E TGN + + ER++  QK+P +F+PLD+  G
Sbjct  585   VGNDKIGGNKLDEMPKSD-AIQEFKRLFLEKTGNPWEAWERKQNFQKQPGRFFPLDIDYG  643

Query  1680  IEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSD  1501
             +  +      ++  ++ V+S+L P V   MK+L + E YR A+ME   +  E+P+G LS 
Sbjct  644   VNKQ----VSKKNNLSNVNSQLAPQVVELMKMLFNVETYRSAMMEFEINMSEMPLGKLSK  699

Query  1500  VHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLRDFADIADHA  1321
              ++++  + L      + S        E+L  + SN++FT++PS  P  +RD  D     
Sbjct  700   SNIQKGFEALTEIQNLLNSNAHDPSFKESLIVDASNRFFTVIPSIHPHVIRDEDDFKSK-  758

Query  1320  ASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKT  1141
               + E+++DI  ASRL+     S     L D+Y KL C I+ L  DS++Y++I KYL  T
Sbjct  759   VKMLEALQDIEIASRLVGFDVDSDDS--LDDKYKKLCCDIAPLPHDSEEYRLIEKYLLTT  816

Query  1140  YDPVRVGDISYGVSVENIFAVEPSACPSLDDM----KKLPNKVLLWCGTRSSNLLRHLQN  973
             + P     + + + +E +F++E       D      +KL N++LLW G+R +N +  L  
Sbjct  817   HAPTH---MDWTLELEEVFSLEREG--EFDKFASYREKLQNRMLLWHGSRLTNFVGILSQ  871

Query  972   GFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGE-----EI  808
             G   A    P  GYMFGK +  +D  +++A+Y +T    P G ++L+  ++GE     + 
Sbjct  872   GLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCYTDRKNPVGLMLLSEVALGEVYELRKA  931

Query  807   MEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDY  628
             M    PPE   S        K  G+KK  +SE+  W+D++ VPCG+ +  S   ++   Y
Sbjct  932   MYMDKPPEGKHS-------TKGLGKKKPQDSEYVKWRDEVVVPCGKPV-PSNVKSTELMY  983

Query  627   NEYAVYDPQQ  598
             NEY VY+  Q
Sbjct  984   NEYIVYNTAQ  993



>ref|XP_006827511.1| hypothetical protein AMTR_s00009p00184050 [Amborella trichopoda]
 gb|ERM94927.1| hypothetical protein AMTR_s00009p00184050 [Amborella trichopoda]
Length=849

 Score =   315 bits (807),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 230/729 (32%), Positives = 361/729 (50%), Gaps = 76/729 (10%)
 Frame = -2

Query  2667  MFYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTP  2488
             M +G +  C +C G++    GG Y C G  S WS C+YST  P R +E  ++PE      
Sbjct  15    MLFGALGSCSLCSGSV-YYFGGRYKCHGYVSAWSKCAYSTTEPTRLKEKWKVPEDSDNEY  73

Query  2487  LSDLIKKHQDPK-NRPL-------------KEQVITVKPLSGMMISLSGRLTRTHQYWKS  2350
             L    K  +  K +R L             K Q+   + L  + +++ G    + + WKS
Sbjct  74    LCKWFKSQKAKKPDRILPPSSSRSSNVVDGKSQLTKSESLQELKVAIVGMSNESLEEWKS  133

Query  2349  QIEKNGGKVANSVIGVT-CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEV  2173
             +I   GG     +   T CLVV+    E    S++  A    I VVRE +LVD I KK  
Sbjct  134   KIGAAGGVFHMKMKKETYCLVVNGNPEEH--DSEIRRARRMKISVVREEYLVDCINKKRR  191

Query  2172  QPLDAY--DVASDIAVDGRGIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGK  1999
              P D Y  +VAS+ +  G                     +KV G+  VH+ + LQD  G 
Sbjct  192   LPTDQYKIEVASETSRSG------------------MVTVKVKGRSAVHEQSGLQD-SGH  232

Query  1998  ILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENR---LHMYYRKGRVGDTARVDDKL  1828
             ILE    ++N  L++ D   G+N + I+Q+I   E+R    +++ + GRVG+     +KL
Sbjct  233   ILEDGKSIFNTTLNMSDLSTGINSYYILQII--QEDRGGDCYVFRKWGRVGNEKIGGNKL  290

Query  1827  EEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALR  1648
             E     D AI+EF R+F + TGN + + E+++  QK+P +F+PLD+  G+      L  R
Sbjct  291   EMMSKSD-AIREFKRLFLDKTGNSWEAWEQKRNFQKQPGRFFPLDIDYGV----NKLEPR  345

Query  1647  QLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLL  1468
             +  +  V S+  P +   MK+L + E YR A+ME   +  E+P+G LS  ++++  + L 
Sbjct  346   KNELGDVKSQFAPRLIELMKMLFNVETYRAAMMEFEINMSEMPLGKLSKSNIQKGFEALT  405

Query  1467  HFVERIRSTKEAGQQVEALWAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDIN  1288
                  + +        E+L  + SN++FT++PS  P  +RD  D       + E+++DI 
Sbjct  406   EIQNLLSNIVYEPSVKESLIVDASNRFFTVIPSIHPHVIRDENDFKS-KVKMLEALQDIE  464

Query  1287  AASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISY  1108
              ASRL+     S  D+ L ++Y KL C ++ L  DS DY+M+ K+L  T+ P       +
Sbjct  465   IASRLVG--FDSENDESLDEKYKKLCCDVAPLPHDSTDYQMVKKFLLNTHAPTHK---DW  519

Query  1107  GVSVENIFAVEPSA-----CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLP  943
              + VE++FA+E         P  D++K   NK+LLW G+R +N +  L  G   A    P
Sbjct  520   TLEVEDVFALERDGEFDKYAPYRDNLK---NKMLLWHGSRLTNFVGILSQGLRIAPPEAP  576

Query  942   VPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGE-----EIMEFSSPPEDT  778
               GYMFGK +  +D  +++A+Y +T      G L+L+  ++GE     +     SPPE  
Sbjct  577   STGYMFGKGVYFADLVSKSAQYCYTDKKDAVGLLLLSEVALGEMYELKKAKYMESPPEGK  636

Query  777   KSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQ  598
              S        K  G+K  +  E   W+D+I VPCG  +  S    +   YNEY VY+  Q
Sbjct  637   HS-------TKGLGQKTPNALEFEKWRDEITVPCGSPV-SSGVRATELMYNEYIVYNTAQ  688

Query  597   VSIRFLVAV  571
             V ++FL+ V
Sbjct  689   VKMQFLLKV  697



>emb|CDP06935.1| unnamed protein product [Coffea canephora]
Length=228

 Score =   285 bits (728),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 152/181 (84%), Gaps = 1/181 (1%)
 Frame = -2

Query  2022  KLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRKGRVGDTAR  1843
             KLQDEGGKI EKDG+LYNCA ++C+Q RG N+F IMQLI+ PENRLHMY ++GR+GD  R
Sbjct  11    KLQDEGGKIFEKDGILYNCAFTLCNQKRG-NNFHIMQLIIVPENRLHMYQKRGRIGDIER  69

Query  1842  VDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHG  1663
              DD+L E EN D AI EF +IFEE+TGNEF   EREKK +KKP KFYPLD+ADG+EVRHG
Sbjct  70    ADDQLNERENIDNAITEFVKIFEEVTGNEFEPWEREKKFEKKPGKFYPLDMADGVEVRHG  129

Query  1662  GLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERC  1483
              +  RQLG+A VHSKLDPMVANF+KILCSQEIYRYAL EMG DYPE PIGMLS+VHL RC
Sbjct  130   AIGFRQLGLAVVHSKLDPMVANFIKILCSQEIYRYALTEMGQDYPEFPIGMLSNVHLNRC  189

Query  1482  E  1480
             +
Sbjct  190   K  190



>ref|XP_002973881.1| hypothetical protein SELMODRAFT_100128 [Selaginella moellendorffii]
 gb|EFJ24836.1| hypothetical protein SELMODRAFT_100128 [Selaginella moellendorffii]
Length=969

 Score =   298 bits (763),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 232/760 (31%), Positives = 379/760 (50%), Gaps = 78/760 (10%)
 Frame = -2

Query  2763  HLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKG  2584
             ++S+ +M+++L+ N    S SD+ I  RC + M +GP   CP CGG L   SGG Y C+G
Sbjct  257   NVSLDEMKEMLEINNGAMSKSDKEIRERCADGMMFGPFKPCPQCGGPL-LYSGGMYSCQG  315

Query  2583  DFSEWSSCSYSTRNPPRKEEPLRIPES-----VQKTPLSDLI------KKHQDPKN----  2449
               SEWS C++ T    R+ +  +IP+      +++  L  L       K  + PK     
Sbjct  316   HLSEWSRCNFKTSEVQRQAK-WKIPKGSTNPFLRQASLFCLCLSCIWNKTQKTPKEPRLL  374

Query  2448  RPLKEQVIT-VKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSV-IGVTCLVVSPAE  2275
             RP  + + +    L G+ +   G +    Q WK+ IE+  G V  ++  G   L      
Sbjct  375   RPSTKNLNSEAHFLRGLHVFFFGAMQEKTQ-WKALIEEAKGVVHKTMDPGAQGL------  427

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDP  2095
              E    + +     R IP V E +L + ++ K+  PL  Y + S                
Sbjct  428   -EDWNLTSLTRRQLR-IPAVGERYLTECMKMKKRLPLKDYRLESS---------------  470

Query  2094  SAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIM  1915
                      +++KV G+  VH+D+++QD+G  +LE   ++Y+  L+  D   G N   ++
Sbjct  471   ---RTSTAMTKVKVKGRSAVHEDSEMQDKG-HVLESGSVIYSVTLNKSDISTGRNSCYVL  526

Query  1914  QLIVAPE-NRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRER  1738
             Q+I   + N  +++ + GRV  + R   KLE +  + GAI+EF + F + TGNE+ S  R
Sbjct  527   QIIEEDKGNACYVFRKWGRVA-SERGHTKLEAFSKQ-GAIEEFEKGFLDKTGNEWHSWVR  584

Query  1737  EKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAV---HSKLDPMVANFMKILCSQEI  1567
             +   QK P K+YP      +E+ +G     Q  +AAV    S L P V N MK+L   E 
Sbjct  585   KTGFQKVPGKYYP------VEIDYGADEAPQKELAAVPGSKSNLHPRVVNLMKMLFDIET  638

Query  1566  YRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERI-RSTKEAGQQVEALWAEFSNK  1390
             Y+ A++E   +  E+P+G L+  H+ +  D L      + R  ++  +QVE +  + SN+
Sbjct  639   YKSAMLEFEINPNEMPLGKLTKAHIAKGFDVLTRIQNVLKREQQDPRRQVELI--DGSNQ  696

Query  1389  WFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLG  1210
             + TL+PST P  + D  D+      + E++RDI  AS+LI+        DPL   Y KL 
Sbjct  697   FNTLIPSTHPTLIDD-EDVLKTKIQMLEALRDIEIASQLIKSADEDDESDPLDVHYKKLK  755

Query  1209  CSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK--L  1036
             C++S +  DS +++++  YLE+T+ P       +G+ VE++F V       L    K  L
Sbjct  756   CAVSPVPHDSPEFELVKNYLERTHAPTHT---EWGLEVEDVFVVSRDGEHDLYAPMKSTL  812

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
              N++LLW G+R++N +  L  G   A    P  GYMFGK +  +D  +++A+Y FT    
Sbjct  813   KNRMLLWHGSRTTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTNRSN  872

Query  855   PEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLG---AKFHGRKKTDESEHFVWKDDIK  685
             P G ++L+  ++G +I E++      + +E+   G    K  GR   D SE   + D + 
Sbjct  873   PVGLMLLSEVALG-DIKEYTH----AQYMEKPPAGYMATKGVGRTMPDPSEFKEFDDGVV  927

Query  684   VPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             VPCGR +       S   YNE+ VY   Q+ +RFL+ V++
Sbjct  928   VPCGRPV--PSQVRSDLLYNEFIVYSTSQIQLRFLLKVRF  965



>ref|XP_002969183.1| hypothetical protein SELMODRAFT_90144 [Selaginella moellendorffii]
 gb|EFJ30299.1| hypothetical protein SELMODRAFT_90144 [Selaginella moellendorffii]
Length=965

 Score =   297 bits (760),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 228/762 (30%), Positives = 373/762 (49%), Gaps = 82/762 (11%)
 Frame = -2

Query  2763  HLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKG  2584
             ++S+ +M+++L+ N    S SD+ I  RC + M +GP   CP CGG L   SGG Y C+G
Sbjct  253   NVSLDEMKEMLEINNGAMSKSDKEIRERCADGMMFGPFKPCPQCGGPL-LYSGGMYSCQG  311

Query  2583  DFSEWSSCSYSTRNPPRKEE---------PLRIPESVQKTPLSDLIKKHQDPKNRP--LK  2437
               SEWS C++ T    R+ +         P     S+    LS +  K Q     P  L+
Sbjct  312   HLSEWSRCNFKTSEVQRQAKWNIPKGSTNPFLRQASLFCLCLSCIWNKTQKTPKEPRLLR  371

Query  2436  EQVITVKP----LSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSV----IGVTCLVVSP  2281
                  +      L G+ +   G +    Q WK+ IE+  G V  ++     G+    ++ 
Sbjct  372   PSTKNLNSEAHFLRGLHVFFFGAMQEKTQ-WKALIEEAKGVVHKTMDPGAQGLEDWNLTS  430

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
               R            + GIP V E +L + ++ K+  PL  Y + S              
Sbjct  431   LTRR-----------QLGIPAVAERYLTECMKMKKRLPLKDYRLESS-------------  466

Query  2100  DPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
                        +++KV G+  VH+D+++QD+G  +LE   ++Y+  L+  D   G N   
Sbjct  467   -----RTSTAMTKVKVKGRSAVHEDSEMQDKG-HVLESGSVIYSVTLNKSDISTGRNSCY  520

Query  1920  IMQLIVAPE-NRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
             ++Q+I   + N  +++ + GRV  + R   KLE +  + GAI+EF + F + TGNE+ S 
Sbjct  521   VLQIIEEDKGNACYVFRKWGRVA-SERGHTKLEAFSKQ-GAIEEFEKGFLDKTGNEWHSW  578

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAV---HSKLDPMVANFMKILCSQ  1573
              R+   QK P K+YP      +E+ +G     Q  +A V    S L P V + MK+L   
Sbjct  579   VRKTGFQKVPGKYYP------VEIDYGADEAPQKELATVSGSKSNLHPRVVSLMKMLFDI  632

Query  1572  EIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERI-RSTKEAGQQVEALWAEFS  1396
             E Y+ A++E   +  E+P+G L+  H+ +  D L      + R  ++  +QVE +  + S
Sbjct  633   ETYKSAMLEFEINPNEMPLGKLTKAHIAKGFDVLTRIQNVLKREQQDPRRQVELI--DGS  690

Query  1395  NKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVK  1216
             N++ TL+PST P  + D  D+      + E++RDI  AS+LI+        DPL   Y K
Sbjct  691   NQFNTLIPSTHPTLIDD-EDVLKTKIQMLEALRDIEIASQLIKSADEDDESDPLDVHYKK  749

Query  1215  LGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK-  1039
             L C++S +  DS +++++  YLE+T+ P       +G+ VE++F V       L    K 
Sbjct  750   LKCAVSPVPHDSPEFELVKNYLERTHAPTHT---EWGLEVEDVFVVSRDGEHDLYAPMKS  806

Query  1038  -LPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAV  862
              L N++LLW G+R++N +  L  G   A    P  GYMFGK +  +D  +++A+Y FT  
Sbjct  807   TLKNRMLLWHGSRTTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTNR  866

Query  861   DRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLG---AKFHGRKKTDESEHFVWKDD  691
               P G ++L+  ++G +I E++      + +E+   G    K  GR   D SE   + D 
Sbjct  867   SNPVGLMLLSEVALG-DIKEYTH----AQYMEKPPAGYMATKGVGRTMPDPSEFKEFDDG  921

Query  690   IKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + VPCGR +       S   YNE+ VY   Q+ +RFL+ V++
Sbjct  922   VVVPCGRPV--PSQVRSDLLYNEFIVYSTSQIQLRFLLKVRF  961



>emb|CDP20882.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   276 bits (706),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 167/210 (80%), Gaps = 2/210 (1%)
 Frame = -2

Query  2664  FYGPVDKCPVCGGALECSSGGTYHCKGDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPL  2485
             F       P+ GG L C+ G  Y C G++SEWSSC+Y+T+NPPR+ EPL IPESV+K+P+
Sbjct  26    FTSSGQNLPLHGGTLVCN-GKEYTCTGEYSEWSSCTYTTKNPPRRNEPLEIPESVEKSPV  84

Query  2484  SDLI-KKHQDPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVI  2308
             SDLI KKHQ   +RP +E  +  KP +GM+ISLSGRL++THQ+W+S+IEK+GGKVAN VI
Sbjct  85    SDLIIKKHQVSNSRPQRELALADKPFTGMVISLSGRLSQTHQHWRSKIEKHGGKVANHVI  144

Query  2307  GVTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVD  2128
             GVTCLV S AERERGGS K+AEA+E GIPVVRE WL+DSIEKKE QP DAYD+ SD+AV 
Sbjct  145   GVTCLVASSAERERGGSGKLAEAIETGIPVVREEWLIDSIEKKEAQPSDAYDIVSDLAVA  204

Query  2127  GRGIPLDKQDPSAEALENITSELKVYGKRG  2038
             G+GIPLDKQDPS EA+++I +E+ +   +G
Sbjct  205   GKGIPLDKQDPSEEAIQSIAAEVLLIFYKG  234



>ref|XP_004959167.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Setaria italica]
Length=845

 Score =   273 bits (699),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 187/576 (32%), Positives = 306/576 (53%), Gaps = 51/576 (9%)
 Frame = -2

Query  2259  SSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDPSAEAL  2080
             +++V +A    IP+VRE ++ + I K    P D Y V + +   G               
Sbjct  306   NAEVRKARRLKIPIVREDYIGECIRKNRTLPFDLYKVENTLESKGG--------------  351

Query  2079  ENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVA  1900
                T  +KV G+  VH+ + LQD    ILE    +YN  L++ D  RG+N + ++Q+I  
Sbjct  352   ---TVTVKVKGRSAVHESSGLQDTA-HILEDGKSIYNTTLNMSDLARGVNSYYVLQVIEE  407

Query  1899  PENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQ  1723
              +      +RK GRVG+      KLEE    D AI+EF R+F E TGN + + ER+   Q
Sbjct  408   DDGSECYVFRKWGRVGNERIGSQKLEEMSKTD-AIQEFKRLFLEKTGNPWEAWERKTNFQ  466

Query  1722  KKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEM  1543
             K+P +FYPLD+  G++      A ++  I+   S L P +   MK+L + E YR A+ E 
Sbjct  467   KQPGRFYPLDIDYGVKQ-----APKRKDISETKSSLAPQLLELMKMLFNVETYRAAMTEF  521

Query  1542  GYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV-EALWAEFSNKWFTLMPST  1366
               +  E+P+G LS  ++++  + L      +++T +    V E+L    SN++FTL+PS 
Sbjct  522   EINMSEMPLGKLSKENIQKGFEALTEIQNLLKNTADQALAVRESLIVAASNRFFTLIPSI  581

Query  1365  RPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEK  1186
              P  +RD  +I    A + E+++DI  AS+L+   S +  D+ L D+Y+KL C+I+ L  
Sbjct  582   HPHIIRDEDEIM-IKAKMLEALQDIEIASKLVGFDSDN--DESLDDKYMKLHCNIAPLPH  638

Query  1185  DSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSACPSLDDMKK----LPNKVLL  1018
             DS+DYK++ +YL  T+ P       + + +E +F+++      L+   +    L NK+LL
Sbjct  639   DSEDYKLVERYLLNTHAPTHK---DWSLELEEVFSLDRDG--ELNKYSRYKNNLHNKMLL  693

Query  1017  WCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLV  838
             W G+R +N +  L  G   A    PV GYMFGK +  +D  +++A+Y +     P G ++
Sbjct  694   WHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRGNPVGLML  753

Query  837   LAVASMGE--EIMEFSS---PPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVPCG  673
             L+  ++G+  E+ + +S   PP       + K   K  G+    ESE   W+DD+ VPCG
Sbjct  754   LSEVALGDMYELKKATSMDKPP-------RGKHSTKGLGKTVPLESEFVNWRDDVVVPCG  806

Query  672   RLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
             + +  S   +S   YNEY VY+  QV ++FL+ V++
Sbjct  807   KPVPSSVR-SSELLYNEYIVYNTSQVKMQFLLKVRF  841



>gb|ADE76583.1| unknown [Picea sitchensis]
Length=456

 Score =   248 bits (633),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 162/476 (34%), Positives = 254/476 (53%), Gaps = 35/476 (7%)
 Frame = -2

Query  1956  VCDQGRGLNDFCIMQLIVAPENR-LHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRI  1780
             + D   G+N + I+Q+I   +    H++ + GRVG++     KLE+   +  AI+EF R+
Sbjct  1     MSDLSTGINSYYILQVIEDDKKAGCHVFRKWGRVGNSKIGGQKLEKMP-KLAAIREFKRL  59

Query  1779  FEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVA  1600
             F E TGNE+ S E ++  +K+P KF PL++  G++        + +G     SKLDP V 
Sbjct  60    FLEKTGNEWESWENKEDFEKQPGKFLPLEIDYGVDESEQ----KDIGSLGAKSKLDPRVI  115

Query  1599  NFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQV  1420
             + MK+L   E YR A+ME   +  E+P+G LS  +++R  + L      I+  +      
Sbjct  116   DLMKMLFDLETYRAAMMEFEINMSEMPLGKLSKSNIQRGFEVLTEVQNLIKQNEPGVALN  175

Query  1419  EALWAEFSNKWFTLMPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDD  1240
             E+L  + SN++FTL+PS  P  +RD  D+      + E++RDI  AS LI        +D
Sbjct  176   ESLIIDASNRFFTLIPSVHPHIIRDEDDLKS-KIQMLETLRDIEIASSLINFKKND--ED  232

Query  1239  PLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVE-----  1075
             P    Y KL C+IS L  DS DY++I KYLE T+ P       + + +E+ +A++     
Sbjct  233   PFDSNYKKLQCNISPLPHDSSDYQLIKKYLETTHAPTHK---EWALELEDAYAIDRKGEY  289

Query  1074  PSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAA  895
              +  P   + K   N++LLW G+R +N +  L  G   A    P  GYMFGK +  +D  
Sbjct  290   DAYFPYKSNFK---NRMLLWHGSRVTNFVGILSQGLRIAPPEAPATGYMFGKGLYFADLV  346

Query  894   AEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSS------PPEDTKSLEQKKLGAKFHGR  733
             +++A+Y +T    P G ++L+  ++G E+ E  S      PP+   S        K  G+
Sbjct  347   SKSAQYCYTHKKNPVGLMLLSEVALG-EVHELKSAKYMDKPPKGKHS-------TKGVGK  398

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              K  ++E+  W DD+ VPCGR +  S   NS   YNEY VYDP QV ++FL+ V++
Sbjct  399   TKPLDTEYERWGDDVTVPCGRPVPSSV-KNSDLLYNEYIVYDPAQVKLQFLLKVRF  453



>ref|XP_007050349.1| Poly(ADP-ribose) polymerase 2 isoform 3, partial [Theobroma cacao]
 gb|EOX94506.1| Poly(ADP-ribose) polymerase 2 isoform 3, partial [Theobroma cacao]
Length=820

 Score =   252 bits (644),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 174/563 (31%), Positives = 290/563 (52%), Gaps = 50/563 (9%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H++  ++R++L+ N QD++GS+  +   C + M +G + KCP+C G+L  S GG Y C 
Sbjct  274   KHVTTGELREMLEANGQDATGSELDLRDHCADGMMFGALGKCPMCSGSLRFS-GGMYRCH  332

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLK----------  2437
             G  S WS CSYS+  P   +   ++P+      L    K  +  K  P++          
Sbjct  333   GYLSAWSKCSYSSYEPEHVKGKWKVPDETNNEFLRKWFKSQKIKK--PVRILPPSASSSQ  390

Query  2436  -----EQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT-CLVVSPAE  2275
                   Q   V+ L+ + +S++G    + + WK +I+  GG V   +   T C VVS  E
Sbjct  391   AANGQSQTSKVESLADLKVSIAGLPQESMEEWKGKIKGAGGIVHAKIKKDTNCFVVS-GE  449

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLDKQDP  2095
              + G  ++V +A    +P+VRE +LVD  ++++  P D Y V                + 
Sbjct  450   LD-GHDAEVRKARRMKLPIVREDYLVDCFKRQKKLPFDLYKV----------------EA  492

Query  2094  SAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFCIM  1915
               EA   +T  +KV G+  VH+ + LQD    ILE    +YN  L++ D   G+N + ++
Sbjct  493   IGEASSMVT--VKVKGRSAVHEASGLQD-SCHILEDGRSIYNTTLNMSDLSTGVNSYYVL  549

Query  1914  QLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSRER  1738
             Q+I   +      +RK GRVG+     +KLEE    D AI EF R+F E TGN + + E+
Sbjct  550   QIIQEDKASDCYVFRKWGRVGNEKIGGNKLEEMSKLD-AISEFKRLFLEKTGNTWEAWEQ  608

Query  1737  EKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIYRY  1558
             ++  QK+P +F+PLD+  G+  +     + +   +   S+L P + + MK+L + E YR 
Sbjct  609   KQNFQKQPGRFFPLDIDYGVNKQ-----VSKNKHSDADSRLPPPLLDLMKMLFNVETYRA  663

Query  1557  ALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWFTL  1378
             A+ME   +  E+P+G LS  ++++  + L      + S        E+L  + SN++FT+
Sbjct  664   AMMEFEINMSEMPLGKLSKSNIQKGFEALTEIQNLLNSNAYDPSVKESLIIDASNRFFTV  723

Query  1377  MPSTRPFYLRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSIS  1198
             +PS  P  +RD  D       + E++ DI  ASR++   + S  DD L ++Y KL C + 
Sbjct  724   IPSIHPHVIRDEDDFKSK-VKMLEALEDIEIASRIVGFDNNS--DDSLDEKYKKLNCDVV  780

Query  1197  ALEKDSDDYKMILKYLEKTYDPV  1129
              L  DS++Y++I KYL  T+ P 
Sbjct  781   PLPHDSEEYRLIEKYLLTTHAPT  803



>gb|AAH37545.1| Poly (ADP-ribose) polymerase 1 [Homo sapiens]
 gb|ABM85752.1| poly (ADP-ribose) polymerase family, member 1 [synthetic construct]
Length=1014

 Score =   246 bits (628),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 221/777 (28%), Positives = 364/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD     A + +++ DI  A  L+
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKAEMLDNLLDIEVAYSLL  778

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  779   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVID  835

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  836   IFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  895

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  896   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  953

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TTPDPSANISL-DGVDVPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_009860226.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ciona intestinalis]
Length=980

 Score =   246 bits (627),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 208/760 (27%), Positives = 364/760 (48%), Gaps = 55/760 (7%)
 Frame = -2

Query  2760  LSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCG-GALECSSGGTYHCKG  2584
             L  +++ +IL++N+Q      + I  R  + M +G +  C +CG G L  SS G Y C G
Sbjct  242   LKKKELVEILEENSQKVPKGLDKIFERVADGMLFGRLPLCTLCGDGQLVASSRGFYQCVG  301

Query  2583  DFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITVKPLSG  2404
             + S W+SC+ +T +  R   P  IP+ + +      +KK++      +       KPL  
Sbjct  302   NISGWTSCTNTTLDVKR--SPWIIPQDLHED--FPYLKKYKYKPTVRIFPPRPKPKPLKD  357

Query  2403  MMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERERGGSSKVAEAVERGI  2224
               + + G+L++     K  +E  GG V  S+    C V + AE E   + ++  A  + +
Sbjct  358   KKVVIIGKLSKPRDELKQLVENLGGSVTTSLNKAYCCVTNQAEVETT-NKRIKSAEIQDV  416

Query  2223  PVVREAWL-------------VDSIEKKEVQPLDAYDVASDIAVDGRGIPLD----KQDP  2095
               V E +L             +  ++K  + P  +  +   +A+  R   L+    K+  
Sbjct  417   FCVSEEFLDCCKDLSTPLNSLLPFLKKYSLCPWGSEVI---VAIFSRNTRLNNAALKRSM  473

Query  2094  SAEALENITSELKVYGKRG--VHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGLNDFC  1921
             + E+    T + K+  K G  V  ++ L+DE  ++L+ DG  Y   L++ D   G N + 
Sbjct  474   AEESRSLSTKKQKLVVKSGAAVDPESNLEDET-EVLQHDGRSYTATLAMVDMKSGTNSYY  532

Query  1920  IMQLIVAPENR-LHMYYRKGRVGDTARVDDKLEEWENEDGAIKEFSRIFEELTGNEFLSR  1744
              +QL+     R  H++   GRVG T+    K+E++   D A++ F+ I+ E TGN+F S+
Sbjct  533   KLQLLADTSGRSWHVFRSWGRVG-TSIGGTKVEKFRTLDNALQNFNEIYTEKTGNDFGSK  591

Query  1743  EREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILCSQEIY  1564
             +      K+PHKFYPL++  G++       ++ L  A   SKL   V + +K++ + E  
Sbjct  592   D----FVKQPHKFYPLEIDYGMDDEK---KVQHLDTAGKSSKLKQEVQDLVKMIFNIESM  644

Query  1563  RYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEFSNKWF  1384
             + A++E   D  ++P+G LS   +++    L    E + +      +V     + SN+++
Sbjct  645   KKAMLEFEIDLNKMPLGKLSKRQMQQAYLVLNEVNELVTAGDHGSGKV----LDCSNRFY  700

Query  1383  TLMPSTRPFY---LRDFADIADHAASVFESVRDINAASRLIEDMSGSTLDDPLYDRYVKL  1213
             TL+P     +   L D  DI      + +++ DI  A  L+   +  T  DPL   Y KL
Sbjct  701   TLIPHDYGVHQPPLLDNLDIIKAKTEMIDNLIDIEVAYNLLTTTTEDTQTDPLDLSYEKL  760

Query  1212  GCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-CPSLDDMKKL  1036
              C I  L+KDS+++KM+ KY + T+         Y +++E++F +            + L
Sbjct  761   QCDILPLDKDSEEFKMVEKYTQLTHASTHN---QYKLTIEHLFKINRKGELSRFRPFQSL  817

Query  1035  PNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKYGFTAVDR  856
             PN  LLW G+R +N    L  G   A    PV GYMFGK +  +D  +++A Y  T+   
Sbjct  818   PNHKLLWHGSRMTNYAGILSQGLRIAPPEAPVTGYMFGKGLYFADMVSKSANYCSTSSRN  877

Query  855   PEGFLVLAVASMGEEI-MEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWKDDIKVP  679
             P G  +LA  ++G    ++++   +D + L + K      G+   D S H     ++ VP
Sbjct  878   PIGLALLADVALGNPYELKYA---KDVRKLPKSKHSVIGLGKTVPDPSTHITVDSNLVVP  934

Query  678   CGRLIEE--SQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
              G+ +E    +   +   YNEY VYD  QV++++LV  K+
Sbjct  935   MGKGVEADLGKDKETSLLYNEYIVYDVAQVNLKYLVQFKF  974



>gb|ABM82562.1| poly (ADP-ribose) polymerase family, member 1 [synthetic construct]
Length=1014

 Score =   246 bits (627),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 221/777 (28%), Positives = 364/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD     A + +++ DI  A  L+
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKAEMLDNLLDIEVAYGLL  778

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  779   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVID  835

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  836   IFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  895

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  896   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  953

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TTPDPSANISL-DGVDVPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>dbj|BAG10250.1| poly [ADP-ribose] polymerase-1 [synthetic construct]
Length=1014

 Score =   245 bits (625),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 220/777 (28%), Positives = 363/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  778

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  779   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVID  835

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  836   IFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  895

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  896   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  953

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TTPDPSANISL-DGVDVPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>gb|AAB59447.1| poly(ADP-ribose) synthetase [Homo sapiens]
Length=1014

 Score =   244 bits (624),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 220/777 (28%), Positives = 363/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  778

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  779   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVID  835

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  836   IFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  895

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  896   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  953

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TTPDPSANISL-DGVDVPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|NP_001609.2| poly [ADP-ribose] polymerase 1 [Homo sapiens]
 sp|P09874.4|PARP1_HUMAN RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Homo 
sapiens]
 gb|AAM75364.1|AF524947_1 ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase) [Homo 
sapiens]
 gb|AAA51663.1| NAD+ ADP-ribosyltransferase [Homo sapiens]
 gb|EAW69783.1| poly (ADP-ribose) polymerase family, member 1, isoform CRA_a 
[Homo sapiens]
 gb|EAW69784.1| poly (ADP-ribose) polymerase family, member 1, isoform CRA_a 
[Homo sapiens]
Length=1014

 Score =   244 bits (624),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 220/777 (28%), Positives = 363/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  778

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  779   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVID  835

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  836   IFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  895

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  896   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  953

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TTPDPSANISL-DGVDVPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>gb|AAA60137.1| poly(ADP-ribose) polymerase [Homo sapiens]
Length=1014

 Score =   244 bits (624),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 220/777 (28%), Positives = 363/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  778

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  779   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVID  835

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  836   IFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  895

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  896   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  953

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TTPDPSANISL-DGVDVPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_002809428.2| PREDICTED: poly [ADP-ribose] polymerase 1 [Pongo abelii]
Length=972

 Score =   244 bits (622),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 220/776 (28%), Positives = 362/776 (47%), Gaps = 68/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  215   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  273

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  274   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSAPVAATPPPSTA  332

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  333   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  392

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  393   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  451

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  452   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  511

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  512   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  570

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  571   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  622

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  623   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  681

Query  1437  EAGQQVEALWAEFSNKWFTLMP---STRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
              +  Q+     + SN+++TL+P     R   L + AD       + +++ DI  A  L+ 
Sbjct  682   SSDSQI----LDLSNRFYTLIPHDFGMRKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLR  737

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +I
Sbjct  738   GGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVIDI  794

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  795   FKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  854

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+ 
Sbjct  855   FADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  912

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  913   TPDPSASISL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  966



>ref|XP_004083528.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Oryzias latipes]
Length=1015

 Score =   244 bits (622),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 213/788 (27%), Positives = 369/788 (47%), Gaps = 83/788 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++ S   M+++L  N Q+    +  +V R  + M +G ++ C  C G L    G  Y+C 
Sbjct  252   KYCSTNDMKELLIANGQEVPSGESNVVDRVADGMAFGALEACNECQGQL-VFKGDAYYCT  310

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD---PKNRP--------  2443
             GD S W+ C + T  P RK+    IP+   + P     K K QD   PK  P        
Sbjct  311   GDISAWTKCVFKTATPLRKD--WIIPKEFHEVPFLKKFKFKRQDRVYPKEAPTQTLTTAK  368

Query  2442  ----------LKEQVI----TVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG  2305
                       LKEQ+       KPL+GM +   G+L++  +  K+++E+ GGK+  S   
Sbjct  369   AEPLASGSGALKEQLPEGAPADKPLTGMKLLAVGKLSKNKEELKAEVEEMGGKITGSANK  428

Query  2304  VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVD  2128
              +  + +  E E+ G  K+ E  + G+ VV E +L+D     K +Q L +    S   V+
Sbjct  429   ASLCLSTKKEVEKMGK-KMEEVRDAGVRVVSEDFLLDIKSSGKALQELVSLHAISTWGVE  487

Query  2127  GRGIPLDKQDPSAE----ALENITS---------------ELKVYGKRGVHKDTKLQDEG  2005
                + ++ Q P+A     AL   +S               +L V G   V  D+ L++  
Sbjct  488   ---VKVEPQAPAAASKSGALAAKSSGKVKEEEGGSKSKKMKLTVKGGAAVDPDSGLENSA  544

Query  2004  GKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKL  1828
               +LE+ G +Y+  L + D  RG N +  +QL+     + +  +R  GRVG T    +KL
Sbjct  545   -HVLEQSGKMYSATLGLVDIVRGTNSYYKLQLLEDDLQKRYWVFRSWGRVGTTIG-GNKL  602

Query  1827  EEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALR  1648
             +++ +++ A+  F  +++E TGNE+ S        K P KFYPL++  G +      A++
Sbjct  603   DKFHDKNSALDNFLSVYKEKTGNEWGSSN----FIKYPTKFYPLEIDYGQDEE----AVK  654

Query  1647  QLGIAA-VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTL  1471
             +L  +A   SKL   V   +K++   E  + A++E   D  ++P+G LS   ++     L
Sbjct  655   RLTASAGTKSKLPKPVQELIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYALL  714

Query  1470  LHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFES  1303
                 + +          EA   + SN+++TL+P      +P  L    D       + ++
Sbjct  715   TEVQQAVSDCVP-----EAQILDLSNRFYTLIPHDFGMKKPPLLNSL-DYIQAKVEMLDN  768

Query  1302  VRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRV  1123
             + DI  A  L+   +     DP+   Y KL   I  ++K + + ++I +Y++ T+     
Sbjct  769   LLDIEVAYSLLRGGAQDNEHDPIDINYEKLKTKIEVVDKSTQEAEVITQYVKNTHAATHN  828

Query  1122  GDISYGVSVENIFAV-EPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSL  946
                +Y + V+ IF +            ++L N+ LLW G+R++N    +  G   A    
Sbjct  829   ---TYTLEVQEIFKIGREGERQRFRPFEELHNRQLLWHGSRATNYAGIMSQGLRIAPPEA  885

Query  945   PVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLE  766
             PV GYMFGK +  +D  +++A Y  T+   P G ++LA  ++G  + E       TK L 
Sbjct  886   PVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLILLAEVALG-NMHELKKASHITK-LP  943

Query  765   QKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIR  586
             + K   K  GR   D S   V  D ++VP G+ ++ +  + S   YNEY VYD  Q++++
Sbjct  944   KGKHSVKGLGRTAPDPSAT-VTLDGVQVPLGKGVQTNIDDTSLL-YNEYIVYDVAQINLK  1001

Query  585   FLVAVKYD  562
             +L+ +K++
Sbjct  1002  YLLKIKFN  1009



>ref|XP_007670669.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ornithorhynchus anatinus]
Length=1002

 Score =   243 bits (621),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 222/778 (29%), Positives = 366/778 (47%), Gaps = 73/778 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  246   STNDLKELLIANKQAVPSGETAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  304

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD---------------PKNR  2446
             + W+ C   T+ P RKE    IP+  ++ P     K K QD               P   
Sbjct  305   TAWTKCVAKTQTPNRKE--WTIPKEFKEIPYLKKFKCKKQDRAFTPEASTPVIVPLPSTT  362

Query  2445  P----LKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
             P    L   V   KPLS M I   G+L+R  +  K+ IE+ GGK+  S    +  + +  
Sbjct  363   PAPPTLNSTVPADKPLSNMKILTLGKLSRNKEEMKATIEELGGKLTGSANKASLCISTQK  422

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIA  2134
             E E+  + K+ E  E G+ VV E +L D +   K +Q L      S           ++ 
Sbjct  423   EVEKM-NKKMEEVKEAGVRVVSEEFLKDVAASGKRLQELLTLHALSPWGAEVKQEHPEVP  481

Query  2133  VDGR-GIPLDKQDPSAEALENITSE------LKVYGKRGVHKDTKLQDEGGKILEKDGLL  1975
             + G+ G P+  +       E   S+      L V G   V  D+ L+D    + EK G +
Sbjct  482   LSGKSGGPVSTKSAGKIKEEEGASKSEKKMKLTVKGGAAVDPDSGLED-SAHVFEKGGKI  540

Query  1974  YNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDGAI  1798
             ++  L + D  RG N +  +QL+    E R  ++   GRVG T    +KLE+  +++ AI
Sbjct  541   FSATLGLVDIVRGTNSYYKLQLLEDDREIRYWVFRSWGRVG-TEIGSNKLEQMPSKEDAI  599

Query  1797  KEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-VHS  1621
             + F  ++EE TGN + S    K   K P KFYPL++  G +      A+++L ++A   S
Sbjct  600   EHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVSAGTKS  651

Query  1620  KLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRST  1441
             KL   V N +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  S 
Sbjct  652   KLPKPVQNLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQNAY-SILNEVQQAVS-  709

Query  1440  KEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRL  1273
              E G   + L  + SN+++TL+P      +P  L +  D       + +++ DI  A  L
Sbjct  710   -EGGSDSQIL--DLSNRFYTLIPHDFGMKKPPLLNNM-DCVQAKVEMLDNLLDIEVAYSL  765

Query  1272  IEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVE  1093
             +   S     DP+   Y KL   I  ++KDS++ ++I +Y++ T+        +Y + V 
Sbjct  766   LRGGSEDGDKDPIDVNYEKLKTDIKVVDKDSEEARIIREYVKNTHATTHN---AYDLQVV  822

Query  1092  NIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKA  916
             +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK 
Sbjct  823   DIFKIEREGESQRYKPFKQLHNRQLLWHGSRATNFAGILSQGLRIAPPEAPVTGYMFGKG  882

Query  915   IVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHG  736
             I  +D  +++A Y  T+   P G ++L   ++G  + E  +    +K L + K   K  G
Sbjct  883   IYFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKNASHISK-LPKGKHSVKGLG  940

Query  735   RKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             +   D S      D ++VP G  I  S  +++   YNEY VYD  QV++++L+ +K++
Sbjct  941   KTAPDPSASITL-DGVEVPLGTGI-SSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFN  996



>ref|XP_007986456.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Chlorocebus sabaeus]
Length=1014

 Score =   243 bits (621),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 217/776 (28%), Positives = 361/776 (47%), Gaps = 68/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMAFGALLPCKECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSAPVVATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAGNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTATKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDISASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DPSAEALENIT----SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P  ++   ++     ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APKGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPLD+  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLDIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKLIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAX-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMP---STRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
              +  Q+     + SN+++TL+P     +   L + AD       + +++ DI  A  L+ 
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNSADSVQAKVEMLDNLLDIEVAYSLLR  779

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  + +DS++ ++I KY++ T+        +Y + V +I
Sbjct  780   GGSDDSSKDPIDVNYEKLKTDIKVVGRDSEEAEIISKYVKNTHATTHN---AYDLEVIDI  836

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  837   FKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  896

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G +VL   ++G  + E       +K L + K   K  G+ 
Sbjct  897   FADMVSKSANYCHTSQGDPIGLIVLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  954

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  955   TPDPSASISL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_003814976.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Pan paniscus]
Length=1014

 Score =   243 bits (621),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 218/777 (28%), Positives = 362/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMMFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQTAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPVLNN-ADSVQAKVEMLDNLLDIEVAYSLL  778

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  779   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVID  835

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+  N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  836   IFKIEREGECQRYKPFKQFHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  895

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  896   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  953

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + +P G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TTPDPSANISL-DGVDIPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_007552911.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Poecilia formosa]
Length=1015

 Score =   243 bits (620),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 205/788 (26%), Positives = 366/788 (46%), Gaps = 83/788 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H SV  M+++L  N QD    +  ++    + M +G ++ C  C G L    G  Y+C 
Sbjct  252   KHCSVNDMKELLIANGQDVPSGESNVLDSLADGMAFGALECCKECKGQL-VFKGDLYYCS  310

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD---PKNRP--------  2443
             GD S W+ C + T+ P RK+    +P+   +       K K QD   PK  P        
Sbjct  311   GDISAWTKCVFKTKTPSRKD--FVVPKEFHEVSFLKKFKFKRQDRVYPKEAPAQTLKPAK  368

Query  2442  --------------LKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG  2305
                           L E   + KPL+GM +   G+L++     K+ +E+ GGK+  +   
Sbjct  369   AETLASASSAPSERLLEAAPSDKPLTGMKLLAVGKLSKNKDDLKAAVEELGGKITGTANK  428

Query  2304  VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVD  2128
              +  + S  E E+ G  K+ E  + G+ VV E +L D     K +Q L +    S    +
Sbjct  429   ASLCLSSKKEVEKMGK-KMEEVRDAGVRVVSEDFLTDVKSSGKALQELVSLHAISPWGAE  487

Query  2127  GRGIPLDKQDPSAEALENITS-------------------ELKVYGKRGVHKDTKLQDEG  2005
              +  P   Q P+A +     S                   +L V G   V  D+ L++  
Sbjct  488   VKAEP---QAPAATSKSGALSAKSTGRVKEEEGGSKAKKMKLTVKGGAAVDPDSGLENSA  544

Query  2004  GKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKL  1828
               +LE++G +Y+  L + D  RG N +  +QL+     + +  +R  GRVG T    +KL
Sbjct  545   -HVLEQNGKMYSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIG-GNKL  602

Query  1827  EEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALR  1648
             +++ +++ A+  F  +++E TGN++ +        K P+KFYPL++  G +      A++
Sbjct  603   DKFHDKNSALDNFLSVYKEKTGNDWGTSN----FTKYPNKFYPLEIDYGQDEE----AVK  654

Query  1647  QLGIAA-VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTL  1471
             +L  +A   SKLD  V + +K++   E  + A++E   D  ++P+G LS   ++     L
Sbjct  655   RLTASAGTKSKLDKPVQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYALL  714

Query  1470  LHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFES  1303
                 + +  +       EA   + SN+++TL+P      +P  L +  D       + ++
Sbjct  715   TEVQQAVSDSVP-----EAQILDLSNRFYTLIPHDFGMKKPPLLNNL-DYIQAKVEMLDN  768

Query  1302  VRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRV  1123
             + DI  A  L+   +     DP+   Y KL   I  ++K + + ++I++Y++ T+     
Sbjct  769   LLDIEVAYSLLRGGAQDNEHDPIDINYEKLKTKIEVIDKTTQEAEIIMQYVKNTHAATHN  828

Query  1122  GDISYGVSVENIFAV-EPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSL  946
                +Y + V++IF V            ++L N+ LLW G+R++N    L  G   A    
Sbjct  829   ---TYTLEVQDIFKVTREGEHQRYSPFEELHNRQLLWHGSRATNYAGILSQGLRIAPPEA  885

Query  945   PVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLE  766
             PV GYMFGK +  +D  +++A Y  T+   P G ++LA  ++G  + E       TK L 
Sbjct  886   PVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLILLAEVALG-NMHELKKASHITK-LP  943

Query  765   QKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIR  586
             + K   K  GR   D +      + ++VP G+ +  +  + S   YNEY VYD  Q++++
Sbjct  944   KGKHSVKGLGRTAPDPNASATL-NGVQVPLGKGVNTNIDDTSLL-YNEYIVYDVAQINLK  1001

Query  585   FLVAVKYD  562
             +L+ ++++
Sbjct  1002  YLLKIRFN  1009



>dbj|BAG64403.1| unnamed protein product [Homo sapiens]
Length=993

 Score =   243 bits (619),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 219/777 (28%), Positives = 362/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  236   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  294

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  295   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  353

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  354   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  413

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  414   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  472

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  473   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  532

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  533   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  591

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  592   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  643

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  644   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  702

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  703   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  757

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I  Y++ T+        +Y + V +
Sbjct  758   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRNYVKNTHATTHN---AYDLEVID  814

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  815   IFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  874

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  875   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  932

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  933   TTPDPSANISL-DGVDVPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  987



>ref|XP_009568032.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Cuculus canorus]
Length=969

 Score =   243 bits (619),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 217/781 (28%), Positives = 369/781 (47%), Gaps = 80/781 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD                  +
Sbjct  273   TAWTKCVSKTQAPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAATGNSVSPPSAS  330

Query  2448  RPLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E       KPL+ M I + G+L++  +  KS +E+ GGK+  +    T  + +  +
Sbjct  331   APLTETASAPRDKPLTNMKILVVGKLSKNKEEVKSIVEELGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + V+ E +L D     K  Q L +  V S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVISEEFLQDVKSSGKNFQELVSRHVLSTWDAEVKMEHEEMAV  449

Query  2130  DGRGIPLDKQDPSAEALENITSE-----------LKVYGKRGVHKDTKLQDEGGKILEKD  1984
             DG+      + PS ++   +  E           L V G   V  D+ L+D    + EK 
Sbjct  450   DGKS----SKPPSMKSAGKVKEEQGPSKSEKKMKLTVKGGAAVDPDSGLED-SAHVFEKG  504

Query  1983  GLLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENED  1807
             G +Y+  L + D  +G+N +  +QL+    ENR  ++   GRVG T    +KLE+  +++
Sbjct  505   GKIYSATLGLVDIVKGMNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKE  563

Query  1806  GAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-  1630
              A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A 
Sbjct  564   DAVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAG  615

Query  1629  VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERI  1450
               SKL   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++ 
Sbjct  616   TKSKLPKPVQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQA  674

Query  1449  RSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAA  1282
              S   +  Q+     + SN+++TL+P      +P  L +   I      + +++ DI  A
Sbjct  675   VSDSSSESQI----LDLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVA  729

Query  1281  SRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGV  1102
               L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y +
Sbjct  730   YSLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDL  786

Query  1101  SVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMF  925
              V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMF
Sbjct  787   KVVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMF  846

Query  924   GKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAK  745
             GK I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K
Sbjct  847   GKGIYFADMVSKSANYCHTSQADPIGLVLLGEVALG-NMCELKNASRITK-LPKGKHSVK  904

Query  744   FHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
               G+   D +      D ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K+
Sbjct  905   GLGKTAPDPTATIT-VDGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKF  962

Query  564   D  562
             +
Sbjct  963   N  963



>ref|XP_007905391.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Callorhinchus milii]
Length=1007

 Score =   242 bits (618),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 212/781 (27%), Positives = 365/781 (47%), Gaps = 80/781 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   M+++L  N Q+    +  I+ R  + M +G +  C  C G L   S   Y+C G+ 
Sbjct  252   STNDMKELLISNKQEVPSGESAILDRVSDGMAFGALQPCEECKGQLVFKSDA-YYCTGNI  310

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD--------PKNRP---LKE  2434
             + W+ C++S   P RK+    IP++  + P     K K QD        P + P   L E
Sbjct  311   TAWTKCTFSVHTPNRKD--WVIPKAFHEVPFLKKFKFKRQDRILGPSVQPTDTPSSTLTE  368

Query  2433  ----QVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAERER  2266
                   +  KPL+ M + L G++++     K+ +E+ GGK   +V   T  + S  E E+
Sbjct  369   ISPSSTLKDKPLTDMKVLLVGKMSKNKDEAKTLVEELGGKTTTTVNKATLCISSKREVEK  428

Query  2265  GGSSKVAEAVERGIPVVREAWLVDSIE--KKEVQPLDAYDVASDIAVDGRGIPLDKQDPS  2092
               S K+ E  E G+ VV    L D +E  K    PL    +   I+  G  +     +P 
Sbjct  429   M-SKKMEELKEAGVQVV----LCDILEDLKSGKAPLQELLLTHGISPWGAEVKAQPSNPQ  483

Query  2091  AEALENITS------------------------ELKVYGKRGVHKDTKLQDEGGKILEKD  1984
               A E  +                         +L V G   V  D+ L+D    + E++
Sbjct  484   PRAQEKPSRATTGKSSSAKVKHEEGSSKSEKKMKLTVKGGAAVDPDSGLED-STHVFEQN  542

Query  1983  GLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENED  1807
             G + +  L + D  RG N +  +QL+     R +  +R  GRVG T    +KLE+  +++
Sbjct  543   GKMLSATLGLVDISRGTNSYYKLQLLEDDNKRRYWVFRAWGRVGTTIG-GNKLEKMSSKE  601

Query  1806  GAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-  1630
              A++ F  ++EE TGN + S    K   K P+KFYPL++  G +      A+R+L  ++ 
Sbjct  602   EAVEHFLALYEEKTGNAWHS----KTFNKFPNKFYPLEIDYGQDEE----AVRKLTASSG  653

Query  1629  VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERI  1450
               SKLD  V + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V+++
Sbjct  654   TKSKLDRAVQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQV  712

Query  1449  RSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAA  1282
              S+  +  Q+     + SN+++TL+P      +P  L +  D       + +++ DI  A
Sbjct  713   VSSSGSESQI----LDLSNRFYTLIPHDFGMKKPALLNN-EDYIQAKVQMLDNLLDIEVA  767

Query  1281  SRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGV  1102
               L++        DP+   Y KL  +I  L+K +D+ K+I++Y++ T+         Y +
Sbjct  768   YSLLKGGKEDEGKDPIDINYEKLHTNIEVLDKTTDEAKIIMEYVKNTHAATHN---QYDL  824

Query  1101  SVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMF  925
              V  IF V                N+ LLW G+R++N    L  G   A    PV GYMF
Sbjct  825   EVVEIFKVRRDGEGQRFKPFSDFHNRQLLWHGSRATNYAGILSQGLRIAPPEAPVTGYMF  884

Query  924   GKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAK  745
             GK +  +D  +++A Y  T+   P G ++LA  ++G  + E       TK L + K   K
Sbjct  885   GKGVYFADMVSKSANYCHTSQADPVGLILLAEVALG-NMYELKRANHITK-LPKGKHSVK  942

Query  744   FHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
               G+   D +   +  D I+VP G+ + ++   +S   YNEY VYD  Q+++++L+ + +
Sbjct  943   GVGKTAPDPNAS-IKLDGIEVPLGKGV-QTPATDSSLLYNEYIVYDVAQINMKYLLKLNF  1000

Query  564   D  562
             +
Sbjct  1001  N  1001



>ref|XP_003999138.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Felis catus]
Length=1013

 Score =   242 bits (618),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 218/776 (28%), Positives = 364/776 (47%), Gaps = 69/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSD-AYYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRP---------------  2443
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P               
Sbjct  316   TAWTKCMVKTQTPSRKEW-VTPKEFREISYLKKLKIKKQDRIFPPETGAPAPAPPPSAAS  374

Query  2442  ----LKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
                 +     + KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  E
Sbjct  375   APTGVNSSAPSDKPLSNMKILTLGKLSRNKDEMKAMIEKLGGKLTGTASKASLCISTKKE  434

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
              E+  S K+ E  E G+ VV E +L D S     +Q L +  V +    D +  P++   
Sbjct  435   VEKM-SKKMEEVREAGVRVVSEDFLQDASASTSSLQDLLSAHVLAPWGADVKAEPVEAAA  493

Query  2097  PSAEALENITSELKVYGKR-GVHKD---TKLQDEGGK-------------ILEKDGLLYN  1969
             P  ++   +  + K   K  GV+K     KL  +GG              +LEK G +++
Sbjct  494   PKGKSGVALPKKSKGPAKEEGVNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFS  553

Query  1968  CALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKE  1792
               L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  ++DGAI+ 
Sbjct  554   ATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQVPSKDGAIEH  612

Query  1791  FSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSKL  1615
             F +++EE TGN +    + K   K P KFYPL++  G +      A+++L +     SKL
Sbjct  613   FMKLYEEKTGNAW----QAKTFTKFPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSKL  664

Query  1614  DPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKE  1435
                V + + ++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S   
Sbjct  665   PKPVQDLITMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILGEVQQAVSQGS  723

Query  1434  AGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
             +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+ 
Sbjct  724   SDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLLR  778

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  +++DS++ + I KY++ T+        +Y + V +I
Sbjct  779   GGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAETIRKYVKNTHATTHN---AYDLEVVDI  835

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  836   FKIEREGESQRYKPFKQLRNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  895

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+ 
Sbjct  896   FADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHAAHISK-LPKGKHSVKGLGKT  953

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TPDPSASITM-DGVEVPLGTGI-PSGVNDTCLLYNEYIVYDVAQVNLKYLLKLKFN  1007



>ref|XP_003462410.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Cavia porcellus]
Length=1011

 Score =   242 bits (617),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 218/775 (28%), Positives = 364/775 (47%), Gaps = 69/775 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMAFGALLPCKECSGQLVFRSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD-------------PKNRPLK  2437
             + W+ C   T+ P RKE  +   E  + + L  L  K QD             P +  L 
Sbjct  316   TAWTKCMVKTQTPSRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSTPLAVPPSSALP  374

Query  2436  EQVI-----TVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAER  2272
                +     T KPLS M + L G+L+R     K+++EK GGK+  S    +  + +  E 
Sbjct  375   PAAVNTSAPTDKPLSNMKVLLLGKLSRNKDEVKTEVEKLGGKLTGSASKASLCISTKKEV  434

Query  2271  ERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQ---------PLDAYDVASDIAVDG-  2125
             E+  S K+ E  E  + VV E +L D S   K +Q         P  A   A  + VD  
Sbjct  435   EKM-SKKMEEVKEANVRVVSEDFLQDVSASTKALQDLLIAHILSPWGAEVKAEPVEVDAP  493

Query  2124  ---RGIPLDKQDPSAEALENITSE----LKVYGKRGVHKDTKLQDEGGKILEKDGLLYNC  1966
                 G  L K+  S    E + SE    L + G   V  D+ L+     +LEK G +++ 
Sbjct  494   KGKSGTALPKKSKSTTKEEGVKSEKRMKLTLKGGAAVDPDSGLE-HSAHVLEKGGKVFSA  552

Query  1965  ALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKEF  1789
              L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ A++ F
Sbjct  553   TLGLVDIVKGTNSYYKLQLLEGDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAVEHF  611

Query  1788  SRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSKLD  1612
              +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SKL 
Sbjct  612   MKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSKLP  663

Query  1611  PMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEA  1432
               V   ++++   E  + A++E   D  ++P+G LS   ++     +L  V++  S   +
Sbjct  664   KPVQELIRMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-AILSEVQQALSQGSS  722

Query  1431  GQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLIED  1264
               Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+  
Sbjct  723   DSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLLRG  777

Query  1263  MSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIF  1084
              S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +IF
Sbjct  778   GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVIRKYVKNTHATTHN---AYDLEVVDIF  834

Query  1083  AV-EPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVC  907
              +            ++L N+ LLW G+R++N    L  G   A    PV GYMFGK I  
Sbjct  835   KIAREGESQRYKPFRQLHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYF  894

Query  906   SDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKK  727
             +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+  
Sbjct  895   ADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKTT  952

Query  726   TDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              D S     +  ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  953   PDPSASITLQ-GVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1005



>dbj|BAG35260.1| unnamed protein product [Homo sapiens]
Length=1014

 Score =   241 bits (616),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 219/777 (28%), Positives = 362/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +    +  
Sbjct  375   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCSSTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P +FYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKRFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  778

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  779   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVID  835

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  836   IFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  895

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  896   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  953

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TTPDPSANISL-DGVDVPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>gb|AAA60155.1| poly(ADP-ribose) polymerase [Homo sapiens]
Length=1014

 Score =   241 bits (616),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 218/777 (28%), Positives = 362/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
             +F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   QFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  778

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  779   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHS---AYDLEVID  835

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  836   IFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  895

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       ++ L + K   K  G+
Sbjct  896   YFADMVSKSANYYHTSQGDPIGLILLGEVALG-NMYELKHASHISR-LPKGKHSVKGLGK  953

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + VP G  I     + S   YNEY VYD  QV++++L+ +K++
Sbjct  954   TTPDPSANISL-DGVDVPLGTGISSGVIDTSLL-YNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_004271024.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Orcinus orca]
Length=1013

 Score =   241 bits (616),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 217/776 (28%), Positives = 367/776 (47%), Gaps = 69/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRP-------------LK  2437
             + W+ C   T+ P RKE  +   E  + + L  L  + QD    P               
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKIRKQDRIFPPETSAPLAAAPLPSAA  374

Query  2436  EQVITV------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
                 TV      KPLS M I   G+L+R     K+ IEK GGK+  +V   +  + S  E
Sbjct  375   SAPATVNSAPPDKPLSNMKILTLGKLSRNKDEVKATIEKLGGKLTGTVNKASLCISSKKE  434

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
              ++  + K+ E  E  + VV E +L D S   K +Q L +  + S    + +  P++   
Sbjct  435   VDKM-NKKMEEVKEANVRVVSEDFLQDISTSTKSLQELLSTHLLSPWGAEVKAEPVEAVA  493

Query  2097  PSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLYN  1969
             P  ++   ++ +    +K  G     K  KL  +GG              +LEK G +++
Sbjct  494   PKGKSGAVLSKKSKGPVKEEGTNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFS  553

Query  1968  CALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKE  1792
               L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+ 
Sbjct  554   ATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEEAIEH  612

Query  1791  FSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSKL  1615
             F++++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SKL
Sbjct  613   FTKLYEEKTGNAWHS----KNFTKHPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSKL  664

Query  1614  DPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKE  1435
                V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V+++ S   
Sbjct  665   PKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQVLSQGS  723

Query  1434  AGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
             +  Q+     + SN+++TL+P      +P  L + +D       + +++ DI  A  L+ 
Sbjct  724   SDSQI----LDLSNRFYTLIPHDFGMKKPPLLSN-SDSVQAKVEMLDNLLDIEVAYSLLR  778

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  ++KDS++ ++I KY++ T+        +Y + V +I
Sbjct  779   GGSDDSSKDPIDVNYEKLRTDIMVVDKDSEEAEIIRKYVKNTHATTHN---AYDLEVVDI  835

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  836   FKIEREGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  895

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+ 
Sbjct  896   FADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  953

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QVS+++L+ +K++
Sbjct  954   TPDPSASITM-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVSLKYLLKLKFN  1007



>ref|XP_003385071.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Amphimedon queenslandica]
Length=883

 Score =   240 bits (612),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 206/764 (27%), Positives = 366/764 (48%), Gaps = 58/764 (8%)
 Frame = -2

Query  2763  HLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKG  2584
             HL+  +++ +L  N Q     +  I+  C + M +G +  C  CGG L   +  +Y C G
Sbjct  143   HLTKGELKDLLDANGQAIPKGESCILDACADGMVFGSLGLCEECGGQLRVRTH-SYSCAG  201

Query  2583  DFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD-PKNRPLKEQVIT-----  2422
               S+W+ C+ +T    R++    IP+ +++    D +K ++  P+ R   E   T     
Sbjct  202   FISDWTKCTNTTTEAKRRK--WVIPKQLKEY---DFLKSYKYVPRTRVFPEAPPTPSPSV  256

Query  2421  --------------VKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVS  2284
                            KPLSG  I+ SGRL++T    K  I   GG+++++V   T L++S
Sbjct  257   GSIASSSSQQPIDPSKPLSGFKIASSGRLSKTKGELKKLIVSLGGEMSSTVNRNTTLLIS  316

Query  2283  -PAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPLD  2107
               AE E   S+ +  A    IPVV   +L D      +  + ++ ++S  A         
Sbjct  317   NEAEVEENSSTAICAASRYQIPVVDIEYLDDVASGDALGKVKSHTISSWTASPHLEGSNG  376

Query  2106  KQDPSAEALENI--TSELKVYGKRGVHKDTKLQDEGGKILEKDGLLYNCALSVCDQGRGL  1933
             +++  +   E +  T ++KV G   V  D+ L D    I E+ G  Y   L + D  +G 
Sbjct  377   REETDSAVFEKVPLTVKMKVKGGGVVDPDSGL-DSSHHIYEQSGEKYTAVLGLVDITKGT  435

Query  1932  NDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENE-DGAIKEFSRIFEELTGN  1759
             N +  +QL+ +   + +  +R  GRVG T    +KLE++  + D A+ EF R+++E TG 
Sbjct  436   NSYYKLQLLESDSGKSYYLFRAWGRVGTTIG-GNKLEDFGYDLDDALSEFLRLYQEKTGT  494

Query  1758  EFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAAVHSKLDPMVANFMKILC  1579
              +  R+  +K+   P KFYP+D+  G E    G +L   G A  +SKL P + + +K++ 
Sbjct  495   SWHIRKHARKV---PGKFYPIDIDYGEEE---GPSLSLSG-AGSNSKLAPEIQDLIKMIF  547

Query  1578  SQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKEAGQQVEALWAEF  1399
               +  + A+ME   D  ++P+G LS   +      L      +   K   + ++      
Sbjct  548   DIQKMKDAMMEFEIDMKKMPLGKLSKRQILSAYSVLNELQNELTGAKNPSRILDG-----  602

Query  1398  SNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLIE-DMSGSTLDDPL  1234
             SN+++TL+P      +P  L +  ++      + +++++I  A  L++ +  GS   DPL
Sbjct  603   SNRFYTLIPHDFGMAKPPLL-ETEEMIKSKILMLDNLKEIEIAYSLLKTEGEGSADKDPL  661

Query  1233  YDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENIFAVEPSA-CPS  1057
                Y KL  ++S L+K+S+++K +++Y+  T+         Y + V+ +F +E       
Sbjct  662   DIHYEKLKTNMSVLDKESEEFKRLVEYVANTHAATHN---QYQLEVQEVFNLERHGEKKR  718

Query  1056  LDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIVCSDAAAEAAKY  877
                  KL N++LLW G+R +N +  L  G   A    PV GYMFGK +  +D  +++A Y
Sbjct  719   YKPFSKLENRMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANY  778

Query  876   GFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRKKTDESEHFVWK  697
              +T+   P G ++L   ++G   M      +   SL   K   K  GR   D + ++V +
Sbjct  779   CWTSPQSPVGLMLLCEVALGN--MYEREHADYITSLPAGKHSTKGIGRTAPDPTSNYVSE  836

Query  696   DDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
                 +P G+    S  + S   YNEY VYD  Q+++++L+ + +
Sbjct  837   SGAIIPMGKGTTSSSRSTSLL-YNEYIVYDVAQINMKYLIKMNF  879



>ref|XP_003949754.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Pan troglodytes]
Length=1014

 Score =   241 bits (615),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 216/777 (28%), Positives = 362/777 (47%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMMFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DP---SAEALENIT-SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P   S  AL   +  ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQTAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPVLNN-ADSVQAKVEMLDNLLDIEVAYSLL  778

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  779   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVID  835

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E    C      K+  N+ L+W G+R++N    +  G   A    PV GYMFGK I
Sbjct  836   IFKIEREGECQRYKPXKQFHNRRLMWHGSRTTNFAGIMSKGLRIAPREAPVTGYMFGKGI  895

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  896   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  953

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S +    D + +P G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TTPDPSANISL-DGVDIPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_006871190.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Chrysochloris 
asiatica]
Length=1013

 Score =   241 bits (615),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 215/777 (28%), Positives = 367/777 (47%), Gaps = 71/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + + +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQEVPSGESAIMDRVADGIVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTP-LSDLIKKHQD-----PKNRPL--------  2440
             + W+ C   T+ P RKE     P+  Q+   L  L  K QD       N P+        
Sbjct  316   TAWTKCMVKTQTPNRKE--WVTPKEFQEISYLKKLKIKKQDRLFPPEANAPVAAALPPST  373

Query  2439  ------KEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                   +   +  KPLS M I   G+L+R  +  K+ IEK GGK+  +    +  + +  
Sbjct  374   ATAPATENSTLPGKPLSNMKILTLGKLSRNKEEMKAMIEKLGGKLTGTANKASVCISTKK  433

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L +  + S    + +  P +  
Sbjct  434   EVEKM-TKKMEEIKEANIRVVSEDFLQDVSGSNKSLQELFSVHILSPWGAEVKAEPDEAA  492

Query  2100  DPSAEALENI----TSELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P A++   +     + +K  G     K  KL  +GG              +LEK G ++
Sbjct  493   APRAKSGATLPKKSKTPIKEEGVNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  552

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  553   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  611

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  612   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  663

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  664   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQALSQS  722

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  723   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  777

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   +  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  778   RGGSDDSSKDPIDVNYEKLKTEMKVIDRDSEEAEIIRKYVKNTHATTHN---AYDLEVID  834

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E           ++L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  835   IFKIEREGENQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  894

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  895   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  952

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  953   TTPDPSASITL-DGVEVPLGTGI-SSGINDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1007



>ref|XP_003930339.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Saimiri boliviensis 
boliviensis]
Length=1013

 Score =   241 bits (615),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 216/780 (28%), Positives = 365/780 (47%), Gaps = 77/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMAFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE     P+  ++  +S L K     +NR    +           
Sbjct  316   TAWTKCMVKTQTPNRKE--WVTPKEFRE--ISYLKKLKVKKQNRIFPPETSAPVAAAPLP  371

Query  2418  ---------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVS  2284
                            KPLS M I   G+L+R     K+ +EK GGK+  +    +  + +
Sbjct  372   SAASKPAAVDSAPAGKPLSNMKILTLGKLSRNKDEMKAMVEKLGGKLTGTANKASLCIST  431

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASD-----------  2140
               E E+  + K+ E  E  + VV E +L D S   K +Q L +  + S            
Sbjct  432   KKEVEKM-NKKMEEVKEANVRVVSEDFLQDVSTSTKNLQELFSAHILSPWGAEVKAEPVE  490

Query  2139  -IAVDGR-GIPLDKQDPSAEALENITS-----ELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
              +A  G+ G PL K+       E I       +L + G   V  D+ L+     +LEK G
Sbjct  491   VVAPKGKSGAPLSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE-HSAHVLEKSG  549

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLEE  +++ 
Sbjct  550   KVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEEMPSKED  608

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAV  1627
             A++ F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +    
Sbjct  609   AVEHFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGT  660

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  
Sbjct  661   KSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAV  719

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             S   +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A 
Sbjct  720   SQGSSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAY  774

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   S  +  DP+   Y KL   +  +++DS++ ++I KY++ T+        +Y + 
Sbjct  775   SLLRGGSDDSSKDPIDVNYEKLKTDMKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLE  831

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  832   VVDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  891

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K 
Sbjct  892   KGIYFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKG  949

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  950   LGKTTPDPSASITL-DGVEVPLGIGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1007



>ref|XP_008396025.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Poecilia reticulata]
Length=1015

 Score =   241 bits (614),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 205/788 (26%), Positives = 366/788 (46%), Gaps = 83/788 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             +H SV  M+++L  N QD    +  ++    + M +G +D C  C G L    G  Y+C 
Sbjct  252   KHCSVNDMKELLIANGQDVPSGESNVLDSLADGMAFGALDSCNECKGQL-VFKGDLYYCS  310

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD---PKNRP--------  2443
             GD S W+ C + T+ P RK+    +P+   +       K K QD   PK  P        
Sbjct  311   GDISAWTKCVFKTKIPSRKD--FVVPKEFHEVSFLKKFKFKRQDRVYPKEAPAQTLKPAK  368

Query  2442  --------------LKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG  2305
                           L E   + KPL+GM +   G+L++     K+ +E+ GGK+  +   
Sbjct  369   AETLASASSAPSERLLEAAPSDKPLTGMKLLAVGKLSKNKDDLKAAVEELGGKITGTANK  428

Query  2304  VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVD  2128
              +  + S  E E+ G  K+ E  + G+ VV E +L D     K +Q L +    S    +
Sbjct  429   ASLCLSSKKEVEKMGK-KMEEVRDAGVRVVSEDFLSDIKSSGKALQELVSLHAISPWGAE  487

Query  2127  GRGIPLDKQDPSAEALENITS-------------------ELKVYGKRGVHKDTKLQDEG  2005
              +  P   Q P+A +     S                   +L V G   V  D+ L++  
Sbjct  488   VKAEP---QAPAATSKSGALSSKSTGRVKEEEGGSKAKKMKLTVKGGAAVDPDSGLENSA  544

Query  2004  GKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKL  1828
               +LE++G +Y+  L + D  RG N +  +QL+     + +  +R  GRVG T    +KL
Sbjct  545   -HVLEQNGKMYSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIG-GNKL  602

Query  1827  EEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALR  1648
             +++ +++ A+  F  +++E TGN++ +        K P+KFYPL++  G +      A++
Sbjct  603   DKFHDKNSALDNFLGVYKEKTGNDWGTSN----FTKYPNKFYPLEIDYGQDEE----AVK  654

Query  1647  QLGIAA-VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTL  1471
             +L  +A   SKLD  V + +K++   E  + A++E   D  ++P+G LS   ++     L
Sbjct  655   RLTASAGTKSKLDKPVQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYALL  714

Query  1470  LHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFES  1303
                 + +  +       EA   + SN+++TL+P      +P  L +  D       + ++
Sbjct  715   TEVQQAVSDSVP-----EAQILDLSNRFYTLIPHDFGMKKPPLLNNL-DYIQAKVEMLDN  768

Query  1302  VRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRV  1123
             + DI  A  L+   +     DP+   Y KL   I  ++K + + ++I++Y++ T+     
Sbjct  769   LLDIEVAYSLLRGGAQDNEHDPIDINYEKLKTKIEVVDKTTQEAEIIMQYVKNTHAATHN  828

Query  1122  GDISYGVSVENIFAV-EPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSL  946
                +Y + V++IF V            ++L N+ LLW G+R++N    L  G   A    
Sbjct  829   ---TYTLEVQDIFKVAREGEQQRYRPFEELHNQQLLWHGSRATNYAGILSQGLRIAPPEA  885

Query  945   PVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLE  766
             PV GYMFGK +  +D  +++A Y  T+   P G ++LA  ++G  + E       +K L 
Sbjct  886   PVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLILLAEVALG-NMHELKKASHISK-LP  943

Query  765   QKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIR  586
             + K   K  GR   D +      + ++VP G+ +  +  + S   YNEY VYD  Q++++
Sbjct  944   KGKHSVKGLGRTAPDPNASATL-NGVQVPLGKGVNTNIDDTSLL-YNEYIVYDVAQINLK  1001

Query  585   FLVAVKYD  562
             +L+ ++++
Sbjct  1002  YLLKIRFN  1009



>ref|XP_001090628.2| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Macaca mulatta]
Length=993

 Score =   240 bits (613),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 216/776 (28%), Positives = 361/776 (47%), Gaps = 68/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  236   STNDLKELLIFNKQQVPSGESAILDRVADGMAFGALLPCKECSGQLVFKSDA-YYCTGDV  294

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  295   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSAPVVATPPPSTA  353

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  354   SAPAAGNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  413

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  414   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  472

Query  2100  DPSAEALENIT----SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P  ++   ++     ++K  G     K  KL  +GG              +LEK G ++
Sbjct  473   APKGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  532

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  533   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  591

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  592   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  643

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  644   LPKPVQDLIKLIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  702

Query  1437  EAGQQVEALWAEFSNKWFTLMP---STRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
              +  Q+     + SN+++TL+P     +   L + AD       + +++ DI  A  L+ 
Sbjct  703   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNSADSVQAKVEMLDNLLDIEVAYSLLR  758

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  + +DS++ ++I KY++ T+        +Y + V +I
Sbjct  759   GGSDDSSKDPIDVNYEKLKTDIKVVGRDSEEAEIIRKYVKNTHATTHN---AYDLEVIDI  815

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  816   FKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  875

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G +VL   ++G  + E       +K L + K   K  G+ 
Sbjct  876   FADMVSKSANYCHTSQGDPIGLIVLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  933

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  934   TPDPSASISL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  987



>ref|XP_002760624.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Callithrix jacchus]
Length=1013

 Score =   240 bits (612),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 217/780 (28%), Positives = 365/780 (47%), Gaps = 77/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ +  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDQVADGMAFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE     P+  ++  +S L K     +NR    +           
Sbjct  316   TAWTKCMVKTQTPNRKE--WVTPKEFRE--ISYLKKLKVKKQNRIFPPETSAPVAAAPPP  371

Query  2418  ---------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVS  2284
                            KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +
Sbjct  372   STASKPAAVNSASAGKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCIST  431

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASD-----------  2140
               E E+  + K+ E  E  + VV E +L D S   K +Q L +  + S            
Sbjct  432   KKEVEKM-NKKMEEVKEANVRVVSEDFLQDVSTTTKSLQELFSAHILSPWGAEVKAEPVE  490

Query  2139  -IAVDGR-GIPLDKQDPSAEALENITS-----ELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
              +A  G+ G PL K+       E I       +L + G   V  D+ L+     +LEK G
Sbjct  491   VVAPKGKSGAPLSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE-HSAHVLEKSG  549

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ 
Sbjct  550   KVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKED  608

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAV  1627
             AI+ F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +    
Sbjct  609   AIEHFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGT  660

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  
Sbjct  661   KSKLPKAVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAV  719

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             S   +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A 
Sbjct  720   SQGSSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAY  774

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + 
Sbjct  775   SLLRGGSDDSSKDPIDVNYEKLRTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLE  831

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  832   VVDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  891

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K 
Sbjct  892   KGIYFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKG  949

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  950   LGKTTPDPSASITL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1007



>ref|XP_001090984.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 4 [Macaca mulatta]
Length=1014

 Score =   240 bits (612),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 216/776 (28%), Positives = 361/776 (47%), Gaps = 68/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMAFGALLPCKECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSAPVVATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAGNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DPSAEALENIT----SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P  ++   ++     ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APKGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKLIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMP---STRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
              +  Q+     + SN+++TL+P     +   L + AD       + +++ DI  A  L+ 
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNSADSVQAKVEMLDNLLDIEVAYSLLR  779

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  + +DS++ ++I KY++ T+        +Y + V +I
Sbjct  780   GGSDDSSKDPIDVNYEKLKTDIKVVGRDSEEAEIIRKYVKNTHATTHN---AYDLEVIDI  836

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  837   FKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  896

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G +VL   ++G  + E       +K L + K   K  G+ 
Sbjct  897   FADMVSKSANYCHTSQGDPIGLIVLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  954

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  955   TPDPSASISL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_010611507.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Fukomys damarensis]
Length=991

 Score =   240 bits (612),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 217/777 (28%), Positives = 363/777 (47%), Gaps = 71/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ +  + + +G +  C  C G L   S   Y+C GD 
Sbjct  235   STNDLKELLIFNKQQVPSGESAILDQVADGVAFGALLPCEECSGQLIFKSDA-YYCTGDV  293

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C+  T+ P RKE  +   E  + + L  L  K QD    P     +T        
Sbjct  294   TAWTKCTVKTQMPSRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSATVTTEPPLSLA  352

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I L G+L+R     K+ +EK GGK+  S    +  + +  
Sbjct  353   LTPAAVNSSALADKPLSNMKILLLGKLSRNKDEVKAAVEKLGGKLTGSASKASLCISTKK  412

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K  Q L    + S    + +  P++ +
Sbjct  413   EIEKM-TKKMEEVKEANIRVVSEDFLQDVSASTKAPQELFLAHILSPWGAEMKAEPVEVE  471

Query  2100  DPSAEA-------------LENITSE----LKVYGKRGVHKDTKLQDEGGKILEKDGLLY  1972
              P  ++              E I SE    L + G   V  D+ L+     +LEK G ++
Sbjct  472   APRGKSGAVLPKKSKATTKEEGIKSEKRMKLTLKGGAAVDPDSGLE-HSAHVLEKGGKVF  530

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  531   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  589

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F++++EE TGN + S    K   K P KFYPLD+  G +      A+++L I     SK
Sbjct  590   HFTKLYEEKTGNAWHS----KNFTKYPKKFYPLDIDYGQDEE----AVKKLTINPGTKSK  641

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V   ++++   E  + A++E   D  ++P+G LS   ++    T+L  V++  S  
Sbjct  642   LPKPVQELIRMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-TILSDVQQALSQG  700

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  701   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  755

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   +  ++KDS++ ++I KY++ T+        +Y + V +
Sbjct  756   RGGSDDSSKDPIDVNYEKLKTDMKVVDKDSEEAEIIRKYVKNTHATTHN---AYDLEVVD  812

Query  1089  IFAV-EPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +            K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  813   IFKIAREGESQRYKPFKQLHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  872

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E        K L + K   K  G+
Sbjct  873   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHINK-LPKGKHSVKGLGK  930

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S     +  ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  931   TTPDPSTSITLQ-GVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  985



>gb|EHH15492.1| hypothetical protein EGK_01593 [Macaca mulatta]
Length=1014

 Score =   240 bits (612),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 216/776 (28%), Positives = 361/776 (47%), Gaps = 68/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMAFGALLPCKECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSAPVVATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAGNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DPSAEALENIT----SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P  ++   ++     ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APKGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKLIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMP---STRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
              +  Q+     + SN+++TL+P     +   L + AD       + +++ DI  A  L+ 
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNSADSVQAKVEMLDNLLDIEVAYSLLR  779

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  + +DS++ ++I KY++ T+        +Y + V +I
Sbjct  780   GGSDDSSKDPIDVNYEKLKTDIKVVGRDSEEAEIIRKYVKNTHATTHN---AYDLEVIDI  836

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  837   FKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  896

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G +VL   ++G  + E       +K L + K   K  G+ 
Sbjct  897   FADMVSKSANYCHTSQGDPIGLIVLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  954

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  955   TPDPSASISL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_009504077.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Phalacrocorax 
carbo]
Length=836

 Score =   238 bits (607),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 217/780 (28%), Positives = 369/780 (47%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  81    STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  139

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQDPKNRPLKEQVITV------  2419
             + W+ C   T+ P RK+    IP+  ++ P     K K QD    P    V +V      
Sbjct  140   TAWTKCVAKTQTPKRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAATVNSVPPPSAS  197

Query  2418  ------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
                         KPL+ M I + G+L++  +  KS +E+ GGK+  +    T  + +  +
Sbjct  198   APLTETASAPRDKPLTNMKILVLGKLSKNKEEVKSIVEELGGKMTTTANKATLCISTQKD  257

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV EA+L D     K+ Q L +    S           ++AV
Sbjct  258   VEKM-SKKMEEVKEAKVRVVSEAFLQDVKSSSKDFQELVSLHALSPWGAEVKMEHEEMAV  316

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  317   DGKCSKPPSTKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  372

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  373   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  431

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             AI+ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L ++A  
Sbjct  432   AIEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVSAGT  483

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++     L    E  +
Sbjct  484   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSIL---NEAQQ  540

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             +  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  541   AVSDSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  597

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  598   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  654

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  655   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  714

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  715   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  772

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  773   LGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  830



>gb|KFO19690.1| Poly [ADP-ribose] polymerase 1 [Fukomys damarensis]
Length=1015

 Score =   239 bits (611),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 217/777 (28%), Positives = 363/777 (47%), Gaps = 71/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ +  + + +G +  C  C G L   S   Y+C GD 
Sbjct  259   STNDLKELLIFNKQQVPSGESAILDQVADGVAFGALLPCEECSGQLIFKSDA-YYCTGDV  317

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C+  T+ P RKE  +   E  + + L  L  K QD    P     +T        
Sbjct  318   TAWTKCTVKTQMPSRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSATVTTEPPLSLA  376

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I L G+L+R     K+ +EK GGK+  S    +  + +  
Sbjct  377   LTPAAVNSSALADKPLSNMKILLLGKLSRNKDEVKAAVEKLGGKLTGSASKASLCISTKK  436

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K  Q L    + S    + +  P++ +
Sbjct  437   EIEKM-TKKMEEVKEANIRVVSEDFLQDVSASTKAPQELFLAHILSPWGAEMKAEPVEVE  495

Query  2100  DPSAEA-------------LENITSE----LKVYGKRGVHKDTKLQDEGGKILEKDGLLY  1972
              P  ++              E I SE    L + G   V  D+ L+     +LEK G ++
Sbjct  496   APRGKSGAVLPKKSKATTKEEGIKSEKRMKLTLKGGAAVDPDSGLE-HSAHVLEKGGKVF  554

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  555   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  613

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F++++EE TGN + S    K   K P KFYPLD+  G +      A+++L I     SK
Sbjct  614   HFTKLYEEKTGNAWHS----KNFTKYPKKFYPLDIDYGQDEE----AVKKLTINPGTKSK  665

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V   ++++   E  + A++E   D  ++P+G LS   ++    T+L  V++  S  
Sbjct  666   LPKPVQELIRMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-TILSDVQQALSQG  724

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  725   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  779

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   +  ++KDS++ ++I KY++ T+        +Y + V +
Sbjct  780   RGGSDDSSKDPIDVNYEKLKTDMKVVDKDSEEAEIIRKYVKNTHATTHN---AYDLEVVD  836

Query  1089  IFAV-EPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +            K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  837   IFKIAREGESQRYKPFKQLHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  896

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E        K L + K   K  G+
Sbjct  897   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHINK-LPKGKHSVKGLGK  954

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S     +  ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  955   TTPDPSTSITLQ-GVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1009



>ref|XP_001638875.1| predicted protein [Nematostella vectensis]
 gb|EDO46812.1| predicted protein [Nematostella vectensis]
Length=968

 Score =   239 bits (610),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 211/787 (27%), Positives = 374/787 (48%), Gaps = 87/787 (11%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S+ ++R++L+DN  +  G + ++  RC + M +G +  C  C G +       YHC G+ 
Sbjct  207   SLSELREMLEDNEINPQGGETSVFDRCSDGMLFGRLLPCHECHGGMLVYRSDGYHCTGNV  266

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-------KHQDPKNRPLKEQVITV  2419
             S W+ C+++T++P R +    I + ++KT  +D +K       K   PK   ++    TV
Sbjct  267   SGWTKCAFTTQDPKRTK--WVISKELKKT--NDFLKTFKCKEMKRLFPKLTAIQPGASTV  322

Query  2418  --------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG-VTCLVVS  2284
                           KPLS MM+++ G+L RT     S + + GG   + V   V C + +
Sbjct  323   FFPMFLDSFLAIPGKPLSNMMVAVIGKLKRTKADVASCVAQLGGTTMDRVTSKVDCCIST  382

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQP------------LDAYDVASD  2140
              AE  +  S K+ +A +  IPVV E +L D+I+  E               + A D+   
Sbjct  383   QAEVSK-SSKKMKDAEKFNIPVVSEEFL-DAIKDGEFNSNIAKHSLVSWGKIKALDI---  437

Query  2139  IAVDGRGIPLDKQ--DPSAEALENITSELKVYGKRGVHKDTKLQDEGGK-----------  1999
               VDG  +PL ++  D   E  +   +   ++G+  + K  KL  +GG            
Sbjct  438   --VDGP-LPLRRKASDSKYELGKTQDNTTLIHGEDSLPKKVKLSVKGGAAVDPASEMEDD  494

Query  1998  --ILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPE-NRLHMYYRKGRVGDTARVDDKL  1828
               +LE  G++Y+  L + D  RG N +  +Q++   + +R +++   GRVG T     KL
Sbjct  495   CHVLEVKGVVYSATLGMVDISRGTNSYYKLQVLKKDKSSRCYLFRSWGRVGTTIG-GSKL  553

Query  1827  EEWEN-EDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLAL  1651
             E+  N  + A++ F  ++ E TGNE+  R+      K P++FYPL++  G    H  +  
Sbjct  554   EDCGNSHNSAVQSFEELYREKTGNEWSERDN---FVKHPNRFYPLEIDYG--QAHEDVVK  608

Query  1650  RQLGIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTL  1471
              ++ + +  SKL   +   +K++   E  +  L+E   D  ++P+G L+   +E+   ++
Sbjct  609   AKIEMGS-KSKLPSQIQELIKMIFDVESMKKTLIEFEIDLKKMPLGKLTKRQIEKAY-SV  666

Query  1470  LHFVERIRSTKEAGQQVEALWAEFSNKWFTLMP---STRPFYLRDFADIADHAASVFESV  1300
             L   ++I S  EA  +   L  + SN+++TL+P     R   L D  ++      + +++
Sbjct  667   LGEAQQILS--EAASKTAVL--DVSNRFYTLIPHDFGMRKPPLLDNQELIKTKIEMLDNL  722

Query  1299  RDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTY-DPVRV  1123
              DI  A  L++   G   +DP+   Y KL   I  L+  S ++ +I +Y+  T+ D  R 
Sbjct  723   IDIEVAFSLLQSSDGEDAEDPIDINYKKLKTDIEVLDHKSAEFGLISEYVSNTHADTHR-  781

Query  1122  GDISYGVSVENIFAVEPSACPSL-DDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSL  946
                 Y + + ++F ++     +L    K+L N+ LLW G+R++N    L  G   A    
Sbjct  782   ---QYELELLDVFKIKREGEEALFKPFKQLHNRQLLWHGSRTTNYAGILSQGLRIAPPEA  838

Query  945   PVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLE  766
             PV GYMFGK +  +D  +++A Y  T+     G L+L   ++G   M         K + 
Sbjct  839   PVTGYMFGKGVYFADMVSKSANYCCTSPSNNIGLLLLCEVALGN--MHELKHASFIKKVP  896

Query  765   QKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIR  586
             + K   K  G+   D S    ++D   VP G+       ++S   YNEY VYD  Q++++
Sbjct  897   KGKHSVKGLGKTAPDPSATHTFEDGTIVPKGKGCPAPVKDSSLL-YNEYIVYDTAQINMK  955

Query  585   FLVAVKY  565
             +L+  K+
Sbjct  956   YLLKTKF  962



>ref|XP_009684683.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Struthio camelus australis]
Length=969

 Score =   238 bits (607),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 219/780 (28%), Positives = 371/780 (48%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD                  +
Sbjct  273   TAWTKCVAKTQTPNRKD--WIIPKEFREIPYLKKFKCKKQDRVFPPEAATMNSVPPPSAS  330

Query  2448  RPLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E V T   KPL+ M I + G+L++  +  KS +E  GGK+  S    T  + +P +
Sbjct  331   APLTETVSTPRDKPLTNMKILVLGKLSKNKEEVKSIVEDLGGKMTGSANKATLCISTPKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  + K+ E  E  + VV E +L D     K  Q L +    S           +++V
Sbjct  391   IEKM-NKKMEEVKEAKVRVVSEEFLQDVKSSSKGFQELLSLHALSPWGAEVKMEHQEVSV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DGR          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGRCSKPSNTKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIFSATLGLVDIVKGTNSYYKLQLLEDDRESRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   +   +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  
Sbjct  617   KSKLAKPIQELIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQAV  675

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             S  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  676   S--DSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  730

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  731   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  787

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  788   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  847

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  848   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  905

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +      D + VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  906   LGKTAPDPTATTTL-DGVDVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>ref|XP_010380279.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Rhinopithecus roxellana]
Length=1014

 Score =   238 bits (608),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 215/776 (28%), Positives = 361/776 (47%), Gaps = 68/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ +  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNNQQVPSGESAILDQVADGMAFGALLPCKECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSAPVVATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SVPAAGNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +Q L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DPSAEALENIT----SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P  ++   ++     ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APKGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKLIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMP---STRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
              +  Q+     + SN+++TL+P     +   L + AD       + +++ DI  A  L+ 
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNSADSVQAKVEMLDNLLDIEVAYSLLR  779

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  + +DS++ ++I KY++ T+        +Y + V +I
Sbjct  780   GGSDDSSKDPIDVNYEKLKTDIKVVGRDSEEAEIIRKYVKNTHATTHN---AYDLEVIDI  836

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  837   FKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  896

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G +VL   ++G  + E       +K L + K   K  G+ 
Sbjct  897   FADMVSKSANYCHTSQGDPIGLIVLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  954

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  955   TPDPSASISL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_005541069.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Macaca fascicularis]
 gb|EHH50496.1| hypothetical protein EGM_01339 [Macaca fascicularis]
Length=1014

 Score =   238 bits (607),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 215/776 (28%), Positives = 360/776 (46%), Gaps = 68/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMAFGALLPCKECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKVKKQDRIFPPETSAPVVATPPPSTA  374

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  375   SAPAAGNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   K +  L    + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVKEANIRVVSEDFLQDVSASTKSLHELFLAHILSPWGAEVKAEPVEVV  493

Query  2100  DPSAEALENIT----SELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P  ++   ++     ++K  G     K  KL  +GG              +LEK G ++
Sbjct  494   APKGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  553

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  554   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  612

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  613   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  664

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  665   LPKPVQDLIKLIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  723

Query  1437  EAGQQVEALWAEFSNKWFTLMP---STRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
              +  Q+     + SN+++TL+P     +   L + AD       + +++ DI  A  L+ 
Sbjct  724   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNSADSVQAKVEMLDNLLDIEVAYSLLR  779

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  + +DS++ ++I KY++ T+        +Y + V +I
Sbjct  780   GGSDDSSKDPIDVNYEKLKTDIKVVGRDSEEAEIIRKYVKNTHATTHN---AYDLEVIDI  836

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E    C      K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  837   FKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  896

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G +VL   ++G  + E       +K L + K   K  G+ 
Sbjct  897   FADMVSKSANYCHTSQGDPIGLIVLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  954

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  955   TPDPSASISL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>gb|KFW91620.1| Poly [ADP-ribose] polymerase 1, partial [Phalacrocorax carbo]
Length=811

 Score =   236 bits (601),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 217/786 (28%), Positives = 370/786 (47%), Gaps = 84/786 (11%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  50    STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  108

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD                  +
Sbjct  109   TAWTKCVAKTQTPKRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAATVNSVPPPSAS  166

Query  2448  RPLKEQ--------VITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCL  2293
              PL E         +   KPL+ M I + G+L++  +  KS +E+ GGK+  +    T  
Sbjct  167   APLTETASAPRGKWLAGYKPLTNMKILVLGKLSKNKEEVKSIVEELGGKMTTTANKATLC  226

Query  2292  VVSPAERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS---------  2143
             + +  + E+  S K+ E  E  + VV EA+L D     K+ Q L +    S         
Sbjct  227   ISTQKDVEKM-SKKMEEVKEAKVRVVSEAFLQDVKSSSKDFQELVSLHALSPWGAEVKME  285

Query  2142  --DIAVDGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGK  1999
               ++AVDG+          G   ++Q PS    +    +L V G   V  D+ L+D    
Sbjct  286   HEEMAVDGKCSKPPSTKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAH  341

Query  1998  ILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEE  1822
             + EK G +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+
Sbjct  342   VFEKGGKIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQ  400

Query  1821  WENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQL  1642
               +++ AI+ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L
Sbjct  401   MPSKEDAIEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKL  452

Query  1641  GIAA-VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLH  1465
              ++A   SKL   + + +K++   E  + A++E   D  ++P+G LS   ++     L  
Sbjct  453   TVSAGTKSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSIL--  510

Query  1464  FVERIRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVR  1297
               E  ++  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ 
Sbjct  511   -NEAQQAVSDSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLL  566

Query  1296  DINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGD  1117
             DI  A  L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+       
Sbjct  567   DIEVAYSLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN--  624

Query  1116  ISYGVSVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPV  940
              +Y + V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV
Sbjct  625   -AYDLKVVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPV  683

Query  939   PGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQK  760
              GYMFGK I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + 
Sbjct  684   TGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKG  741

Query  759   KLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFL  580
             K   K  G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L
Sbjct  742   KHSVKGLGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYL  799

Query  579   VAVKYD  562
             + +K++
Sbjct  800   LKLKFN  805



>ref|XP_010007824.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nestor notabilis]
Length=969

 Score =   237 bits (605),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 217/780 (28%), Positives = 367/780 (47%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD                  +
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDTTTANSVPPPSAS  330

Query  2448  RPLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E V     KPL+ M I + G+L++  +  KS +E  GGK+  +    T  + +  +
Sbjct  331   APLSETVSAPRDKPLTNMKILVLGKLSKNKEEVKSIVEDLGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEEFLQDVKSSSKDFQELVSLHALSPWGAEVKMEHEEMAV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGKCSKPSSVKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +Y+  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIYSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++     L    E  +
Sbjct  617   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSIL---SEAQQ  673

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             +  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  674   AVSDSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  730

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  731   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  787

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  788   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  847

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  848   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  905

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  906   LGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>ref|XP_006157311.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Tupaia chinensis]
Length=1014

 Score =   237 bits (605),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 212/778 (27%), Positives = 361/778 (46%), Gaps = 72/778 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKE---------------------EPLRIPESVQKTPLSDLIKKHQ  2461
             + W+ C   T+ P RKE                     E +  PES    P++       
Sbjct  316   TAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQERIFPPES--SAPVAAAPPSST  373

Query  2460  DPKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSP  2281
                   +       KPLS M I   G+L+R     K+ +EK GGK+  +    +  + + 
Sbjct  374   ASAPAAVNSSAPADKPLSNMKILTLGKLSRNKDEVKALVEKLGGKLTGTANKASLCISTK  433

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDK  2104
              E E+  + K+ E  E  I VV E +L D S   K +Q L +  + S    + +  P++ 
Sbjct  434   KEVEKM-NKKMEEVKEANIRVVSEDFLQDISASTKSLQELFSVHILSPWGAEVKAEPVEA  492

Query  2103  QDPSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLL  1975
               P  ++   ++ +    +K  G     K  KL  +GG              +LEK G +
Sbjct  493   VAPRGKSGAALSKKSKGPIKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKV  552

Query  1974  YNCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAI  1798
             ++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI
Sbjct  553   FSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAI  611

Query  1797  KEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHS  1621
             + F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     S
Sbjct  612   EHFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKS  663

Query  1620  KLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRST  1441
             KL   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S 
Sbjct  664   KLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQ  722

Query  1440  KEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRL  1273
               +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L
Sbjct  723   GSSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSL  777

Query  1272  IEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVE  1093
             +   S  +  DP+   Y KL   I  ++KDS++ ++I KY++ T+        +Y + V 
Sbjct  778   LRGGSDDSNKDPIDVNYEKLKTDIKVVDKDSEEAEIIRKYVKNTHATTHN---AYDLEVV  834

Query  1092  NIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKA  916
             +IF +E           ++L N+ LLW G+R++N    L  G   A    PV GYMFGK 
Sbjct  835   DIFKIEREGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKG  894

Query  915   IVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHG  736
             I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G
Sbjct  895   IYFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLG  952

Query  735   RKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             +   D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  953   KTTPDPSASITL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_009581523.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Fulmarus glacialis]
Length=969

 Score =   237 bits (604),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 215/780 (28%), Positives = 368/780 (47%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD                  +
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAATVNSVPPPSAS  330

Query  2448  RPLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E V     KPL+ M I + G+L++  +  KS +E+ GGK+  +    T  + +  +
Sbjct  331   APLTETVSAPRDKPLTNMKILVLGKLSKNKEEVKSIVEELGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEEFLQDVKSSSKDFQELVSLHALSPWGAEVKMEHEEMAV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGKCSKPPSMKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++        F   ++
Sbjct  617   KSKLPKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSI---FSSLVQ  673

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             +  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  674   AVSDSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  730

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  731   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  787

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  788   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  847

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  848   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  905

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  906   LGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>ref|XP_010732988.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Larimichthys crocea]
Length=1014

 Score =   237 bits (605),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 213/791 (27%), Positives = 363/791 (46%), Gaps = 89/791 (11%)
 Frame = -2

Query  2766  EHLSVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCK  2587
             ++ S   M+++L  N Q+    +  +V    + M +G ++ C  C G L    G  Y+C 
Sbjct  251   KYCSTNDMKELLIANGQEVPSGESNVVDSLADGMAFGALEACKECKGQL-VFKGDAYYCT  309

Query  2586  GDFSEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD---PKNRP--------  2443
             GD S W+ C + T  P RK+    IP+   + P     K K QD   PK  P        
Sbjct  310   GDISAWTKCVFKTATPVRKD--WVIPKEFHEVPFLKKFKFKAQDRVYPKEAPTQTLTAAK  367

Query  2442  --------------LKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIG  2305
                           L E     KPL+GM +   G+L++     K+ +E+ GGK+  +   
Sbjct  368   AEPLASASSAPMERLPEGAPADKPLTGMKLLAVGKLSKNKDDLKAAVEEMGGKITGTANK  427

Query  2304  VTCLVVSPAERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVD  2128
              +  + +  E E+  S K+ E  + G+ VV E +L D     K +Q L +      I+  
Sbjct  428   ASVCLSTKKEVEKM-SKKMEEVRDAGVRVVSEDFLTDIKSSGKALQELVSLHA---ISPW  483

Query  2127  GRGIPLDKQDPSAEALENITS-------------------ELKVYGKRGVHKDTKLQDEG  2005
             G  + ++ Q P+A +     +                   +L V G   V  D+ L++  
Sbjct  484   GAEVKVESQAPAAASKSGAMAAKSTGRVKEEEGGSKTKKMKLTVKGGAAVDPDSGLEN-S  542

Query  2004  GKILEKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKL  1828
               +LE+ G +Y+  L + D  RG N +  +QL+     + +  +R  GRVG T    +KL
Sbjct  543   AHVLEQSGKMYSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIG-GNKL  601

Query  1827  EEWENEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALR  1648
             +++ +++ A+  F  +++E TGN + +        K P+KFYPL++  G +      A++
Sbjct  602   DKFHDKNSAMDNFLAVYKEKTGNNWGASN----FTKYPNKFYPLEIDYGQDEE----AVK  653

Query  1647  QL-GIAAVHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTL  1471
             +L   A   SKL   V   +K +   E  + A++E   D  ++P+G LS   ++     L
Sbjct  654   RLTATAGTKSKLAKPVQELIKTIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-AL  712

Query  1470  LHFVERIRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFES  1303
             L  V++  S      QV     + SN+++TL+P      +P  L +  D       + ++
Sbjct  713   LTEVQQAVSDCLPESQV----LDLSNRFYTLIPHDFGMKKPPLLNNL-DYIQAKVQMLDN  767

Query  1302  VRDINAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRV  1123
             + DI  A  L+   +    +DP+   Y KL   I  ++K +++ ++IL+Y++ T+     
Sbjct  768   LLDIEVAYSLLRGGAQDNENDPIDINYEKLKTKIEVVDKTTEEAQVILQYVKNTHAATHN  827

Query  1122  GDISYGVSVENIFA-VEPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSL  946
                +Y + V+ IF  V           ++L N+ LLW G+R++N    L  G   A    
Sbjct  828   ---TYTLEVQEIFKIVREGERQRYRPFEELHNRQLLWHGSRTTNYAGILSQGLRIAPPEA  884

Query  945   PVPGYMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLE  766
             PV GYMFGK +  +D  +++A Y  T+   P G L+LA  ++G  + E       TK L 
Sbjct  885   PVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLLLLAEVALG-NMHELKKASHITK-LP  942

Query  765   QKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNN---SPFDYNEYAVYDPQQV  595
             + K   K  GR   D S   V  D ++VP G+      H N   +   YNEY VYD  QV
Sbjct  943   KGKHSVKGVGRTAPDPSAA-VTLDGVQVPLGK----GAHTNIDDTSLLYNEYIVYDVAQV  997

Query  594   SIRFLVAVKYD  562
             ++++L+ +K++
Sbjct  998   NMKYLLKIKFN  1008



>ref|XP_010391791.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Corvus cornix cornix]
Length=969

 Score =   237 bits (604),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 217/784 (28%), Positives = 370/784 (47%), Gaps = 86/784 (11%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQDPKNRPLKEQVITV------  2419
             + W+ C   T+ P RK+    IP+  ++ P     K K QD   R      +TV      
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQD---RIFPPDAVTVSSAPPP  327

Query  2418  ---------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVS  2284
                            KPL+ M I + G+L++  +  KS +E  GGK+  +    T  + +
Sbjct  328   SASAPLSETVSAPRDKPLTNMKILVVGKLSKNKEEVKSIVEDLGGKMTTTANKATLCIST  387

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------D  2140
               + E+  S K+ E  E  + VV EA+L D     K  Q L +    S           +
Sbjct  388   QKDVEKM-SKKMEEVKEAKVRVVSEAFLQDVKSSSKAFQELVSLHALSPWGAEVKMEHEE  446

Query  2139  IAVDGRGIPLDKQDPSAEALENITSE-----------LKVYGKRGVHKDTKLQDEGGKIL  1993
             +AVDG+      + PS ++   +  E           L V G   V  D+ L+D    + 
Sbjct  447   MAVDGKS----SKPPSTKSTGKVKEEQGPSKSEKKMKLTVKGGAAVDPDSGLED-SAHVF  501

Query  1992  EKDGLLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWE  1816
             EK G +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  
Sbjct  502   EKGGKIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMP  560

Query  1815  NEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI  1636
             +++ AI++F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L +
Sbjct  561   SKEDAIEQFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTV  612

Query  1635  AA-VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFV  1459
              A   SKL   + + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V
Sbjct  613   GAGTKSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEV  671

Query  1458  ERIRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDI  1291
             ++  S  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI
Sbjct  672   QQAVS--DSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDI  726

Query  1290  NAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDIS  1111
               A  L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +
Sbjct  727   EVAYSLLRGGNEDGDKDPIDINYEKLKTDIKVVDKDSEEAKIIKQYVKNTHAATHN---A  783

Query  1110  YGVSVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPG  934
             Y + V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV G
Sbjct  784   YDLKVVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTG  843

Query  933   YMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKL  754
             YMFGK I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K 
Sbjct  844   YMFGKGIYFADMVSKSANYCHTSQADPIGLVLLGEVALG-NMYELKNASHITK-LPKGKH  901

Query  753   GAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVA  574
               K  G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ 
Sbjct  902   SVKGLGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLK  959

Query  573   VKYD  562
             +K++
Sbjct  960   LKFN  963



>ref|XP_006198888.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Vicugna pacos]
Length=1018

 Score =   237 bits (605),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 216/777 (28%), Positives = 364/777 (47%), Gaps = 71/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  262   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  320

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQDPKNRP-------------L  2440
             + W+ C   T+ P RK+    IP+  ++      +K K QD    P              
Sbjct  321   TAWTKCMVKTQMPKRKD--WVIPKEFREISCFKKLKIKRQDRIFPPETSAPVAAAPPPSA  378

Query  2439  KEQVITV------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                  TV      KPL+ M I   G+L+R     K+ IEK GGK+  +    +  V +  
Sbjct  379   ASAPATVNSAPPDKPLANMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCVSTKK  438

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E ++  + K+ E  E  IPVV E +L D S   K +Q L +  + S    + +  P++  
Sbjct  439   EVDKM-NKKMEEVKEANIPVVSEDFLQDVSASTKSLQELLSTHILSPWGAEVKAEPVEAV  497

Query  2100  DPSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P  ++   ++ +    +K  G     K  KL  +GG              +LEK G ++
Sbjct  498   APRGKSGAGLSKKSKGPVKEEGPNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  557

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  558   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  616

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  617   NFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  668

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  669   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  727

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  728   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  782

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  ++KDS++ + I KY++ T+        +Y + V +
Sbjct  783   RGGSDDSSKDPIDVNYEKLKTDIKVVDKDSEEAETIRKYVKNTHATTHN---AYDLEVID  839

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  840   IFKIEREGETQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  899

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  900   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  957

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S      D + VP G  I  S  +++   YNEY VYD  QV++++L+ +K++
Sbjct  958   TTPDPSASITM-DGVDVPLGTGI-PSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1012



>ref|XP_007935170.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Orycteropus afer afer]
Length=1016

 Score =   237 bits (605),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 214/778 (28%), Positives = 364/778 (47%), Gaps = 71/778 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  258   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSNA-YYCTGDV  316

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  317   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKIKKQDRLFPPETSAPVAAAAAPPST  375

Query  2418  --------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSP  2281
                           KPLS M I   G+L+R  +  K+ IEK GGK+  +    +  + + 
Sbjct  376   AVAPATENSSAPADKPLSNMKIMTLGKLSRNKEEMKAMIEKLGGKLTGTANKASVCISTK  435

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDK  2104
              E E+  + K+ E  E  I VV E +L D S   K +Q L +  + S    + +  P++ 
Sbjct  436   KEVEKM-TKKMEEVKEANIRVVSEDFLQDVSGSTKSLQELLSVHILSPWGAEVKTEPVET  494

Query  2103  QDPSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLL  1975
               P A++   +  +    +K  G     K  KL  +GG              +LEK G +
Sbjct  495   VAPKAKSGAALPKKSKAPIKEEGNNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKV  554

Query  1974  YNCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAI  1798
             ++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI
Sbjct  555   FSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEEAI  613

Query  1797  KEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHS  1621
             + F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     S
Sbjct  614   EHFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKS  665

Query  1620  KLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRST  1441
             +L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S 
Sbjct  666   RLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQ  724

Query  1440  KEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRL  1273
               +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L
Sbjct  725   GSSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSL  779

Query  1272  IEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVE  1093
             +   S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V 
Sbjct  780   LRGGSEDSSKDPIDVNYEKLKTEIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVI  836

Query  1092  NIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKA  916
             +IF +E           ++L N+ LLW G+R++N    L  G   A    PV GYMFGK 
Sbjct  837   DIFKIEREGENQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKG  896

Query  915   IVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHG  736
             I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G
Sbjct  897   IYFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLG  954

Query  735   RKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             +   D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  955   KTTPDPSASITL-DGVEVPLGTGI-SSGINDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1010



>ref|XP_005289623.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Chrysemys 
picta bellii]
Length=969

 Score =   236 bits (603),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 217/777 (28%), Positives = 366/777 (47%), Gaps = 72/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGESAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RKE    IP+  ++       K K QD                  +
Sbjct  273   TAWTKCVAKTQTPNRKE--WIIPKEFREISYLKKFKCKKQDRAFPPEAVAVNAVLPAAAS  330

Query  2448  RPLKEQ--VITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E+  V   KPLS M I   G+L+R  +  K+ IE  GGKV  +    T  + +  E
Sbjct  331   APLTEKASVPADKPLSSMKILTLGKLSRNKEEVKAMIEDLGGKVTGTANKATLCISTQKE  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  + K+ E  E  + VV E +L D    +K  Q L +    S           + ++
Sbjct  391   VEKM-TKKMEEVKEAKVRVVSEEFLQDVKSSRKGFQELLSLHALSPWGAEVKQEHTETSL  449

Query  2130  DGR--GIPLDKQDPSAEALENITS-----ELKVYGKRGVHKDTKLQDEGGKILEKDGLLY  1972
              G+  G+P  K     +  +  +      +L V G   V  D+ L+D    + EK G ++
Sbjct  450   GGKSSGLPNMKSAGKVKEEQGTSKSEKKMKLTVKGGAAVDPDSGLED-SAHVFEKSGKIF  508

Query  1971  NCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  RG N +  +QL+    E R  ++   GRVG TA   +KLE+  ++D AI+
Sbjct  509   SATLGLVDIVRGTNSYYKLQLLEDDREIRYWVFRSWGRVG-TAIGSNKLEQMPSKDDAIE  567

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-VHSK  1618
              F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L ++A   SK
Sbjct  568   HFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVSAGTKSK  619

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  S  
Sbjct  620   LPKPVQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQAVSDG  678

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L +  D       + +++ DI  A  L+
Sbjct  679   GSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNNL-DHIQAKVEMLDNLLDIEVAYSLL  733

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                +     DP+   Y KL  +I  ++KDS++ K+I +Y++ T+        +Y + V +
Sbjct  734   RGGNEDGDKDPIDINYEKLKTNIKVIDKDSEEAKIIKQYVKNTHASTHN---AYDLKVVD  790

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E           ++L N+ LLW G+R++N       G   A    PV GYMFGK I
Sbjct  791   IFKIEREGENQRYKPFRQLHNRQLLWHGSRATNFAGIFSQGLRIAPPEAPVTGYMFGKGI  850

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K  G+
Sbjct  851   YFADMVSKSANYCHTSQTDPIGLILLGEVALG-NMHELKNASHITK-LPKGKHSVKGLGK  908

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D +      D + +P G  I  S  +++   YNEY VYD  QV++++L+ +K++
Sbjct  909   TAPDPTATITL-DGVDIPLGNGI-PSGVSDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>ref|XP_005404552.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Chinchilla lanigera]
Length=1013

 Score =   237 bits (605),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 214/777 (28%), Positives = 367/777 (47%), Gaps = 71/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + + +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGVAFGALLPCEECSGQLVFRSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD---------------PKNRP  2443
             + W+ C   T+ P RKE  +   E  + + L  L  K QD               P +  
Sbjct  316   TAWTKCMVKTQTPRRKEW-VTPKEFREISYLKKLKVKKQDRIFPPEASAPVAMAPPASSS  374

Query  2442  LKEQVITV-----KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
             LK   ++      KPLS M I L G+L+      K+++EK GGK+  S    +  + +  
Sbjct  375   LKPAAVSSSATADKPLSNMKILLLGKLSCNKDEMKAKVEKLGGKLTGSANKASLCISTKK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  S K+ E  E  + VV E +L D S   + +Q L +  + S    + +  P++ +
Sbjct  435   EVEKM-SKKMEEVKEANVRVVSEDFLQDVSTATRALQELFSEHILSPWGAEVKAEPVEVE  493

Query  2100  DPSAEA-------------LENITSE----LKVYGKRGVHKDTKLQDEGGKILEKDGLLY  1972
              P  ++              E I SE    L + G   V  D+ L+     +LEK G ++
Sbjct  494   APKGKSGTVLPKKSKGAPKEEGIKSEKRMKLTLKGGAAVDPDSGLE-HSAHVLEKGGKVF  552

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  553   SATLGLVDIIKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIE  611

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSK  1618
              F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SK
Sbjct  612   HFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSK  663

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V   ++++   E  + A++E   D  ++P+G LS   ++    T+L  V++  S  
Sbjct  664   LPKPVQELIRMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-TILSEVQQALSQD  722

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  723   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSLL  777

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +
Sbjct  778   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVVD  834

Query  1089  IFAV-EPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +            ++L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  835   IFKIAREGESQRYKPFRQLHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  894

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  895   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  952

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S     +  ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  953   TTPDSSASITLQ-GVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1007



>gb|EFB29647.1| hypothetical protein PANDA_016433 [Ailuropoda melanoleuca]
Length=981

 Score =   237 bits (604),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 216/780 (28%), Positives = 360/780 (46%), Gaps = 73/780 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  221   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  279

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RK+  +   E  + + L  L  K QD    P     +         
Sbjct  280   TAWTKCMIKTQTPSRKDW-VTPKEFREISYLKKLKIKRQDRIFPPETSAPVAAVALPSTA  338

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  339   SAPAAVNSSTPPDKPLSSMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  398

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  S K+ E  E GI VV E +L D S     +Q L A  V +    + +  P++  
Sbjct  399   EVEKM-SKKMEEVREAGIRVVSEDFLRDLSDSTGSLQDLLAAHVLAPWGAEVKAEPVEPT  457

Query  2100  DPSA-------------------EALENITSELKVYGKRG--VHKDTKLQDEGGKILEKD  1984
             +P+A                   E +      +K+  K G  V  D+ L+     +LEK 
Sbjct  458   EPAAPKAKSGAALSKKSKGPAKEEGINKSEKRMKLTLKGGAAVDPDSGLE-HSAHVLEKG  516

Query  1983  GLLYNCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENED  1807
             G +++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE   +++
Sbjct  517   GKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLERVPSKE  575

Query  1806  GAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AA  1630
              AI+ F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +   
Sbjct  576   DAIEHFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPG  627

Query  1629  VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERI  1450
               SKL   V   +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++ 
Sbjct  628   TKSKLPKPVQELIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQA  686

Query  1449  RSTKEAGQQVEALWAEFSNKWFTLMP---STRPFYLRDFADIADHAASVFESVRDINAAS  1279
              S   +  Q+     + SN+++TL+P     R   L + AD       + +++ DI  A 
Sbjct  687   VSQGSSDSQI----LDLSNRFYTLIPHDFGMRKPPLLNNADCVQAKVEMLDNLLDIEVAY  742

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   S  +  DP+   Y KL   I  +++DS++ + I KY++ T+        +Y + 
Sbjct  743   SLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAETIRKYVKNTHATTHN---AYDLE  799

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           ++L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  800   VVDIFKIEREGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  859

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K 
Sbjct  860   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKG  917

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D S      D ++VP G  I  S  N++   YNEY VYD  QV++R+L+ ++++
Sbjct  918   LGKTTPDPSASITM-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLRYLLKLRFN  975



>gb|AAI00002.1| Poly (ADP-ribose) polymerase family, member 1 [Danio rerio]
Length=1011

 Score =   237 bits (604),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 206/784 (26%), Positives = 361/784 (46%), Gaps = 79/784 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S+  M+++L  N+Q+    +  IV R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  249   SINDMKELLIANSQEVPSGESNIVDRLSDCMAFGSLKPCETCKGQLVFKSDA-YYCTGDI  307

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD---PKNRPLKEQVITV---  2419
             S W+ C + T+ P RK+     P+   + P     K K QD   PK+ P      +    
Sbjct  308   SAWTKCVFKTQTPDRKD--WVTPKEFSEIPFLKKFKFKRQDRVFPKDAPPAAATPSSGST  365

Query  2418  --------------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
                                 KPL+GM +   G+L++     K  +E  GGK+  +     
Sbjct  366   TSAATSVSSASKNLTEAPADKPLTGMKLLAVGKLSKNKDDLKKFVEDLGGKITGTASKAA  425

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEK-KEVQPLDAYDVAS----DIA  2134
               + S  E E+  S K+ E  + G+ VV + +L D  E  K +Q L +    S    ++ 
Sbjct  426   LCISSKKEIEK-MSKKMEEVRDAGVRVVADDFLTDIKESGKALQELISLHAISPWGAEVK  484

Query  2133  VDGRGIPLDKQDPSAEALENITS-------------ELKVYGKRGVHKDTKLQDEGGKIL  1993
             V+        +   A + ++                +L V G   V  D+ L++    +L
Sbjct  485   VEAPAAAAATKSTGAHSSKSTGKVKEEEGGSKSKKMKLTVKGGAAVDPDSGLEN-CAHVL  543

Query  1992  EKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWE  1816
             E++G +Y+  L + D  RG N +  +QL+     + +  +R  GRVG T    +KL+++ 
Sbjct  544   EQNGKIYSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIG-GNKLDKFY  602

Query  1815  NEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI  1636
             +++ A+  F  ++EE TGN + S        K P+KFYPL++  G +      A+++L  
Sbjct  603   DKNSAMDNFCGVYEEKTGNAWASSN----FTKYPNKFYPLEIDYGQDEE----AVKKLTQ  654

Query  1635  AA-VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFV  1459
             +A   S+L+  V + ++++   E  + A++E   D  ++P+G LS   ++     L    
Sbjct  655   SAGAKSQLEKPVQDLIRMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSLLSEVQ  714

Query  1458  ERIRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDI  1291
             + +     A    E+L  + SN+++TL+P      +P  L +  D       + +++ DI
Sbjct  715   QAV-----ADSSSESLILDLSNRFYTLIPHDFGMKKPPLLSN-VDYIQQKVQMLDNLLDI  768

Query  1290  NAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDIS  1111
               A  L+     +   DP+   Y KL   I  ++K S + ++IL+Y++ T+        +
Sbjct  769   EVAYSLLRGGVENNEKDPIDINYEKLKTKIEVVDKSSHEAQLILQYVKNTHAATHN---T  825

Query  1110  YGVSVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPG  934
             Y + VE IF +E           K+LPN+ LLW G+R++N    L  G   A    PV G
Sbjct  826   YTLDVEEIFKIEREGEYQRYRPFKELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTG  885

Query  933   YMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKL  754
             YMFGK +  +D  +++A Y  T+   P G ++L   ++G  + E       TK L + K 
Sbjct  886   YMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEVALG-NMHELKKASHITK-LPKGKH  943

Query  753   GAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVA  574
               K  GR   D     V  + + +P G+ +  +  + S   YNEY VYD  QV++++L+ 
Sbjct  944   SVKGLGRSAPD-PRATVSLNGVDIPLGKGMNTNIDDTSLL-YNEYIVYDVSQVNLKYLLK  1001

Query  573   VKYD  562
             ++++
Sbjct  1002  IRFN  1005



>ref|XP_005043071.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ficedula albicollis]
Length=969

 Score =   236 bits (603),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 218/781 (28%), Positives = 370/781 (47%), Gaps = 80/781 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCQECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQDPKNRP--------------  2443
             + W+ C   T+ P RK+    IP+  ++ P     K K QD    P              
Sbjct  273   TAWTKCVAKTQTPNRKD--WIIPKEFREIPYLKKFKCKKQDRVFPPDAATVNSAPPPSAS  330

Query  2442  --LKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
               L E V     KPL+ M I + G+L++  +  K+ +E  GGK+  +    T  + +  +
Sbjct  331   APLSETVSAPRDKPLTNMKILVVGKLSKNKEEVKNIVEDLGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV EA+L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEAFLQDVKSSSKDFQELVSLHALSPWGAEVKMEIEEMAV  449

Query  2130  DGRGIPLDKQDPSAEALENITSE-----------LKVYGKRGVHKDTKLQDEGGKILEKD  1984
             DG+      + PS ++   +  E           L V G   V  D+ L+D    + EK 
Sbjct  450   DGKS----SKPPSTKSTGKVKEEQGPSKSEKKMKLTVKGGAAVDPDSGLED-SAHVFEKG  504

Query  1983  GLLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENED  1807
             G +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++
Sbjct  505   GKIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKE  563

Query  1806  GAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-  1630
              AI+ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A 
Sbjct  564   DAIEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAG  615

Query  1629  VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERI  1450
               SKL   + + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++ 
Sbjct  616   TKSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQA  674

Query  1449  RSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAA  1282
              S  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A
Sbjct  675   VS--DSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVA  729

Query  1281  SRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGV  1102
               L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y +
Sbjct  730   YSLLRGGNEDGDKDPIDINYEKLKTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDL  786

Query  1101  SVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMF  925
              V  IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMF
Sbjct  787   KVVEIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMF  846

Query  924   GKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAK  745
             GK I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K
Sbjct  847   GKGIYFADMVSKSANYCHTSQADPIGLVLLGEVALG-NMYELKNASHITK-LPKGKHSVK  904

Query  744   FHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
               G+   D +       D++VP G  I  +  N++   YNEY VYD  QV++++L+ +K+
Sbjct  905   GLGKTAPDPTATTTL-GDVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKF  962

Query  564   D  562
             +
Sbjct  963   N  963



>ref|XP_009470783.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nipponia nippon]
Length=969

 Score =   236 bits (603),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 217/780 (28%), Positives = 372/780 (48%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD                  +
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAATANSVPPPSAS  330

Query  2448  RPLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E V     KPL+ M I + G+L++  +  KS +E+ GGK+  +    T  + +  +
Sbjct  331   APLTETVSAPRDKPLTNMKILVLGKLSKNKEEMKSIVEELGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEQFLQDVKSSSKDFQELVSLHALSPWGAEVKMEHEEMAV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGKCSKPPSTKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  
Sbjct  617   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQAV  675

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             S  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  676   S--DSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  730

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  731   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  787

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  788   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  847

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  848   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  905

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  906   LGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>emb|CDQ76498.1| unnamed protein product [Oncorhynchus mykiss]
Length=1013

 Score =   237 bits (604),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 215/782 (27%), Positives = 361/782 (46%), Gaps = 78/782 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   M+++L  N Q+    +  +V    + M +G +  C  C G L   S   Y+C GD 
Sbjct  254   STNDMKELLIANGQEVPSGESNVVDSLGDCMAFGALKPCEECQGQLVFKSDA-YYCTGDL  312

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD---PKNR------------  2446
             S W+ C + T+ P RK     IP+   + P     K K QD   PK              
Sbjct  313   SAWTKCVFKTQLPNRK--GWVIPKEFHELPFLKKFKFKRQDRVFPKVAPPPASSASAPVP  370

Query  2445  --------PLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLV  2290
                     PL E     KPL+GM +   G+L +     K  +E+ GGK+  +    T  +
Sbjct  371   SASSDPSIPLPEGAPADKPLTGMKLLTVGKLRQNKDELKIAVEELGGKITGTANKATLCL  430

Query  2289  VSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEKKEVQPLDAYDVASDIAVDGRGIPL  2110
              +  E E+  S K+ EA E G+ VV E +L D   K   + L        I+  G  + L
Sbjct  431   STKKEVEKR-SKKMEEAEEAGVRVVSEDFLTDI--KSSGKALQELVSLHAISPWGAEVKL  487

Query  2109  DKQDPSAEALENIT---SELKVYGKRGVHKDTK---LQDEGGK-------------ILEK  1987
             + Q  SA +        S  +V  + GV K +K   L  +GG              +L++
Sbjct  488   ETQAQSAASRSGAMAGKSTKRVKEEEGVSKASKKMKLTVKGGAAVDPDSCLENSAHVLDQ  547

Query  1986  DGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENE  1810
             +G +++  L + D  RG N +  +QL+    ++ +  +R  GRVG T    +KL+++ ++
Sbjct  548   NGKIFSATLGLVDIVRGTNSYYKLQLLEDDVHKRYWVFRSWGRVGTTIG-GNKLDKFHDK  606

Query  1809  DGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA  1630
             + A+  F  ++EE TGN + S        K P++FYPL++  G +      A+++L  +A
Sbjct  607   NSAMDNFLGVYEEKTGNAWGSSH----FTKYPNRFYPLEIDYGQDEE----AVKRLTASA  658

Query  1629  -VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVER  1453
               +S L   V   ++ +   E  + A++E   D  ++P+G LS   ++    TLL  V++
Sbjct  659   GTNSLLAKPVQELIRTIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-TLLSEVQQ  717

Query  1452  IRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINA  1285
               S   +   +     + SN+++TL+P      +P  L +  D       + +++ DI  
Sbjct  718   AVSDSSSESHI----LDLSNRFYTLIPHDFGMKKPPLLSNL-DYIQAKVQMLDNLLDIEV  772

Query  1284  ASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYG  1105
             A  L++  +     DP+   Y KL   I  ++K +++ ++IL+Y++ T+        +Y 
Sbjct  773   AYSLLKGGAEDNKKDPIDINYEKLKTKIEVVDKTTEEAEIILQYVKNTHAATHN---TYT  829

Query  1104  VSVENIFA-VEPSACPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYM  928
             + VE IF  V           + LPN+ LLW G+R++N    L  G   A    PV GYM
Sbjct  830   LEVEEIFKIVREGEYQKYRPFQDLPNRQLLWHGSRATNYAGILSQGLRIAPPEAPVTGYM  889

Query  927   FGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGA  748
             FGK +  +D  +++A Y  T+   P G L+L   ++G  + E       TK L + K   
Sbjct  890   FGKGVYFADMVSKSANYCHTSQSDPTGLLLLGEVALG-NMHELKKASHITK-LPKGKHSV  947

Query  747   KFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVK  568
             K  GR   D S   V  D ++VP G+    +  + S   YNEY VYD  QV++++L+ +K
Sbjct  948   KGLGRNAPDPSAT-VTLDGVQVPLGKGTNTNIDDTSLL-YNEYIVYDVAQVNLKYLLKIK  1005

Query  567   YD  562
             ++
Sbjct  1006  FN  1007



>ref|XP_002926747.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Ailuropoda melanoleuca]
Length=1018

 Score =   237 bits (604),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 216/780 (28%), Positives = 360/780 (46%), Gaps = 73/780 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  258   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  316

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RK+  +   E  + + L  L  K QD    P     +         
Sbjct  317   TAWTKCMIKTQTPSRKDW-VTPKEFREISYLKKLKIKRQDRIFPPETSAPVAAVALPSTA  375

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  376   SAPAAVNSSTPPDKPLSSMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  435

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  S K+ E  E GI VV E +L D S     +Q L A  V +    + +  P++  
Sbjct  436   EVEKM-SKKMEEVREAGIRVVSEDFLRDLSDSTGSLQDLLAAHVLAPWGAEVKAEPVEPT  494

Query  2100  DPSA-------------------EALENITSELKVYGKRG--VHKDTKLQDEGGKILEKD  1984
             +P+A                   E +      +K+  K G  V  D+ L+     +LEK 
Sbjct  495   EPAAPKAKSGAALSKKSKGPAKEEGINKSEKRMKLTLKGGAAVDPDSGLE-HSAHVLEKG  553

Query  1983  GLLYNCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENED  1807
             G +++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE   +++
Sbjct  554   GKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLERVPSKE  612

Query  1806  GAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AA  1630
              AI+ F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +   
Sbjct  613   DAIEHFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPG  664

Query  1629  VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERI  1450
               SKL   V   +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++ 
Sbjct  665   TKSKLPKPVQELIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQA  723

Query  1449  RSTKEAGQQVEALWAEFSNKWFTLMP---STRPFYLRDFADIADHAASVFESVRDINAAS  1279
              S   +  Q+     + SN+++TL+P     R   L + AD       + +++ DI  A 
Sbjct  724   VSQGSSDSQI----LDLSNRFYTLIPHDFGMRKPPLLNNADCVQAKVEMLDNLLDIEVAY  779

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   S  +  DP+   Y KL   I  +++DS++ + I KY++ T+        +Y + 
Sbjct  780   SLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAETIRKYVKNTHATTHN---AYDLE  836

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           ++L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  837   VVDIFKIEREGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  896

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K 
Sbjct  897   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKG  954

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D S      D ++VP G  I  S  N++   YNEY VYD  QV++R+L+ ++++
Sbjct  955   LGKTTPDPSASITM-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLRYLLKLRFN  1012



>ref|XP_010300324.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Balearica regulorum 
gibbericeps]
Length=969

 Score =   236 bits (602),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 217/780 (28%), Positives = 371/780 (48%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQDPKNRPLKEQVITV------  2419
             + W+ C   T+ P RK+    IP+  ++ P     K K QD    P    V +V      
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAAAVNSVPPPSAS  330

Query  2418  ------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
                         KPL+ M I + G+L++T +  KS +E  GGK+  +    T  + +  +
Sbjct  331   APLTETASAPRDKPLTNMKILVLGKLSKTKEEVKSIVEDLGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEEFLQDVKSSSKDFQELVSLHAVSPWGAEVKMEHEEMAV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGKCSKPSSMKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  
Sbjct  617   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQAV  675

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             S  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  676   S--DSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  730

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  731   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  787

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  788   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  847

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  848   KGIYFADMVSKSANYCHTSQTDPIGLVLLGEVALG-NMYELKNASHITK-LPKGKHSVKG  905

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  906   LGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>ref|XP_006268817.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Alligator mississippiensis]
Length=1011

 Score =   236 bits (603),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 215/777 (28%), Positives = 369/777 (47%), Gaps = 72/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  256   STNDLKELLMANKQEVPSGESAILDRVADGMAFGALLPCEECKGQFMFKSDA-YYCSGDI  314

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T++P RKE    IP+  ++ P     K K QD                  +
Sbjct  315   TAWTKCVAKTQSPNRKE--WVIPKEFREIPYLKKFKCKKQDRVFPQEAAAVNTVLPSAAS  372

Query  2448  RPLKEQVI--TVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E+    T KPLS M I + G+L+R  +  K+++E+ GGKV  +       + +  E
Sbjct  373   APLTEEASAPTDKPLSNMKILILGKLSRNKEEMKTRVEELGGKVTGTANKANLCISTQKE  432

Query  2274  RERGGSSKVAEAVERGIPVVREAWL--VDSIEKKEVQPLDAYDVAS----------DIAV  2131
              E+  + K+ E  E  + VV E +L  V S  K   + L  ++++S          +  V
Sbjct  433   VEKM-NKKMEEVKEAKVRVVSEEFLKDVKSSSKGFRELLSVHELSSWGAEVKQENMETTV  491

Query  2130  DGR--GIP-LDKQDPSAEALENITSE----LKVYGKRGVHKDTKLQDEGGKILEKDGLLY  1972
              G+  G P +       E      SE    L V G   V  D+ L+D    + EK G +Y
Sbjct  492   GGKSSGPPNMKSAGKVKEEQGTCKSEKKMKLTVKGGAAVDPDSGLED-SAHVFEKGGKIY  550

Query  1971  NCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  551   SATLGLVDIVKGTNSYYKLQLLEDDREIRYWVFRSWGRVG-TVIGSNKLEQMPSKEDAIE  609

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-VHSK  1618
              F  ++EE TGN + S    K   K P KFYPL++  G +      A+++L + A   SK
Sbjct  610   HFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVGAGTKSK  661

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  S  
Sbjct  662   LPKSVQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNDVQQAVSGG  720

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
                 Q+     + SN+++TL+P      +P  L +   I      + +++ DI  A  L+
Sbjct  721   GTDSQI----LDLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAYSLL  775

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + V +
Sbjct  776   RGGNEDGDKDPIDVNYEKLKTEIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLKVVD  832

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E           ++L N+ LLW G+R++N    L  G   A    PV GYMFGK +
Sbjct  833   IFKIEREGESQRYKPFRQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGV  892

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K  G+
Sbjct  893   YFADMVSKSANYCHTSQADPVGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKGLGK  950

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D +    + + ++VP G  +  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  951   TAPDPTATISY-EGVEVPLGNGM-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  1005



>ref|NP_001038407.1| poly [ADP-ribose] polymerase 1 [Danio rerio]
Length=1013

 Score =   236 bits (603),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 206/784 (26%), Positives = 361/784 (46%), Gaps = 79/784 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S+  M+++L  N+Q+    +  IV R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  251   SINDMKELLIANSQEVPSGESNIVDRLSDCMAFGSLKPCETCKGQLVFKSDA-YYCTGDI  309

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD---PKNRPLKEQVITV---  2419
             S W+ C + T+ P RK+     P+   + P     K K QD   PK+ P      +    
Sbjct  310   SAWTKCVFKTQTPDRKD--WVTPKEFSEIPFLKKFKFKRQDRVFPKDAPPAAATPSSGST  367

Query  2418  --------------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVT  2299
                                 KPL+GM +   G+L++     K  +E  GGK+  +     
Sbjct  368   TSAATSVSSASKNLTEAPADKPLTGMKLLAVGKLSKNKDDLKKFVEDLGGKITGTASKAA  427

Query  2298  CLVVSPAERERGGSSKVAEAVERGIPVVREAWLVDSIEK-KEVQPLDAYDVAS----DIA  2134
               + S  E E+  S K+ E  + G+ VV + +L D  E  K +Q L +    S    ++ 
Sbjct  428   LCISSKKEIEK-MSKKMEEVRDAGVRVVADDFLTDIKESGKALQELISLHAISPWGAEVK  486

Query  2133  VDGRGIPLDKQDPSAEALENITS-------------ELKVYGKRGVHKDTKLQDEGGKIL  1993
             V+        +   A + ++                +L V G   V  D+ L++    +L
Sbjct  487   VEAPAAAAATKSTGAHSSKSTGKVKEEEGGSKSKKMKLTVKGGAAVDPDSGLEN-CAHVL  545

Query  1992  EKDGLLYNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWE  1816
             E++G +Y+  L + D  RG N +  +QL+     + +  +R  GRVG T    +KL+++ 
Sbjct  546   EQNGKIYSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIG-GNKLDKFY  604

Query  1815  NEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI  1636
             +++ A+  F  ++EE TGN + S        K P+KFYPL++  G +      A+++L  
Sbjct  605   DKNSAMDNFCGVYEEKTGNAWASSN----FTKYPNKFYPLEIDYGQDEE----AVKKLTQ  656

Query  1635  AA-VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFV  1459
             +A   S+L+  V + ++++   E  + A++E   D  ++P+G LS   ++     L    
Sbjct  657   SAGAKSQLEKPVQDLIRMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSLLSEVQ  716

Query  1458  ERIRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDI  1291
             + +     A    E+L  + SN+++TL+P      +P  L +  D       + +++ DI
Sbjct  717   QAV-----ADSSSESLILDLSNRFYTLIPHDFGMKKPPLLSN-VDYIQQKVQMLDNLLDI  770

Query  1290  NAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDIS  1111
               A  L+     +   DP+   Y KL   I  ++K S + ++IL+Y++ T+        +
Sbjct  771   EVAYSLLRGGVENNEKDPIDINYEKLKTKIEVVDKSSHEAQLILQYVKNTHAATHN---T  827

Query  1110  YGVSVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPG  934
             Y + VE IF +E           K+LPN+ LLW G+R++N    L  G   A    PV G
Sbjct  828   YTLDVEEIFKIEREGEYQRYRPFKELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTG  887

Query  933   YMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKL  754
             YMFGK +  +D  +++A Y  T+   P G ++L   ++G  + E       TK L + K 
Sbjct  888   YMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEVALG-NMHELKKASHITK-LPKGKH  945

Query  753   GAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVA  574
               K  GR   D     V  + + +P G+ +  +  + S   YNEY VYD  QV++++L+ 
Sbjct  946   SVKGLGRSAPD-PRATVSLNGVDIPLGKGMNTNIDDTSLL-YNEYIVYDVSQVNLKYLLK  1003

Query  573   VKYD  562
             ++++
Sbjct  1004  IRFN  1007



>ref|XP_008266574.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Oryctolagus cuniculus]
Length=1013

 Score =   236 bits (603),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 213/776 (27%), Positives = 363/776 (47%), Gaps = 69/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD--------------------  2458
             + W+ C   T+ P RKE  +   E  + + L  L  K QD                    
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKIKKQDRIFPPESSAPAAAAPPPSTA  374

Query  2457  PKNRPLKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                  +       KPLS M I   G+L+R     K+ +EK GGKV  +    +  + +  
Sbjct  375   SAPASVTPSAPADKPLSNMKILTLGKLSRNKDEVKAAVEKLGGKVTGTASKASLCISTQK  434

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  + VV E +L D S   K +Q L +  + S    + +  P++  
Sbjct  435   EVEKM-NKKMEEVREANVRVVAEDFLQDVSSSAKSLQELLSAHILSPWGAEVKAEPVEAV  493

Query  2100  DPSAEALENITSELKVYGKRGVHKD---TKLQDEGGK-------------ILEKDGLLYN  1969
              P  ++   +  + K   + G++K     KL  +GG              +LEK G +++
Sbjct  494   APKPKSGAAVAKKSKGPVEEGMNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFS  553

Query  1968  CALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKE  1792
               L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+ 
Sbjct  554   ATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIEH  612

Query  1791  FSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIA-AVHSKL  1615
             F +++EE TGN + S    K   K P KFYPL++  G +      A+++L ++    SKL
Sbjct  613   FMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVSPGTKSKL  664

Query  1614  DPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKE  1435
                V   +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  S   
Sbjct  665   PKPVQELIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILNEVQQAVSQGS  723

Query  1434  AGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
             +  Q+     + SN+++TL+P      +P  L +  D       + +++ DI  A  L+ 
Sbjct  724   SESQI----LDLSNRFYTLIPHDFGMKKPPLLNN-TDSVQAKVEMLDNLLDIEVAYSLLR  778

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  ++KDS++ ++I KY++ T+        +Y + V +I
Sbjct  779   GGSDDSSKDPIDVNYEKLKTDIKVVDKDSEEAEVIRKYVKNTHATTHN---AYDLEVVDI  835

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  836   FKIERDGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  895

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+ 
Sbjct  896   FADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKQASHISK-LPKGKHSVKGLGKT  953

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TPDPSASITL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1007



>ref|XP_004313311.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1-like [Tursiops truncatus]
Length=1022

 Score =   236 bits (603),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 217/788 (28%), Positives = 367/788 (47%), Gaps = 84/788 (11%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRP-------------LK  2437
             + W+ C   T+ P RKE  +   E  + + L  L  + QD    P               
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKIRKQDRIFPPETSAPLAAAPLPSAA  374

Query  2436  EQVITV------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
                 TV      KPLS M I   G+L+R     K+ IEK GGK+  +V   +  + S  E
Sbjct  375   SAPATVNSAPPDKPLSNMKILTLGKLSRNKDEVKATIEKLGGKLTGTVNKASLCISSKKE  434

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
              ++  + K+ E  E  + VV E +L D S   K +Q L +  + S    + +  P++   
Sbjct  435   VDKM-NKKMEEVKEANVRVVSEDFLQDISTSTKSLQELLSTHLLSPWGAEVKAEPVEAVA  493

Query  2097  PSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLYN  1969
             P  ++   ++ +    +K  G     K  KL  +GG              +LEK G +++
Sbjct  494   PKGKSGAVLSKKSKGPVKEEGTNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFS  553

Query  1968  CALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKE  1792
               L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+ 
Sbjct  554   ATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEEAIEH  612

Query  1791  FSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSKL  1615
             F++++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SKL
Sbjct  613   FTKLYEEKTGNAWHS----KNFTKHPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSKL  664

Query  1614  DPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKE  1435
                V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V+++ S   
Sbjct  665   PKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQVLSQGS  723

Query  1434  AGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
             +  Q+     + SN+++TL+P      +P  L + +D       + +++ DI  A  L+ 
Sbjct  724   SDSQI----LDLSNRFYTLIPHDFGMKKPPLLSN-SDSVQAKVEMLDNLLDIEVAYSLLR  778

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  ++KDS++ ++I KY++ T+        +Y + V +I
Sbjct  779   GGSDDSSKDPIDVNYEKLRTDIMVVDKDSEEAEIIRKYVKNTHATTHN---AYDLEVVDI  835

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  836   FKIEREGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  895

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIME---------FSSPPED---TKSLE  766
              +D  +++A Y  T+   P G ++L   ++G              FS+P      T +  
Sbjct  896   FADMVSKSANYCHTSQGDPIGLILLGEVALGNMFKXTHRSHLSGAFSTPVATNHITSAFC  955

Query  765   QKKLGAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIR  586
                LG      K T +    +  D ++VP G  I  S  N++   YNEY VYD  QVS++
Sbjct  956   FAGLG------KTTPDPSASITMDGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVSLK  1008

Query  585   FLVAVKYD  562
             +L+ +K++
Sbjct  1009  YLLKLKFN  1016



>ref|XP_009969669.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Tyto alba]
Length=969

 Score =   236 bits (601),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 217/780 (28%), Positives = 371/780 (48%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD                  +
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAATVNSVPPPSAS  330

Query  2448  RPLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E V     KPL+ M I + G+L++  +  KS +E  GGK+  +    T  + +  +
Sbjct  331   APLAETVSAPRDKPLTNMKILVLGKLSKNKEEVKSIVEDLGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     KE Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEEFLQDVKSSSKEFQDLVSLHALSPWGAEVKMEHEEMAV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGKCSKPPNMKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  
Sbjct  617   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQ--  673

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             +  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  674   AVSDSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  730

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  731   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  787

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  788   VVDIFRIEREGETQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  847

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  848   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  905

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  906   LGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>ref|XP_004375937.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Trichechus 
manatus latirostris]
 ref|XP_004375938.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 2 [Trichechus 
manatus latirostris]
Length=1013

 Score =   236 bits (602),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 213/776 (27%), Positives = 366/776 (47%), Gaps = 69/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S+  ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   SMNDLKELLIFNEQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRP---------------  2443
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P               
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKIKKQDRLFPPEATTPVAAAPPPRTA  374

Query  2442  ----LKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
                  +      KPLS M I   G+L+R  +  K+ IEK GGK+  +    +  + +  E
Sbjct  375   AAPAAENSAPAGKPLSNMKILTLGKLSRNKEEVKTMIEKLGGKLTGTATKASLCISTKKE  434

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
              E+  + K+AE  E  + VV E +L D S   + +Q L +  V S    + +  P +   
Sbjct  435   VEKM-TKKMAEVREASVRVVSEEFLQDVSGSTRSLQELLSVHVLSSWGAEVKVEPAEVVA  493

Query  2097  PSAEALENITSELK-VYGKRGVHKD---TKLQDEGGK-------------ILEKDGLLYN  1969
             P A++   +  + K    + GV+K     KL  +GG              +LEK G +++
Sbjct  494   PKAKSGAALPKKSKGAVKEEGVNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFS  553

Query  1968  CALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKE  1792
               L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ A++ 
Sbjct  554   ATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAVEH  612

Query  1791  FSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSKL  1615
             F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     S+L
Sbjct  613   FMKLYEEKTGNAWNS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSRL  664

Query  1614  DPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKE  1435
                V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S   
Sbjct  665   PKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQGS  723

Query  1434  AGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
             +  Q+     + SN+++TL+P      +P  L +  D       + +++ DI  A  L+ 
Sbjct  724   SDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-TDSVQAKVEMLDNLLDIEVAYSLLR  778

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V +I
Sbjct  779   GGSEDSTKDPIDVNYEKLKTEIKVVDRDSEEAEIIRKYVKNTHASTHN---AYDLEVIDI  835

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E           ++L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  836   FKIEREGETQRYKPFRQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  895

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+ 
Sbjct  896   FADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  953

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  954   TPDPSASITL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1007



>ref|XP_004605484.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sorex araneus]
Length=1015

 Score =   236 bits (602),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 215/779 (28%), Positives = 361/779 (46%), Gaps = 73/779 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMAFGALLPCEECSGQLVFKSDA-YYCTGDI  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTP-LSDLIKKHQDPKNRPLKEQVITV------  2419
             + W+ C + T+ P RK+     P+  ++   L  L  K QD    P     +        
Sbjct  316   TAWTKCLFKTQTPSRKD--WVTPKEFREIAHLKKLKIKKQDRIFPPEAPAPVVAAEPPLC  373

Query  2418  ---------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVS  2284
                            KPL+ M I   G+L++  +  K+ IEK GGKV  +    +  V +
Sbjct  374   AAPAPEAPVNSTPQDKPLNNMKILTLGKLSQNKEDVKATIEKLGGKVTGTANKASLCVST  433

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLD  2107
               E E+  S K+ E  E  I VV E +L D S   K +Q L +  + S    + +  P++
Sbjct  434   KKEVEKM-SKKMEEVREANIRVVSEEFLQDVSASTKSLQELLSAHILSPWGAEVKAEPIE  492

Query  2106  KQDPSAEA----LENITSELKVYGKRGVHKDTKLQDEGGK-------------ILEKDGL  1978
                P  ++     +     +K  G     K  KL  +GG              +LEK+G 
Sbjct  493   VSAPKGKSGTAQSKKSKGSIKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKNGK  552

Query  1977  LYNCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGA  1801
             +++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE   +++ A
Sbjct  553   VFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEAMPSKEDA  611

Query  1800  IKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVH  1624
             ++ F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     
Sbjct  612   LEHFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTK  663

Query  1623  SKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRS  1444
             SKL   V   +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S
Sbjct  664   SKLPKPVQELIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVS  722

Query  1443  TKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASR  1276
                +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  
Sbjct  723   QGSSDSQI----LDLSNRFYTLIPHDFGMKKPPLLSN-ADSVQAKVEMLDNLLDIEVAYS  777

Query  1275  LIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSV  1096
             L+   S  T  DP+   Y KL   I  ++KDS++ + I KY++ T+        +Y + V
Sbjct  778   LLRAGSDDTGKDPIDVNYEKLKTDIKVVDKDSEEAQTIRKYVKNTHATTHN---AYDLEV  834

Query  1095  ENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGK  919
              +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK
Sbjct  835   LDIFKIEREGENQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGK  894

Query  918   AIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFH  739
              I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  
Sbjct  895   GIYFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMHELKHASHISK-LPKGKHSVKGL  952

Query  738   GRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             G+   D S      D ++VP G  I  S  N++   YNEY +YD  QV++++L+ +K++
Sbjct  953   GKTTPDPSASITM-DGVEVPLGTGI-PSGVNDTCLLYNEYIIYDIAQVNLKYLLKLKFN  1009



>ref|XP_005241893.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Falco peregrinus]
Length=969

 Score =   235 bits (600),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 217/780 (28%), Positives = 367/780 (47%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD--------PKNR-------  2446
             + W+ C   T+ P RK+    IP+  ++ P     K K QD        P N        
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAAPVNSVPPPSAS  330

Query  2445  -PLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E V     KPL+ M I + G+L++  +  K  +E  GGK+  +    T  + +  +
Sbjct  331   APLAETVSAPRDKPLTNMKILVLGKLSKNKEEVKGIVEDLGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEEFLQDVKSSSKDFQELVSLHALSPWGAEVKMEHEEMAV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGKCSKPPSMKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AVEHFLNLYEEKTGNSWHS----KSFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++     L   V+ + 
Sbjct  617   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSILNXLVQAVS  676

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
                ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  677   ---DSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  730

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  731   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  787

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  788   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  847

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  848   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  905

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  906   LGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>ref|XP_005289622.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Chrysemys 
picta bellii]
Length=1011

 Score =   236 bits (601),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 217/777 (28%), Positives = 366/777 (47%), Gaps = 72/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  256   STNDLKELLIANKQEVPSGESAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  314

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RKE    IP+  ++       K K QD                  +
Sbjct  315   TAWTKCVAKTQTPNRKE--WIIPKEFREISYLKKFKCKKQDRAFPPEAVAVNAVLPAAAS  372

Query  2448  RPLKEQ--VITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E+  V   KPLS M I   G+L+R  +  K+ IE  GGKV  +    T  + +  E
Sbjct  373   APLTEKASVPADKPLSSMKILTLGKLSRNKEEVKAMIEDLGGKVTGTANKATLCISTQKE  432

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  + K+ E  E  + VV E +L D    +K  Q L +    S           + ++
Sbjct  433   VEKM-TKKMEEVKEAKVRVVSEEFLQDVKSSRKGFQELLSLHALSPWGAEVKQEHTETSL  491

Query  2130  DGR--GIPLDKQDPSAEALENITS-----ELKVYGKRGVHKDTKLQDEGGKILEKDGLLY  1972
              G+  G+P  K     +  +  +      +L V G   V  D+ L+D    + EK G ++
Sbjct  492   GGKSSGLPNMKSAGKVKEEQGTSKSEKKMKLTVKGGAAVDPDSGLEDSA-HVFEKSGKIF  550

Query  1971  NCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  RG N +  +QL+    E R  ++   GRVG TA   +KLE+  ++D AI+
Sbjct  551   SATLGLVDIVRGTNSYYKLQLLEDDREIRYWVFRSWGRVG-TAIGSNKLEQMPSKDDAIE  609

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-VHSK  1618
              F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L ++A   SK
Sbjct  610   HFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVSAGTKSK  661

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  S  
Sbjct  662   LPKPVQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQAVSDG  720

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L +  D       + +++ DI  A  L+
Sbjct  721   GSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNNL-DHIQAKVEMLDNLLDIEVAYSLL  775

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                +     DP+   Y KL  +I  ++KDS++ K+I +Y++ T+        +Y + V +
Sbjct  776   RGGNEDGDKDPIDINYEKLKTNIKVIDKDSEEAKIIKQYVKNTHASTHN---AYDLKVVD  832

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E           ++L N+ LLW G+R++N       G   A    PV GYMFGK I
Sbjct  833   IFKIEREGENQRYKPFRQLHNRQLLWHGSRATNFAGIFSQGLRIAPPEAPVTGYMFGKGI  892

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K  G+
Sbjct  893   YFADMVSKSANYCHTSQTDPIGLILLGEVALG-NMHELKNASHITK-LPKGKHSVKGLGK  950

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D +      D + +P G  I  S  +++   YNEY VYD  QV++++L+ +K++
Sbjct  951   TAPDPTATITL-DGVDIPLGNGI-PSGVSDTCLLYNEYIVYDVAQVNLKYLLKLKFN  1005



>ref|XP_009910585.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Haliaeetus albicilla]
Length=969

 Score =   235 bits (600),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 217/780 (28%), Positives = 367/780 (47%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQDPKNRP--------------  2443
             + W+ C   T+ P RK+    IP+  ++ P     K K QD    P              
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAATVNSVPPPSSS  330

Query  2442  --LKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
               L E V T   KPL+ M I + G+L++  +  KS +E  GGK+  +    T  + +  +
Sbjct  331   APLAETVSTPRDKPLTNMKILVLGKLSKNKEEVKSIVEDLGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEEFLQDVKSSSKDFQELVSLHALSPWGAEVKMEHEEMAV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGKCSKPPSTKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++     L    E + 
Sbjct  617   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSIL---NEVVX  673

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             +  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  674   AVSDSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  730

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  731   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  787

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  788   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  847

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  848   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  905

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  906   LGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>ref|XP_009076073.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Acanthisitta chloris]
Length=958

 Score =   235 bits (599),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 214/781 (27%), Positives = 365/781 (47%), Gaps = 91/781 (12%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQDPKNRPLKEQVITV------  2419
             + W+ C   T+NP RK+    IP+  ++ P     K K QD    P    V +       
Sbjct  273   TAWTKCVAKTQNPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAANVNSAPPPSAP  330

Query  2418  ------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
                         KPL+ M I   G+L++  +  KS +E  GGK+  +    T  + +  +
Sbjct  331   APLSETVSAPRDKPLTNMKIMALGKLSKNKEEVKSIVEDLGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV EA+L D     K+ Q L +  V S           ++AV
Sbjct  391   VEKM-SKKMEEVKEANVRVVSEAFLQDVKSSSKDFQELVSLHVLSPWGAEVKMEHEEMAV  449

Query  2130  DGRGIPLDKQDPSAEALENITSE-----------LKVYGKRGVHKDTKLQDEGGKILEKD  1984
             DG+    + + PS ++   +  E           L V G   V  D+ L+D    + EK 
Sbjct  450   DGK----NSKPPSTKSAGKVKEEQGPSKSEKKMKLTVKGGAAVDPDSGLED-SAHVFEKG  504

Query  1983  GLLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENED  1807
             G +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++
Sbjct  505   GKIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEKMPSKE  563

Query  1806  GAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-  1630
              A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+++L + A 
Sbjct  564   DAVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVGAG  615

Query  1629  VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERI  1450
               SKL   + + +K++   E  + A++E   D  ++P+G LS                +I
Sbjct  616   TKSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSK--------------RQI  661

Query  1449  RSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAA  1282
             ++  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A
Sbjct  662   QAVADSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVA  718

Query  1281  SRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGV  1102
               L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y +
Sbjct  719   YSLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDL  775

Query  1101  SVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMF  925
              V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMF
Sbjct  776   KVVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMF  835

Query  924   GKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAK  745
             GK I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K
Sbjct  836   GKGIYFADMVSKSANYCHTSQADPIGLVLLGEVALG-NMYELKNASHITK-LPKGKHSVK  893

Query  744   FHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
               G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K+
Sbjct  894   GLGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKF  951

Query  564   D  562
             +
Sbjct  952   N  952



>ref|XP_010076719.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Pterocles gutturalis]
Length=970

 Score =   235 bits (599),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 218/780 (28%), Positives = 370/780 (47%), Gaps = 77/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCTGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD                  +
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDGATVNSVPPPSAS  330

Query  2448  RPLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              P+ E V T   KPL+ M I   G+L++  +  KS +E+ GGK+  +    T  + +  +
Sbjct  331   APVTETVSTPRDKPLTNMKILALGKLSKNKEEVKSIVEELGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEEFLRDVKSSSKDFQELVSLHALSPWGAEVKMEHEEMAV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGKCSKPPSTKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             AI+ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AIEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++    ++L+F E I 
Sbjct  617   KSKLPKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNFHE-ID  674

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             +  +   + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  675   AVSDNSSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  731

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  732   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  788

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  789   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  848

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  849   KGIYFADMVSKSANYCHTSQADPIGLVLLGEVALG-NMYELKNASHITK-LPKGKHSVKG  906

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  907   LGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  964



>ref|XP_005014800.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1, partial [Anas platyrhynchos]
Length=877

 Score =   234 bits (597),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 214/780 (27%), Positives = 373/780 (48%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  122   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  180

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----PK------------N  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD    P+            +
Sbjct  181   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRIFPPEAATVNSALPPHAS  238

Query  2448  RPLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E V     KPL+ M I   G+L++  +  K+ +E+ GGK+  +    T  + +  +
Sbjct  239   APLTETVSAPQDKPLANMKILALGKLSKNKEEVKNIVEELGGKMTTTANKATLCISTQKD  298

Query  2274  RERGGSSKVAEAVERGIPVVREAWL--VDSIEKKEVQPLDAYDVA----------SDIAV  2131
              E+  S K+ E  E  + VV EA+L  + S  K   + L  + ++           ++AV
Sbjct  299   LEKM-SKKMEEVKEAKVRVVSEAFLQXLKSSSKSFQELLSVHAISPWGAEIKMEHHEVAV  357

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  358   DGKCSKPQHTKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  413

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ 
Sbjct  414   KIFSATLGLVDIVKGTNSYYKLQLLEDDRESRYWVFRSWGRVG-TVIGSNKLEQMPSKED  472

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+++L + A  
Sbjct  473   AVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVGAGT  524

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  
Sbjct  525   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQAV  583

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             S   +  Q+     + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  584   SDNGSESQI----LDLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  638

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  639   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  695

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  696   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  755

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  756   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  813

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +      D ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  814   LGKTAPDPTATTSL-DGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  871



>ref|XP_003791037.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Otolemur garnettii]
Length=1014

 Score =   235 bits (600),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 210/778 (27%), Positives = 364/778 (47%), Gaps = 72/778 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + + +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGIAFGALLPCKECSGQLVFKSDA-YYCTGDI  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C + T+ P RKE     P+  Q+      +K  +  +  P +  +  V       
Sbjct  316   TAWTKCMFKTQTPNRKE--WVTPKEFQEISYLKKLKIKKQDRIFPSEASMPVVAAPPPST  373

Query  2418  --------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSP  2281
                           KPLS M I   G+L+R     K+ IEK GG++  +    +  + + 
Sbjct  374   ASAPASVNSSAPADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGRLTGTTNKASLCISTK  433

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDK  2104
              E E+  S K+ E  E  I VV E +L D S   + +  L +  + S    + +  P++ 
Sbjct  434   KEIEKM-SKKMEEVKEANIRVVSEDFLQDISASTRSLPELFSTYILSPWGAEVKTEPVEV  492

Query  2103  QDPSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLL  1975
               P  ++   ++ +    +K  G     K  KL  +GG              +LEK G +
Sbjct  493   AVPKGKSGSTLSKKSKGPIKEEGINKSEKKMKLTLKGGAAVDPDSGLEHSAHVLEKGGKV  552

Query  1974  YNCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAI  1798
             ++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI
Sbjct  553   FSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAI  611

Query  1797  KEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHS  1621
             + F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     S
Sbjct  612   EHFMKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKS  663

Query  1620  KLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRST  1441
             KL   V   +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S 
Sbjct  664   KLSKPVQELIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQ  722

Query  1440  KEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRL  1273
               +  Q+     + SN+++TL+P      +P  L +   +      + +++ DI  A  L
Sbjct  723   GSSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNNEGSV-QAKVEMLDNLLDIEVAYSL  777

Query  1272  IEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVE  1093
             +   S  +  DP+   Y KL  +I  ++KDS++ ++I KY++ T+        +Y + V 
Sbjct  778   LRGGSDDSSKDPIDVNYEKLKTNIKVVDKDSEEAEIIRKYVKNTHATTHN---AYDLQVV  834

Query  1092  NIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKA  916
             +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK 
Sbjct  835   DIFKIEREGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKG  894

Query  915   IVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHG  736
             I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G
Sbjct  895   IYFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLG  952

Query  735   RKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             +   D S   V  D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  953   KTTPDPSAS-VTLDGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1008



>ref|XP_008499362.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Calypte anna]
Length=967

 Score =   234 bits (598),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 216/780 (28%), Positives = 368/780 (47%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  212   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEACKGQFVFKSDA-YYCSGDI  270

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD                  +
Sbjct  271   TAWTKCVAKTQIPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAVIMNSVPPPSTS  328

Query  2448  RPLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E V T   KPL+ M I + G+L++  +  KS +E+ GGK+  +    T  + +  +
Sbjct  329   TPLTEAVSTPRDKPLTNMKILVLGKLSKNKEEVKSIVEELGGKMTTTASKATLCISTQKD  388

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D +    ++Q L A  V S           ++AV
Sbjct  389   VEKM-SKKMEEVKEAKVRVVSEEFLQDVTSSSTDIQELVALRVLSPWGADVKMEHEEMAV  447

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  448   DGKCRKASSMKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  503

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++    RVG      +KLE+  +++ 
Sbjct  504   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRAWTRVGKVIG-SNKLEQMPSKED  562

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  563   AVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  614

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++     L    E  +
Sbjct  615   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSIL---NEGQQ  671

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             +  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  672   AVSDSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  728

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  729   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  785

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  786   VVDIFRIEREGESQRYKPFKHLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  845

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  846   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  903

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  904   LGKTAPDPTATTTL-GGVEVPLGSGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  961



>ref|XP_009283832.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Aptenodytes forsteri]
Length=969

 Score =   234 bits (598),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 216/780 (28%), Positives = 372/780 (48%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RK+    IP+  ++ P     K K QD                  +
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAATVNSVPPPSAS  330

Query  2448  RPLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E V     KPL+ M I + G+L++  +  KS +E+ GGK+  +    T  + +  +
Sbjct  331   APLTETVSAPRDKPLTNMKILVLGKLSKNKEEVKSIVEELGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEEFLQDVKSSSKDFQELVSLHALSPWGAEVKMEHEEMAV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGKCSKPPSMKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AVEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  
Sbjct  617   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQAV  675

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
             S  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  676   S--DSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  730

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  731   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  787

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  788   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  847

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  848   KGIYFADMVSKSANYCHTSQADPIGLVLLGEVALG-NMYELKNASHITK-LPKGKHSVKG  905

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        +++P G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  906   LGKTAPDPTATTTL-GGVEIPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>ref|XP_009092024.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Serinus canaria]
Length=969

 Score =   234 bits (598),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 216/781 (28%), Positives = 369/781 (47%), Gaps = 80/781 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEQCKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQDPKNRP--------------  2443
             + W+ C   T+ P RK+    IP+  ++ P     K K QD    P              
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAASVNSAPPPSAS  330

Query  2442  --LKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
               L E V     KPL+ M I + G+L++  +  KS +E  GGK+  +    T  + +  +
Sbjct  331   APLSETVSVPRDKPLTSMKILVVGKLSKNKEEVKSIVEDLGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     K+ Q L A    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEVFLQDVKSSSKDFQELVALHALSPWGAEVKMEHEEMAV  449

Query  2130  DGRGIPLDKQDPSAEALENITSE-----------LKVYGKRGVHKDTKLQDEGGKILEKD  1984
             DG+      + PS ++   +  E           L V G   V  D+ L+D    + EK 
Sbjct  450   DGKS----SKPPSTKSAGKVKEEQGPSKSEKKMKLTVKGGAAVDPDSGLED-SAHVFEKG  504

Query  1983  GLLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENED  1807
             G +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++
Sbjct  505   GKIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKE  563

Query  1806  GAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-  1630
              AI+ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A 
Sbjct  564   DAIEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAG  615

Query  1629  VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERI  1450
               SKL   + + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++ 
Sbjct  616   TKSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNEVQQ-  673

Query  1449  RSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAA  1282
              +  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A
Sbjct  674   -AVSDSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVA  729

Query  1281  SRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGV  1102
               L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y +
Sbjct  730   YSLLRGGNEDGDKDPIDINYEKLKTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDL  786

Query  1101  SVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMF  925
              V +IF +E           ++L N+ LLW G+R++N    L  G   A    PV GYMF
Sbjct  787   KVVDIFRIEREGESQRYKPFRQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMF  846

Query  924   GKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAK  745
             GK I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K
Sbjct  847   GKGIYFADMVSKSANYCHTSQADPIGLVLLGEVALG-NMYELKNASHITK-LPKGKHSVK  904

Query  744   FHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKY  565
               G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K+
Sbjct  905   GLGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKF  962

Query  564   D  562
             +
Sbjct  963   N  963



>ref|XP_005427073.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Geospiza fortis]
Length=973

 Score =   234 bits (598),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 214/782 (27%), Positives = 367/782 (47%), Gaps = 78/782 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEQCKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQDPKNRP--------------  2443
             + W+ C   T+ P RK+    IP+  ++ P     K K QD    P              
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAATVNSAPPPSAS  330

Query  2442  --LKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
               L E V     KPL+ M I + G+L++  +  KS +E  GGK+  +    T  + +  +
Sbjct  331   APLSETVSAPRDKPLTNMKILIVGKLSKNKEEVKSIVEDLGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV EA+L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEAFLQDVKSSSKDFQELVSLHALSPWGAEVKMEHEEMAV  449

Query  2130  DGRGIPLDKQDPSAEALENITSE-----------LKVYGKRGVHKDTKLQDEGGKILEKD  1984
             DG+    + + PS ++   +  E           L V G   V  D+ L+D    + EK 
Sbjct  450   DGK----NSKPPSTKSAGKVKEEQGPSKSEKKMKLTVKGGAAVDPDSGLED-SAHVFEKG  504

Query  1983  GLLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENED  1807
             G +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++
Sbjct  505   GKIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKE  563

Query  1806  GAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-  1630
              AI+ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A 
Sbjct  564   DAIEHFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAG  615

Query  1629  VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVE-R  1453
               SKL   + + +K++   E  + A++E   D  ++P+G LS   ++     +       
Sbjct  616   TKSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSSYSVIFFGACCL  675

Query  1452  IRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINA  1285
             +++  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  
Sbjct  676   VQAVSDSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEV  732

Query  1284  ASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYG  1105
             A  L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y 
Sbjct  733   AYSLLRGGNEDGDKDPIDINYEKLKTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYD  789

Query  1104  VSVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYM  928
             + V +IF +E           ++L N+ LLW G+R++N    L  G   A    PV GYM
Sbjct  790   LKVVDIFRIEREGESQRYKPFRQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYM  849

Query  927   FGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGA  748
             FGK I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   
Sbjct  850   FGKGIYFADMVSKSANYCHTSQADPIGLVLLGEVALG-NMYELKNASHITK-LPKGKHSV  907

Query  747   KFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVK  568
             K  G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K
Sbjct  908   KGLGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLK  965

Query  567   YD  562
             ++
Sbjct  966   FN  967



>ref|XP_007102732.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Physeter catodon]
Length=1013

 Score =   234 bits (598),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 213/776 (27%), Positives = 364/776 (47%), Gaps = 69/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQD-------------PKNRPLK  2437
             + W+ C   T+ P RKE  +   E  + + L  L  + QD                    
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKIRKQDRIFPPEAGAPLAAAPLPSAA  374

Query  2436  EQVITV------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
                 TV      KPLS M I   G+L++     K+ IEK GGK+  +    +  + +  E
Sbjct  375   SAPATVNSAPPDKPLSNMKILTLGKLSQNKDEVKATIEKLGGKLTGTTNKASLCISTKKE  434

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
              ++  + K+ E  E  + VV E +L D S   K +Q L +  + S    + +  P++   
Sbjct  435   VDKM-NKKMEEVKEANVRVVSEDFLQDVSASTKSLQELLSTHLLSPWGAEVKAEPVEAVA  493

Query  2097  PSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLYN  1969
             P  ++   ++ +    +K  G     K  KL  +GG              +LEK G +++
Sbjct  494   PKGKSGAVLSKKSKGPVKEEGTNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFS  553

Query  1968  CALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKE  1792
               L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+ 
Sbjct  554   ATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIEH  612

Query  1791  FSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSKL  1615
             F++++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SKL
Sbjct  613   FTKLYEEKTGNAWHS----KNFTKHPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSKL  664

Query  1614  DPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKE  1435
                V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S   
Sbjct  665   PKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQGS  723

Query  1434  AGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
             +  Q+     + SN+++TL+P      +P  L + +D       + +++ DI  A  L+ 
Sbjct  724   SDSQI----LDLSNRFYTLIPHDFGMKKPPLLSN-SDSVQAKVEMLDNLLDIEVAYSLLR  778

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  ++KDS++ ++I KY++ T+        +Y + V +I
Sbjct  779   GGSDDSSKDPIDVNYEKLKTDIMVVDKDSEEAEIIRKYVKNTHATTHN---AYDLEVVDI  835

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  836   FKIEREGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  895

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+ 
Sbjct  896   FADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  953

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QVS+++L+ +K++
Sbjct  954   TPDPSASITM-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVSLKYLLKLKFN  1007



>ref|XP_006016655.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Alligator sinensis]
Length=1049

 Score =   235 bits (599),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 216/777 (28%), Positives = 370/777 (48%), Gaps = 72/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  294   STNDLKELLIANKQEVPSGESAILDRVADGMAFGALLPCEECKGQFMFKSDA-YYCSGDI  352

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD---PK-------------N  2449
             + W+ C   T++P RKE    IP+  ++ P     K K QD   P+             +
Sbjct  353   TAWTKCVAKTQSPKRKE--WVIPKEFREIPYLKKFKCKKQDRVFPREAAAVNTVLPSAAS  410

Query  2448  RPLKEQVI--TVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E+    T KPLS M I + G+L+R  +  K+ +E+ GGKV  +       + +  E
Sbjct  411   APLTEEASAPTDKPLSNMKILILGKLSRNKEEMKTTVEELGGKVTGTANKANLCISTQKE  470

Query  2274  RERGGSSKVAEAVERGIPVVREAWL--VDSIEKKEVQPLDAYDVAS----------DIAV  2131
              E+  + K+ E  E  + VV E +L  V S  K   + L  ++++S          +  V
Sbjct  471   VEKM-NKKMEEVKEAKVRVVSEEFLKDVKSSSKGFRELLSVHELSSWGAEVKQENMETTV  529

Query  2130  DGR--GIP-LDKQDPSAEALENITSE----LKVYGKRGVHKDTKLQDEGGKILEKDGLLY  1972
              G+  G P +       E      SE    L V G   V  D+ L+D    + EK G +Y
Sbjct  530   GGKSSGPPNMKSAGKVKEEQGTCKSEKKMKLTVKGGAAVDPDSGLED-SAHVFEKGGKIY  588

Query  1971  NCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  589   SATLGLVDIVKGTNSYYKLQLLEDDREIRYWVFRSWGRVG-TVIGSNKLEQMPSKEDAIE  647

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-VHSK  1618
              F  ++EE TGN + S    K   K P KFYPL++  G +      A+++L + A   SK
Sbjct  648   HFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVGAGTKSK  699

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L+ V++  S  
Sbjct  700   LPKSVQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILNDVQQAVSGG  758

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
                 Q+     + SN+++TL+P      +P  L +   I      + +++ DI  A  L+
Sbjct  759   GTDSQI----LDLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAYSLL  813

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + V +
Sbjct  814   RGGNEDGDKDPIDVNYEKLKTEIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLKVVD  870

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E           ++L N+ LLW G+R++N    L  G   A    PV GYMFGK +
Sbjct  871   IFKIEREGESQRYKPFRQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGV  930

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K  G+
Sbjct  931   YFADMVSKSANYCHTSQADPVGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKGLGK  988

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D +    + + ++VP G  +  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  989   TAPDPTATISY-EGVEVPLGNGM-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  1043



>ref|XP_010589425.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Loxodonta africana]
Length=1000

 Score =   234 bits (598),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 213/778 (27%), Positives = 362/778 (47%), Gaps = 72/778 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + + +G +  C  C G L   S   Y+C GD 
Sbjct  243   STNDLKELLIFNKQQVPSGESAILDRVADGIVFGALLPCEECSGQLVFKSDA-YYCTGDV  301

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRPLKEQVITV-------  2419
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P     +         
Sbjct  302   TAWTKCMVRTQTPNRKEW-VTPKEFREISYLKKLKIKKQDRLFPPEASAPVVAAPPPSKA  360

Query  2418  -------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                          KPLS M I   G+L+R  +  K+ IEK GGK+  +    +  + +  
Sbjct  361   TPPPTENSSAPADKPLSNMKILTLGKLSRNKEEVKAMIEKLGGKLTGTANKASVCISTKK  420

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPL---------------DAYDVA  2146
             E E+  + K+ E  E  + VV E +L D S   K +Q L               +  +V 
Sbjct  421   EVEKM-TKKMEEVKEANVRVVSEDFLQDVSGSTKSLQELLSVHVLSSWGAAVKVEPAEVV  479

Query  2145  SDIAVDGRGIPLDKQDPSAEALENITSE---LKVYGKRGVHKDTKLQDEGGKILEKDGLL  1975
             +  A  G  +P   + P  E   N + +   L + G   V  ++ L+     +LEK G +
Sbjct  480   APKAKSGAAVPKKSKGPVKEEGVNKSEKRMKLTLKGGAAVDPESGLE-HSAHVLEKSGKV  538

Query  1974  YNCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAI  1798
             ++  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI
Sbjct  539   FSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAI  597

Query  1797  KEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHS  1621
             + F +++EE TGN + S    K   K P KFYPL++  G +      A+++L +     S
Sbjct  598   EHFMKLYEEKTGNAWNS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKS  649

Query  1620  KLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRST  1441
             KL   V   +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S 
Sbjct  650   KLPKPVQELIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQALSQ  708

Query  1440  KEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRL  1273
               +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L
Sbjct  709   GSSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADSVQAKVEMLDNLLDIEVAYSL  763

Query  1272  IEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVE  1093
             +   S  +  DP+   Y KL   I  +++DS++ ++I KY++ T+        +Y + V 
Sbjct  764   LRGGSEDSSKDPIDVNYEKLKTEIKVVDRDSEEAEIIRKYVKNTHATTHN---AYDLEVV  820

Query  1092  NIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKA  916
             +IF +E           ++L N+ LLW G+R++N    L  G   A    PV GYMFGK 
Sbjct  821   DIFKIEREGENQRYKPFRQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKG  880

Query  915   IVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHG  736
             I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G
Sbjct  881   IYFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLG  938

Query  735   RKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             +   D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  939   KTTPDPSASITL-DGVEVPLGTGI-SSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFN  994



>ref|XP_547506.3| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Canis lupus 
familiaris]
Length=1043

 Score =   235 bits (599),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 214/777 (28%), Positives = 361/777 (46%), Gaps = 70/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  286   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  344

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRP---------------  2443
             + W+ C   T+ P RKE  +   E  + + L  L  K QD    P               
Sbjct  345   TAWTKCMVKTQTPSRKEW-VTPKEFREISYLKKLKIKKQDRIFPPETSAPVAAAPPPSTA  403

Query  2442  -----LKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                  +       KPLS M I   G+L+R     K+ IEK GGK+  +    +  + +  
Sbjct  404   LAPASVNSSTPPGKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK  463

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQ  2101
             E E+  + K+ E  E  I VV E +L D S   + +Q L +  V +    + +  P +  
Sbjct  464   EVEKM-NKKMEEVREASIRVVSEDFLRDVSDSTRSLQDLLSAHVLAPWGAEVKAEPAEPA  522

Query  2100  DPSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLY  1972
              P A++   ++ +    +K  G     K  KL  +GG              +LEK G ++
Sbjct  523   APKAKSGAALSKKSKGPVKEEGVNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVF  582

Query  1971  NCALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+
Sbjct  583   SATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQVPSKEEAIE  641

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIA-AVHSK  1618
              F +++EE TGN +      K   K P KFYPL++  G +      A+++L +     SK
Sbjct  642   HFMKLYEEKTGNAW----HAKNFTKHPKKFYPLEIDYGQDEE----AVKKLTVKPGTKSK  693

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S  
Sbjct  694   LPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQG  752

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L+
Sbjct  753   SSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNN-ADCVQAKVEMLDNLLDIEVAYSLL  807

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S  +  DP+   Y KL   I  +++DS++ + I KY++ T+        +Y + V +
Sbjct  808   RGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAETIRKYVKNTHATTHN---AYDLEVVD  864

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  865   IFKIEREGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGI  924

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  925   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  982

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S      D ++VP G  I  S  N++   YNEY VYD  QV++++L+ +K++
Sbjct  983   TTPDPSASITL-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFN  1037



>ref|XP_007071821.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Chelonia mydas]
Length=992

 Score =   234 bits (597),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 216/777 (28%), Positives = 365/777 (47%), Gaps = 72/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  ++ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  237   STNDLKELLIANKQEVPSGESALLDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  295

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD----------------PKN  2449
             + W+ C   T+ P RKE    IP+  ++       K K QD                  +
Sbjct  296   TAWTKCVAKTQTPNRKE--WIIPKEFREISYLKKFKCKKQDRAFPPESVAVNAVLPATAS  353

Query  2448  RPLKEQ--VITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E+  V   KPLS M I   G+L+R  +  K+ IE  GGKV  +    T  + +  E
Sbjct  354   APLTEKASVPADKPLSSMKILTLGKLSRNKEEVKAIIEDLGGKVTGTANKATLCISTQKE  413

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  + K+ E  E  + VV E +L D     K  Q L +    S           + ++
Sbjct  414   IEKM-TKKMEEVKEAKVRVVSEQFLQDVKSSSKGFQELLSLHALSPWGAEVKQEHTETSL  472

Query  2130  DGR--GIPLDKQDPSAEALENITS-----ELKVYGKRGVHKDTKLQDEGGKILEKDGLLY  1972
              G+  G+P  K     +  +  +      +L V G   V  D+ L+D    + EK G ++
Sbjct  473   GGKSSGLPNMKSAGKVKEEQGTSKSEKKMKLTVKGGAAVDPDSGLEDSA-HVFEKSGKIF  531

Query  1971  NCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  RG N +  +QL+    E R  ++   GRVG T    +KLE+  ++D AI+
Sbjct  532   SATLGLVDIVRGTNSYYKLQLLEDDREIRYWVFRSWGRVG-TVIGSNKLEQMPSKDDAIE  590

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-VHSK  1618
              F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L ++A   SK
Sbjct  591   HFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTVSAGTKSK  642

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V + +K++   E  + A++E   D  ++P+G LS   ++    ++LH  ++ ++  
Sbjct  643   LPKPVQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAY-SILH--DKRQAVS  699

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
             + G   + L  + SN+++TL+P      +P  L +   I      + +++ DI  A  L+
Sbjct  700   DGGSDSQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEHI-QAKVQMLDNLLDIEVAYSLL  756

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                +     DP+   Y KL  +I  ++KDS++ K+I +Y++ T+        +Y + V +
Sbjct  757   RGGNEDGDKDPIDINYEKLKTNIKVIDKDSEEAKIIKQYVKNTHASTHN---AYDLKVVD  813

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E           ++L N+ LLW G+R++N       G   A    PV GYMFGK I
Sbjct  814   IFKIEREGENQRYKPFRQLHNRQLLWHGSRATNFAGIFSQGLRIAPPEAPVTGYMFGKGI  873

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K  G+
Sbjct  874   YFADMVSKSANYCHTSQTDPIGLILLGEVALG-NMHELKNASHITK-LPKGKHSVKGLGK  931

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D S      D + +P G  I  S  +++   YNEY VYD  QV++++L+ +K++
Sbjct  932   TAPDPSATITL-DGVDIPLGNGI-PSGISDTCLLYNEYIVYDVAQVNLKYLLKLKFN  986



>ref|XP_008628789.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Corvus brachyrhynchos]
Length=960

 Score =   234 bits (596),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 214/784 (27%), Positives = 363/784 (46%), Gaps = 95/784 (12%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQDPKNRPLKEQVITV------  2419
             + W+ C   T+ P RK+    IP+  ++ P     K K QD   R      +TV      
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQD---RIFPPDAVTVSSAPPP  327

Query  2418  ---------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVS  2284
                            KPL+ M I + G+L++  +  KS +E  GGK+  +    T  + +
Sbjct  328   SASAPLSETVSAPRDKPLTNMKILVVGKLSKNKEEVKSIVEDLGGKMTTTANKATLCIST  387

Query  2283  PAERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------D  2140
               + E+  S K+ E  E  + VV EA+L D     K  Q L +    S           +
Sbjct  388   QKDVEKM-SKKMEEVKEAKVRVVSEAFLQDVKSSSKAFQELVSLHALSPWGAEVKMEHEE  446

Query  2139  IAVDGRGIPLDKQDPSAEALENITSE-----------LKVYGKRGVHKDTKLQDEGGKIL  1993
             +AVDG+      + PS ++   +  E           L V G   V  D+ L+D    + 
Sbjct  447   MAVDGKS----SKPPSTKSTGKVKEEQGPSKSEKKMKLTVKGGAAVDPDSGLED-SAHVF  501

Query  1992  EKDGLLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWE  1816
             EK G +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  
Sbjct  502   EKGGKIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMP  560

Query  1815  NEDGAIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI  1636
             +++ AI++F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L +
Sbjct  561   SKEDAIEQFLNLYEEKTGNSWHS----KNFTKYPKKFYPLEIDYGQDEE----AVRKLTV  612

Query  1635  AA-VHSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFV  1459
              A   SKL   + + +K++   E  + A++E   D  ++P+G LS   ++          
Sbjct  613   GAGTKSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSA--------  664

Query  1458  ERIRSTKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDI  1291
                 +  ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI
Sbjct  665   ----AVSDSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDI  717

Query  1290  NAASRLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDIS  1111
               A  L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +
Sbjct  718   EVAYSLLRGGNEDGDKDPIDINYEKLKTDIKVVDKDSEEAKIIKQYVKNTHAATHN---A  774

Query  1110  YGVSVENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPG  934
             Y + V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV G
Sbjct  775   YDLKVVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTG  834

Query  933   YMFGKAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKL  754
             YMFGK I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K 
Sbjct  835   YMFGKGIYFADMVSKSANYCHTSQADPIGLVLLGEVALG-NMYELKNASHITK-LPKGKH  892

Query  753   GAKFHGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVA  574
               K  G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ 
Sbjct  893   SVKGLGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLK  950

Query  573   VKYD  562
             +K++
Sbjct  951   LKFN  954



>ref|XP_007481564.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Monodelphis 
domestica]
Length=895

 Score =   233 bits (594),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 211/777 (27%), Positives = 365/777 (47%), Gaps = 72/777 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    D  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  140   STNDLKELLIANKQEVPSGDSAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  198

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD---------PKNRPLKEQV  2428
             + W+ C   T+ P RKE    IP+  ++       K K QD         P ++PL   V
Sbjct  199   TAWTKCVAKTQTPNRKE--WIIPKEFREISYLKKFKCKKQDRAFPPEANAPPSKPLPSSV  256

Query  2427  I---TV-------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPA  2278
                 TV       KPLS M I   G+L+R     K+ IE+ GGK+  +    +  + +  
Sbjct  257   AAPPTVNSSAQPDKPLSNMKILTLGKLSRNKDEMKATIEELGGKLTGTANKASLCISTKK  316

Query  2277  ERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLD--  2107
             E E+  + K+ E  E  + VV E +L D S   K +Q L +  + S    + +  P++  
Sbjct  317   EVEKM-NKKMEEVKEANVRVVSEDFLKDISASGKSLQELLSLHILSSWGTEVKQEPVEVK  375

Query  2106  -------------KQDPSAEALENITSELKVYGKRG--VHKDTKLQDEGGKILEKDGLLY  1972
                           Q    E       ++K+  K G  V  D+ L+D    +LEK+G ++
Sbjct  376   AGGKSGPSSKKSKGQVKEEEGTSKSEKKMKLTLKGGAAVDPDSGLED-SAHVLEKNGKIF  434

Query  1971  NCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIK  1795
             +  L + D  +G N +  +QL+    E R  ++   GRVG T    +KLE+  + + AI 
Sbjct  435   SATLGLVDIVKGTNSYYKLQLLEDDREIRYWIFRSWGRVG-TVIGSNKLEQMSSREDAID  493

Query  1794  EFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-VHSK  1618
              F +++EE TGN + S        K P KFYPL++  G +      A+++L ++A   SK
Sbjct  494   HFCKLYEEKTGNSWHSTN----FTKYPKKFYPLEIDYGQDEE----AVKKLTVSAGTKSK  545

Query  1617  LDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTK  1438
             L   V N +K++   E  + A++E   D  ++P+G LS   ++    ++L  V+++ S  
Sbjct  546   LPIPVQNLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQNAY-SILSEVQQVVSQG  604

Query  1437  EAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLI  1270
              +  Q+     + SN+++TL+P      +P  L +  D       + +++ DI  A  L+
Sbjct  605   GSDSQI----LDLSNRFYTLIPHDFGMKKPPLLNNI-DCVQAKVEMLDNLLDIEVAYSLL  659

Query  1269  EDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVEN  1090
                S     DP+   Y KL   I  ++++S++  +I +Y++ T+        +Y + + +
Sbjct  660   RGGSEDGSKDPIDVNYEKLKTDIKVVDQNSEEADIIRQYVKNTHATTHN---AYDLEIID  716

Query  1089  IFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAI  913
             IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I
Sbjct  717   IFKIERDGESQRYKPFKQLHNRRLLWHGSRATNYAGILSQGLRIAPPEAPVTGYMFGKGI  776

Query  912   VCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGR  733
               +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+
Sbjct  777   YFADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGK  834

Query  732   KKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
                D +      D +++P G  +  S  +++   YNEY +YD  QV++++L+ +K++
Sbjct  835   TTPDPTASITL-DGVEIPLGTGV-SSGVSDTCLLYNEYIIYDIAQVNLKYLLKLKFN  889



>ref|XP_008159430.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Eptesicus fuscus]
Length=972

 Score =   234 bits (596),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 213/778 (27%), Positives = 362/778 (47%), Gaps = 72/778 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + + +G +  C  C G L   S   Y+C GD 
Sbjct  215   STNDLKELLIFNKQQVPSGESAILDRVADGIVFGALLPCEECSGQLVFKSDA-YYCTGDI  273

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTP-LSDLIKKHQDPKNRPLKEQVITV------  2419
             + W+ C   T+ P RKE    IP+  ++ P L  L  K QD    P     +        
Sbjct  274   TAWTKCMVKTQTPNRKE--WVIPKEFREIPYLKKLKVKKQDRIFPPETSAPVAAAPPPPT  331

Query  2418  --------------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSP  2281
                           KPLS M I   G+L R+    K+ +EK GGK+  +    +  + + 
Sbjct  332   ASAPTTTNSSAPPDKPLSNMKILTLGKLARSKDEVKATVEKLGGKLTGTANKASLCISTK  391

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDK  2104
              E E+  S K+ E  E  + VV E +L D +   K  Q L +  + S    + +  P++ 
Sbjct  392   KEVEKM-SKKMEEVKEGNVRVVSEDFLQDVAASTKSFQELVSAHLLSPWGAEVKEEPVEV  450

Query  2103  QDPSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLL  1975
               P A++   ++ +    +K  G     K  KL  +GG              +LEK G +
Sbjct  451   VAPKAKSGAAVSKKSKAPVKEEGNNKSEKTVKLTLKGGAAVDPDSGLERSAHVLEKGGKV  510

Query  1974  YNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAI  1798
             ++  L + D  +G N +  +QL+   +   +  +R  GRVG T    +KLE+  +++ A+
Sbjct  511   FSATLGLVDIVKGTNSYYKLQLLEDDKGSRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAV  569

Query  1797  KEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHS  1621
             + F +++EE TGN + S        K P KFYPL++  G +      A+++L +     S
Sbjct  570   EHFMKLYEEKTGNAWHSEN----FTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKS  621

Query  1620  KLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRST  1441
             KL   V N +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S 
Sbjct  622   KLPKPVQNLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQALSQ  680

Query  1440  KEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRL  1273
               +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L
Sbjct  681   GSSDSQI----LDLSNRFYTLIPHDFGMKKPPLLSN-ADSVQAKVEMLDNLLDIEVAYSL  735

Query  1272  IEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVE  1093
             +   S  +  DP+   Y KL   I  ++KDS++ K+I KY++ T+        +Y + V 
Sbjct  736   LRGGSEDSSKDPIDVNYEKLKTDIKVVDKDSEEAKVIRKYVKNTHATTHN---AYDLKVL  792

Query  1092  NIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKA  916
              IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK 
Sbjct  793   EIFKIEREGEHQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKG  852

Query  915   IVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHG  736
             I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G
Sbjct  853   IYFADMVSKSANYCHTSQGDPVGLILLGEVALG-NMYELKHALHVSK-LPKGKHSVKGLG  910

Query  735   RKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             +   D S      D ++VP G  +  S  +++   YNEY VYD  QV++++L+ +K++
Sbjct  911   KTTPDPSASITL-DGVEVPLGTGV-SSGVDDTSLLYNEYIVYDTAQVNLKYLLKLKFN  966



>ref|XP_007464233.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Lipotes vexillifer]
Length=1013

 Score =   234 bits (597),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 215/776 (28%), Positives = 364/776 (47%), Gaps = 69/776 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + M +G +  C  C G L   S   Y+C GD 
Sbjct  257   STNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDA-YYCTGDV  315

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIKKHQDPKNRP-------------LK  2437
             + W+ C   T+ P RKE  +   E  + + L  L  + QD    P               
Sbjct  316   TAWTKCMVKTQTPNRKEW-VTPKEFREISYLKKLKIRKQDRIFPPETSTPLAAAPLPSAA  374

Query  2436  EQVITV------KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
                 TV      KPLS M I   G+L+R     K+ IEK GGK+  +V   +  + +  E
Sbjct  375   SAPATVNSAPPDKPLSNMKILTLGKLSRNKDEVKATIEKLGGKLTGTVNKASLCISTKKE  434

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDKQD  2098
              ++  + K+ E  E  + VV E +L D S   K +Q L +  + S    + +   ++   
Sbjct  435   VDKM-NKKMEEVKEANVRVVSEDFLQDISASTKSLQELLSTHLLSPWGAEVKAERVEAVA  493

Query  2097  PSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLLYN  1969
             P  ++   ++ +    +K  G     K  KL  +GG              +LEK G +++
Sbjct  494   PKGKSGAVLSKKSKGPVKEEGTNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFS  553

Query  1968  CALSVCDQGRGLNDFCIMQLIVA-PENRLHMYYRKGRVGDTARVDDKLEEWENEDGAIKE  1792
               L + D  +G N +  +QL+    E+R  ++   GRVG T    +KLE+  +++ AI+ 
Sbjct  554   ATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAIEH  612

Query  1791  FSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHSKL  1615
             F++++EE TGN + S    K   K P KFYPL++  G +      A+++L +     SKL
Sbjct  613   FTKLYEEKTGNAWHS----KNFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKSKL  664

Query  1614  DPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRSTKE  1435
                V + +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S   
Sbjct  665   PKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQAVSQGS  723

Query  1434  AGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRLIE  1267
             +  Q+     + SN+++TL+P      +P  L   +D       + +++ DI  A  L+ 
Sbjct  724   SDSQI----LDLSNRFYTLIPHDFGMKKPPLLSS-SDSVQAKVEMLDNLLDIEVAYSLLR  778

Query  1266  DMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVENI  1087
               S  +  DP+   Y KL   I  ++KDS++ ++I KY++ T+        +Y + V +I
Sbjct  779   GGSDDSSKDPIDVNYEKLRTDIMVVDKDSEEAEIIRKYVKNTHATTHN---AYDLEVVDI  835

Query  1086  FAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKAIV  910
             F +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK I 
Sbjct  836   FKIEREGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY  895

Query  909   CSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHGRK  730
              +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G+ 
Sbjct  896   FADMVSKSANYCHTSQGDPIGLILLGEVALG-NMYELKHASHISK-LPKGKHSVKGLGKT  953

Query  729   KTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
               D S      D ++VP G  I  S  N++   YNEY VYD  QVS+++L+ +K++
Sbjct  954   TPDPSASITM-DGVEVPLGTGI-SSGVNDTCLLYNEYIVYDIAQVSLKYLLKLKFN  1007



>ref|XP_005441299.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Falco cherrug]
Length=969

 Score =   234 bits (596),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 216/780 (28%), Positives = 366/780 (47%), Gaps = 78/780 (10%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q+    +  I+ R  + M +G +  C  C G     S   Y+C GD 
Sbjct  214   STNDLKELLIANKQEVPSGENAILDRVADGMAFGALLPCEECKGQFVFKSDA-YYCSGDI  272

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTPLSDLIK-KHQD--------PKNR-------  2446
             + W+ C   T+ P RK+    IP+  ++ P     K K QD        P N        
Sbjct  273   TAWTKCVAKTQTPNRKD--WVIPKEFREIPYLKKFKCKKQDRVFPPDAAPVNSVPPPSAS  330

Query  2445  -PLKEQVITV--KPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSPAE  2275
              PL E V     KPL+ M I + G+L++  +  K  +E  GGK+  +    T  + +  +
Sbjct  331   APLAETVSAPRDKPLTNMKILVLGKLSKNKEEVKGIVEDLGGKMTTTANKATLCISTQKD  390

Query  2274  RERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVAS-----------DIAV  2131
              E+  S K+ E  E  + VV E +L D     K+ Q L +    S           ++AV
Sbjct  391   VEKM-SKKMEEVKEAKVRVVSEEFLQDVKSSSKDFQELVSLHALSPWGAEVKMEHEEMAV  449

Query  2130  DGR----------GIPLDKQDPSAEALENITSELKVYGKRGVHKDTKLQDEGGKILEKDG  1981
             DG+          G   ++Q PS    +    +L V G   V  D+ L+D    + EK G
Sbjct  450   DGKCSKPPSMKSAGKVKEEQGPSKSEKK---MKLTVKGGAAVDPDSGLED-SAHVFEKGG  505

Query  1980  LLYNCALSVCDQGRGLNDFCIMQLIVAP-ENRLHMYYRKGRVGDTARVDDKLEEWENEDG  1804
              +++  L + D  +G N +  +QL+    ENR  ++   GRVG T    +KLE+  +++ 
Sbjct  506   KIFSATLGLVDIVKGTNSYYKLQLLEDDRENRYWVFRSWGRVG-TVIGSNKLEQMPSKED  564

Query  1803  AIKEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGIAA-V  1627
             A++ F  ++EE TGN + S    K   K P KFYPL++  G +      A+R+L + A  
Sbjct  565   AVEHFLNLYEEKTGNSWHS----KSFTKYPKKFYPLEIDYGQDEE----AVRKLTVGAGT  616

Query  1626  HSKLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIR  1447
              SKL   + + +K++   E  + A++E   D  ++P+G LS   ++         V+ + 
Sbjct  617   KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYXXXXXLVQAVS  676

Query  1446  STKEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAAS  1279
                ++G + + L  + SN+++TL+P      +P  L +   I      + +++ DI  A 
Sbjct  677   ---DSGSESQIL--DLSNRFYTLIPHDFGMKKPPLLNNLEYI-QAKVQMLDNLLDIEVAY  730

Query  1278  RLIEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVS  1099
              L+   +     DP+   Y KL   I  ++KDS++ K+I +Y++ T+        +Y + 
Sbjct  731   SLLRGGNEDGDKDPIDINYEKLRTDIKVVDKDSEEAKIIKQYVKNTHAATHN---AYDLK  787

Query  1098  VENIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFG  922
             V +IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFG
Sbjct  788   VVDIFRIEREGESQRYKPFKQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFG  847

Query  921   KAIVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKF  742
             K I  +D  +++A Y  T+   P G ++L   ++G  + E  +    TK L + K   K 
Sbjct  848   KGIYFADMVSKSANYCHTSQADPIGLILLGEVALG-NMYELKNASHITK-LPKGKHSVKG  905

Query  741   HGRKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
              G+   D +        ++VP G  I  +  N++   YNEY VYD  QV++++L+ +K++
Sbjct  906   LGKTAPDPTATTTL-GGVEVPLGNGI-STGINDTCLLYNEYIVYDVAQVNLKYLLKLKFN  963



>ref|XP_005880205.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Myotis brandtii]
Length=969

 Score =   233 bits (595),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 211/778 (27%), Positives = 360/778 (46%), Gaps = 72/778 (9%)
 Frame = -2

Query  2757  SVQQMRQILQDNAQDSSGSDETIVPRCQEIMFYGPVDKCPVCGGALECSSGGTYHCKGDF  2578
             S   ++++L  N Q     +  I+ R  + + +G +  C  C G L   S   Y+C GD 
Sbjct  212   STNDLKELLIFNKQQVPSGESAILDRVADGIVFGALLPCEECSGQLVFKSDA-YYCTGDI  270

Query  2577  SEWSSCSYSTRNPPRKEEPLRIPESVQKTP-LSDLIKKHQDPKNRP--------------  2443
             + W+ C   T+ P RKE     P+  ++ P L  L  K QD    P              
Sbjct  271   TAWTKCMVRTQTPNRKE--WVTPKEFREIPYLKKLKVKKQDRLFPPETSAPVAAAPPPST  328

Query  2442  ------LKEQVITVKPLSGMMISLSGRLTRTHQYWKSQIEKNGGKVANSVIGVTCLVVSP  2281
                   +       KPLS M I   G+L+R     K+ +EK GGK+  +    +  + + 
Sbjct  329   ASAPTTVNSSAPPDKPLSNMKILALGKLSRNKDEVKATVEKLGGKLTGTANKASLCISTK  388

Query  2280  AERERGGSSKVAEAVERGIPVVREAWLVD-SIEKKEVQPLDAYDVASDIAVDGRGIPLDK  2104
              E E+  + K+ E  E  I VV E +L D +   K  Q L +  + S      +  P++ 
Sbjct  389   KEVEKM-NKKMEEVKEGNIRVVSEDFLQDVAASTKSFQELVSAHLLSPWGAAVKEEPIEV  447

Query  2103  QDPSAEALENITSE----LKVYGKRGVHKDTKLQDEGGK-------------ILEKDGLL  1975
               P  ++   ++ +    +K  G     K  KL  +GG              +LEK G +
Sbjct  448   VAPKPKSGAAVSKKSKAPVKEEGNNKSEKTVKLTLKGGAAVDPDSGLERSAHVLEKGGKV  507

Query  1974  YNCALSVCDQGRGLNDFCIMQLIVAPENRLHMYYRK-GRVGDTARVDDKLEEWENEDGAI  1798
             ++  L + D  +G N +  +QL+   +   +  +R  GRVG T    +KLE+  +++ A+
Sbjct  508   FSATLGLVDIVKGTNSYYKLQLLEDDKGSRYWIFRSWGRVG-TVIGSNKLEQMPSKEDAV  566

Query  1797  KEFSRIFEELTGNEFLSREREKKIQKKPHKFYPLDVADGIEVRHGGLALRQLGI-AAVHS  1621
             + F +++EE TGN + S    +   K P KFYPL++  G +      A+++L +     S
Sbjct  567   EHFMKLYEEKTGNAWHS----ENFTKYPKKFYPLEIDYGQDEE----AVKKLTVNPGTKS  618

Query  1620  KLDPMVANFMKILCSQEIYRYALMEMGYDYPEIPIGMLSDVHLERCEDTLLHFVERIRST  1441
             KL   V N +K++   E  + A++E   D  ++P+G LS   ++    ++L  V++  S 
Sbjct  619   KLPKPVQNLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAY-SILSEVQQALSQ  677

Query  1440  KEAGQQVEALWAEFSNKWFTLMPS----TRPFYLRDFADIADHAASVFESVRDINAASRL  1273
               +  Q+     + SN+++TL+P      +P  L + AD       + +++ DI  A  L
Sbjct  678   GSSDSQI----LDLSNRFYTLIPHDFGMKKPPLLSN-ADSVQAKVEMLDNLLDIEVAYSL  732

Query  1272  IEDMSGSTLDDPLYDRYVKLGCSISALEKDSDDYKMILKYLEKTYDPVRVGDISYGVSVE  1093
             +   S  +  DP+   Y KL   I  ++KDS++ K+I KY++ T+        +Y + V 
Sbjct  733   LRGGSDDSSKDPIDVNYEKLKTDIKVVDKDSEEAKIIRKYVKNTHATTHN---AYDLKVL  789

Query  1092  NIFAVEPSA-CPSLDDMKKLPNKVLLWCGTRSSNLLRHLQNGFLPAVCSLPVPGYMFGKA  916
              IF +E           K+L N+ LLW G+R++N    L  G   A    PV GYMFGK 
Sbjct  790   EIFKIEREGENQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKG  849

Query  915   IVCSDAAAEAAKYGFTAVDRPEGFLVLAVASMGEEIMEFSSPPEDTKSLEQKKLGAKFHG  736
             I  +D  +++A Y  T+   P G ++L   ++G  + E       +K L + K   K  G
Sbjct  850   IYFADMVSKSANYCHTSQGDPVGLVLLGEVALG-NMYELKHALHVSK-LPKGKHSVKGLG  907

Query  735   RKKTDESEHFVWKDDIKVPCGRLIEESQHNNSPFDYNEYAVYDPQQVSIRFLVAVKYD  562
             +   D S      D ++VP G  +  S  +++   YNEY VYD  QV++++L+ +K++
Sbjct  908   KTTPDPSASITL-DGVEVPLGNGV-SSGVDDTSLLYNEYIVYDTAQVNLKYLLKLKFN  963



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10013908030048