BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82710_g1_i1 len=511 path=[1:0-510]

Length=511
                                                                      Score     E

emb|CDP06149.1|  unnamed protein product                              66.2    2e-10   
ref|XP_011098097.1|  PREDICTED: uncharacterized protein LOC105176861  61.2    4e-09   
ref|XP_011009814.1|  PREDICTED: uncharacterized protein LOC105114819  58.2    4e-08   
ref|XP_002313367.2|  hypothetical protein POPTR_0009s05280g           57.4    8e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006375589.1|  hypothetical protein POPTR_0014s16960g           57.4    8e-08   
ref|XP_002320539.2|  heavy-metal-associated domain-containing fam...  57.0    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011012621.1|  PREDICTED: uncharacterized protein LOC105116833  56.6    1e-07   
ref|XP_011012623.1|  PREDICTED: uncharacterized protein LOC105116834  56.6    1e-07   
ref|XP_006387353.1|  hypothetical protein POPTR_1183s00200g           56.6    2e-07   
ref|XP_009783945.1|  PREDICTED: uncharacterized protein LOC104232429  55.8    4e-07   
ref|XP_011032085.1|  PREDICTED: uncharacterized protein LOC105131026  54.3    8e-07   
ref|XP_011032087.1|  PREDICTED: uncharacterized protein LOC105131...  53.9    1e-06   
ref|XP_011032086.1|  PREDICTED: uncharacterized protein LOC105131...  54.3    1e-06   
ref|XP_010038748.1|  PREDICTED: uncharacterized protein LOC104427341  53.1    2e-06   
emb|CDP08855.1|  unnamed protein product                              52.4    4e-06   
ref|XP_010038750.1|  PREDICTED: uncharacterized protein LOC104427343  52.4    5e-06   
gb|KCW47636.1|  hypothetical protein EUGRSUZ_K01379                   52.0    5e-06   
ref|XP_006379054.1|  hypothetical protein POPTR_0009s05300g           52.0    7e-06   
ref|XP_002268731.1|  PREDICTED: uncharacterized protein LOC100255094  52.0    7e-06   Vitis vinifera
dbj|BAD17465.1|  hypothetical protein                                 51.6    7e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KCW47638.1|  hypothetical protein EUGRSUZ_K01380                   52.0    8e-06   
ref|XP_010036116.1|  PREDICTED: uncharacterized protein LOC104425196  52.0    8e-06   
ref|XP_002263660.1|  PREDICTED: uncharacterized protein LOC100258045  51.6    9e-06   Vitis vinifera
ref|XP_010542497.1|  PREDICTED: uncharacterized protein LOC104815685  51.6    1e-05   
ref|XP_010036113.1|  PREDICTED: uncharacterized protein LOC104425192  51.2    1e-05   
ref|XP_006349960.1|  PREDICTED: uncharacterized protein LOC102599063  51.6    1e-05   
gb|KDP22993.1|  hypothetical protein JCGZ_01715                       50.8    2e-05   
ref|XP_010241736.1|  PREDICTED: uncharacterized protein LOC104586261  50.1    2e-05   
ref|XP_011091863.1|  PREDICTED: uncharacterized protein LOC105172...  49.7    4e-05   
ref|XP_010038749.1|  PREDICTED: uncharacterized protein LOC104427342  50.8    4e-05   
ref|XP_004486553.1|  PREDICTED: uncharacterized protein LOC101501843  48.5    5e-05   
ref|XP_011091871.1|  PREDICTED: uncharacterized protein LOC105172...  49.3    5e-05   
ref|XP_010036115.1|  PREDICTED: uncharacterized protein LOC104425195  49.7    5e-05   
ref|XP_004252124.1|  PREDICTED: uncharacterized protein LOC101267...  48.5    5e-05   
ref|XP_002533038.1|  metal ion binding protein, putative              49.3    7e-05   Ricinus communis
ref|XP_006583442.1|  PREDICTED: uncharacterized protein LOC100812612  48.9    9e-05   
ref|XP_004243215.1|  PREDICTED: uncharacterized protein LOC101251005  48.9    1e-04   
ref|XP_004243214.1|  PREDICTED: uncharacterized protein LOC101250708  49.3    1e-04   
gb|AES71738.2|  metal ion-binding protein, putative                   48.1    1e-04   
gb|KDP22991.1|  hypothetical protein JCGZ_01713                       48.5    1e-04   
gb|KEH15709.1|  heavy metal transport/detoxification superfamily ...  47.8    1e-04   
ref|XP_003594348.1|  hypothetical protein MTR_2g027600                47.8    1e-04   
ref|NP_001149591.1|  ATFP4                                            48.9    1e-04   Zea mays [maize]
ref|XP_003601487.1|  hypothetical protein MTR_3g082210                48.1    1e-04   
gb|KDP22995.1|  hypothetical protein JCGZ_01717                       48.1    1e-04   
ref|XP_008794762.1|  PREDICTED: uncharacterized protein LOC103710688  48.1    2e-04   
ref|XP_010036114.1|  PREDICTED: uncharacterized protein LOC104425194  48.1    2e-04   
gb|ACF84352.1|  unknown                                               48.5    2e-04   Zea mays [maize]
gb|KHN44736.1|  hypothetical protein glysoja_032075                   48.1    2e-04   
ref|XP_003533352.1|  PREDICTED: uncharacterized protein LOC100797364  48.1    2e-04   
gb|KDP22996.1|  hypothetical protein JCGZ_01718                       47.8    2e-04   
ref|XP_007049439.1|  Heavy metal transport/detoxification superfa...  47.8    2e-04   
gb|KHF99125.1|  Fimbrial                                              47.8    2e-04   
ref|XP_006348967.1|  PREDICTED: uncharacterized protein LOC102605417  47.8    2e-04   
gb|KDP22994.1|  hypothetical protein JCGZ_01716                       47.8    2e-04   
ref|XP_007020383.1|  Heavy metal transport/detoxification superfa...  47.4    3e-04   
ref|XP_009591620.1|  PREDICTED: uncharacterized protein LOC104088617  46.6    3e-04   
ref|XP_009419204.1|  PREDICTED: uncharacterized protein LOC103999...  47.0    3e-04   
ref|XP_009419205.1|  PREDICTED: uncharacterized protein LOC103999...  47.0    4e-04   
ref|XP_006469401.1|  PREDICTED: uncharacterized protein LOC102626...  47.0    4e-04   
ref|XP_010096497.1|  hypothetical protein L484_017949                 46.2    4e-04   
ref|XP_006447867.1|  hypothetical protein CICLE_v10017001mg           47.8    4e-04   
ref|XP_008669289.1|  PREDICTED: uncharacterized protein LOC103646...  46.6    5e-04   
ref|XP_002266819.2|  PREDICTED: uncharacterized protein LOC100242530  47.4    6e-04   Vitis vinifera
ref|XP_009625093.1|  PREDICTED: uncharacterized protein LOC104116027  46.6    6e-04   
gb|KDO74056.1|  hypothetical protein CISIN_1g033712mg                 46.6    6e-04   
ref|XP_009789253.1|  PREDICTED: uncharacterized protein LOC104236903  47.0    7e-04   
ref|XP_006469400.1|  PREDICTED: uncharacterized protein LOC102626...  47.0    7e-04   
ref|XP_010529393.1|  PREDICTED: uncharacterized protein LOC104806...  45.4    8e-04   
ref|XP_007204171.1|  hypothetical protein PRUPE_ppa017127mg           46.2    9e-04   
ref|XP_006348966.1|  PREDICTED: uncharacterized protein LOC102605080  46.2    9e-04   
ref|XP_010529392.1|  PREDICTED: uncharacterized protein LOC104806...  45.4    0.001   



>emb|CDP06149.1| unnamed protein product [Coffea canephora]
Length=185

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (60%), Gaps = 2/102 (2%)
 Frame = -1

Query  466  QKAVIKLEVNGKRPASMAKKMGVGMLKAILPFESVSECFNHTAPQNKSKAMQIAVGFHGV  287
            +K VIK+ ++G++    A  M + ++KA++P E +      +A +NK KAMQI     GV
Sbjct  41   KKVVIKVSLHGEKSRPKAVDMLIQVMKAMMPCELLWNQLKPSAAKNKIKAMQIVARTRGV  100

Query  286  NSAGLEGEGKDELVVKG--VFDAVELVKLLREKVGGATIKSV  167
             S  L+GE K++LVV G   FD V+L  LLR  +G A I SV
Sbjct  101  ASIALDGEEKNQLVVSGDDDFDPVKLATLLRRHLGIANIVSV  142



>ref|XP_011098097.1| PREDICTED: uncharacterized protein LOC105176861 [Sesamum indicum]
Length=111

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = -1

Query  466  QKAVIKLEVNGKR--PASMAKKMGVGMLKAILPFESVSECFNHTAPQNKSKAMQIAVGFH  293
            QK VIK+  +G+R  PA  A K+ + +LK ++P++ + +  + +  +  +KAM+IAV   
Sbjct  3    QKIVIKVWTDGQRCRPAK-AMKIVIYVLKLMMPYDIIWKKSSISTAKITTKAMKIAVTSP  61

Query  292  GVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            GV S  L GE K++LVV G   DAV L +++R+ +G A + SV
Sbjct  62   GVASVALTGEEKNQLVVTGEGVDAVNLTRVIRQNIGFAVLLSV  104



>ref|XP_011009814.1| PREDICTED: uncharacterized protein LOC105114819 [Populus euphratica]
Length=121

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -1

Query  343  TAPQNKSKAMQIAVGFHGVNSAGLEGEGKDEL-VVKGVFDAVELVKLLREKVGGATIKSV  167
            + P+++SK++QIAVGF GV SAGL G+ K ++ VV    DAVEL   LR+KVG A I SV
Sbjct  12   SGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLRKKVGYAEIVSV  71



>ref|XP_002313367.2| hypothetical protein POPTR_0009s05280g [Populus trichocarpa]
 gb|EEE87322.2| hypothetical protein POPTR_0009s05280g [Populus trichocarpa]
Length=114

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  337  PQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            P+++SKA+QIAVG  GV SAGL GE K ++ V G   DAV+L  LLR+KVG A + SV
Sbjct  14   PKSRSKALQIAVGLSGVESAGLGGEDKSQIEVVGDGVDAVQLTNLLRKKVGYAELASV  71



>ref|XP_006375589.1| hypothetical protein POPTR_0014s16960g [Populus trichocarpa]
 gb|ERP53386.1| hypothetical protein POPTR_0014s16960g [Populus trichocarpa]
Length=121

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  337  PQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            P+++SK++QIAVGF GV SAGL G+ K ++ V G   DAVEL   LR+KVG A I SV
Sbjct  14   PKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGHGVDAVELTNCLRKKVGYAEIVSV  71



>ref|XP_002320539.2| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE98854.2| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
Length=123

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  337  PQNKSKAMQIAVGFHGVNSAGLEGEGKDEL-VVKGVFDAVELVKLLREKVGGATIKSV  167
            P+++SK++QIAVGF GV SAGL G+ K ++ VV    DAVEL   LR+KVG A I SV
Sbjct  16   PKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNRLRKKVGYAEIVSV  73



>ref|XP_011012621.1| PREDICTED: uncharacterized protein LOC105116833 [Populus euphratica]
Length=121

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  337  PQNKSKAMQIAVGFHGVNSAGLEGEGKDEL-VVKGVFDAVELVKLLREKVGGATIKSV  167
            P+++SK++QIAVGF GV SAGL G+ K ++ VV    DAVEL   LR+KVG A + SV
Sbjct  14   PKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLRKKVGYAELVSV  71



>ref|XP_011012623.1| PREDICTED: uncharacterized protein LOC105116834 [Populus euphratica]
Length=121

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  337  PQNKSKAMQIAVGFHGVNSAGLEGEGKDEL-VVKGVFDAVELVKLLREKVGGATIKSV  167
            P+++SK++QIAVGF GV SAGL G+ K ++ VV    DAVEL   LR+KVG A + SV
Sbjct  14   PKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLRKKVGYAELVSV  71



>ref|XP_006387353.1| hypothetical protein POPTR_1183s00200g [Populus trichocarpa]
 gb|ERP46267.1| hypothetical protein POPTR_1183s00200g [Populus trichocarpa]
Length=128

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  337  PQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            P+++SKA+QIAVG  GV SAGL G+ K ++ V G   DAV+L  LLR+KVG A + SV
Sbjct  28   PKSRSKALQIAVGLSGVESAGLGGQDKSQIEVVGDGVDAVQLTNLLRKKVGYAELASV  85



>ref|XP_009783945.1| PREDICTED: uncharacterized protein LOC104232429 [Nicotiana sylvestris]
Length=149

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 10/105 (10%)
 Frame = -1

Query  466  QKAVIKLEVNGKRPASMAKKMGVGMLKAILPFESVSEC----FNHTAPQNKSKAMQIAVG  299
            +K VIK+ +NG    S+ KK  +  LK     + +++C    +  +  +N+SK + IA  
Sbjct  3    KKVVIKVSINGNS-HSILKKFLMDFLK----LKYLAKCWGNNYQDSRSKNQSKVLLIAAK  57

Query  298  FHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
              GV    +EGE K+EL+V G   DA ELV +LR+KVG A I S+
Sbjct  58   IPGVEKVAIEGEEKNELMVIGEEIDAAELVTILRKKVGFANIVSI  102



>ref|XP_011032085.1| PREDICTED: uncharacterized protein LOC105131026 [Populus euphratica]
Length=114

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -1

Query  337  PQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            P++++KA+QIAVG  GV SAG+ G+ K ++ V G   DAV+L  LLR+KVG A + SV
Sbjct  14   PKSRTKALQIAVGLSGVESAGIGGQDKSQIEVVGDGVDAVQLTNLLRKKVGYAELASV  71



>ref|XP_011032087.1| PREDICTED: uncharacterized protein LOC105131028 isoform X2 [Populus 
euphratica]
 ref|XP_011032089.1| PREDICTED: uncharacterized protein LOC105131029 isoform X2 [Populus 
euphratica]
Length=114

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            +++SKA+QIAVG  GV SAGL GE K ++ V G   DAV+L  LLR+KVG A + SV
Sbjct  15   KSRSKALQIAVGLSGVESAGLGGEDKSQVEVVGDGVDAVQLTNLLRKKVGYAELASV  71



>ref|XP_011032086.1| PREDICTED: uncharacterized protein LOC105131028 isoform X1 [Populus 
euphratica]
 ref|XP_011032088.1| PREDICTED: uncharacterized protein LOC105131029 isoform X1 [Populus 
euphratica]
Length=128

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            +++SKA+QIAVG  GV SAGL GE K ++ V G   DAV+L  LLR+KVG A + SV
Sbjct  29   KSRSKALQIAVGLSGVESAGLGGEDKSQVEVVGDGVDAVQLTNLLRKKVGYAELASV  85



>ref|XP_010038748.1| PREDICTED: uncharacterized protein LOC104427341 [Eucalyptus grandis]
Length=120

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = -1

Query  355  CFNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATI  176
            CFN  +  ++SKA+ +  GF GV S  +E + KD++ + GVFD+V L  LLR+KVG A I
Sbjct  19   CFNLRS--SRSKALSVVSGFQGVKSVKIEDD-KDQIEMTGVFDSVALTTLLRKKVGFAQI  75

Query  175  KSV  167
             +V
Sbjct  76   ITV  78



>emb|CDP08855.1| unnamed protein product [Coffea canephora]
Length=119

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -1

Query  364  VSECFNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVG  188
            V    + T  +  SKAMQIAV   G+    L+GE KD++VV G   DAV L  LLR+K+G
Sbjct  6    VIRVLDCTKKKQLSKAMQIAVSVAGIERVALQGENKDQIVVVGEGIDAVNLTSLLRKKLG  65

Query  187  GATIKSV  167
               + SV
Sbjct  66   SVELVSV  72



>ref|XP_010038750.1| PREDICTED: uncharacterized protein LOC104427343 [Eucalyptus grandis]
Length=121

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 5/64 (8%)
 Frame = -1

Query  355  CFNHTAPQNK-SKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGAT  179
            CF    PQN  SKA+++A GF GV S  L G+ +D + V G  DAV L  LLR+KVG A 
Sbjct  20   CF---GPQNPHSKALKVAGGFQGVQSVALTGD-QDRIEVTGDLDAVNLTTLLRKKVGFAE  75

Query  178  IKSV  167
            I SV
Sbjct  76   IVSV  79



>gb|KCW47636.1| hypothetical protein EUGRSUZ_K01379 [Eucalyptus grandis]
Length=109

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = -1

Query  406  MGVGMLKAILPFESVSECFNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFD  227
            M   +L+  +  ++ + C     P +KSK ++ A  F GV S  + G+GKD++ V G FD
Sbjct  1    MKKAVLQVCVNEDAPTFCCFKLRPSSKSKVVKAASDFRGVKSVTI-GDGKDQIEVTGDFD  59

Query  226  AVELVKLLREKVGGATIKSV  167
             V L  LLR+KVG A I +V
Sbjct  60   PVNLTVLLRKKVGSAEIITV  79



>ref|XP_006379054.1| hypothetical protein POPTR_0009s05300g [Populus trichocarpa]
 gb|ERP56851.1| hypothetical protein POPTR_0009s05300g [Populus trichocarpa]
Length=118

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -1

Query  337  PQNKSKAMQIAVGFHGVNSAGLEGEGKDEL-VVKGVFDAVELVKLLREKVGGATIKSV  167
            P++++KA++IAVG  GV SA L GE K ++ VV    DAV+L  LLR+KVG A + SV
Sbjct  14   PKSRTKALRIAVGLSGVESARLGGEDKSQIEVVGDGVDAVQLTNLLRKKVGYAELASV  71



>ref|XP_002268731.1| PREDICTED: uncharacterized protein LOC100255094 [Vitis vinifera]
Length=124

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  328  KSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATIKSV  167
            +SKAMQ AVG  GV S  LEGE K+++VV G   D+V L  LLR+K G A + SV
Sbjct  18   RSKAMQTAVGVPGVESIALEGEDKNQIVVIGDSVDSVNLTCLLRKKFGSAELLSV  72



>dbj|BAD17465.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD29339.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ23593.1| hypothetical protein OsJ_07292 [Oryza sativa Japonica Group]
Length=119

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  352  FNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATI  176
             N  + + +SKAM +     GV+S  L G+GKD+LVV G   D++EL   LR+KVG AT+
Sbjct  10   MNMASDKCRSKAMALVASTTGVDSVALAGDGKDQLVVVGDGVDSIELTTALRKKVGHATL  69

Query  175  KSV  167
             +V
Sbjct  70   MTV  72



>gb|KCW47638.1| hypothetical protein EUGRSUZ_K01380 [Eucalyptus grandis]
Length=132

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = -1

Query  355  CFNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATI  176
            CFN  +  +++KA+++A GF GV S    G+GKD++ + G FD+V L  LLR+KVG A I
Sbjct  20   CFNLRS--SRAKALRVAGGFRGVESVKT-GDGKDQIEMTGNFDSVALTNLLRKKVGFAEI  76

Query  175  KSV  167
             +V
Sbjct  77   IAV  79



>ref|XP_010036116.1| PREDICTED: uncharacterized protein LOC104425196 [Eucalyptus grandis]
Length=131

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = -1

Query  355  CFNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATI  176
            CFN  +  +++KA+++A GF GV S    G+GKD++ + G FD+V L  LLR+KVG A I
Sbjct  19   CFNLRS--SRAKALRVAGGFRGVESVKT-GDGKDQIEMTGNFDSVALTNLLRKKVGFAEI  75

Query  175  KSV  167
             +V
Sbjct  76   IAV  78



>ref|XP_002263660.1| PREDICTED: uncharacterized protein LOC100258045 [Vitis vinifera]
Length=127

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 62/114 (54%), Gaps = 16/114 (14%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATIKSVgpe  158
            ++++KA++IAVG  GV SA L+G+ KDE+ V G   D V L  LLR+ VG A + SV   
Sbjct  15   KSRTKALKIAVGVSGVESAALKGQEKDEIEVTGEEIDVVALTFLLRKNVGNAEVVSV---  71

Query  157  eekkkeepkkeepkkgddkkppENAAVVHPWPSQPLV-------LYEIPEYTPR  17
                    +K+E KK + K+  +N   VH W S P         +Y  PEYT R
Sbjct  72   -----GAAEKKEQKKEEKKEEQKNEPTVHAWHSYPYEIGVTHYPIYHYPEYTDR  120



>ref|XP_010542497.1| PREDICTED: uncharacterized protein LOC104815685 [Tarenaya hassleriana]
Length=136

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  340  APQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATIKSV  167
            +P+++SKAM+IA G  GV S  ++GE  D+LVV G   D VEL + LR+KVG A I +V
Sbjct  14   SPKSRSKAMKIASGTSGVRSVSIQGEN-DQLVVLGEEIDTVELTRELRKKVGHAKIVTV  71



>ref|XP_010036113.1| PREDICTED: uncharacterized protein LOC104425192 [Eucalyptus grandis]
Length=117

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -1

Query  355  CFNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATI  176
            CF   +P   SKAM++A GF GV S  L G+ +D + V G  DAV L  LLR+KVG A I
Sbjct  10   CFGPQSPH--SKAMKLAGGFQGVQSVALVGD-RDRIEVTGDVDAVNLTNLLRKKVGFAEI  66

Query  175  KSV  167
             +V
Sbjct  67   VTV  69



>ref|XP_006349960.1| PREDICTED: uncharacterized protein LOC102599063 [Solanum tuberosum]
Length=149

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 49/98 (50%), Gaps = 7/98 (7%)
 Frame = -1

Query  463  KAVIKLEVNGKRPASMAKKMGVGMLKAILPFESVSECFNHTAPQNKSKAMQIAVGFHGVN  284
            K V+ + VNG +P S  K   +G LK ++P       F HT  +NK   M IA    GV 
Sbjct  4    KVVVDVSVNGCQPRSSLKNCILGWLKPMVPCL-----FKHTTCKNK--VMTIAATLPGVE  56

Query  283  SAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATIKS  170
               LE E     V+    DAVEL+  +R+KVG A + S
Sbjct  57   KVSLEEEKNLLTVIGERIDAVELLNKIRKKVGFAKLVS  94



>gb|KDP22993.1| hypothetical protein JCGZ_01715 [Jatropha curcas]
Length=125

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = -1

Query  352  FNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATI  176
            F+ ++ +++SKAM+IAVG  GV SA L G+ K ++ V G   DAV+L  LLR+ VG + I
Sbjct  9    FSLSSQKSRSKAMKIAVGVAGVESAALGGQDKSQIEVIGDGVDAVQLTTLLRKHVGYSEI  68

Query  175  KSV  167
             SV
Sbjct  69   MSV  71



>ref|XP_010241736.1| PREDICTED: uncharacterized protein LOC104586261, partial [Nelumbo 
nucifera]
Length=85

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  328  KSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATIKSV  167
            +SKAM+IA    GV S  LEG+ KD+LVV G   D+  L +LLR+KVG A I ++
Sbjct  17   RSKAMKIAASTQGVTSVALEGDFKDKLVVMGEEVDSTCLTRLLRKKVGHAVIVTI  71



>ref|XP_011091863.1| PREDICTED: uncharacterized protein LOC105172196 isoform X1 [Sesamum 
indicum]
Length=105

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            Q  SKAM+IA G  GV S  L GE KD+++V G   DAV L K +R+K+G A + S+
Sbjct  19   QYSSKAMKIAAGVSGVESMTLLGENKDQIMVIGAGIDAVNLTKCMRKKLGSAELISL  75



>ref|XP_010038749.1| PREDICTED: uncharacterized protein LOC104427342 [Eucalyptus grandis]
Length=186

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -1

Query  355  CFNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATI  176
            CF   +P  +SKAM+I  GF G+ S   + + +D++ V GV DA+ L  LLR+KVG A +
Sbjct  20   CFGSQSP--RSKAMKIVAGFPGIQSVEWDKD-QDQIKVTGVVDAINLTSLLRKKVGFAEL  76

Query  175  KSV  167
             SV
Sbjct  77   VSV  79



>ref|XP_004486553.1| PREDICTED: uncharacterized protein LOC101501843 [Cicer arietinum]
Length=71

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -1

Query  340  APQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATI  176
              + ++KA ++    +GVN  GLEGE KD+LVV G   DAV+L+K LR+KVG   I
Sbjct  7    CQKCRTKAFKVVASTYGVNFVGLEGEEKDKLVVIGEGVDAVKLIKWLRKKVGQTNI  62



>ref|XP_011091871.1| PREDICTED: uncharacterized protein LOC105172196 isoform X2 [Sesamum 
indicum]
Length=101

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            Q  SKAM+IA G  GV S  L GE KD+++V G   DAV L K +R+K+G A + S+
Sbjct  15   QYSSKAMKIAAGVSGVESMTLLGENKDQIMVIGAGIDAVNLTKCMRKKLGSAELISL  71



>ref|XP_010036115.1| PREDICTED: uncharacterized protein LOC104425195 [Eucalyptus grandis]
 gb|KCW47635.1| hypothetical protein EUGRSUZ_K01377 [Eucalyptus grandis]
Length=129

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -1

Query  355  CFNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATI  176
            CF+   P   SKA+++A GF GV S  L G+ +D + V G  DAV L  LLR+KVG A I
Sbjct  20   CFSPRNPH--SKALKLAGGFQGVQSVALVGD-QDRIEVTGDVDAVNLTTLLRKKVGFAKI  76

Query  175  KSV  167
             +V
Sbjct  77   VTV  79



>ref|XP_004252124.1| PREDICTED: uncharacterized protein LOC101267291 isoform X2 [Solanum 
lycopersicum]
Length=75

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  352  FNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATI  176
             +H   + +SKA+ IA    GVNS  LEGE KD++V+ G   DA  +  LLR+KVG A++
Sbjct  9    VHHKCKKCQSKALMIAAMSTGVNSVALEGEKKDKVVIIGEAVDAAGITSLLRKKVGHASL  68

Query  175  KSV  167
            + V
Sbjct  69   ELV  71



>ref|XP_002533038.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF29346.1| metal ion binding protein, putative [Ricinus communis]
Length=119

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  328  KSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATIKSV  167
            ++KAMQ A    GVNS  LEG+ KD+LVV G + DA  L K LR+K+  A I +V
Sbjct  17   RTKAMQTAAVADGVNSVALEGDDKDKLVVIGEMVDAACLTKALRKKINYAEIVTV  71



>ref|XP_006583442.1| PREDICTED: uncharacterized protein LOC100812612 [Glycine max]
 gb|KHN44586.1| hypothetical protein glysoja_027197 [Glycine soja]
Length=123

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATIKSV  167
            +++SKA++IA    GV+S  LEG+ KD+L V G  DAV L ++LR+K    T+ SV
Sbjct  15   KSRSKALKIAAQEIGVSSVALEGDNKDKLTVTGDVDAVHLGRVLRKKFQCVTLVSV  70



>ref|XP_004243215.1| PREDICTED: uncharacterized protein LOC101251005 [Solanum lycopersicum]
Length=129

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -1

Query  352  FNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATIK  173
             N    ++++KA +IAV   GV SA + G+GK++L V G  DA  L  LLR+ +G A + 
Sbjct  11   LNGNGQKDRTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAATLTSLLRKNLGQADLV  70

Query  172  SV  167
            SV
Sbjct  71   SV  72



>ref|XP_004243214.1| PREDICTED: uncharacterized protein LOC101250708 [Solanum lycopersicum]
Length=151

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 49/98 (50%), Gaps = 11/98 (11%)
 Frame = -1

Query  463  KAVIKLEVNGKRPASMAKKMGVGMLKAILP--FESVSECFNHTAPQNKSKAMQIAVGFHG  290
            K VI + VNG +P    K   +G LK ++P  F+ ++          K+K M IA    G
Sbjct  4    KVVIDVSVNGCQPRPSLKNCILGWLKPMVPCLFKQLT---------CKNKVMTIAATLPG  54

Query  289  VNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATI  176
            V    LE E     V+    DAVELV ++R+KVG A I
Sbjct  55   VEKVSLEEEKNLLTVIGEGIDAVELVNIIRKKVGFAKI  92



>gb|AES71738.2| metal ion-binding protein, putative [Medicago truncatula]
Length=103

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATIKSV  167
            +++SKAM+IAVG  GV SA ++G+ KD++ V G   DA +L  LLR+K   A + SV
Sbjct  5    KSRSKAMKIAVGVSGVESAAVKGDSKDQIEVTGEQIDAAKLTCLLRKKFCHADLVSV  61



>gb|KDP22991.1| hypothetical protein JCGZ_01713 [Jatropha curcas]
Length=123

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  343  TAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            ++ +++SKAM+IAVG  GV SA L G+ K ++ V G   DAV+L  LLR+++G + + SV
Sbjct  12   SSQKSRSKAMKIAVGVAGVESAALRGQDKSQIEVVGDGVDAVKLTTLLRKQIGYSELVSV  71



>gb|KEH15709.1| heavy metal transport/detoxification superfamily protein, partial 
[Medicago truncatula]
Length=75

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -1

Query  340  APQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
              + ++KA+++  G +GVN  GLEG+ KD++VV G   DAV L K LR+KVG   I S+
Sbjct  11   CQKCRTKALEVVAGANGVNFVGLEGDEKDKIVVIGDGVDAVTLTKCLRKKVGQTEIVSL  69



>ref|XP_003594348.1| hypothetical protein MTR_2g027600 [Medicago truncatula]
 gb|ABN08867.1| Heavy metal transport/detoxification protein [Medicago truncatula]
 gb|AES64599.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=77

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -1

Query  340  APQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
              + ++KA+++  G +GVN  GLEG+ KD++VV G   DAV L K LR+KVG   I S+
Sbjct  13   CQKCRTKALEVVAGANGVNFVGLEGDEKDKIVVIGDGVDAVTLTKCLRKKVGQTEIVSL  71



>ref|NP_001149591.1| ATFP4 [Zea mays]
 gb|ACG35969.1| ATFP4 [Zea mays]
Length=150

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATI  176
            +N+SKAMQ+A  F GVNS G+ G+ KD L V G   D   ++ LLR+KV  A I
Sbjct  16   KNRSKAMQMASKFVGVNSVGIAGDAKDRLEVVGESVDITCMINLLRKKVCRADI  69



>ref|XP_003601487.1| hypothetical protein MTR_3g082210 [Medicago truncatula]
Length=115

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATIKSV  167
            +++SKAM+IAVG  GV SA ++G+ KD++ V G   DA +L  LLR+K   A + SV
Sbjct  17   KSRSKAMKIAVGVSGVESAAVKGDSKDQIEVTGEQIDAAKLTCLLRKKFCHADLVSV  73



>gb|KDP22995.1| hypothetical protein JCGZ_01717 [Jatropha curcas]
Length=109

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -1

Query  343  TAPQNKSKAMQIAVGFHGVNSAGLEGEGKDEL-VVKGVFDAVELVKLLREKVGGATIKSV  167
            ++ +++SKAM+IAVG  GV SA   G+   E+ VV   FD V+LV LLR++VG + I SV
Sbjct  6    SSQKSRSKAMKIAVGVAGVKSAAFGGQDMSEIEVVGDEFDVVKLVCLLRKQVGHSEILSV  65



>ref|XP_008794762.1| PREDICTED: uncharacterized protein LOC103710688 [Phoenix dactylifera]
Length=111

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            + +SKA++  VGF+G+ SA L+G+ KD++VV G   D V LVK LR+++  A + SV
Sbjct  16   KQRSKALKTVVGFNGITSASLDGKEKDQIVVVGDGIDPVTLVKKLRKRMNYAELLSV  72



>ref|XP_010036114.1| PREDICTED: uncharacterized protein LOC104425194 [Eucalyptus grandis]
 gb|KCW47633.1| hypothetical protein EUGRSUZ_K01375 [Eucalyptus grandis]
Length=121

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 21/100 (21%)
 Frame = -1

Query  466  QKAVIKLEVNGKRPASMAKKMGVGMLKAILPFESVSECFNHTAPQNKSKAMQIAVGFHGV  287
            QK VIK+ +NG   AS                     CF   +P   S+A+++A GF GV
Sbjct  3    QKVVIKVSMNGNGHASSFF------------------CFGPQSPH--SRALRLASGFRGV  42

Query  286  NSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATIKSV  167
             S  L G+ +D++ V G  D+V+L   LR+K G A I +V
Sbjct  43   QSVALVGD-RDQIEVTGEVDSVDLTNSLRKKFGSAEIVTV  81



>gb|ACF84352.1| unknown [Zea mays]
 gb|AFW58541.1| ATFP4 [Zea mays]
Length=150

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATI  176
            +N+SKAMQ+A  F GVNS G+ G+ KD L V G   D   ++ LLR+KV  A I
Sbjct  16   KNRSKAMQMASKFVGVNSVGIAGDAKDRLEVVGESVDITCMINLLRKKVCRADI  69



>gb|KHN44736.1| hypothetical protein glysoja_032075 [Glycine soja]
Length=127

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  328  KSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATIKSV  167
            +SKA++IA    GV+S  LEGE +D++VV G   D+V L    R+K   AT+ SV
Sbjct  16   RSKALKIAAASQGVHSVALEGESRDQVVVTGDTIDSVCLTNKFRKKFSNATLISV  70



>ref|XP_003533352.1| PREDICTED: uncharacterized protein LOC100797364 [Glycine max]
 gb|KHN23744.1| hypothetical protein glysoja_033627 [Glycine soja]
Length=122

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  340  APQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATIKS  170
            + +++SKA++IA    GV+S  LEG+ KD+LVV G  DAV L ++LR+K    T+ S
Sbjct  13   SDKSRSKALKIAAQEIGVSSVALEGDNKDKLVVTGDVDAVCLGRVLRKKFRCVTLVS  69



>gb|KDP22996.1| hypothetical protein JCGZ_01718 [Jatropha curcas]
Length=115

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = -1

Query  352  FNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATI  176
             + ++ +++SKAM+IAVG  GV SA L G+ K E+ V G   D+V+L  LLR++VG + +
Sbjct  9    ISMSSQKSRSKAMKIAVGVAGVESAALGGQDKSEIEVVGDGVDSVKLTTLLRKQVGYSEL  68

Query  175  KSV  167
             SV
Sbjct  69   LSV  71



>ref|XP_007049439.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOX93596.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=121

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            +++SKA++IAVG  GV SA L+G+ K ++ + G   D V+L  LLR+ VG A + SV
Sbjct  15   KSRSKALKIAVGLAGVESASLKGDDKSQIEITGEGVDPVQLTSLLRKSVGHAELVSV  71



>gb|KHF99125.1| Fimbrial [Gossypium arboreum]
Length=115

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            +++SKA+++ VGF GV SA L+G+ K ++ V G   DAV+L   LR+ VG A + SV
Sbjct  15   KSRSKALKVVVGFSGVESASLKGDDKSQIEVTGDGVDAVQLTSRLRKSVGHAELVSV  71



>ref|XP_006348967.1| PREDICTED: uncharacterized protein LOC102605417 [Solanum tuberosum]
Length=131

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -1

Query  352  FNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATIK  173
             N    + ++KA +IAV   GV SA + G+GK++L V G  DAV L+ LLR+ +G A + 
Sbjct  11   LNGNDQKCRTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAVALMMLLRKNLGQADLV  70

Query  172  SV  167
            SV
Sbjct  71   SV  72



>gb|KDP22994.1| hypothetical protein JCGZ_01716 [Jatropha curcas]
Length=119

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = -1

Query  349  NHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIK  173
            + ++ +++SKAM+IAVG  GV SA L G+ K ++ V G   DAV+L  LLR++VG + + 
Sbjct  10   SMSSQKSRSKAMKIAVGVAGVESAALGGQDKSQIEVVGDGVDAVKLTTLLRKQVGYSELV  69

Query  172  SV  167
            SV
Sbjct  70   SV  71



>ref|XP_007020383.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOY11908.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=114

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  328  KSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATIKSV  167
            ++KA++IA   HGVN   ++G+ +DEL V G   D+V+L   LR+K+  ATI SV
Sbjct  17   RTKALKIAATTHGVNEVAIKGKARDELTVIGNEVDSVKLACSLRKKLRNATIVSV  71



>ref|XP_009591620.1| PREDICTED: uncharacterized protein LOC104088617 [Nicotiana tomentosiformis]
Length=75

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = -1

Query  352  FNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATI  176
              H   + +SK++ IA    GVNS  L+GE KDE+V+ G   DA  +  LLR+KVG A++
Sbjct  9    VKHKCQKCQSKSLMIAAMSTGVNSVALQGEKKDEVVIIGEQVDAAGITTLLRKKVGHASL  68



>ref|XP_009419204.1| PREDICTED: uncharacterized protein LOC103999243 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=116

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = -1

Query  328  KSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATI  176
            +SKAMQ+     GV+S  +EGE KD+LV+ G   D   +  +LR+KVG ATI
Sbjct  17   RSKAMQLVAEADGVDSVAIEGENKDQLVIVGDGVDPANVTLVLRKKVGRATI  68



>ref|XP_009419205.1| PREDICTED: uncharacterized protein LOC103999243 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=115

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = -1

Query  328  KSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATI  176
            +SKAMQ+     GV+S  +EGE KD+LV+ G   D   +  +LR+KVG ATI
Sbjct  16   RSKAMQLVAEADGVDSVAIEGENKDQLVIVGDGVDPANVTLVLRKKVGRATI  67



>ref|XP_006469401.1| PREDICTED: uncharacterized protein LOC102626749 isoform X2 [Citrus 
sinensis]
Length=124

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            +++SKA++IAVG  GV SA L+G+ K ++ V G   D V L  LLR+KVG A + SV
Sbjct  15   KSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLRKKVGYAELVSV  71



>ref|XP_010096497.1| hypothetical protein L484_017949 [Morus notabilis]
 gb|EXB64617.1| hypothetical protein L484_017949 [Morus notabilis]
Length=76

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            + ++KA+++     GV   GLEGE KD++VV G   DA++L K LR+K+GGA I ++
Sbjct  15   KCRTKALKVVAAKDGVIYVGLEGEAKDKVVVIGDGVDAIDLAKALRKKMGGADIITI  71



>ref|XP_006447867.1| hypothetical protein CICLE_v10017001mg [Citrus clementina]
 gb|ESR61107.1| hypothetical protein CICLE_v10017001mg [Citrus clementina]
Length=164

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            +++SKA++IAVG  GV SA L+G+ K ++ V G   D V L  LLR+KVG A + SV
Sbjct  55   KSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLRKKVGYAELVSV  111



>ref|XP_008669289.1| PREDICTED: uncharacterized protein LOC103646335 isoform X1 [Zea 
mays]
 tpg|DAA37383.1| TPA: hypothetical protein ZEAMMB73_337241 [Zea mays]
Length=118

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKV  191
            +N+SKAMQ+A  F GV+  G+ G+GKD L V+G   D V LV  LR+KV
Sbjct  16   KNRSKAMQLASKFVGVSKVGITGDGKDRLEVEGEGVDTVLLVNYLRKKV  64



>ref|XP_002266819.2| PREDICTED: uncharacterized protein LOC100242530 [Vitis vinifera]
Length=152

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            +++SK++++AVG  GV SA L+G+ K+++ V G   DAV L  LLR+KVG A + SV
Sbjct  49   KSRSKSLKVAVGVAGVESAALQGQEKNQIEVIGEGIDAVALTTLLRKKVGFAELVSV  105



>ref|XP_009625093.1| PREDICTED: uncharacterized protein LOC104116027 [Nicotiana tomentosiformis]
Length=128

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -1

Query  352  FNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATIK  173
             N    + ++KA++IAV   GV SA + GE K++L V G  DA +L  LLR+ +G A + 
Sbjct  11   LNGNDQKYRTKALKIAVSQPGVESAAMTGEEKNQLEVVGEIDAADLTSLLRKNLGQAELV  70

Query  172  SV  167
            SV
Sbjct  71   SV  72



>gb|KDO74056.1| hypothetical protein CISIN_1g033712mg [Citrus sinensis]
Length=113

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -1

Query  343  TAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKG-VFDAVELVKLLREKVGGATIKSV  167
            T  + + KAM+IAV   GV    ++GEGKDELVV G   D+V+L + L++K+G A++ SV
Sbjct  2    TCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVKLTRKLQKKLGFASLLSV  61



>ref|XP_009789253.1| PREDICTED: uncharacterized protein LOC104236903 [Nicotiana sylvestris]
Length=147

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 52/101 (51%), Gaps = 12/101 (12%)
 Frame = -1

Query  466  QKAVIKLEVNGKRPASMAKKMGVGMLKAILPFESVSECFNHTAPQNKSKAMQIAVGFHGV  287
            QK V+ + +NG +     KK  +G L   L  ++            K+K M IAV   GV
Sbjct  3    QKVVLNVSLNGCKRRPSLKKFVLGWLVPCLVQDATC----------KNKVMSIAVTLRGV  52

Query  286  NSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
                +E E K+EL V G   DAV+LV +LR+KVG A I +V
Sbjct  53   EKVSIEVE-KNELTVIGEGIDAVKLVNILRKKVGFAKIVTV  92



>ref|XP_006469400.1| PREDICTED: uncharacterized protein LOC102626749 isoform X1 [Citrus 
sinensis]
Length=145

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -1

Query  334  QNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            +++SKA++IAVG  GV SA L+G+ K ++ V G   D V L  LLR+KVG A + SV
Sbjct  36   KSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLRKKVGYAELVSV  92



>ref|XP_010529393.1| PREDICTED: uncharacterized protein LOC104806273 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010534712.1| PREDICTED: uncharacterized protein LOC104810216 isoform X2 [Tarenaya 
hassleriana]
Length=76

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = -1

Query  340  APQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKG--VFDAVELVKLLREKVGGATIKSV  167
              + +SKA++IA G  GV   GLEGE KD +VV G    DAV +V  LR K+G   I SV
Sbjct  12   CEKCRSKALKIAAGSDGVKFVGLEGEKKDRVVVVGEDSVDAVAIVLRLRNKLGRTDIISV  71



>ref|XP_007204171.1| hypothetical protein PRUPE_ppa017127mg [Prunus persica]
 gb|EMJ05370.1| hypothetical protein PRUPE_ppa017127mg [Prunus persica]
Length=121

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  328  KSKAMQIAVGFHGVNSAGLEGEGKDELVVKGV-FDAVELVKLLREKVGGATIKSV  167
            +SKAM+IAV   GV S   +G  +D++V+ G   DAV++ K LR+K+G A + SV
Sbjct  17   RSKAMKIAVAEDGVISVAFQGPNRDKMVITGDGIDAVDMAKSLRKKLGYADLVSV  71



>ref|XP_006348966.1| PREDICTED: uncharacterized protein LOC102605080 [Solanum tuberosum]
Length=119

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -1

Query  352  FNHTAPQNKSKAMQIAVGFHGVNSAGLEGEGKDELVVKGVFDAVELVKLLREKVGGATIK  173
             N    + ++KA +IA    GV SA + G+GK++L V G  DAV L  LLR+ +G A + 
Sbjct  11   LNGNDRKYRTKAFKIAASQSGVESAAITGDGKNQLEVVGEVDAVTLTSLLRKNLGLADLV  70

Query  172  SV  167
            SV
Sbjct  71   SV  72



>ref|XP_010529392.1| PREDICTED: uncharacterized protein LOC104806273 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534711.1| PREDICTED: uncharacterized protein LOC104810216 isoform X1 [Tarenaya 
hassleriana]
Length=77

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -1

Query  328  KSKAMQIAVGFHGVNSAGLEGEGKDELVVKG--VFDAVELVKLLREKVGGATIKSV  167
            +SKA++IA G  GV   GLEGE KD +VV G    DAV +V  LR K+G   I SV
Sbjct  17   RSKALKIAAGSDGVKFVGLEGEKKDRVVVVGEDSVDAVAIVLRLRNKLGRTDIISV  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513299277426