BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82664_g1_i1 len=107 path=[1:0-106]

Length=107
                                                                      Score     E

ref|XP_006346743.1|  PREDICTED: putative uncharacterized protein ...  51.6    6e-06   
ref|XP_009618502.1|  PREDICTED: LOW QUALITY PROTEIN: putative unc...  50.8    1e-05   
emb|CDP01520.1|  unnamed protein product                              50.8    1e-05   
ref|XP_011100028.1|  PREDICTED: putative uncharacterized protein ...  50.4    1e-05   
ref|XP_004236704.1|  PREDICTED: putative uncharacterized protein ...  50.1    2e-05   
ref|XP_009770158.1|  PREDICTED: putative uncharacterized protein ...  49.7    2e-05   
ref|XP_003632479.1|  PREDICTED: putative uncharacterized protein ...  49.3    3e-05   
emb|CBI33150.3|  unnamed protein product                              49.3    3e-05   
ref|XP_009771664.1|  PREDICTED: LOW QUALITY PROTEIN: putative unc...  47.4    1e-04   
ref|XP_009615427.1|  PREDICTED: putative uncharacterized protein ...  46.2    4e-04   
gb|KDO60653.1|  hypothetical protein CISIN_1g000621mg                 46.2    4e-04   
gb|KDO60652.1|  hypothetical protein CISIN_1g000621mg                 46.2    4e-04   
ref|XP_006465847.1|  PREDICTED: putative uncharacterized protein ...  46.2    4e-04   
ref|XP_006426318.1|  hypothetical protein CICLE_v10024688mg           46.2    4e-04   
gb|EYU30966.1|  hypothetical protein MIMGU_mgv1a000119mg              45.8    6e-04   
ref|XP_008338551.1|  PREDICTED: putative uncharacterized protein ...  45.4    7e-04   
ref|XP_004250516.1|  PREDICTED: putative uncharacterized protein ...  45.1    8e-04   



>ref|XP_006346743.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic-like 
[Solanum tuberosum]
Length=1729

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             RWGRVTF++P+AAK+A  LN    SGG +KVVPS+
Sbjct  1077  RWGRVTFLSPDAAKQAMLLNQVECSGGFLKVVPSR  1111



>ref|XP_009618502.1| PREDICTED: LOW QUALITY PROTEIN: putative uncharacterized protein 
At4g01020, chloroplastic [Nicotiana tomentosiformis]
Length=1766

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             RWGRVTF++P+AAK+A+ L+    SGG +KVVPS+
Sbjct  1110  RWGRVTFLSPDAAKQATLLDQVECSGGFLKVVPSR  1144



>emb|CDP01520.1| unnamed protein product [Coffea canephora]
Length=1626

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             +WGR+TF++P+ AKRA+ LN   L GG++KV+PS+
Sbjct  973   KWGRITFLSPDTAKRATQLNLVELCGGLLKVIPSR  1007



>ref|XP_011100028.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic 
[Sesamum indicum]
Length=1752

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             +WGRVTF+TP+AAK+A AL+     GG +KVVPS+
Sbjct  1095  KWGRVTFLTPDAAKKAVALDQVEFCGGSLKVVPSR  1129



>ref|XP_004236704.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic 
[Solanum lycopersicum]
Length=1730

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             RWGRVTF++P+AAK+A  LN    +GG +KVVPS+
Sbjct  1075  RWGRVTFLSPDAAKQAMLLNQVECNGGFLKVVPSR  1109



>ref|XP_009770158.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic 
[Nicotiana sylvestris]
Length=1725

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             +WGRVTF+TP+AAK+A+ L+    +GG +KVVPS+
Sbjct  1068  KWGRVTFLTPDAAKQAAFLDQVEFNGGFLKVVPSR  1102



>ref|XP_003632479.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic 
[Vitis vinifera]
Length=1686

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             RWGR+TF+TP++AK+A+ LN     G ++KV+PS+
Sbjct  1086  RWGRITFLTPDSAKKATDLNKVEFRGSLLKVIPSR  1120



>emb|CBI33150.3| unnamed protein product [Vitis vinifera]
Length=1988

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             RWGR+TF+TP++AK+A+ LN     G ++KV+PS+
Sbjct  1086  RWGRITFLTPDSAKKATDLNKVEFRGSLLKVIPSR  1120



>ref|XP_009771664.1| PREDICTED: LOW QUALITY PROTEIN: putative uncharacterized protein 
At4g01020, chloroplastic, partial [Nicotiana sylvestris]
Length=1385

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
            RWGRVTF++P+A K+A+ L+     GG +KVVPS+
Sbjct  815  RWGRVTFLSPDATKQATLLDKVECGGGFLKVVPSR  849



>ref|XP_009615427.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic 
[Nicotiana tomentosiformis]
Length=1725

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             +WGRVTF+TP+AAK+A+ L+    +GG +KVV S+
Sbjct  1068  KWGRVTFLTPDAAKQAAFLDQVEFNGGFLKVVSSR  1102



>gb|KDO60653.1| hypothetical protein CISIN_1g000621mg [Citrus sinensis]
Length=1252

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             +WGRVTF+TP+ A +A+ LN    +G ++KVVPS+
Sbjct  971   KWGRVTFLTPDTAGKATELNGVEYNGSLLKVVPSR  1005



>gb|KDO60652.1| hypothetical protein CISIN_1g000621mg [Citrus sinensis]
Length=1387

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
            +WGRVTF+TP+ A +A+ LN    +G ++KVVPS+
Sbjct  958  KWGRVTFLTPDTAGKATELNGVEYNGSLLKVVPSR  992



>ref|XP_006465847.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic-like 
[Citrus sinensis]
 ref|XP_006466273.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic-like 
[Citrus sinensis]
 ref|XP_006495187.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic-like 
[Citrus sinensis]
Length=1730

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             +WGRVTF+TP+ A +A+ LN    +G ++KVVPS+
Sbjct  1073  KWGRVTFLTPDTAGKATELNGVEYNGSLLKVVPSR  1107



>ref|XP_006426318.1| hypothetical protein CICLE_v10024688mg [Citrus clementina]
 gb|ESR39558.1| hypothetical protein CICLE_v10024688mg [Citrus clementina]
Length=1730

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             +WGRVTF+TP+ A +A+ LN    +G ++KVVPS+
Sbjct  1073  KWGRVTFLTPDTAGKATELNGVEYNGSLLKVVPSR  1107



>gb|EYU30966.1| hypothetical protein MIMGU_mgv1a000119mg [Erythranthe guttata]
Length=1734

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVP  100
             +WGRVTF+TP+AA++A  LN     GG+++V+P
Sbjct  1079  KWGRVTFLTPDAAEKAVDLNKTEFCGGLLEVIP  1111



>ref|XP_008338551.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic 
[Malus domestica]
Length=1720

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             +W RVTF TP AA++A+ LN    SG ++KV+PS+
Sbjct  1067  KWVRVTFQTPEAAQKAAELNESEFSGSILKVIPSQ  1101



>ref|XP_004250516.1| PREDICTED: putative uncharacterized protein At4g01020, chloroplastic 
[Solanum lycopersicum]
Length=1705

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  2     RWGRVTFVTPNAAKRASALNSGPLSGGMVKVVPSK  106
             +WG V F+TP+AA++A++LN    +GG +K+VPS+
Sbjct  1050  KWGTVKFLTPDAAEQATSLNKVEFNGGFLKMVPSR  1084



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 539028242558