BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82657_g1_i1 len=1853 path=[1831:0-1852]

Length=1853
                                                                      Score     E

ref|XP_009780811.1|  PREDICTED: cytochrome P450 82C4-like               628   0.0      
emb|CDP15727.1|  unnamed protein product                                617   0.0      
emb|CDP15728.1|  unnamed protein product                                614   0.0      
ref|XP_006340061.1|  PREDICTED: cytochrome P450 82C4-like               610   0.0      
ref|XP_004247061.1|  PREDICTED: cytochrome P450 82C4-like               609   0.0      
ref|XP_006346673.1|  PREDICTED: cytochrome P450 82C4-like               587   0.0      
gb|AJD25202.1|  cytochrome P450 CYP82U4                                 575   0.0      
ref|XP_007049681.1|  Cytochrome P450                                    553   0.0      
ref|XP_002531093.1|  cytochrome P450, putative                          540   0.0      Ricinus communis
ref|XP_010696237.1|  PREDICTED: cytochrome P450 82G1                    540   0.0      
ref|XP_006443550.1|  hypothetical protein CICLE_v10019727mg             538   0.0      
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             523   2e-176   
gb|KHG29587.1|  Cytochrome P450 protein                                 521   2e-175   
ref|XP_010091295.1|  Cytochrome P450 82G1                               513   3e-172   
ref|XP_002264473.1|  PREDICTED: cytochrome P450 82C4-like               512   5e-172   Vitis vinifera
gb|KHG07864.1|  Cytochrome P450 protein                                 511   8e-172   
ref|XP_006376421.1|  cytochrome P450 family protein                     509   6e-171   
ref|XP_011037409.1|  PREDICTED: cytochrome P450 82G1-like               509   7e-171   
emb|CAN81014.1|  hypothetical protein VITISV_025152                     508   2e-170   Vitis vinifera
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             507   5e-170   
ref|XP_002305292.2|  hypothetical protein POPTR_0004s10630g             506   6e-170   Populus trichocarpa [western balsam poplar]
ref|XP_002264520.2|  PREDICTED: cytochrome P450 82C4                    507   1e-169   Vitis vinifera
ref|XP_008235428.1|  PREDICTED: cytochrome P450 82G1-like               506   2e-169   
ref|XP_007201144.1|  hypothetical protein PRUPE_ppa016050mg             503   5e-169   
ref|XP_007134139.1|  hypothetical protein PHAVU_010G022600g             504   8e-169   
ref|XP_009348372.1|  PREDICTED: cytochrome P450 82G1-like               504   1e-168   
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           503   2e-168   
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                502   3e-168   Vitis vinifera
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                501   6e-168   Vitis vinifera
ref|XP_008235427.1|  PREDICTED: cytochrome P450 82G1-like               502   7e-168   
ref|XP_003548649.2|  PREDICTED: cytochrome P450 82C2-like               501   1e-167   
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           501   2e-167   Vitis vinifera
ref|XP_011008137.1|  PREDICTED: cytochrome P450 82G1-like               500   2e-167   
gb|KDP26346.1|  hypothetical protein JCGZ_17504                         499   6e-167   
ref|XP_003547786.2|  PREDICTED: cytochrome P450 82C2-like               499   1e-166   
gb|KDO65988.1|  hypothetical protein CISIN_1g011292mg                   497   1e-166   
ref|XP_008372516.1|  PREDICTED: cytochrome P450 82G1-like               498   2e-166   
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                497   4e-166   Vitis vinifera
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           491   9e-164   
emb|CAN77159.1|  hypothetical protein VITISV_019026                     493   1e-163   Vitis vinifera
ref|XP_007134140.1|  hypothetical protein PHAVU_010G022700g             490   3e-163   
ref|XP_009348373.1|  PREDICTED: cytochrome P450 CYP82D47-like           490   3e-163   
ref|XP_007200049.1|  hypothetical protein PRUPE_ppa023510mg             488   1e-162   
emb|CAN61061.1|  hypothetical protein VITISV_018742                     488   3e-162   Vitis vinifera
ref|XP_008382597.1|  PREDICTED: cytochrome P450 82G1-like               488   3e-162   
ref|XP_008382594.1|  PREDICTED: cytochrome P450 82G1-like               488   3e-162   
gb|KDP45301.1|  hypothetical protein JCGZ_15166                         487   3e-162   
ref|XP_008372515.1|  PREDICTED: cytochrome P450 82C4-like               486   5e-162   
ref|XP_009372224.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    487   5e-162   
ref|XP_002323130.1|  hypothetical protein POPTR_0016s00980g             485   9e-162   Populus trichocarpa [western balsam poplar]
ref|XP_009372225.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    486   1e-161   
ref|XP_011040244.1|  PREDICTED: cytochrome P450 82C4-like               485   3e-161   
emb|CBI36491.3|  unnamed protein product                                486   3e-161   
gb|KDP26344.1|  hypothetical protein JCGZ_17502                         484   4e-161   
ref|XP_009372223.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    483   3e-160   
emb|CBI37514.3|  unnamed protein product                                500   5e-160   
ref|XP_008235431.1|  PREDICTED: cytochrome P450 82C4-like               481   6e-160   
ref|XP_008372514.1|  PREDICTED: cytochrome P450 CYP82D47-like           481   7e-160   
ref|XP_009372222.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    481   1e-159   
gb|KDP26345.1|  hypothetical protein JCGZ_17503                         480   1e-159   
ref|XP_010036785.1|  PREDICTED: cytochrome P450 82G1                    477   2e-158   
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               476   4e-158   
gb|KDP26347.1|  hypothetical protein JCGZ_17505                         476   6e-158   
ref|XP_007201695.1|  hypothetical protein PRUPE_ppa004301mg             474   2e-157   
ref|XP_002531094.1|  cytochrome P450, putative                          474   4e-157   Ricinus communis
ref|XP_007049687.1|  Cytochrome P450 82A3, putative                     474   5e-157   
ref|XP_011089652.1|  PREDICTED: cytochrome P450 82C2                    474   5e-157   
emb|CAN75482.1|  hypothetical protein VITISV_020998                     473   5e-157   Vitis vinifera
dbj|BAF98469.1|  cytochrome P450                                        471   4e-156   Coptis japonica var. dissecta
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               470   2e-155   
ref|XP_010106089.1|  Cytochrome P450 82C4                               469   5e-155   
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             468   1e-154   
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             467   2e-154   
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    467   2e-154   
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    467   3e-154   Vitis vinifera
emb|CBI29738.3|  unnamed protein product                                473   3e-154   
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           466   8e-154   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               465   2e-153   
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             464   2e-153   
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               464   2e-153   
gb|AJD25203.1|  cytochrome P450 CYP82V2                                 464   4e-153   
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   462   4e-153   
ref|XP_002300088.2|  hypothetical protein POPTR_0001s34230g             463   5e-153   Populus trichocarpa [western balsam poplar]
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               463   6e-153   
ref|XP_011045174.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    463   9e-153   
ref|XP_010036784.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    462   1e-152   
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               462   1e-152   Vitis vinifera
ref|XP_010036782.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    462   3e-152   
ref|XP_010036783.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    461   3e-152   
ref|XP_010069626.1|  PREDICTED: cytochrome P450 CYP82D47-like           462   3e-152   
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             461   5e-152   
ref|XP_010527268.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    460   9e-152   
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               460   1e-151   
ref|XP_007017413.1|  Cytochrome P450                                    459   3e-151   
emb|CAN74205.1|  hypothetical protein VITISV_031127                     459   3e-151   Vitis vinifera
ref|XP_010527267.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    459   4e-151   
ref|XP_004510285.1|  PREDICTED: uncharacterized protein LOC101505071    475   5e-151   
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           458   6e-151   
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     457   9e-151   
emb|CDP15065.1|  unnamed protein product                                457   1e-150   
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             456   2e-150   
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             455   3e-150   
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             456   4e-150   
ref|XP_010527265.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    456   5e-150   
ref|XP_010527266.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    456   6e-150   
ref|XP_008235430.1|  PREDICTED: cytochrome P450 CYP82D47-like           455   7e-150   
ref|XP_004517185.1|  PREDICTED: cytochrome P450 82C4-like               455   8e-150   
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           455   9e-150   
ref|XP_011045172.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    455   1e-149   
ref|XP_010069621.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    454   2e-149   
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               454   2e-149   
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           454   3e-149   Vitis vinifera
ref|XP_007200972.1|  hypothetical protein PRUPE_ppa004569mg             452   3e-149   
ref|XP_006418652.1|  hypothetical protein EUTSA_v10002489mg             453   4e-149   
gb|KCW58034.1|  hypothetical protein EUGRSUZ_H00762                     453   6e-149   
ref|XP_008372381.1|  PREDICTED: cytochrome P450 82G1-like               453   6e-149   
gb|KEH18124.1|  cytochrome P450 family 82 protein                       450   1e-148   
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             452   1e-148   
emb|CAN66023.1|  hypothetical protein VITISV_042713                     451   2e-148   Vitis vinifera
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             451   2e-148   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             451   3e-148   
ref|XP_004292356.1|  PREDICTED: cytochrome P450 82C4-like               449   5e-148   
ref|XP_007134137.1|  hypothetical protein PHAVU_010G022400g             450   7e-148   
ref|XP_010436299.1|  PREDICTED: cytochrome P450 82C4-like               450   8e-148   
ref|XP_010513989.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    449   9e-148   
ref|XP_006297446.1|  hypothetical protein CARUB_v10013469mg             449   9e-148   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    449   1e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             449   1e-147   
emb|CDY53704.1|  BnaC03g67210D                                          449   2e-147   
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           449   2e-147   Vitis vinifera
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               449   2e-147   
ref|XP_010445016.1|  PREDICTED: cytochrome P450 82C4-like               449   2e-147   
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                449   2e-147   Vitis vinifera
ref|XP_010451089.1|  PREDICTED: cytochrome P450 82C4                    449   2e-147   
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           449   2e-147   
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             449   4e-147   
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   449   4e-147   
emb|CDY23316.1|  BnaA08g12300D                                          448   5e-147   
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     448   6e-147   
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           447   7e-147   
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     451   8e-147   
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           447   9e-147   
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    447   1e-146   
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     454   3e-146   
ref|XP_004154898.1|  PREDICTED: cytochrome P450 82A3-like               445   4e-146   
gb|KGN59915.1|  Cytochrome P450                                         446   4e-146   
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           446   4e-146   Vitis vinifera
ref|XP_010466938.1|  PREDICTED: cytochrome P450 82G1-like               446   6e-146   
ref|XP_006339196.1|  PREDICTED: cytochrome P450 82C4-like               445   7e-146   
ref|XP_002869304.1|  CYP82C4                                            445   8e-146   
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           454   9e-146   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    444   1e-145   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    443   3e-145   Vitis vinifera
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               460   3e-145   Vitis vinifera
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           443   3e-145   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               443   4e-145   
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               442   6e-145   
ref|XP_010432796.1|  PREDICTED: cytochrome P450 82C4-like               442   7e-145   
ref|XP_002510313.1|  cytochrome P450, putative                          442   9e-145   Ricinus communis
emb|CAN65652.1|  hypothetical protein VITISV_016780                     440   1e-144   Vitis vinifera
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             441   2e-144   
emb|CDP16080.1|  unnamed protein product                                441   2e-144   
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               440   2e-144   
ref|XP_002885694.1|  CYP82G1                                            440   4e-144   
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   440   4e-144   
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           441   5e-144   
ref|XP_004489343.1|  PREDICTED: cytochrome P450 82A3-like               440   5e-144   
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           440   8e-144   
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           439   9e-144   
ref|XP_002869302.1|  CYP82C4                                            439   1e-143   
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         439   1e-143   
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                439   1e-143   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     439   1e-143   Vitis vinifera
ref|XP_008358513.1|  PREDICTED: cytochrome P450 82G1-like               445   1e-143   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    438   3e-143   Vitis vinifera
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           438   3e-143   
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               438   5e-143   
ref|NP_194925.1|  cytochrome P450, family 82, subfamily C, polype...    437   6e-143   Arabidopsis thaliana [mouse-ear cress]
gb|AGO03797.1|  cytochrome P450-like protein                            437   6e-143   
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           437   8e-143   
gb|ABK28662.1|  unknown                                                 437   8e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                437   1e-142   Vitis vinifera
gb|ABB20912.1|  P450 mono-oxygenase                                     437   1e-142   Stevia rebaudiana
ref|XP_008796321.1|  PREDICTED: cytochrome P450 CYP82D47-like           437   1e-142   
ref|XP_010527272.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    435   1e-142   
ref|XP_009136105.1|  PREDICTED: cytochrome P450 82G1                    436   2e-142   
ref|XP_007047111.1|  Cytochrome P450                                    436   2e-142   
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   436   2e-142   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   436   2e-142   
ref|XP_002510298.1|  cytochrome P450, putative                          436   2e-142   Ricinus communis
emb|CBI32510.3|  unnamed protein product                                439   2e-142   
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         436   2e-142   
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               435   3e-142   
ref|XP_010527271.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    435   3e-142   
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                439   3e-142   Vitis vinifera
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           435   3e-142   
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           435   4e-142   
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             433   5e-142   
ref|XP_007049686.1|  Cytochrome P450, family 82, subfamily C, pol...    437   6e-142   
ref|XP_010106082.1|  Cytochrome P450 82A3                               435   7e-142   
ref|XP_009801176.1|  PREDICTED: cytochrome P450 CYP82D47-like           434   7e-142   
gb|KEH25406.1|  cytochrome P450 family protein                          434   7e-142   
ref|XP_010919967.1|  PREDICTED: cytochrome P450 CYP82D47-like           434   8e-142   
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               435   8e-142   
ref|XP_010104162.1|  Cytochrome P450 82C4                               433   8e-142   
ref|XP_010106080.1|  Cytochrome P450 82A3                               438   1e-141   
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             434   1e-141   
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             434   1e-141   
ref|XP_010527270.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    434   1e-141   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            434   1e-141   
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           434   1e-141   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               434   1e-141   
ref|XP_010527269.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    434   2e-141   
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   434   2e-141   
ref|XP_006283535.1|  hypothetical protein CARUB_v10004585mg             434   2e-141   
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             434   2e-141   
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           433   3e-141   
ref|XP_010092357.1|  Cytochrome P450 82A3                               434   3e-141   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           434   3e-141   
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               433   3e-141   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             433   4e-141   
emb|CDY61596.1|  BnaC03g74240D                                          430   5e-141   
emb|CAN66846.1|  hypothetical protein VITISV_002367                     432   6e-141   Vitis vinifera
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           432   1e-140   
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         431   1e-140   
gb|KEH18125.1|  cytochrome P450 family protein                          431   1e-140   
ref|XP_010106083.1|  Cytochrome P450 82A3                               431   1e-140   
emb|CBI40977.3|  unnamed protein product                                432   1e-140   
ref|NP_189154.1|  cytochrome P450, family 82, subfamily G, polype...    431   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             432   1e-140   
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               446   2e-140   
ref|XP_003548652.1|  PREDICTED: cytochrome P450 82C4-like               431   2e-140   
emb|CDY52276.1|  BnaA03g57690D                                          428   3e-140   
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           431   3e-140   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               431   3e-140   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               431   3e-140   
ref|XP_003618363.1|  Cytochrome P450                                    430   5e-140   
ref|XP_010106079.1|  Cytochrome P450 82A3                               430   5e-140   
gb|AJD25201.1|  cytochrome P450 CYP82D71                                429   5e-140   
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                429   9e-140   
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           429   9e-140   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               428   1e-139   
emb|CAN64501.1|  hypothetical protein VITISV_020341                     427   1e-139   Vitis vinifera
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               429   1e-139   
ref|XP_009616319.1|  PREDICTED: cytochrome P450 CYP82D47-like           429   1e-139   
ref|XP_004249377.1|  PREDICTED: cytochrome P450 82C4-like               429   1e-139   
gb|AFK79026.1|  cytochrome P450 CYP82T1                                 429   2e-139   
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    429   2e-139   
ref|XP_007047112.1|  Cytochrome P450                                    434   2e-139   
gb|KHN04536.1|  Cytochrome P450 82A1                                    427   2e-139   
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             429   2e-139   
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               428   2e-139   
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           428   2e-139   
emb|CDP07595.1|  unnamed protein product                                439   3e-139   
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           428   3e-139   
ref|XP_004306669.1|  PREDICTED: cytochrome P450 82A3-like               428   4e-139   
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    428   4e-139   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             427   4e-139   
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               427   5e-139   
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           427   5e-139   
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    427   6e-139   
dbj|BAM36727.1|  nicotine N-demethylase                                 427   6e-139   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               427   6e-139   
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     427   6e-139   
dbj|BAM36724.1|  nicotine N-demethylase                                 427   7e-139   
ref|XP_010934114.1|  PREDICTED: cytochrome P450 82C4-like               427   7e-139   
gb|ABC69374.1|  CYP82M1v3                                               427   7e-139   Nicotiana tabacum [American tobacco]
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               427   9e-139   
ref|XP_002510297.1|  cytochrome P450, putative                          427   1e-138   Ricinus communis
emb|CBI32505.3|  unnamed protein product                                441   1e-138   
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       427   1e-138   
ref|XP_010106088.1|  Cytochrome P450 82A4                               426   1e-138   
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           427   1e-138   
gb|ABC69376.1|  CYP82M1v5                                               426   1e-138   Nicotiana tabacum [American tobacco]
gb|ABC69372.1|  CYP82M1v1                                               426   1e-138   Nicotiana tabacum [American tobacco]
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     425   2e-138   
gb|ABC69373.1|  CYP82M1v2                                               426   2e-138   Nicotiana tabacum [American tobacco]
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    433   2e-138   Vitis vinifera
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               426   2e-138   
gb|ABC69375.1|  CYP82M1v4                                               426   2e-138   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               426   3e-138   
dbj|BAM36725.1|  nicotine N-demethylase                                 425   3e-138   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           426   3e-138   
dbj|BAM36723.1|  nicotine N-demethylase                                 425   3e-138   
ref|XP_010526011.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    425   4e-138   
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           425   4e-138   
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    425   4e-138   
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               426   4e-138   
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    425   5e-138   
ref|XP_010488628.1|  PREDICTED: cytochrome P450 82G1                    422   5e-138   
gb|KDP38429.1|  hypothetical protein JCGZ_04354                         424   5e-138   
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         426   5e-138   
ref|XP_004147801.1|  PREDICTED: cytochrome P450 82A4-like               425   5e-138   
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               425   5e-138   
ref|XP_006375029.1|  putative cytochrome P450 family protein            424   6e-138   
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         424   6e-138   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             424   7e-138   
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               424   7e-138   
dbj|BAM36726.1|  nicotine N-demethylase                                 424   8e-138   
ref|XP_002885686.1|  CYP82G1                                            424   8e-138   
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               424   9e-138   
ref|XP_002510312.1|  cytochrome P450, putative                          424   9e-138   
ref|XP_004291926.1|  PREDICTED: cytochrome P450 82A3-like               424   1e-137   
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               424   1e-137   
gb|KHG26594.1|  Cytochrome P450                                         424   1e-137   
gb|ABC69371.1|  CYP82E5                                                 423   1e-137   
gb|AAS90126.1|  cytochrome P450                                         424   1e-137   
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             424   2e-137   
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               424   2e-137   
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           423   2e-137   
ref|XP_009757628.1|  PREDICTED: cytochrome P450 CYP82D47-like           423   2e-137   
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             423   2e-137   
gb|ADP65809.1|  nicotine N-demethylase                                  423   2e-137   
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               423   3e-137   
gb|KCW48426.1|  hypothetical protein EUGRSUZ_K02129                     421   3e-137   
ref|XP_009609537.1|  PREDICTED: cytochrome P450 82C4-like               422   3e-137   
ref|XP_009619218.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   3e-137   
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               424   3e-137   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               422   3e-137   
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               423   3e-137   
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               422   4e-137   
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               423   4e-137   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    422   4e-137   
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               422   5e-137   
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         424   5e-137   
ref|XP_004147820.1|  PREDICTED: cytochrome P450 82C4-like               422   5e-137   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   6e-137   
ref|XP_009364154.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   7e-137   
gb|KDP38424.1|  hypothetical protein JCGZ_04349                         421   1e-136   
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               421   1e-136   
ref|XP_007151147.1|  hypothetical protein PHAVU_004G021800g             421   1e-136   
ref|XP_004488195.1|  PREDICTED: cytochrome P450 82A3-like               421   2e-136   
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             421   2e-136   
ref|XP_007017415.1|  Cytochrome P450, putative                          421   2e-136   
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           421   2e-136   
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         421   2e-136   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             422   2e-136   
ref|XP_006297448.1|  hypothetical protein CARUB_v10013469mg             418   2e-136   
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     421   2e-136   
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   421   2e-136   
ref|XP_002883585.1|  CYP82G1                                            419   2e-136   
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               421   3e-136   
ref|XP_003618361.1|  Cytochrome P450                                    420   4e-136   
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    420   4e-136   
gb|KHG29694.1|  Cytochrome P450                                         420   4e-136   
gb|KHN36187.1|  Cytochrome P450 82A3                                    420   4e-136   
gb|ABX56037.1|  CYP82E5v2                                               419   5e-136   
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           420   5e-136   
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             420   6e-136   
ref|XP_006349946.1|  PREDICTED: cytochrome P450 82C2-like               419   7e-136   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               420   7e-136   
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     420   9e-136   
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     417   2e-135   
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           418   2e-135   
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               416   2e-135   
ref|XP_004147822.1|  PREDICTED: uncharacterized protein LOC101212976    434   2e-135   
ref|XP_007017411.1|  Cytochrome P450, putative                          418   2e-135   
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           418   3e-135   
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             417   3e-135   
gb|ABC69420.1|  CYP82E8                                                 417   3e-135   
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               417   4e-135   
gb|KHG29695.1|  Cytochrome P450                                         417   4e-135   
ref|XP_003618354.1|  Cytochrome P450                                    417   5e-135   
gb|AII31758.1|  cytochrome P450 monooxygenase                           417   5e-135   
ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               417   5e-135   
ref|XP_007151141.1|  hypothetical protein PHAVU_004G021200g             417   7e-135   
ref|XP_003546624.1|  PREDICTED: cytochrome P450 82A2-like               416   1e-134   
gb|ABD39480.1|  CYP82E4v10                                              416   1e-134   
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             416   1e-134   
gb|AII31759.1|  cytochrome P450 monooxygenase                           416   1e-134   
ref|XP_002510306.1|  cytochrome P450, putative                          416   1e-134   
gb|KHN34164.1|  Cytochrome P450 82A4                                    416   2e-134   
ref|XP_007017409.1|  Cytochrome P450, family 82, subfamily C, pol...    416   2e-134   
ref|XP_010070481.1|  PREDICTED: cytochrome P450 CYP82D47-like           416   2e-134   
gb|KHN16362.1|  Cytochrome P450 82A3                                    416   2e-134   
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               415   2e-134   
gb|ABD39479.1|  CYP82E4v8                                               415   3e-134   
gb|ABA07807.1|  cytochrome P450 monooxygenase CYP82E3                   415   3e-134   
ref|XP_009609539.1|  PREDICTED: cytochrome P450 82C4-like               415   4e-134   
ref|XP_009770601.1|  PREDICTED: cytochrome P450 CYP82D47-like           415   4e-134   
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             415   4e-134   
emb|CBI19610.3|  unnamed protein product                                427   4e-134   
gb|ABD39478.1|  CYP82E4v7                                               414   4e-134   
ref|XP_009792748.1|  PREDICTED: cytochrome P450 CYP82D47-like           414   5e-134   
gb|KHN42044.1|  Cytochrome P450 82A3                                    415   5e-134   
sp|O49859.1|C82A4_SOYBN  RecName: Full=Cytochrome P450 82A4; AltN...    414   5e-134   
gb|ABA07804.1|  cytochrome P450 monooxygenase CYP82E4v2                 414   6e-134   
ref|XP_011101555.1|  PREDICTED: cytochrome P450 CYP82D47-like           414   6e-134   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    414   6e-134   
ref|XP_004147802.1|  PREDICTED: cytochrome P450 82A4-like               414   7e-134   
ref|NP_001240972.1|  cytochrome P450 82A3                               414   7e-134   
gb|ABA07805.1|  cytochrome P450 monooxygenase CYP82E4v1                 414   8e-134   
emb|CDP00859.1|  unnamed protein product                                414   8e-134   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           414   9e-134   
gb|ABD39476.1|  CYP82E4v5                                               414   9e-134   
gb|KHN36186.1|  Cytochrome P450 82A3                                    414   1e-133   
ref|XP_010696627.1|  PREDICTED: cytochrome P450 CYP82D47-like           413   1e-133   
ref|XP_009778755.1|  PREDICTED: cytochrome P450 82C4-like               413   1e-133   
gb|ABD39474.1|  CYP82E4v3                                               413   1e-133   
gb|ABK55756.1|  P450 monooxygenase-like protein                         413   2e-133   
ref|XP_003554074.1|  PREDICTED: cytochrome P450 82A3-like               413   2e-133   
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               410   2e-133   
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               412   3e-133   
ref|XP_006581227.1|  PREDICTED: cytochrome P450 82A1-like               412   3e-133   
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               412   3e-133   
gb|KHG24650.1|  Cytochrome P450 protein                                 412   4e-133   
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           412   4e-133   
ref|XP_004248527.2|  PREDICTED: cytochrome P450 CYP82D47-like           412   5e-133   
dbj|BAA35080.1|  putative cytochrome P450                               412   6e-133   
ref|XP_009768110.1|  PREDICTED: cytochrome P450 82A4-like               412   6e-133   
ref|XP_010069622.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    410   6e-133   
gb|ABD39475.1|  CYP82E4v4                                               411   7e-133   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    412   8e-133   
ref|XP_003527704.1|  PREDICTED: cytochrome P450 82A1-like               412   9e-133   
gb|KHN13272.1|  Cytochrome P450 82A4                                    411   9e-133   
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               411   1e-132   
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             411   1e-132   
gb|KEH37856.1|  cytochrome P450 family protein                          410   1e-132   
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               411   2e-132   
gb|ABD39477.1|  CYP82E4v6                                               410   2e-132   
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               410   2e-132   
gb|KHG01290.1|  Cytochrome P450                                         410   2e-132   
gb|ABD39481.1|  CYP82E4v11                                              410   2e-132   
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               410   2e-132   
gb|AGD93125.1|  CYP450 nicotine N-demethylase                           410   2e-132   
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           410   3e-132   
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     410   3e-132   
gb|ABD39482.1|  CYP82E4v12                                              410   3e-132   
ref|XP_006856218.1|  hypothetical protein AMTR_s00059p00203770          410   3e-132   
ref|XP_006856215.1|  hypothetical protein AMTR_s00059p00202900          414   3e-132   
gb|KCW58033.1|  hypothetical protein EUGRSUZ_H00761                     410   3e-132   
ref|XP_009758062.1|  PREDICTED: cytochrome P450 82C4-like               408   4e-132   
ref|NP_001240077.1|  cytochrome P450 82A2                               409   4e-132   
ref|XP_009627979.1|  PREDICTED: cytochrome P450 82C4-like               409   4e-132   
ref|XP_009595933.1|  PREDICTED: cytochrome P450 82A4-like               409   5e-132   
emb|CAN82329.1|  hypothetical protein VITISV_016031                     406   6e-132   
gb|KHN16363.1|  Cytochrome P450 82A4                                    408   1e-131   
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             409   1e-131   
gb|AII31760.1|  cytochrome P450 monooxygenase                           408   1e-131   
ref|XP_010040234.1|  PREDICTED: cytochrome P450 CYP82D47-like           409   1e-131   
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               408   1e-131   
gb|KCW45363.1|  hypothetical protein EUGRSUZ_L00956                     408   2e-131   
gb|KHN22285.1|  Cytochrome P450 82A4                                    408   2e-131   
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   409   2e-131   
gb|KHN19614.1|  Cytochrome P450 82A4                                    407   2e-131   
ref|XP_002522370.1|  cytochrome P450, putative                          407   2e-131   
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           407   2e-131   
ref|XP_004236938.1|  PREDICTED: cytochrome P450 82C4-like               407   3e-131   
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           407   4e-131   
ref|XP_007151149.1|  hypothetical protein PHAVU_004G022000g             408   4e-131   
gb|AGN54072.1|  cytochrome P450 monooxygenase                           407   4e-131   
ref|XP_009606611.1|  PREDICTED: cytochrome P450 82C4-like               408   4e-131   
gb|KEH30993.1|  cytochrome P450 family protein                          407   5e-131   
gb|KDP38430.1|  hypothetical protein JCGZ_04355                         407   6e-131   
ref|XP_010070486.1|  PREDICTED: cytochrome P450 CYP82D47-like           407   6e-131   
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           406   6e-131   
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               407   7e-131   
gb|KHN44000.1|  Cytochrome P450 82A4                                    406   7e-131   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             406   9e-131   
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             405   1e-130   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               407   1e-130   
gb|AES74583.2|  cytochrome P450 family 82 protein                       406   1e-130   
ref|XP_010070483.1|  PREDICTED: cytochrome P450 CYP82D47-like           405   2e-130   
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           405   2e-130   
gb|ABR57311.1|  cytochrome P450 monooxygenase                           405   2e-130   
gb|KHG07801.1|  Cytochrome P450                                         405   2e-130   
ref|XP_008378401.1|  PREDICTED: cytochrome P450 CYP82D47-like           405   2e-130   
ref|XP_002510308.1|  cytochrome P450, putative                          404   3e-130   
gb|KEH33015.1|  cytochrome P450 family 82 protein                       405   4e-130   
ref|XP_003618365.1|  Cytochrome P450                                    404   5e-130   
gb|KDP38433.1|  hypothetical protein JCGZ_04358                         403   5e-130   
gb|KDP46184.1|  hypothetical protein JCGZ_10024                         403   6e-130   
gb|KDP38422.1|  hypothetical protein JCGZ_04347                         404   7e-130   
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           404   9e-130   
ref|XP_007033359.1|  Cytochrome P450                                    402   1e-129   
ref|XP_010248151.1|  PREDICTED: cytochrome P450 82C4-like               401   1e-129   
ref|XP_004505090.1|  PREDICTED: cytochrome P450 82A3-like               404   1e-129   
gb|KDP38436.1|  hypothetical protein JCGZ_04361                         402   2e-129   
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             402   2e-129   
ref|XP_004147804.1|  PREDICTED: cytochrome P450 82C4-like               402   3e-129   
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             402   3e-129   
ref|XP_002510311.1|  cytochrome P450, putative                          402   4e-129   
ref|XP_010686308.1|  PREDICTED: cytochrome P450 CYP82D47-like           401   4e-129   
gb|KHN08850.1|  Cytochrome P450 82C4                                    398   5e-129   
gb|KHG01223.1|  Cytochrome P450 protein                                 401   7e-129   
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           402   8e-129   
gb|KCW44328.1|  hypothetical protein EUGRSUZ_L02217                     400   8e-129   
gb|ABD39485.1|  CYP82E2v4                                               400   1e-128   
ref|XP_007017406.1|  Cytochrome P450 82A3, putative                     416   1e-128   
gb|KHN42045.1|  Cytochrome P450 82C4                                    398   2e-128   
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    400   2e-128   
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           400   2e-128   
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1           402   4e-128   
gb|ABD39483.1|  CYP82E2v2                                               399   4e-128   
ref|XP_003554857.2|  PREDICTED: cytochrome P450 82A4-like               409   5e-128   
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             399   6e-128   
ref|XP_007136643.1|  hypothetical protein PHAVU_009G061500g             398   7e-128   
gb|ABA07806.2|  cytochrome P450 monooxygenase CYP82E2                   398   8e-128   
ref|XP_007151143.1|  hypothetical protein PHAVU_004G021400g             398   1e-127   
ref|XP_007151896.1|  hypothetical protein PHAVU_004G085000g             398   1e-127   



>ref|XP_009780811.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=708

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/499 (64%), Positives = 386/499 (77%), Gaps = 19/499 (4%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             R+  +  K   +  P+APGAWPFIGHLHLL   +P  RTLG MADKYGP+F L+LG+HPA
Sbjct  204   RNRASTAKNSSIGAPKAPGAWPFIGHLHLLSDPVPACRTLGLMADKYGPIFQLQLGTHPA  263

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +VVSS E+VK+CFTTND +FASRP M + KY  YN+AVFALAPYG YWR++RKMVTLEL 
Sbjct  264   LVVSSWEMVKDCFTTNDKIFASRPKMTLSKYF-YNDAVFALAPYGPYWREIRKMVTLELF  322

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSMCHENG----EVNLSEWFEHVTLNITLRLLVGKRF  649
             T SRL+KL+HVR SEV+ CI +LYS C+ N     +VNLS WFEH+T NI +R+L GKRF
Sbjct  323   TNSRLEKLKHVRASEVDCCIKELYSFCNNNNNFPTQVNLSSWFEHITCNIIIRMLAGKRF  382

Query  650   SRIAK--------HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEI  805
             S              KE + +AL+LGG FV SDVIPSLEWMDIGG+IK +K+   E+D +
Sbjct  383   SSSVNEQSGTKEMQFKESIKKALFLGGTFVVSDVIPSLEWMDIGGHIKAMKQTFNEVDSV  442

Query  806   IGTWLQEHIRNRKEdddd------qsdfmdVMLSSLPEDAVISGHKRDtiikattlilil  967
                WL+EHI+ RK+ ++       QSDF+DVMLS+LPE+ ++SG+ RD IIKATTLILI+
Sbjct  443   FDIWLKEHIQKRKDCENSNTGDDHQSDFIDVMLSTLPEETMVSGYDRDAIIKATTLILIM  502

Query  968   tGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGL  1147
             T SESTAETLIWT SLL+N+   +K+AQDE+D HVG++R VEESD+KNLKY QAI+KE L
Sbjct  503   TASESTAETLIWTLSLLMNDRRILKIAQDELDEHVGRNRWVEESDMKNLKYLQAIVKETL  562

Query  1148  RLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDE  1327
             RLYPPGPL+GPREA+EDC +GKYHI KGTRLI+NL KL RD  +W  P EF+PERWF  E
Sbjct  563   RLYPPGPLAGPREAIEDCYVGKYHIRKGTRLIVNLWKLQRDSSIWENPNEFQPERWFLKE  622

Query  1328  HASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGL  1507
             H +I + G+SFEY+PFS GRRMCPG+ F  QVV LTLARLL GFNIS P   PVD+SEGL
Sbjct  623   HMNINFRGQSFEYIPFSSGRRMCPGLTFGTQVVHLTLARLLHGFNISMPREEPVDLSEGL  682

Query  1508  GIALPKLTPIQVLLTPRLP  1564
             GIALPK+ P+Q LLTPRLP
Sbjct  683   GIALPKMKPLQPLLTPRLP  701



>emb|CDP15727.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/487 (64%), Positives = 380/487 (78%), Gaps = 20/487 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEAPGA PFIGHLH L G+LP+AR LG MADKYGP F LRLGS PAIVVSS E+VKECF
Sbjct  86    APEAPGALPFIGHLHHLGGQLPLARILGSMADKYGPTFSLRLGSRPAIVVSSWEMVKECF  145

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND  FASRP+ A+ KY+G N A+FALAPYG YWRDVRKMVTLEL+T  RL+KL+HVR 
Sbjct  146   TINDKTFASRPNTALAKYMGNNNAIFALAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRA  205

Query  521   SEVEHCIGDLYSMCHENG--------EVNLSEWFEHVTLNITLRLLVGKRFSRIA-----  661
             SE    I DLYS+C +N         +V L+EWFE +T N+ LR+LVG+ FS  +     
Sbjct  206   SEFNKWIRDLYSLCSKNDRPDVDVPTKVVLNEWFELLTFNLILRMLVGRPFSTSSQGNDN  265

Query  662   ---KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
                + +KE + + LYLGGVFV SDVIP +EW+DIGG+IK +K+  KE+DE++G WLQEHI
Sbjct  266   SEDRRMKEAIKKMLYLGGVFVFSDVIPWIEWLDIGGHIKSMKKAGKELDEVLGQWLQEHI  325

Query  833   RNRKEd---dddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIW  1003
             +  K+     +   DFMDVMLS++PE   ISGHKRD IIK+TT  LI+TGSESTAETLIW
Sbjct  326   QKAKQSHPESEAVHDFMDVMLSTIPETGEISGHKRDAIIKSTTATLIMTGSESTAETLIW  385

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               SLLLN+P+ +K+AQ+E+D+ VGK R +EE+DIKNL + QAI+KE  RLYPPGPLSGPR
Sbjct  386   ALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKETFRLYPPGPLSGPR  445

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EA EDC +G + +PKG RLI+NL KLHRDPR+WS+P EFKPER F + HA+I   G+SFE
Sbjct  446   EATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPER-FLNSHANISLKGQSFE  504

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
             Y+PFS GRRMCP +N+ + VVQLTLAR+LQ F+I+TPMGMPVDM EGLG+ALPKL P++V
Sbjct  505   YIPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDIATPMGMPVDMGEGLGVALPKLKPLEV  564

Query  1544  LLTPRLP  1564
             LLTPRLP
Sbjct  565   LLTPRLP  571



>emb|CDP15728.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/487 (64%), Positives = 381/487 (78%), Gaps = 20/487 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE PGA PFIGHLH L G+LP+AR LG MADK+GP+F LRLGS PAIVVSS E+VK+CF
Sbjct  39    APEPPGALPFIGHLHHLGGQLPLARILGSMADKHGPIFSLRLGSRPAIVVSSWEMVKDCF  98

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND  FASRP+MAV KY+G N A+F+LAPYG YWRDVRKMVTLEL+T  RL+KL+HVR 
Sbjct  99    TTNDKTFASRPNMAVAKYMGNNNAIFSLAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRA  158

Query  521   SEVEHCIGDLYSMCHENG--------EVNLSEWFEHVTLNITLRLLVGKRFSRIA-----  661
             SE    I DLYS+C +N         +V L+EWFE +T N+ LR+LVG+ FS  +     
Sbjct  159   SEFNKWIRDLYSLCSKNDRPDVDVPTKVVLNEWFELLTFNLILRMLVGRPFSTSSQGNDN  218

Query  662   ---KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
                + LKE + +ALYL GVFV SDVIP +EW+DIGG+IK +K+  KE+DE++G WLQEHI
Sbjct  219   SEDRRLKEAIKKALYLSGVFVFSDVIPWIEWLDIGGHIKSMKKAGKELDEVLGQWLQEHI  278

Query  833   RNRKEd---dddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIW  1003
             +  K+     +   DFMDVMLS++PE   ISGHKRD IIK+TT  LILTGSESTAETLIW
Sbjct  279   QKAKQSHPESEAVHDFMDVMLSTIPEIGEISGHKRDAIIKSTTATLILTGSESTAETLIW  338

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               SLLLN+P+ +K+AQ+E+D+ VGK R +EE+DIKNL + QAI+KE  RLYPPGPLSGPR
Sbjct  339   ALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKETFRLYPPGPLSGPR  398

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EA EDC +G + +PKG RLI+NL KLHRDPR+WS+P EFKPER F + H +I   G+SFE
Sbjct  399   EATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPER-FMNSHENISLKGQSFE  457

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
             Y+PFS GRRMCP +N+ + VVQLTLAR+LQ F+I+TPMGMPVDM EGLG+ALPKL P++V
Sbjct  458   YIPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDITTPMGMPVDMGEGLGVALPKLKPLEV  517

Query  1544  LLTPRLP  1564
             LLTPRLP
Sbjct  518   LLTPRLP  524



>ref|XP_006340061.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=511

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/488 (63%), Positives = 382/488 (78%), Gaps = 12/488 (2%)
 Frame = +2

Query  113   KYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGS  292
             K+K  N  +  +     P+APGAWPFIGHLHLL+G LPV RTLG MADKYGP+F L+LG 
Sbjct  23    KFKSRNITSAAI---GAPKAPGAWPFIGHLHLLNGHLPVCRTLGLMADKYGPIFQLQLGD  79

Query  293   HPAIVVSSCEVVKECFTTN-DLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVT  469
             HPAIVVS+ E+VK+CFT N D +F+SRP+MAV KYLGYN AVFA+APYG YWRD+RKMVT
Sbjct  80    HPAIVVSNWEIVKDCFTANNDKIFSSRPNMAVSKYLGYNGAVFAMAPYGPYWRDIRKMVT  139

Query  470   LELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRF  649
             +EL+T SRL+KL+HVRTSEV  CI +LYS C    +VNLS WFE++T NI +R+L GKRF
Sbjct  140   VELLTHSRLEKLKHVRTSEVNCCIKELYSNC--PSQVNLSSWFENITCNIIVRMLAGKRF  197

Query  650   SRIAK--HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQ  823
             +  A+  + KE + +ALYLGG FV SD IP LEWMDIGG+IK +KE  KE+D +  +WL+
Sbjct  198   TGCAEEMNFKESIKKALYLGGAFVFSDAIPWLEWMDIGGHIKAMKETYKEVDSVFDSWLK  257

Query  824   EHIRNRKEddddqsdfmdVMLSSLPEDAVI--SGHKRDtiikattlililtGSESTAETL  997
             +HI +  + +        +MLS+LPE+  +  + + R  IIKATTLILI+T SESTAETL
Sbjct  258   QHINSIGDGEQSDFID--IMLSTLPEETNMESAAYNRHAIIKATTLILIMTASESTAETL  315

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
             IW  SLL+NN H++K+AQ+E+D  +G+++ VEESDIKNL Y QAI+KE LRLYPPGPL+G
Sbjct  316   IWALSLLMNNTHSLKLAQNELDEQIGRNKWVEESDIKNLPYLQAIVKETLRLYPPGPLAG  375

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             PREA+EDC IGKYHI KGTRLI+NL KL RD R+W +P EFKPERWF +EH +I + G+ 
Sbjct  376   PREAIEDCYIGKYHIKKGTRLIVNLWKLQRDSRIWEDPNEFKPERWFLNEHTNINFRGQH  435

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FEY+PFS GRRMCPG+ F+ QVV LTLA+LL GFNIS P   PVD+SEGLGIALPK+ P+
Sbjct  436   FEYIPFSSGRRMCPGLTFATQVVHLTLAKLLHGFNISMPKEEPVDVSEGLGIALPKVKPL  495

Query  1538  QVLLTPRL  1561
             Q LL+PRL
Sbjct  496   QPLLSPRL  503



>ref|XP_004247061.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=518

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/490 (63%), Positives = 381/490 (78%), Gaps = 13/490 (3%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             I  KYK  N  +        P+APGAWPFIGHLHLL G LPV RTLG MADKYGP+F L+
Sbjct  30    IARKYKSRNITSA------APKAPGAWPFIGHLHLLSGHLPVCRTLGLMADKYGPIFQLQ  83

Query  284   LGSHPAIVVSSCEVVKECFTT-NDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRK  460
             LG HPAIVVS+ E+VK+CFT  ND +FASRP+MA+ KYLGYN A+FALAPYG YWR++RK
Sbjct  84    LGDHPAIVVSNWEMVKDCFTAKNDKIFASRPNMAISKYLGYNGAIFALAPYGPYWRNIRK  143

Query  461   MVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVG  640
             MVTLEL+T SRL+KL+HVRTSEV  CI +LYS  +  G+VNLS WFE++T NI +R+L G
Sbjct  144   MVTLELLTNSRLEKLKHVRTSEVNSCIKELYS-NNCPGQVNLSSWFENITCNIIIRMLAG  202

Query  641   KRFSRIAK--HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGT  814
             KRF+  A+  + KE + +ALYLGG FV SD IP  EWMDIGG+IK +K+  KE+D +  +
Sbjct  203   KRFTGSAEEMNFKESIKKALYLGGTFVFSDSIPWFEWMDIGGHIKAMKDTYKEVDSVFDS  262

Query  815   WLQEHIRNRKEddddqsdfmdVMLSSLPEDAVI-SGHKRDtiikattlililtGSESTAE  991
             WL++HI +  + +        +MLS+LPE+  + SG+ RD IIKATTLILI+T SESTAE
Sbjct  263   WLKQHINSIGDGEQSDFID--IMLSTLPEETNMESGYNRDAIIKATTLILIMTASESTAE  320

Query  992   TLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPL  1171
             TLIW  SLLLNN H++K+AQDE+D H+G+++ VEESDIKNL Y QAI+KE LRLYPPGPL
Sbjct  321   TLIWALSLLLNNTHSLKLAQDELDEHIGRNKWVEESDIKNLPYLQAIVKETLRLYPPGPL  380

Query  1172  SGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVG  1351
             +GPREA+EDC + KYHI KGTRLI+NL KL RD R+W +P EFKPERWF  EH +I + G
Sbjct  381   AGPREALEDCYVDKYHIKKGTRLIVNLWKLQRDSRIWKDPNEFKPERWFLKEHTNINFRG  440

Query  1352  KSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLT  1531
             ++FEY+PFS GRRMCPG+ F  QVV LTLA+LL GFN+S     PVD+SEGLGIALPK+ 
Sbjct  441   QNFEYIPFSSGRRMCPGLTFGSQVVHLTLAKLLHGFNVSMLKEEPVDLSEGLGIALPKVK  500

Query  1532  PIQVLLTPRL  1561
             P+Q LL+PRL
Sbjct  501   PLQPLLSPRL  510



>ref|XP_006346673.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=518

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/497 (61%), Positives = 376/497 (76%), Gaps = 17/497 (3%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             +  KYK  N+          P+APGA PFIGHL+LL G LPV R LG M DKYGP+F L+
Sbjct  20    VACKYKTRNRET------VAPKAPGALPFIGHLYLLSGDLPVCRILGLMTDKYGPIFQLQ  73

Query  284   LGSHPAIVVSSCEVVKECFTT-NDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRK  460
             LGSHPA+VVSS E+VK+CFT  ND +FASRPSMA+ KYLGYN A+FALAPYG+YWRD+RK
Sbjct  74    LGSHPALVVSSWEMVKDCFTAGNDKIFASRPSMALSKYLGYNGAIFALAPYGQYWRDIRK  133

Query  461   MVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSE--WFEHVTLNITLRLL  634
             MVT+EL+T SRL+KL+HVRTSEV   I DLYS C  N    ++   WFE++T NI +R+L
Sbjct  134   MVTVELLTNSRLEKLKHVRTSEVNCSIKDLYSNCSSNNNSEVNLSSWFENITFNIIIRML  193

Query  635   VGKRFS---RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEI  805
             VGKRF+       + KE + + LYLGG FV SD IPS+EWMDIGG+IK +K+  KE+D +
Sbjct  194   VGKRFTGCFEAEMNFKESIKKVLYLGGTFVFSDAIPSIEWMDIGGHIKSMKQTYKEVDSV  253

Query  806   IGTWLQEHIRNRKEddddqsdfmd-----VMLSSLPEDAVISGHKRDtiikattlililt  970
             + +WL++HI  RK+ D + S         VMLS+LPE+ + SG+ R+ IIKAT LILI+T
Sbjct  254   LDSWLKQHIEKRKDCDSNSSGSDQSDFFDVMLSTLPEETMESGYDRNAIIKATALILIMT  313

Query  971   GSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLR  1150
              SESTAETLIW  S+L+N   ++K+AQDE++ HVG++R VEESDIKNL Y QAI+KE LR
Sbjct  314   ASESTAETLIWALSMLINGTRSLKLAQDELEEHVGRNRWVEESDIKNLPYLQAIVKETLR  373

Query  1151  LYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEH  1330
             LYPPGPL+GPREA+EDC +G YHI KGTRLI+NL KL RD R+W +P EFKPERWF  EH
Sbjct  374   LYPPGPLAGPREAIEDCYVGNYHIKKGTRLIVNLWKLQRDSRIWEDPNEFKPERWFLKEH  433

Query  1331  ASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLG  1510
             +   + G++FEY+PFS GRRMCPG+ F  QVV LTLA+LL GFNIST    P+D+SEGLG
Sbjct  434   SEFNFRGQNFEYIPFSSGRRMCPGLTFGSQVVHLTLAKLLHGFNISTTREEPIDLSEGLG  493

Query  1511  IALPKLTPIQVLLTPRL  1561
             IALPK+ P+Q  ++PRL
Sbjct  494   IALPKVKPLQPFVSPRL  510



>gb|AJD25202.1| cytochrome P450 CYP82U4 [Salvia miltiorrhiza]
Length=522

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/481 (61%), Positives = 360/481 (75%), Gaps = 16/481 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE PGAWP IGHLHLL G  PVARTLG MAD++GPVF LRLGSH  +VVSS E +KEC T
Sbjct  37    PEPPGAWPLIGHLHLLDGLSPVARTLGAMADRHGPVFSLRLGSHRGLVVSSWEAIKECLT  96

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
              ND VFA+RPS+AV KYLGY  A F LAPYG YWRDVRKMVT++L+T   L    HVRT+
Sbjct  97    ANDRVFATRPSIAVAKYLGYGGASFGLAPYGPYWRDVRKMVTVDLLTARHLDDFSHVRTA  156

Query  524   EVEHCIGDLYSMCH--ENGE----VNLSEWFEHVTLNITLRLLVGKRFSRIAK-------  664
             EV+  + DL+SMC     GE    V LS   E +T NI LR+LVGKRFS  +K       
Sbjct  157   EVDGFVKDLHSMCGGGNGGESKMVVALSGRIELLTFNIILRMLVGKRFS-FSKGDDDKNW  215

Query  665   HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK  844
               +E + + LYLGGVFV SD IPSLEW+DIGGYIK +K+  K++D ++  W+QE I+ RK
Sbjct  216   RFQEAIKKVLYLGGVFVFSDAIPSLEWLDIGGYIKSMKQTFKQVDNVLEDWVQERIQTRK  275

Query  845   Eddddqsdfmd-VMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
             + D         VMLS++ ++ +++G+ R+T+IKAT L+LI+TGSEST+ET+IW  SLLL
Sbjct  276   QKDAQTDSDFMDVMLSTIDKNEMMAGYTRETVIKATILMLIMTGSESTSETIIWAISLLL  335

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NNPH +K AQDE+D ++G+DR V+ESDI NL Y QAI KE LRLYPPGPLSGPREA+EDC
Sbjct  336   NNPHTMKTAQDEIDNNIGRDRFVQESDINNLTYLQAIFKETLRLYPPGPLSGPREALEDC  395

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              IG YH+P+GTRL+LNL KLHRDP +W  P+EF+PER F +E + + + G+ FE++PFS 
Sbjct  396   HIGGYHVPRGTRLVLNLWKLHRDPNIWFNPDEFRPER-FLNEKSQMNFKGQYFEFIPFSS  454

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRRMCPGM F LQV+ LTLARLLQ F+ S P G  VDM EGLGIALPKL P+ V+LTPRL
Sbjct  455   GRRMCPGMTFGLQVIHLTLARLLQSFDFSMPNGETVDMGEGLGIALPKLKPLDVVLTPRL  514

Query  1562  P  1564
             P
Sbjct  515   P  515



>ref|XP_007049681.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX93838.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/503 (56%), Positives = 368/503 (73%), Gaps = 19/503 (4%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             +I +Y   N N       R+PE  G+WP IGHLHLL G+  + + LG MADKYGP++ L+
Sbjct  22    VIWRYIARNSNKS-----RIPEPSGSWPLIGHLHLLGGKETLCKKLGAMADKYGPLYSLK  76

Query  284   LGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKM  463
             LG    +VVSS E+ K+C T ND   A+RPS+A G+++GYN A+FALAPYG YWR++RK+
Sbjct  77    LGHRRVLVVSSWEIAKDCLTNNDRALATRPSIAAGRHIGYNNAIFALAPYGEYWRNIRKI  136

Query  464   VTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG----EVNLSEWFEHVTLNITLRL  631
             VT+EL++  RL+KL+H+R SE++  I +L+ +C EN     +V +SE  E +T NI LR+
Sbjct  137   VTIELLSSYRLEKLKHIRFSEMDLFIKELFRLCVENADNCAQVTMSEVLERLTFNINLRM  196

Query  632   LVGKRFSRIAK--------HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVS  787
             LVGKRF+  +           ++ + + LYL G+FV +D +P LEWMDI G+++ +K+ +
Sbjct  197   LVGKRFASSSYAQAHSQPWRYEKAIKQTLYLSGIFVLADALPFLEWMDIQGHVRSMKQTA  256

Query  788   KEMDEIIGTWLQEHIRNRKEdd-ddqsdfmdVMLSSLPEDAVISGHKRDtiikattlili  964
             KE+D II  WL+ H+R ++E     +SDFMDVML++LP+DAVISGH RDTI+KATTLIL 
Sbjct  257   KELDSIISVWLENHLRRKRESQGSCESDFMDVMLANLPQDAVISGHTRDTIVKATTLILT  316

Query  965   ltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEG  1144
             +TG EST+ T+ W  SLLLN+P  +K AQ E+D+HVG DR VEESDIK+LKY QAI+KE 
Sbjct  317   MTGGESTSVTMTWVLSLLLNHPSVLKAAQQELDLHVGIDRWVEESDIKSLKYLQAIVKET  376

Query  1145  LRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRD  1324
             LRLYPPGPL+G REAMEDC I  YH+PKGTRLI+NL KL RDPRVW  P EF+PER F  
Sbjct  377   LRLYPPGPLTGIREAMEDCCIAGYHVPKGTRLIVNLWKLQRDPRVWENPGEFQPER-FLT  435

Query  1325  EHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEG  1504
              HA     G++FEY+PFS GRR CP + F LQVV LTLA+LLQGF+I TP G PVDM EG
Sbjct  436   THADFDVRGQNFEYIPFSSGRRSCPAITFGLQVVHLTLAKLLQGFDIRTPDGKPVDMGEG  495

Query  1505  LGIALPKLTPIQVLLTPRLPNLF  1573
             LG+ALPK TP+ V+LTPRL + F
Sbjct  496   LGLALPKRTPLDVVLTPRLAHEF  518



>ref|XP_002531093.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31307.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/484 (57%), Positives = 361/484 (75%), Gaps = 16/484 (3%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             + VPE  GAWP IGH HLL  + P  R LG +ADK GP++ LRLG +  +V S  EVVKE
Sbjct  33    INVPEPTGAWPLIGHFHLLARQEPACRILGDIADKTGPLYSLRLGINRIMVASGWEVVKE  92

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTTND +FA+R S+A GKY+GYN A+FALAPYG+YWRDVRK+ TL+L++ +RL+KL+HV
Sbjct  93    CFTTNDRIFATRASIAAGKYIGYNNAIFALAPYGQYWRDVRKLATLKLLSSNRLEKLKHV  152

Query  515   RTSEVEHCIGDLYSMCHENGEVN-----LSEWFEHVTLNITLRLLVGKRFSRIAK-----  664
             R SEV+  + DL+++  E+ + N     ++  FE +T NI+LR++VGK+FS         
Sbjct  153   RLSEVDTFLKDLHNLYVESADSNHAKVIINTLFERLTFNISLRMIVGKQFSSSTYGEENS  212

Query  665   ---HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
                  K+ +  A+YL G FV SD IP LEW+D  G+I  +K  +KE+D +I TWL+EHI+
Sbjct  213   EPWRYKKAIEEAVYLSGTFVMSDAIPWLEWIDHQGHISAMKRTAKELDAVIETWLEEHIK  272

Query  836   NRK--EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTT  1009
              R   E    ++DFMDVMLS L EDAV+SGH RDT+IKAT +IL LTGS STA TL W  
Sbjct  273   KRSSDECHKGENDFMDVMLSDLDEDAVMSGHSRDTVIKATAMILTLTGSGSTAVTLTWAL  332

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLNNP  +K AQ+E+D+HVG+++ V+ESDI+NLKY QAI+KE LRLYPPGPL+G REA
Sbjct  333   SLLLNNPGVLKAAQEELDIHVGREKWVQESDIENLKYLQAIVKETLRLYPPGPLTGIREA  392

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
              EDC +G Y +PKGTRLI+N+ +L RDPRVW +P EF+PER F   H+ + + G++FE++
Sbjct  393   SEDCNLGGYFVPKGTRLIINIWQLQRDPRVWKDPGEFQPER-FLTTHSDVDFRGQNFEFI  451

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PFS GRR CP + F LQVV LTLAR+LQGF+++T  G+PVDM+EGLGIALPK+ P++V++
Sbjct  452   PFSSGRRSCPAITFGLQVVHLTLARVLQGFDLTTIGGLPVDMTEGLGIALPKVNPVEVII  511

Query  1550  TPRL  1561
              PRL
Sbjct  512   KPRL  515



>ref|XP_010696237.1| PREDICTED: cytochrome P450 82G1 [Beta vulgaris subsp. vulgaris]
Length=532

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/505 (55%), Positives = 364/505 (72%), Gaps = 22/505 (4%)
 Frame = +2

Query  101   QIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGL  280
             QI  +  +  K N K    ++P+  GA PFIGHLHLL G+  +ARTLG MAD+ GP FGL
Sbjct  26    QISARKSKKTKQNFK----QLPQPKGALPFIGHLHLLGGKRTIARTLGAMADECGPSFGL  81

Query  281   RLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRK  460
             RLG   A+V++S EVV++CF  ND V A+RP+MAV KY  YN A FA++P+G+YWRD+RK
Sbjct  82    RLGQQQAVVLNSKEVVQDCFVKNDAVTATRPTMAVSKYFAYNYACFAISPHGKYWRDIRK  141

Query  461   MVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCH-------ENGEVNLSEWFEHVTLNI  619
             + T+EL++  RL+K++HVR SEV  CI +L+  C        + G+++L +WFE+ + NI
Sbjct  142   ISTVELLSTKRLEKMKHVRASEVNSCIKNLFRKCTTLNNSSLQTGKISLCKWFEYTSFNI  201

Query  620   TLRLLVGKRFS--------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGL  775
              + ++VGK FS          A   K ++ RA Y+ GV VPSD +P +EWMD+ GYI+ +
Sbjct  202   VISMIVGKTFSPELYDENGTFASRFKNLIGRATYVAGVAVPSDFMPYIEWMDVMGYIRDM  261

Query  776   KEVSKEMDEIIGTWLQEHIRNRKEddddqsd--fmdVMLSSLPEDAVISGHKRDtiikat  949
             K++ KE+D IIG WL EHI  RKE +    D  FMDVMLS+L E   +SG+ R+T+IKAT
Sbjct  262   KDIHKEIDMIIGHWLDEHILRRKEHEGSFEDGDFMDVMLSNLVEGCDMSGYTRETVIKAT  321

Query  950   tlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQA  1129
              LIL+LTGSEST+ TL W  SLLLN+P A+K AQ+E+D  VGK R V ESDI NL Y QA
Sbjct  322   ALILLLTGSESTSITLTWAISLLLNHPKALKAAQEELDQQVGKQRWVNESDIANLPYLQA  381

Query  1130  IIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPE  1309
             IIKE LRLYPP PL+GPREA+EDC I  + I KGTR+I+N+ K+HRDPRVW+ P+EF+PE
Sbjct  382   IIKETLRLYPPSPLAGPREALEDCHIDNHFIRKGTRIIVNIWKVHRDPRVWAGPDEFRPE  441

Query  1310  RWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPV  1489
             R F +EH SI + G+SFEY+PFS GRR CPGMNF LQVVQL L +L+QGF++ T  G PV
Sbjct  442   R-FLNEHGSIDFRGQSFEYIPFSLGRRACPGMNFGLQVVQLMLGQLIQGFDMWTEDGGPV  500

Query  1490  DMSEGLGIALPKLTPIQVLLTPRLP  1564
             DMSEGLG+A+P+ TP+  +L  RLP
Sbjct  501   DMSEGLGLAMPRATPLNAILAARLP  525



>ref|XP_006443550.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
 ref|XP_006479221.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Citrus sinensis]
 ref|XP_006479222.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Citrus sinensis]
 gb|ESR56790.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
Length=520

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/485 (58%), Positives = 360/485 (74%), Gaps = 24/485 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWP IGHL LL    PV + LG +ADKYGP++ LRLG HP ++VSS E+VK+CF
Sbjct  38    APEPFGAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCF  97

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND V A+RPS+A GKYLGY+ AVFALAPYGRYWRD+RK+ T +L++  RL+ L+HVR 
Sbjct  98    TTNDRVLATRPSIAAGKYLGYDNAVFALAPYGRYWRDIRKIATTDLLSSHRLELLKHVRY  157

Query  521   SEVEHCIGDLYSMCHEN----GEVNLSEWFEHVTLNITLRLLVGKRFS------------  652
             SEV+  I DLYS C EN     +V +S+  E +T NI+LRL+ GKRFS            
Sbjct  158   SEVDTFIKDLYSRCSENAFNPAKVVISKLIEQLTFNISLRLIAGKRFSAREFGEQGSEGW  217

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
             RI + +KE    A YL GVFV  D IP LEW+D  G+I  ++  +K++D++IG WL+EH 
Sbjct  218   RINRAIKE----ATYLTGVFVLGDAIPWLEWIDFQGHIGSMRRTAKKIDDVIGNWLEEHA  273

Query  833   RNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
             + + +    + DFMDV+LS + ++ V+SGH RDT+IKAT LILI TGSEST   +IWT S
Sbjct  274   QRKLQ---GEGDFMDVLLSKIEDNTVMSGHTRDTVIKATALILIFTGSESTYLGIIWTLS  330

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLN+P  +K AQ+E+D+HVG+DR V ESD+KNLKY +AI+KE LR+YPPGP++G REAM
Sbjct  331   LLLNHPKELKKAQEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIYPPGPVTGIREAM  390

Query  1193  EDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLP  1372
             EDC+IG YH+PKGTRLI+N+ KLHRDPR+W  P EF+PER F   HA +    + FEY+P
Sbjct  391   EDCEIGGYHVPKGTRLIVNVWKLHRDPRMWENPCEFRPER-FLTTHADVDVNTQHFEYIP  449

Query  1373  FSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLT  1552
             FS GRR CPGM   LQ+VQLTLAR+LQGF+++T  G+PVDM EGLGIALPKL P++V++ 
Sbjct  450   FSFGRRSCPGMTSGLQIVQLTLARILQGFDLATVGGIPVDMKEGLGIALPKLNPVEVVIK  509

Query  1553  PRLPN  1567
             PRL +
Sbjct  510   PRLSD  514



>ref|XP_006443549.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
 ref|XP_006479223.1| PREDICTED: cytochrome P450 82G1-like [Citrus sinensis]
 gb|ESR56789.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
Length=525

 Score =   523 bits (1348),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 269/485 (55%), Positives = 356/485 (73%), Gaps = 23/485 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWP IGHL LL+G+ P+ + LG +ADKYGP++ LRLG HP ++VSS E+VK+CF
Sbjct  38    APEPSGAWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSSWEIVKDCF  97

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND + A+R  +  GK +GY+ A+FALAPYG YWRD+RK+ T EL++  RL+ L+HVR 
Sbjct  98    TTNDRILATRAKIVAGKLMGYDNAIFALAPYGPYWRDIRKIATTELLSSHRLELLKHVRY  157

Query  521   SEVEHCIGDLYSMCHENG----EVNLSEWFEHVTLNITLRLLVGKRFS------------  652
             SEV+  I DLYS+C EN     +V +S+  E +T NI+L+L+ GKRFS            
Sbjct  158   SEVDTFIKDLYSLCSENAFNPAKVVISKLIEQLTFNISLKLIAGKRFSAKDYEEQGSEAW  217

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
             RI + +KE    A +L GVF+  D IP LEW+D  G++  +K  +KE+D++IG WL+E +
Sbjct  218   RINRAIKE----ATHLFGVFILGDAIPWLEWIDFQGHVGSMKSTAKEIDDVIGNWLKERL  273

Query  833   RNR--KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWT  1006
             +N+   E  + + D +DV+LS L EDAV+ GH RDT++KAT LILILTGSEST   +IWT
Sbjct  274   QNKLQGEGHNGKGDLIDVLLSKLQEDAVMGGHTRDTVVKATALILILTGSESTYLGIIWT  333

Query  1007  TSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPRE  1186
              SLLLN+P  +K AQ+E+D+HVG+DR V ESD+K LKY +AI+KE LR+YPPGP++G RE
Sbjct  334   MSLLLNHPKELKKAQEELDVHVGRDRWVNESDMKKLKYLRAIVKETLRIYPPGPVTGIRE  393

Query  1187  AMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEY  1366
             AMEDC+IG YH+PKGTRLI+N+ KLHRDPR+W  P EF+PER F   HA +    + FEY
Sbjct  394   AMEDCEIGGYHVPKGTRLIVNIWKLHRDPRMWENPCEFRPER-FLTTHADVDVNTQHFEY  452

Query  1367  LPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVL  1546
             +PFS GRR CPGM   LQ+VQLTLAR+LQGF+++T  G PVDM  GLG+ALPK  P++V+
Sbjct  453   VPFSFGRRSCPGMTSGLQIVQLTLARILQGFDLATVGGTPVDMQIGLGLALPKSNPLEVI  512

Query  1547  LTPRL  1561
             + PRL
Sbjct  513   IKPRL  517



>gb|KHG29587.1| Cytochrome P450 protein [Gossypium arboreum]
Length=521

 Score =   521 bits (1341),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 270/498 (54%), Positives = 354/498 (71%), Gaps = 21/498 (4%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHP  298
             +R  KN+ K     +PE  G+ P IGHLHLL G+ P+ + L  MADK+GP++ L+LG+H 
Sbjct  22    RRAPKNSKKSC---IPEPSGSLPLIGHLHLLGGKEPICKKLATMADKHGPLYSLKLGTHR  78

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
              +VVSS E+ K+CFT ND   A+R S+A G+++GYN AV ALAPYG YWR++RK+ T+EL
Sbjct  79    VLVVSSWEIAKDCFTDNDRTLATRASIAAGRHMGYNNAVMALAPYGEYWRNIRKIATVEL  138

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFS--  652
             ++  RL+KL+H+R SE++  I +LY +     +V ++E  E +T NI LRLLVGKRFS  
Sbjct  139   LSSHRLEKLKHIRFSEMDSFIKELYGLSRNGAKVTINEALERLTFNINLRLLVGKRFSGC  198

Query  653   ----------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDE  802
                       R  K +K    RAL+L GVFV +D +P LEW+DI G+++ +K+ +KE+D 
Sbjct  199   DYEEVNSEPWRYGKAIK----RALHLSGVFVLADALPYLEWLDIQGHVRSMKKTAKELDS  254

Query  803   IIGTWLQEHIRNRKEdd-ddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSE  979
             +I  WL+EH++ +K +    ++DFMDVML+ LPED VISGH RD I+KATTLIL LTG E
Sbjct  255   VISVWLEEHLKKKKANQGTSENDFMDVMLNHLPEDTVISGHNRDNIVKATTLILSLTGGE  314

Query  980   STAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYP  1159
             ST+ T+ W  SLLLN+P  +  AQ E+D+HVGK R VEESDIKNLKY QAI+KE LRLYP
Sbjct  315   STSVTITWVLSLLLNHPKILMAAQQELDLHVGKQRWVEESDIKNLKYLQAIVKETLRLYP  374

Query  1160  PGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASI  1339
             PGP++G REA +DC+I  Y + KGTRLI+NL KL RDPRVW   +EF+PER F   H   
Sbjct  375   PGPITGIREATKDCRIAGYDVSKGTRLIVNLWKLQRDPRVWENADEFRPER-FMTTHVDF  433

Query  1340  GYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIAL  1519
                G++FEY+PFS GRR CPG+ F LQVV L +A+L+QGF+I T  G  VDM EGLG+AL
Sbjct  434   DVRGQNFEYMPFSSGRRSCPGITFGLQVVHLMVAKLIQGFDIKTAEGTAVDMEEGLGLAL  493

Query  1520  PKLTPIQVLLTPRLPNLF  1573
             PKL PI V+L PRL   F
Sbjct  494   PKLNPIDVVLRPRLRTEF  511



>ref|XP_010091295.1| Cytochrome P450 82G1 [Morus notabilis]
 gb|EXC36851.1| Cytochrome P450 82G1 [Morus notabilis]
Length=546

 Score =   513 bits (1322),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 279/505 (55%), Positives = 357/505 (71%), Gaps = 23/505 (5%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHP  298
             K + K N     + VPE  GA P IGHLHLL G++PVA  LG MADKYGP++ LRLG H 
Sbjct  37    KCNRKKNNITNKICVPEPSGALPIIGHLHLLGGQVPVALILGAMADKYGPIYSLRLGQHR  96

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
             A+V+SS E+VKECFTTND +FA+RPS+AVGKY+ Y+ A FA++ YG YWRDVRKMVTL L
Sbjct  97    ALVLSSWELVKECFTTNDRLFANRPSIAVGKYILYDSAAFAISSYGNYWRDVRKMVTLRL  156

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVN-LSEWFEHVTLNITLRLLVGKRFSR  655
             ++  RL+ L+H+RTSE    I  LY    + G +  LSE  E +T N+  RL+VGKRF +
Sbjct  157   LSSHRLESLQHIRTSEFGSFIKGLYFEYTKLGPLAPLSELLEQLTFNLNARLIVGKRFIK  216

Query  656   IA--------KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIG  811
              A        +  K+ +  ALYL GVFV SD IP +E +DI G++  +K V KE+D ++G
Sbjct  217   SAVGDADTDARRFKKAIKEALYLSGVFVWSDAIPWVECLDIHGHVSSMKRVFKEIDLVLG  276

Query  812   TWLQEHIRNRK------------EddddqsdfmdVMLSSLPED-AVISGHKRDtiikatt  952
              WL+EH + R+             + D + D MDVMLSS+ ED A++S + RDTIIKAT 
Sbjct  277   KWLEEHRQAREVLDDQRSNDKSSSNGDVERDLMDVMLSSIEEDDAMLSCYSRDTIIKATA  336

Query  953   lililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAI  1132
             LILILTG+ESTA TLIW  SLLLNNP  +K AQ E+D HVG+DR V+ESD+ NLK+ +AI
Sbjct  337   LILILTGTESTAVTLIWAISLLLNNPSVMKAAQRELDTHVGRDRWVQESDLSNLKFLEAI  396

Query  1133  IKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPER  1312
             +KE +RLYPPGP++GPREA E+C +G +H+PKGTRLI+N+ KLHRDPR+W++P EF+PER
Sbjct  397   VKETIRLYPPGPITGPREATEECFVGGHHVPKGTRLIVNIWKLHRDPRMWADPCEFRPER  456

Query  1313  WFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVD  1492
              F   H  + + G++F+Y+PFS GRR CPGM F L VV+L LA L+QGF   T    PVD
Sbjct  457   -FMTTHEDLNFRGQNFQYIPFSSGRRSCPGMTFGLLVVELMLASLVQGFEFKTKDDKPVD  515

Query  1493  MSEGLGIALPKLTPIQVLLTPRLPN  1567
             M EGLGIALPKL  + V L PRLP 
Sbjct  516   MREGLGIALPKLNSLDVFLYPRLPT  540



>ref|XP_002264473.1| PREDICTED: cytochrome P450 82C4-like [Vitis vinifera]
Length=519

 Score =   512 bits (1318),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 263/503 (52%), Positives = 354/503 (70%), Gaps = 19/503 (4%)
 Frame = +2

Query  95    YNQIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVF  274
             YN+ I++    N        +  P+ PGAWP IGHLHLL G++P+ RTLG MADK+GPVF
Sbjct  21    YNRWIVRTLTHNSKG-----ISAPKPPGAWPIIGHLHLLSGQVPIFRTLGAMADKHGPVF  75

Query  275   GLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDV  454
              ++LG HPA+VVSS E VKECFTTND VFASRP  +V K LGYN A+F  APYG +WR++
Sbjct  76    MIQLGMHPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNYAMFGSAPYGLFWREM  135

Query  455   RKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNI  619
             RK+  +E+++  RL +L+ VR SE++ CI DLYS+  +N      +V +SEWFEH+T N 
Sbjct  136   RKLSVVEILSARRLNELKDVRISELDACIKDLYSLGKDNNWISPIKVVMSEWFEHLTFNF  195

Query  620   TLRLLVGKRFSRIAKHLKE-------VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLK  778
              LR++ GKR+   A H  E        + + L L G FVPSDV P LE +D+ GY+  +K
Sbjct  196   ALRMIAGKRYFDNAVHGNEEARGAIITIKKYLSLSGAFVPSDVFPFLERLDLQGYLGSMK  255

Query  779   EVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattli  958
              V++E+D ++G+W++EH+   K +   + DF+DV+LS++ +D  + GH R+T+IKAT + 
Sbjct  256   HVTEELDCLVGSWVEEHVMRLKSEPGCRHDFIDVLLSTV-QDTSMFGHTRETVIKATIVN  314

Query  959   liltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIK  1138
             LI+ GS+ST+ T  W  S LLNN  A+K AQ+E+D+ VG+ R VEESDI+ L Y +AIIK
Sbjct  315   LIVGGSDSTSITSTWILSALLNNREAMKHAQEELDLKVGRSRWVEESDIQKLDYLRAIIK  374

Query  1139  EGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWF  1318
             E LRLYP  PL  P EA +DC +  YHIPKGTRL +N  KLHRDPRVWS PEEF+PER F
Sbjct  375   ESLRLYPAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPER-F  433

Query  1319  RDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMS  1498
                HA++   G  FE +PF  GRR CPG+N +LQ++ LT ARLLQGF+++TP   PVDM+
Sbjct  434   LGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMT  493

Query  1499  EGLGIALPKLTPIQVLLTPRLPN  1567
             EG+   +PKLTP++V+LTPRLP+
Sbjct  494   EGISFTMPKLTPLRVMLTPRLPS  516



>gb|KHG07864.1| Cytochrome P450 protein [Gossypium arboreum]
Length=515

 Score =   511 bits (1316),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 264/484 (55%), Positives = 347/484 (72%), Gaps = 18/484 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  G+ P IGHLHLL G+ P+ + L  MADK+GP++ L+LG+H  +VVSS E+ K+CF
Sbjct  33    IPEPTGSLPLIGHLHLLGGKEPICKNLATMADKHGPLYSLKLGTHRILVVSSWEIAKDCF  92

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND   A+R ++  G+Y+GY+ A+F+LAPYG YWR++RKM T+EL++  RL+KL+H+R 
Sbjct  93    TNNDRTLATRANIVAGRYMGYDNAIFSLAPYGEYWRNIRKMATVELLSSHRLEKLKHIRF  152

Query  521   SEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFS------------RIAK  664
             SE++  I +LY +     +V +SE  E +T NI LR+L GKRFS            R  K
Sbjct  153   SEMDSFIKELYGLSRNGDKVTISEALERLTFNINLRMLFGKRFSGNDYGEVDSEPWRFMK  212

Query  665   HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK  844
              +K    RALYL G+FV  D +  LE  DI G+++ +KE +KE+D II  WL+EH++ ++
Sbjct  213   AIK----RALYLFGIFVLPDALQWLERFDIQGHVRSMKENAKELDSIINVWLEEHLKKKR  268

Query  845   Edd-ddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
             E+    +SDFMDVML+ L ED VISGH RDTI+KATTL+L LTG EST+ T+ W  SLLL
Sbjct  269   ENQGASESDFMDVMLTHLREDTVISGHTRDTIVKATTLVLSLTGGESTSVTITWVLSLLL  328

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             N+P+ +  AQ+E+D HVGK R VEESDIKNLKY QAI+KE LRLYPPGP++G REAM+DC
Sbjct  329   NHPNVLITAQEEIDHHVGKQRWVEESDIKNLKYLQAIVKETLRLYPPGPITGIREAMQDC  388

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              I  Y +PKGTRLI+N+ KLHRDPRVW    EF PER F   H      G++FEY+PFS 
Sbjct  389   CIAGYDVPKGTRLIVNIWKLHRDPRVWENANEFHPER-FMTTHVDFDVKGQNFEYMPFSS  447

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPGM F LQVV LT+++L+QGF+I    G  VDM EGLG+ALPKL P++V+L+PRL
Sbjct  448   GRRSCPGMTFGLQVVHLTVSKLIQGFDIRVAEGTAVDMEEGLGLALPKLNPLEVVLSPRL  507

Query  1562  PNLF  1573
                F
Sbjct  508   GTEF  511



>ref|XP_006376421.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP54218.1| cytochrome P450 family protein [Populus trichocarpa]
Length=511

 Score =   509 bits (1310),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 351/481 (73%), Gaps = 17/481 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             R PE  GAWP IGHL  L G+ P  +TL  +ADKYGP++ LRLGSH  +VVSS E VK+C
Sbjct  29    RAPEPSGAWPVIGHLPRLRGQDPACKTLAAIADKYGPIYSLRLGSHRIVVVSSWETVKDC  88

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
              TTND + A+R ++A GK++GYN A FAL+PYG+YWRDVRK+VTL+L++  RL+ L+HVR
Sbjct  89    LTTNDRILATRANIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTLQLLSNHRLEMLKHVR  148

Query  518   TSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRFSRIAK-------  664
               EV+  I  L++   E  E    V +S+ FE +T NI+LR +VGKR+            
Sbjct  149   VLEVDAFIKGLHNSYAETAEYPAKVTMSKLFESLTFNISLRTIVGKRYCSSLYDKENSEP  208

Query  665   -HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
                K+ + +ALYL G+FV SD IP LEW+D  G+I  +K  +KE+D +IG+WL+EH+   
Sbjct  209   WRYKKAIEKALYLSGIFVMSDAIPWLEWIDFQGHISAMKRTAKELDAVIGSWLEEHL---  265

Query  842   KEddddqsdfmdVMLSSLPEDAV-ISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
             K++   +SDFMDV++S+L + A  +SG+ RD +IKATTLIL LTG+ STA TL W  SLL
Sbjct  266   KKEIQGESDFMDVIISNLADGAAEMSGYSRDVVIKATTLILTLTGAGSTAVTLTWALSLL  325

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LN+P  +K AQ+E+D  VG+++ VEESDI+NL Y QAI+KE LRLYPPGPL+G REAMED
Sbjct  326   LNHPSVLKAAQEELDKQVGREKWVEESDIQNLMYLQAIVKETLRLYPPGPLTGIREAMED  385

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C I  Y++PKGTRL++N+ KLHRDPRVW  P++F+PER F   HA + + G+ FE++PFS
Sbjct  386   CHICGYYVPKGTRLVVNIWKLHRDPRVWKNPDDFQPER-FLTTHADLDFRGQDFEFIPFS  444

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CP +N  + VV LTLARLLQGF+++T  G+PVDM+EG GIALPKL P++ ++ PR
Sbjct  445   SGRRSCPAINLGMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIALPKLIPLEAVIKPR  504

Query  1559  L  1561
             L
Sbjct  505   L  505



>ref|XP_011037409.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
 ref|XP_011037412.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=511

 Score =   509 bits (1310),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 350/481 (73%), Gaps = 17/481 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             RVPE  GAWP IGHL  L G+ P  +TL  + DKYGP++ LRLGSH  +VVSS E VK+C
Sbjct  29    RVPEPSGAWPVIGHLPCLRGQDPACKTLAAIDDKYGPIYSLRLGSHRIVVVSSRETVKDC  88

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
              TTND + A+R ++A GK++GYN A FAL+PYG+YWRDVRK+VTL+L++  RL+ L+HVR
Sbjct  89    LTTNDRILATRANIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTLQLLSNHRLEMLKHVR  148

Query  518   TSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRFSRIAK-------  664
               EV+  I  L++   E  E    V +S+ FE +T NI+LR +VGKR+            
Sbjct  149   KLEVDAFIKGLHNSYAETAEYPAKVTMSKLFESLTFNISLRTIVGKRYCSTIYDKENSEP  208

Query  665   -HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
                K+ + +ALYL G+FV SD IP LEW+D  G++  +K  +KE+D +IG+WL+EH+   
Sbjct  209   WRYKKAIEKALYLSGIFVMSDAIPWLEWIDFQGHVSAMKRTAKELDAVIGSWLEEHL---  265

Query  842   KEddddqsdfmdVMLSSLPEDAV-ISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
             K++   +SDFMDVM+S+L + A  +SG+ RD +IKATTLIL LTG+ STA TL W  SLL
Sbjct  266   KKEIQGESDFMDVMISNLADGAAEMSGYSRDVVIKATTLILTLTGAGSTAVTLTWALSLL  325

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LN+P  +K AQ+E+D  VG+++ VEESDI+NL Y QAI+KE LRLYPPGPL+G REAMED
Sbjct  326   LNHPSVLKAAQEELDKQVGREKWVEESDIQNLVYLQAIVKETLRLYPPGPLTGIREAMED  385

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C I  Y++PKGTRL++N+ KLHRDPRVW  P +F+PER F   HA + + G+ FE++PFS
Sbjct  386   CHICGYYVPKGTRLVVNIWKLHRDPRVWKNPNDFQPER-FLTTHADLDFRGQDFEFIPFS  444

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CP +N  + VV LTLARLLQGF+++T  G+PVDM+EG GIALPKL P++ ++ PR
Sbjct  445   SGRRSCPAINLGMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIALPKLIPLEAVVKPR  504

Query  1559  L  1561
             L
Sbjct  505   L  505



>emb|CAN81014.1| hypothetical protein VITISV_025152 [Vitis vinifera]
Length=519

 Score =   508 bits (1308),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 259/483 (54%), Positives = 343/483 (71%), Gaps = 14/483 (3%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             +  P+ PGAWP IGHLHLL G++P+ RTLG MADK+GPVF ++LG HPA+VVSS E VKE
Sbjct  36    ISAPKPPGAWPIIGHLHLLSGQVPIFRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKE  95

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTTND VFASRP  +V K LGYN A F  APYG +WR++RK+  +E+++  RL +L+ V
Sbjct  96    CFTTNDKVFASRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVVEILSARRLNELKDV  155

Query  515   RTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE-  676
             R SE++ CI DLYS+  +N      EV +SEWFEH+T N  LR++ GKR+   A H  E 
Sbjct  156   RISELDACIQDLYSLGKDNNWISPIEVVMSEWFEHLTFNFVLRMIAGKRYFDNAVHGNEE  215

Query  677   ------VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
                    + + L L G FVPSDV P LE +D+ GY+  +K V++E+D ++G+W++EH+  
Sbjct  216   ARGAIIAIKKFLSLSGAFVPSDVFPFLERLDLKGYLGSMKHVAEELDCLVGSWVEEHVMR  275

Query  839   RKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
              K +   + DF+DV+LS++ +D  + GH R+T+IKAT   LI+ GS+ST+ T  W  S L
Sbjct  276   LKSEPGSRHDFIDVLLSAV-QDTSMFGHSRETVIKATIGNLIVGGSDSTSITSTWILSAL  334

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN  A+K AQ+E+D+ VG+ R VEESDI+ L Y +AIIKE LRLY   PL  P EA +D
Sbjct  335   LNNREAMKXAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYXAAPLLVPHEATQD  394

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C +  YHIPKGTRL +N  KLHRDPRVWS PEEF+PER F   HA++   G  FE +PF 
Sbjct  395   CHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPER-FLGSHANLDVFGHQFELIPFG  453

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CPG+N +LQ++ LT ARLLQGF+++TP   PVDM+EG+   +PKLTP+ V+LTPR
Sbjct  454   SGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLXVMLTPR  513

Query  1559  LPN  1567
             LP+
Sbjct  514   LPS  516



>ref|XP_007201702.1| hypothetical protein PRUPE_ppa004095mg [Prunus persica]
 gb|EMJ02901.1| hypothetical protein PRUPE_ppa004095mg [Prunus persica]
Length=530

 Score =   507 bits (1306),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 272/487 (56%), Positives = 351/487 (72%), Gaps = 21/487 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             VP+  GAWPFIGHL LL G+ PVA TLG MAD +GP+F L+LG H  +V+S+ + VKEC 
Sbjct  41    VPQPSGAWPFIGHLPLLRGKDPVALTLGAMADDHGPIFSLKLGQHQVLVLSAWDTVKECL  100

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND VFA+RPS+A GKYLGY+ A+F+LAPYG YWR +RK+ TLEL++  R++ L HVRT
Sbjct  101   TTNDRVFATRPSIAGGKYLGYDNALFSLAPYGPYWRHIRKLATLELLSTKRVETLSHVRT  160

Query  521   SEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRFS--------RIAK  664
             SEV+  I +L S+C +NG     V+LSE  E +T NI +RL+ GKRF+          A 
Sbjct  161   SEVDLFIKNLLSLCTKNGTGSTPVHLSELIEFLTFNINVRLIAGKRFTAEQYNEKNSEAW  220

Query  665   HLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
               ++ V  ALYL GVFV SD +P LEW+D + G++  +K   KE+D ++G WL+EH R R
Sbjct  221   RFEKAVKEALYLFGVFVWSDAMPWLEWLDSLFGHVGSMKRCFKELDCVLGKWLEEH-RQR  279

Query  842   KEdd----ddqsdfmdVMLSSLPEDA-VISGHKRDtiikattlililtGSESTAETLIWT  1006
                       +SD MDVM+SSL E+  VISGH  D +IK+T L+LILTG+EST+ TL W 
Sbjct  280   SSAQGKIERVESDLMDVMISSLQEEEDVISGHSLDNVIKSTALVLILTGTESTSVTLTWA  339

Query  1007  TSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPRE  1186
              SLLLNNP  +K AQ E+D+HVG+DR V+ESD+ NLKY QAI+KE LR+YPPGPL+G RE
Sbjct  340   LSLLLNNPKTLKAAQQELDIHVGRDRWVQESDLPNLKYLQAILKETLRVYPPGPLTGLRE  399

Query  1187  AMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGK-SFE  1363
             A EDC +  YH+ KGTR+++N+ KL RDPR+W+ P EF+PER F   HA + + G+ +FE
Sbjct  400   ATEDCHLAGYHVSKGTRVLVNIWKLQRDPRMWANPSEFQPER-FMTTHADVEFKGQNNFE  458

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
             Y+PFS GRR CPGM   LQVVQL LARL+QGF++S      VDM EGLG+ALPK  P++ 
Sbjct  459   YIPFSSGRRSCPGMVLGLQVVQLILARLVQGFDMSRVGEEAVDMREGLGLALPKANPLEA  518

Query  1544  LLTPRLP  1564
             LL+PRLP
Sbjct  519   LLSPRLP  525



>ref|XP_002305292.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
 gb|EEE85803.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
Length=516

 Score =   506 bits (1304),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 265/484 (55%), Positives = 345/484 (71%), Gaps = 17/484 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             R PE  GAWP  GHL  L G+ P  +TLG +ADKYGP++ L+ G H  +VVSS E VK+C
Sbjct  29    RAPEPSGAWPLFGHLPSLVGKDPACKTLGAIADKYGPIYSLKFGIHRTLVVSSWETVKDC  88

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
               TND V A+R  +A GK++ YN A FALAPYG+YWRDVRK+ TL+L++  RL+ L+HVR
Sbjct  89    LNTNDRVLATRAGIAAGKHMFYNNAAFALAPYGQYWRDVRKLATLQLLSNQRLEMLKHVR  148

Query  518   TSEVEHCIGDLYSMCHEN----GEVNLSEWFEHVTLNITLRLLVGKRFSRIAK-------  664
              SEV+  I  L+S    N     +VN+S+  E +T NI LR +VGKR+            
Sbjct  149   VSEVDTFIKGLHSFYAGNVDSPAKVNISKLLESLTFNINLRTIVGKRYCSSTYDKENSEP  208

Query  665   -HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
                K+ + +ALYL G+FV SD IP LEW+D  G++  +K+ +KE+D +I  WL+EH++ +
Sbjct  209   WRYKKAIKKALYLSGIFVMSDAIPFLEWLDYQGHVSAMKKTAKELDAVIRNWLEEHLKKK  268

Query  842   KEd---dddqsdfmdVMLSSLPEDA-VISGHKRDtiikattlililtGSESTAETLIWTT  1009
              +     D +SDFMDVM+S+L E    ISG+ RD +IKAT LIL LTG+ STA TL+WT 
Sbjct  269   IDGELGSDRESDFMDVMISNLAEGPDKISGYSRDVVIKATALILTLTGAGSTATTLVWTL  328

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLNNP  +K AQ+E+D  VG++R VEESDI+NLKY QAI+KE LRLYPPGPL+G REA
Sbjct  329   SLLLNNPTVLKAAQEELDKQVGRERWVEESDIQNLKYLQAIVKETLRLYPPGPLTGIREA  388

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
             MEDC IG Y +PKGTRL++N+ KLHRDPRVW  P EFKP+R F   HA + + G++ E++
Sbjct  389   MEDCSIGGYDVPKGTRLVVNIWKLHRDPRVWKNPNEFKPDR-FLTTHADLDFRGQNMEFI  447

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PFS GRR CP +N  L VV LTLAR+LQGF+++T  G+PVDM EG GIALPK TP++V++
Sbjct  448   PFSSGRRSCPAINLGLIVVHLTLARILQGFDLTTVAGLPVDMIEGPGIALPKETPLEVVI  507

Query  1550  TPRL  1561
              PRL
Sbjct  508   KPRL  511



>ref|XP_002264520.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=567

 Score =   507 bits (1306),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 259/483 (54%), Positives = 343/483 (71%), Gaps = 14/483 (3%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             +  P+ PGAWP IGHLHLL G++P+ RTLG MADK+GPVF ++LG HPA+VVSS E VKE
Sbjct  84    ISAPKPPGAWPIIGHLHLLSGQVPIFRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKE  143

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTTND VFASRP  +V K LGYN A F  APYG +WR++RK+  +E+++  RL +L+ V
Sbjct  144   CFTTNDKVFASRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVVEILSARRLNELKDV  203

Query  515   RTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE-  676
             R SE++ CI DLYS+  +N      EV +SEWFEH+T N  LR++ GKR+   A H  E 
Sbjct  204   RISELDACIQDLYSLGKDNNWISPIEVVMSEWFEHLTFNFVLRMIAGKRYFDNAVHGNEE  263

Query  677   ------VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
                    + + L L G FVPSDV P LE +D+ GY+  +K V++E+D ++G+W++EH+  
Sbjct  264   ARGAIIAIKKFLSLSGAFVPSDVFPFLERLDLKGYLGSMKHVAEELDCLVGSWVEEHVMR  323

Query  839   RKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
              K +   + DF+DV+LS++ +D  + GH R+T+IKAT   LI+ GS+ST+ T  W  S L
Sbjct  324   LKSEPGSRHDFIDVLLSAV-QDTSMFGHSRETVIKATIGNLIVGGSDSTSITSTWILSAL  382

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN  A+K AQ+E+D+ VG+ R VEESDI+ L Y +AIIKE LRLY   PL  P EA +D
Sbjct  383   LNNREAMKRAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYSAAPLLVPHEATQD  442

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C +  YHIPKGTRL +N  KLHRDPRVWS PEEF+PER F   HA++   G  FE +PF 
Sbjct  443   CHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPER-FLGSHANLDVFGHQFELIPFG  501

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CPG+N +LQ++ LT ARLLQGF+++TP   PVDM+EG+   +PKLTP+ V+LTPR
Sbjct  502   SGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLCVMLTPR  561

Query  1559  LPN  1567
             LP+
Sbjct  562   LPS  564



>ref|XP_008235428.1| PREDICTED: cytochrome P450 82G1-like [Prunus mume]
Length=535

 Score =   506 bits (1303),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 272/486 (56%), Positives = 352/486 (72%), Gaps = 19/486 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             VP+  GAWPFIGHL LL G+ PVA TLG MAD +GP+F L+LG H  +V+S+ + VKEC 
Sbjct  46    VPQPSGAWPFIGHLPLLRGKDPVALTLGAMADDHGPIFSLKLGQHQVLVLSAWDTVKECL  105

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND VFA+R S+A GKYLGY+ A+FALAPYG YWR VRK+ TLEL++  R++ L HVRT
Sbjct  106   TTNDRVFATRASIAGGKYLGYDNALFALAPYGPYWRHVRKLATLELLSTKRVEMLSHVRT  165

Query  521   SEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRFS--------RIAK  664
             SEV+  + +L S+C +NG     V+LSE  E +T NI +RL+ GKRF+          A 
Sbjct  166   SEVDLFVKNLLSLCTKNGAGSTPVHLSELIEFLTFNINVRLIAGKRFTAEQYNEKNSEAW  225

Query  665   HLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEIIGTWLQEH---I  832
               ++ V  ALYL GVFV SD +P LEW+D + G++  +K   KE+D ++G WL+EH    
Sbjct  226   CFEKAVKEALYLFGVFVWSDAMPWLEWLDSLFGHVGSMKRCFKELDCVLGKWLEEHRQRS  285

Query  833   RNRKEddddqsdfmdVMLSSLPEDA-VISGHKRDtiikattlililtGSESTAETLIWTT  1009
             R + + D  +SD MDVM+SSL E+   ISGH  D +IK+T L+LILTG+EST+ T+ W  
Sbjct  286   RPQGKIDRVESDLMDVMISSLQEEEDAISGHSLDNVIKSTALVLILTGTESTSVTVTWAL  345

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLNNP  +K AQ E+D+HVG+DR V+ESD+ NLKY QAI+KE LR+YPPGPL+G REA
Sbjct  346   SLLLNNPKTLKAAQQELDIHVGRDRWVQESDLPNLKYLQAILKETLRVYPPGPLTGLREA  405

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGK-SFEY  1366
              EDC +  YH+PKGTRL++N+ KL RDPR+W+ P EF+PER F   HA + + G+ +FEY
Sbjct  406   TEDCHLAGYHVPKGTRLLVNIWKLQRDPRMWANPSEFQPER-FMTTHADVEFKGQNNFEY  464

Query  1367  LPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVL  1546
             +PFS GRR CPGM   LQVVQL LARL+QGF++S      VDM EGLG+ALPK  P++ L
Sbjct  465   IPFSSGRRSCPGMVLGLQVVQLILARLVQGFDMSRVGEEAVDMREGLGLALPKANPLEAL  524

Query  1547  LTPRLP  1564
             L+PRLP
Sbjct  525   LSPRLP  530



>ref|XP_007201144.1| hypothetical protein PRUPE_ppa016050mg, partial [Prunus persica]
 gb|EMJ02343.1| hypothetical protein PRUPE_ppa016050mg, partial [Prunus persica]
Length=502

 Score =   503 bits (1296),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 272/485 (56%), Positives = 350/485 (72%), Gaps = 19/485 (4%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             P+  GAWPFIGHL LL G+ PVA TLG MAD +GP+F L+LG H  +V+S+ E VKEC T
Sbjct  1     PQPSGAWPFIGHLPLLRGKDPVAVTLGAMADDHGPIFSLKLGQHQVLVLSAWETVKECLT  60

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND VFA+RPSMA GKYLGY+ A FA+APYG YWR VRK+  LEL++  R++ L H+RTS
Sbjct  61    TNDRVFATRPSMAGGKYLGYDNAAFAIAPYGPYWRHVRKLAMLELLSTKRVEMLSHIRTS  120

Query  524   EVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRFS--------RIAKH  667
             EV+  + +L S+C +NG     V+LSE  E +T NI +RL+VGKRF+          A  
Sbjct  121   EVDLFVKNLLSLCMKNGAGPTPVHLSELIEFLTFNINVRLIVGKRFTAEQYNEKNSDAWR  180

Query  668   LKEVVSRALYLGGVFVPSDVIPSLEWMDI-GGYIKGLKEVSKEMDEIIGTWLQEH---IR  835
              ++ V  ALYL GVFV SD +P LEW+DI  G++  +K   KE+D ++G WL+EH    R
Sbjct  181   FEKAVKDALYLLGVFVWSDAMPWLEWLDILFGHVGSMKRCFKELDCVLGKWLEEHRQRSR  240

Query  836   NRKEddddqsdfmdVMLSSLPEDA-VISGHKRDtiikattlililtGSESTAETLIWTTS  1012
              + + D  +SD MDVM+SS  E+  VI GH RD +IKAT L+LILTG+EST+ TL W  S
Sbjct  241   PQCKIDRVESDLMDVMMSSFQEEEDVIFGHSRDNVIKATALVLILTGTESTSVTLTWALS  300

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLNNP  +K AQ E+D+HVG+DR V+ESD+ NLKY QAI+KE LR+YPPGPL+G REA 
Sbjct  301   LLLNNPTTLKAAQQELDIHVGRDRWVQESDLPNLKYLQAILKETLRIYPPGPLAGLREAT  360

Query  1193  EDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGK-SFEYL  1369
             EDC +  YH+PKGTR+++N+ KL RDPR+W+ P EF+P+R F   HA + +  + +FEY+
Sbjct  361   EDCHLAGYHVPKGTRVLVNIWKLQRDPRMWANPGEFQPKR-FMTTHADVEFKDQNNFEYI  419

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PFS GRR CPGM   LQVVQL LARL+QGF++S      VDM EGLG+ALPK  P++ LL
Sbjct  420   PFSSGRRSCPGMVLGLQVVQLILARLVQGFDMSRVCEEAVDMREGLGLALPKANPLEALL  479

Query  1550  TPRLP  1564
             +PRLP
Sbjct  480   SPRLP  484



>ref|XP_007134139.1| hypothetical protein PHAVU_010G022600g [Phaseolus vulgaris]
 gb|ESW06133.1| hypothetical protein PHAVU_010G022600g [Phaseolus vulgaris]
Length=530

 Score =   504 bits (1298),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 262/497 (53%), Positives = 339/497 (68%), Gaps = 15/497 (3%)
 Frame = +2

Query  116   YKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSH  295
             +   N++  +    ++PE  GA PFIGHLHLL+ R+P  RT   MA+KYGP+F ++LG H
Sbjct  28    FTSPNESTKRKKGTKIPEPYGALPFIGHLHLLNARIPYFRTFSAMAEKYGPIFCVKLGCH  87

Query  296   PAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLE  475
             P IVV+S E+ KEC TTND VFASRP+   G+ +GYN A+F LAPYG YWR++RKM  LE
Sbjct  88    PTIVVNSREIAKECLTTNDRVFASRPNTTGGRLMGYNNAIFGLAPYGNYWREIRKMAVLE  147

Query  476   LMTVSRLKKLRHVRTSEVEHCIGDLYSMCHE------NGEVNLSEWFEHVTLNITLRLLV  637
             +++  RL+KL+HVR +E    + DLYS          + EV +S   EH T NI +R++ 
Sbjct  148   ILSSYRLEKLKHVRDTETFSLVKDLYSSMSSPKNVKGSTEVAISNLLEHTTFNIIVRMIA  207

Query  638   GKRF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKE  793
             GKRF           A  L++ +  + YL GVFV +D IPSL W D  GY+  +K  +K+
Sbjct  208   GKRFGGDTVNQEDNEAWKLRKSIRDSTYLFGVFVVADAIPSLSWFDFQGYVSFMKRTAKQ  267

Query  794   MDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtG  973
              D I+  W++EH+R+R  D   + DFMDVM+S+  E   I G+K++T+IKAT ++LILTG
Sbjct  268   TDLILQKWMEEHLRDRVRDGKCERDFMDVMISTFEEQEEICGYKKETVIKATAMLLILTG  327

Query  974   SESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRL  1153
             S STA TL W  SLLLN+P  +K+A  E+D HVGK+R VEESDIKNL Y  AIIKE LRL
Sbjct  328   SGSTAMTLTWALSLLLNHPKVLKVALQELDTHVGKERWVEESDIKNLNYLHAIIKETLRL  387

Query  1154  YPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHA  1333
             YPP PL+G RE MEDC +  YH+PKGTRL++NL  L RDP VW+ P EF+PER F   H 
Sbjct  388   YPPAPLTGIREVMEDCSLVGYHVPKGTRLLINLWNLQRDPEVWANPNEFQPER-FLSSHR  446

Query  1334  SIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGI  1513
              I ++ + FE +PFS GRR CPGM F LQV  LTLARLLQGF+I    G  VDM+EGLG+
Sbjct  447   DIDFMSQDFELIPFSFGRRSCPGMAFGLQVTHLTLARLLQGFHICLKDGAEVDMTEGLGV  506

Query  1514  ALPKLTPIQVLLTPRLP  1564
             ALPK  P++V+L PRLP
Sbjct  507   ALPKEQPLRVMLQPRLP  523



>ref|XP_009348372.1| PREDICTED: cytochrome P450 82G1-like [Pyrus x bretschneideri]
Length=539

 Score =   504 bits (1297),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 271/511 (53%), Positives = 357/511 (70%), Gaps = 32/511 (6%)
 Frame = +2

Query  107   ILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRL  286
             I   K++  N    LP +VP+  GAWPFIGHL LL G  PVA  LG MAD++GP++ L+L
Sbjct  29    IANTKKNTINKNTTLP-KVPQPSGAWPFIGHLPLLCGENPVALILGAMADQHGPIYSLKL  87

Query  287   GSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMV  466
             G H  +++S+ E V+E FT ND VFA+RPS   GKYLGY+ A+F+LAPYG YWRDVRK+ 
Sbjct  88    GQHELLLLSAWEQVQELFTKNDRVFATRPSTTGGKYLGYDNAIFSLAPYGSYWRDVRKLA  147

Query  467   TLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG---------EVNLSEWFEHVTLNI  619
             TLEL++  R+K L H+R SEV   I  L+ +C ++           V+++E  EH+T NI
Sbjct  148   TLELLSSQRVKTLSHIRASEVGSFIKTLHLLCTKDNVGPSSTSSSSVHMTELLEHLTFNI  207

Query  620   TLRLLVGKRFS------------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGG  760
              ++L+VGKRF+            R  K LKE    AL+L GVFV SD +P  EW+D + G
Sbjct  208   NVKLIVGKRFTAGQYNEKNSDVGRFEKALKE----ALHLFGVFVWSDAMPCFEWLDGLFG  263

Query  761   YIKGLKEVSKEMDEIIGTWLQEHIRNRKEddddqsdf--mdVMLSSLPEDAVISGHKRDt  934
             ++  +K+  KE+D ++G WL+EH + R E   ++ +   MDV++S+  ED  ISGH RD 
Sbjct  264   HVSSMKKCFKELDYVLGKWLEEHRQRRLESKTNRLESDLMDVLISNFKEDE-ISGHCRDK  322

Query  935   iikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNL  1114
             +IKAT L+L+LTG+EST+ TL W  SLLLNN   +K AQ+E+D+HVG++R V+ESD+ NL
Sbjct  323   VIKATALVLMLTGTESTSVTLTWAISLLLNNQKDLKSAQEELDIHVGRNRWVQESDLTNL  382

Query  1115  KYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPE  1294
             KY QAI+KE LRLYPPGP++G REAMEDC +G Y +PKGTRLI+N+ KL RDPR+W+ P 
Sbjct  383   KYLQAILKETLRLYPPGPVTGLREAMEDCHLGGYFVPKGTRLIVNIWKLQRDPRMWANPC  442

Query  1295  EFKPERWFRDEHASIGYVGKS-FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNIST  1471
             EF+PER F   HA + + G+S FEY+PFS GRR CPGM   L VVQL LARL+QGFN+S 
Sbjct  443   EFQPER-FMTTHADVDFKGQSNFEYVPFSAGRRSCPGMTLGLHVVQLVLARLIQGFNMSR  501

Query  1472  PMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
                 PVDM EGLG+ALPK  P++VLL PRLP
Sbjct  502   VGDGPVDMKEGLGLALPKANPLEVLLAPRLP  532



>ref|XP_003635525.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=518

 Score =   503 bits (1294),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 255/483 (53%), Positives = 346/483 (72%), Gaps = 14/483 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWPF+GHLHLL G  P+ RTL  MADK+GPVF +RLG H A+VVSS E VKEC 
Sbjct  37    APEPSGAWPFVGHLHLLSGPTPIFRTLAAMADKHGPVFMIRLGMHRALVVSSHEAVKECL  96

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND  FASRPS + GK LGYN A F  APYG  WR++RK+   EL++   L +L+HV  
Sbjct  97    TTNDKAFASRPSSSAGKLLGYNYAGFGFAPYGPLWREMRKLSVTELLSNRPLNELKHVLV  156

Query  521   SEVEHCIGDLYSMCHENGEVN-----LSEWFEHVTLNITLRLLVGKRF-------SRIAK  664
             SE++ CI DLYS+  E   VN     +SEW E +T N+ LR++ GKR+       +  A+
Sbjct  157   SELDVCIRDLYSLGKETNWVNPIKVAMSEWLEQLTFNVVLRMVAGKRYFGNGVHGNEEAR  216

Query  665   HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK  844
             H   V+ + ++L GVFV SD IP +EWMD+ G++  +K V++++D  +  W++EH+   K
Sbjct  217   HAIAVIKKFIFLTGVFVASDAIPFVEWMDLQGHLGSMKRVAEQLDPFVEGWVEEHVTKLK  276

Query  845   EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLN  1024
              D   + DF+DVMLS L ++++  GH+R+T+IKAT + LI+ GSE+T+   IW  S LLN
Sbjct  277   SDPSSRQDFIDVMLSVLKDNSMF-GHRRETVIKATVMTLIVGGSETTSIASIWILSALLN  335

Query  1025  NPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCK  1204
             N H +K AQ+E+D+ VG+ R VEESDI+NL Y QA +KE LRLYPPGPL  P EA++DC 
Sbjct  336   NRHTLKRAQEELDLKVGRGRWVEESDIQNLIYLQAAVKETLRLYPPGPLLVPHEAIQDCS  395

Query  1205  IGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGG  1384
             +  YHIPKGTRL++N+ KLHRDP  WS+PEEF+PER F   HA++   G+  E +PFS G
Sbjct  396   VCGYHIPKGTRLLVNVWKLHRDPDAWSDPEEFQPER-FLTTHANLNVFGQHSELIPFSSG  454

Query  1385  RRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             RR CPG+  +LQ++ LT+ARLLQG++++TP+  PVDM+EG+G+A+PK TP++V+LTPRLP
Sbjct  455   RRSCPGIALALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGLAMPKETPLEVMLTPRLP  514

Query  1565  NLF  1573
             +L 
Sbjct  515   SLL  517



>ref|XP_002264790.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   502 bits (1293),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 255/479 (53%), Positives = 342/479 (71%), Gaps = 14/479 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE  GAWPF+GHLHLL G++PV RTLG MADK GPVF +RLG + A+VVS+ E  KECFT
Sbjct  39    PEPSGAWPFVGHLHLLQGKVPVFRTLGAMADKVGPVFVIRLGMYRALVVSNHEAAKECFT  98

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND VFASRPS +  K LGYN   F LAPYG  WR++RK+  LE+++  RL  L HV  S
Sbjct  99    TNDKVFASRPSSSASKILGYNYVAFGLAPYGPLWREIRKLCMLEILSTRRLSDLMHVHVS  158

Query  524   EVEHCIGDLYSMCHENGEVN-----LSEWFEHVTLNITLRLLVGKRFSRIAKHLKE----  676
             E+   I DLY +  +   VN     +SEWFEH+  N+ LR++ GKR+     H  E    
Sbjct  159   ELHAGIKDLYILGKDYNWVNPKKVVISEWFEHLNFNVVLRMVAGKRYFNNVVHGGEEAGS  218

Query  677   ---VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKE  847
                V+ + + L G FV SDVIP LEW+D+ G++  +K+V+KEMD ++ +W++EH      
Sbjct  219   ATAVIKKLVPLAGAFVASDVIPFLEWVDLQGHLSSMKQVAKEMDSVLESWVEEHTGRLNS  278

Query  848   ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
             +   + DF+D+ML+ L +DA + G+ R+TIIKAT ++LI+ GS++T+ T  W  S LLNN
Sbjct  279   EASSRQDFIDIMLTKL-KDASLFGYSRETIIKATVMMLIVAGSDTTSITSTWLLSALLNN  337

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
              H +K AQ+E+D+ VG+DR VE+SDI+NL Y +AI+KE LRLYP  PL  P EAMEDC +
Sbjct  338   RHVMKHAQEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCHV  397

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
             G YHIPKGTRL++N  KLHRDP VWS PEEF+PER F   HA++  +G++FE +PF  GR
Sbjct  398   GGYHIPKGTRLLVNAWKLHRDPAVWSNPEEFQPER-FLTSHATVDVLGQNFELIPFGSGR  456

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             R CPG+N +LQ++ LT+A+LLQGF+++TP   PVDM+E + I +PKLTP++V+LTPRLP
Sbjct  457   RSCPGINMALQMLHLTIAQLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRLP  515



>ref|XP_002274740.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=518

 Score =   501 bits (1291),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 261/483 (54%), Positives = 338/483 (70%), Gaps = 14/483 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWPF+GHL LL G+ P+ RTLG MADK+GPVF +RLG H A+VVSS E VKECF
Sbjct  37    APEPSGAWPFLGHLPLLRGQTPIFRTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECF  96

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND VFASRPS + GK LGYN A F  APYG  WR++RK+  +E+++  RL  L+HV+ 
Sbjct  97    TTNDKVFASRPSSSAGKLLGYNYAGFGFAPYGALWREMRKLSMMEILSARRLDALKHVQI  156

Query  521   SEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVVS  685
             SE++  I DLYS+   +      +V +SEWF+H++ NI L+++ GKR+   + H  E   
Sbjct  157   SELDLSIKDLYSLGKGSDWVHPVKVVMSEWFQHLSFNIVLKMIAGKRYFNTSGHGIEEAR  216

Query  686   RA-------LYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK  844
             RA       L L G FV SD IP +EWMD+ GY+  +K V+KE+D ++G W++EH     
Sbjct  217   RAIATIQEFLSLSGAFVLSDAIPGVEWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLN  276

Query  845   EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLN  1024
              +     DF+DVMLS L ED  + GH R+T+IKAT +ILI+ G+E+ A T  W  S LLN
Sbjct  277   SEGSRMQDFIDVMLSVL-EDTSMFGHSRETVIKATIVILIVGGTETVATTSTWLLSALLN  335

Query  1025  NPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCK  1204
             N HA+K AQ+E+D+ VG+ R VEESDI NL Y QA+IKE LRLY   PLS P EAMEDC 
Sbjct  336   NKHALKRAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCH  395

Query  1205  IGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGG  1384
             +  YHIPKGTRL +N  KLHRDP VWS+PE+F+PER F   HA +  +G+ FE +PF  G
Sbjct  396   VAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPER-FLTSHADLDVLGQHFELIPFGSG  454

Query  1385  RRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             RR CPG+  +L+++ L + RLLQGF++STP+  PVDM EGL I L KLTP++V+LTPRLP
Sbjct  455   RRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVILTPRLP  514

Query  1565  NLF  1573
             + F
Sbjct  515   SQF  517



>ref|XP_008235427.1| PREDICTED: cytochrome P450 82G1-like [Prunus mume]
Length=535

 Score =   502 bits (1292),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 273/486 (56%), Positives = 347/486 (71%), Gaps = 19/486 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             VP+  GAWPFIGHL LL G+ PVA TLG MAD +GP+F L+LG H  +V+S+ E VKEC 
Sbjct  46    VPQPSGAWPFIGHLPLLRGKDPVAITLGAMADDHGPLFSLKLGQHQVLVLSAWETVKECL  105

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND VFA+RPSMA GKYLGY+ A FA+APYG YWR VRK+ TLEL++  R++ L HVRT
Sbjct  106   TTNDRVFATRPSMAGGKYLGYDNAAFAIAPYGPYWRHVRKLATLELLSTKRVEMLSHVRT  165

Query  521   SEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRFS--------RIAK  664
             SEV+  + +L S+C +NG     V+LSE  E +T NI +RL+ GKRF+          A 
Sbjct  166   SEVDLFVKNLLSLCTKNGSRTTPVHLSELIEFLTFNINVRLIAGKRFTAEQYNEKNSDAW  225

Query  665   HLKEVVSRALYLGGVFVPSDVIPSLEWMDI-GGYIKGLKEVSKEMDEIIGTWLQEH---I  832
               ++ V  ALYL GVFV SD +P LEW+DI  G++  +K   KE+D ++G WL+EH    
Sbjct  226   RFEKAVKDALYLLGVFVWSDAMPWLEWLDILFGHVGSMKRCFKELDCVLGKWLEEHRQRS  285

Query  833   RNRKEddddqsdfmdVMLSSLP-EDAVISGHKRDtiikattlililtGSESTAETLIWTT  1009
             R + + D  +SD MDVM+SS   ED VI GH RD +IKAT L+LILTG+EST+ TL W  
Sbjct  286   RPQCKIDRVESDLMDVMMSSFQEEDDVIFGHSRDDVIKATALVLILTGTESTSVTLTWAL  345

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLNNP  +K  Q E+D+HVG+DR V+ESD+ NLKY QAI+KE LR+YPPGPL+G REA
Sbjct  346   SLLLNNPTTLKAVQQELDIHVGRDRWVQESDLPNLKYLQAILKETLRIYPPGPLAGLREA  405

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGK-SFEY  1366
              EDC +  YH+PKGTR+++N+ KL RD R+W+ P EF+PER F    A + +  + +FEY
Sbjct  406   TEDCHLAGYHVPKGTRVLVNIWKLQRDARIWANPGEFQPER-FMTTRADVEFKDQNNFEY  464

Query  1367  LPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVL  1546
             +PF  GRR CPGM   LQVVQL LARL+QGF+IS      VDM EGLG+ALPK  P++ L
Sbjct  465   IPFGSGRRSCPGMVLGLQVVQLILARLVQGFDISRVGEEAVDMREGLGLALPKANPLEAL  524

Query  1547  LTPRLP  1564
             L+PRLP
Sbjct  525   LSPRLP  530



>ref|XP_003548649.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   501 bits (1291),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 263/486 (54%), Positives = 339/486 (70%), Gaps = 18/486 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             +VPE  GA PFIGH+HLL+ R P  RT   +A+KYGP+F L+LG HP +VV+S E+ KEC
Sbjct  50    QVPEPRGALPFIGHVHLLNARKPYFRTFSAIAEKYGPIFILKLGCHPTLVVNSREIAKEC  109

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
              TTND VFASRP  + GK LGYN AVF  +PYG+YWR++RKM TLE+++  +L+KL+HVR
Sbjct  110   LTTNDKVFASRPITSAGKILGYNNAVFGFSPYGKYWREIRKMATLEILSSYKLEKLKHVR  169

Query  518   TSEVEHCIGDLYSMCHENGEVN-------LSEWFEHVTLNITLRLLVGKRF--------S  652
              +E    + DLYS       VN       +S   EH++ NI +R++ GKRF         
Sbjct  170   DTETLSLVKDLYSSISYPKNVNGSTTHVPISNLLEHMSFNIIVRMIAGKRFGGDTVNQED  229

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
               A  L+  +  A YL GVFV +D IPSL W+D  GY+  +K  +KE+D I+  WL+EH+
Sbjct  230   NEAWRLRNAIRDATYLCGVFVAADAIPSLSWIDFQGYVSFMKRTNKEIDLILEKWLEEHL  289

Query  833   RNRKEdd--ddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWT  1006
             R R E+     +SDFMDVM+S+  E+  I G+KR+ +IKAT+++LILT S STA TL W 
Sbjct  290   RKRGEEKDGKCESDFMDVMISAFQEEEEICGYKREMVIKATSVLLILTASGSTAITLTWA  349

Query  1007  TSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPRE  1186
              SLLLN+P  +K AQ E+D H+GK+R V+ESDIKNL Y QAIIKE LRLYPP PL+G RE
Sbjct  350   LSLLLNHPKVLKAAQKELDTHLGKERWVQESDIKNLTYLQAIIKETLRLYPPAPLTGIRE  409

Query  1187  AMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEY  1366
              MEDC +  YH+PKGTRL++NL  L RDP+VW  P +F+PER F   H  I ++ ++FE 
Sbjct  410   VMEDCCVAGYHVPKGTRLLINLWNLQRDPKVWPNPNKFEPER-FLTTHHDINFMSQNFEL  468

Query  1367  LPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVL  1546
             +PFS GRR CPGM F LQV+ LTLARLLQGF+I T  G  VDM+EGLG+ALPK   +QV+
Sbjct  469   IPFSIGRRSCPGMTFGLQVLHLTLARLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVM  528

Query  1547  LTPRLP  1564
             L PRLP
Sbjct  529   LQPRLP  534



>ref|XP_002274509.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=543

 Score =   501 bits (1290),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 258/483 (53%), Positives = 341/483 (71%), Gaps = 14/483 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWPF+GHL +L G+ P+ RTLG MADK+GPVF +RLG H A+VVSS E VKECF
Sbjct  62    APEPFGAWPFLGHLPILRGQTPIFRTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECF  121

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND VFASRPS + GK LGYN A F  APYG  WR++RK+  +E+++  RL  L+HV+ 
Sbjct  122   TTNDKVFASRPSSSAGKILGYNHAGFGFAPYGALWREMRKLSMMEILSARRLDALKHVQI  181

Query  521   SEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVVS  685
             SE++  I DLYS+   +      +V +SEWF+H++ NI L+++ GKR+   + H  E   
Sbjct  182   SELDLSIKDLYSLGKGSDWFHPVKVVMSEWFQHLSFNIVLKMIAGKRYFNTSGHGNEEAR  241

Query  686   RA-------LYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK  844
             RA       L+L G FV SD IP +EWMD  GY+  +K+V+KE+D ++G W++EH     
Sbjct  242   RAIATIQKLLFLTGAFVLSDAIPGVEWMDSQGYLGSMKQVAKEVDSLVGGWVEEHEMRLN  301

Query  845   EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLN  1024
              + + + DF+DVMLS L ED  + GH R+T+IKAT +ILI+ G+++ + T  W  S LLN
Sbjct  302   SEGNKRQDFIDVMLSVL-EDTSMFGHSRETVIKATIMILIVGGTDTVSTTSTWLLSALLN  360

Query  1025  NPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCK  1204
             N HA+K AQ+E+D+ VG+ R VEESDI NL Y QA+IKE LRLY   PLS P EAMEDC 
Sbjct  361   NKHALKCAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTATPLSAPHEAMEDCH  420

Query  1205  IGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGG  1384
             +  YHIPKGTRL +N  KLHRDP VWS+PE+F+PER F   HA +  +G+ FE +PF  G
Sbjct  421   VAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPER-FLTTHADLDVLGQHFELIPFGSG  479

Query  1385  RRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             RR CPG+  +L+++ L + RLLQGF++STP+  PVDM EGL I L KLTP++V+LTPRLP
Sbjct  480   RRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVMLTPRLP  539

Query  1565  NLF  1573
             + F
Sbjct  540   SQF  542



>ref|XP_011008137.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=516

 Score =   500 bits (1287),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 262/484 (54%), Positives = 342/484 (71%), Gaps = 17/484 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             R PE  GAWP  GHL  L G+ P  +TLG +ADKYGP++ L+ G H  +VVSS E VK+C
Sbjct  29    RAPEPSGAWPLFGHLPSLVGKDPACKTLGAIADKYGPIYSLKFGIHRTLVVSSWETVKDC  88

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
               TND V A+R  +A GK++ YN A FALA YG+YWRDVRK+ TL+L++  RL+ L+HVR
Sbjct  89    LNTNDRVLATRAGIAAGKHMFYNNAAFALATYGQYWRDVRKLATLQLLSNQRLEMLKHVR  148

Query  518   TSEVEHCIGDLYSM----CHENGEVNLSEWFEHVTLNITLRLLVGKRFSRIAK-------  664
              SEV+  I  L+S          +VN+S+  E +T NI LR +VGKR+            
Sbjct  149   VSEVDTFIKGLHSFYAGSVDSPAKVNISKLLESLTFNINLRTIVGKRYCSSTYDKENSEP  208

Query  665   -HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
                K+ + +ALYL G+FV SD IP LEW+D  G++  +K+ +KE+D +I  WL EH++ +
Sbjct  209   WRYKKAIKKALYLSGIFVMSDAIPFLEWLDYQGHVSAMKKTAKELDAVIRNWLDEHLKKK  268

Query  842   KEd---dddqsdfmdVMLSSLPEDA-VISGHKRDtiikattlililtGSESTAETLIWTT  1009
              +     D +SDFMDVM+S+L E    ISG+ RD +IKAT LIL LTG+ STA TL+WT 
Sbjct  269   IDGELGSDRESDFMDVMISNLAEGPDKISGYSRDVVIKATALILTLTGAGSTATTLVWTL  328

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLNNP  +K AQ+E+D  VG++R VEESDI++LKY QAI+KE LRLYPPGPL+G REA
Sbjct  329   SLLLNNPTVLKAAQEELDKQVGRERWVEESDIQDLKYLQAIVKETLRLYPPGPLTGIREA  388

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
             MEDC IG Y +PKGTRL++N+ KLHRDPRVW  P EFKP+R F   HA + + G++ E++
Sbjct  389   MEDCSIGGYDVPKGTRLVVNIWKLHRDPRVWKNPNEFKPDR-FLTTHADLDFRGQNMEFI  447

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PFS GRR CP +N  L VV LTLAR+LQGF+++T  G+PVDM EG GIALPK TP++V++
Sbjct  448   PFSSGRRSCPAINLGLIVVHLTLARILQGFDLTTVAGLPVDMIEGPGIALPKETPLEVVI  507

Query  1550  TPRL  1561
              PRL
Sbjct  508   KPRL  511



>gb|KDP26346.1| hypothetical protein JCGZ_17504 [Jatropha curcas]
Length=515

 Score =   499 bits (1284),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 257/493 (52%), Positives = 347/493 (70%), Gaps = 14/493 (3%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             R  KN  K   L VPEAPGA P IGHLH L G   +ART+G +ADK GP+F +RLG+H A
Sbjct  24    RFGKNGTKNKGLSVPEAPGALPIIGHLHRLGGEKTLARTMGDLADKCGPIFTVRLGAHKA  83

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             I++S+ E +KE FTTND++F+SRP  +  KY+GYN A F  APYG YWR++RK++ +EL+
Sbjct  84    IIISNYEAMKETFTTNDILFSSRPPSSQAKYIGYNYAAFGFAPYGTYWRNMRKLIMIELL  143

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRF----  649
             +V R+K +RHV+ SEV + I DLYS      ++++SE  EH+ LNI  R++ GKR+    
Sbjct  144   SVQRIKLMRHVQVSEVNNMIKDLYS--DSKKKIDMSEMLEHLILNIITRMVAGKRYFDGN  201

Query  650   ----SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTW  817
                     + + +++   +++ G  VP D+IP L W DI G  K +K+VSKE+D I+ TW
Sbjct  202   SEGRDEHGRPIGKIMREFMFVVGALVPGDLIPFLGWWDIQGIKKTMKKVSKELDVIMSTW  261

Query  818   LQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETL  997
             ++EH + +K   D   DF+DVMLS + +D    GHK D IIK+T + LI+ GS++T+ T+
Sbjct  262   IEEH-KTKKNKTDSNKDFIDVMLSVIEDDTTF-GHKCDVIIKSTAMSLIVAGSDTTSITM  319

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
              W  S LLNN   ++  Q+E+D  VG+DR V++SDI+ L YF A+IKE LRLYPPGPL  
Sbjct  320   TWALSSLLNNRKTLERLQEELDQKVGRDRWVDDSDIEKLDYFSAVIKETLRLYPPGPLGV  379

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             PREA EDC I  YHIPKGTRL  NL KLHRDP VW++PEEFKPER+  D +A++   G+ 
Sbjct  380   PREATEDCTIAGYHIPKGTRLFTNLWKLHRDPNVWADPEEFKPERFLTD-NANLDVSGQH  438

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FEYLPF  GRR CPG+NF++QV+ +TLARLLQ ++  TP   PVDM+EG GIALPK+TP+
Sbjct  439   FEYLPFGAGRRSCPGLNFAMQVMNITLARLLQAYDFRTPGNEPVDMTEGKGIALPKITPL  498

Query  1538  QVLLTPRL-PNLF  1573
             +V+LTPRL P L+
Sbjct  499   EVVLTPRLAPELY  511



>ref|XP_003547786.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   499 bits (1284),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 263/486 (54%), Positives = 340/486 (70%), Gaps = 18/486 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             +VPE  GA PFIGHLHLL+ R P  RT   +A+KYGP+F L+LG HP +VV+S E+ KEC
Sbjct  50    QVPEPRGALPFIGHLHLLNARKPYFRTFSAIAEKYGPIFILKLGCHPTLVVNSREIAKEC  109

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
              TTND VFASRP  + GK LGYN AVF  +PYG+YWR++RKM  LE+++  +L+KL+HVR
Sbjct  110   LTTNDKVFASRPITSAGKILGYNNAVFGFSPYGKYWREIRKMAILEILSSYKLEKLKHVR  169

Query  518   TSEVEHCIGDLYSM--CHEN-----GEVNLSEWFEHVTLNITLRLLVGKRF--------S  652
              +E    + DLYS   C +N       V +S   EH++ NI +R++ GKRF         
Sbjct  170   DTETLSLVKDLYSSISCPKNVNGSTTHVPISNLLEHMSFNIIVRMIAGKRFGGDTVNQED  229

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
               A  L+  +  A YL GVFV +D IPSL W+D  GY+  +K  +KE+D I+  WL+EH+
Sbjct  230   NEAWRLRNAIKDATYLCGVFVAADAIPSLSWIDFQGYVSFMKRTNKEIDLILEKWLEEHL  289

Query  833   RNRKEdd--ddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWT  1006
             R R E+     +SDFMDVM+S+  E+  I G+KR+ +IKAT+++LILT S STA TL W 
Sbjct  290   RKRGEEKDGKCESDFMDVMISAFQEEEEICGYKREMVIKATSVLLILTASGSTAITLTWA  349

Query  1007  TSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPRE  1186
              SLLLN+P  +K AQ E+D H+GK+R V+ESDI+NL Y QAIIKE LRLYPP PL+G RE
Sbjct  350   LSLLLNHPKVLKAAQKELDTHLGKERWVQESDIENLTYLQAIIKETLRLYPPAPLTGIRE  409

Query  1187  AMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEY  1366
              MEDC +  YH+PKGTRL++NL  L RDP+VW  P +F+PER F   H  I ++ ++FE 
Sbjct  410   VMEDCCVAGYHVPKGTRLLINLWNLQRDPKVWPNPNKFEPER-FLTTHHDINFMSQNFEL  468

Query  1367  LPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVL  1546
             +PFS GRR CPGM F LQV+ LTLARLLQGF+I T  G  VDM+EGLG+ALPK   +QV+
Sbjct  469   IPFSIGRRSCPGMTFGLQVLHLTLARLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVM  528

Query  1547  LTPRLP  1564
             L PRLP
Sbjct  529   LQPRLP  534



>gb|KDO65988.1| hypothetical protein CISIN_1g011292mg [Citrus sinensis]
Length=489

 Score =   497 bits (1279),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 258/453 (57%), Positives = 332/453 (73%), Gaps = 24/453 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWP IGHL LL    PV + LG +ADKYGP++ LRLG HP ++VSS E+VK+CF
Sbjct  38    APEPFGAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCF  97

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND V A+RPS+A GKYLGY+ AVFALAPYGRYWRD+RK+ T +L++  RL+ L+HVR 
Sbjct  98    TTNDRVLATRPSIAAGKYLGYDNAVFALAPYGRYWRDIRKIATTDLLSSHRLELLKHVRY  157

Query  521   SEVEHCIGDLYSMCHENG----EVNLSEWFEHVTLNITLRLLVGKRFS------------  652
             SEV+  I DLYS C EN     +V +S+  E +T NI+LRL+ GKRFS            
Sbjct  158   SEVDTFIKDLYSRCSENAFNPAKVVISKLIEQLTFNISLRLIAGKRFSAREFGEQGSEGW  217

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
             RI + +KE    A YL GVFV  D IP LEW+D  G+I  ++  +K++D++IG WL+EH 
Sbjct  218   RINRAIKE----ATYLTGVFVLGDAIPWLEWIDFQGHIGSMRRTAKKIDDVIGNWLEEHA  273

Query  833   RNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
             + + + + D  D   V+LS + ++ V+SGH RDT+IKAT LILI TGSEST   +IWT S
Sbjct  274   QRKLQGEGDFMD---VLLSKIEDNTVMSGHTRDTVIKATALILIFTGSESTYLGIIWTLS  330

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLN+P  +K AQ+E+D+HVG+DR V ESD+KNLKY +AI+KE LR+YPPGP++G REAM
Sbjct  331   LLLNHPKELKKAQEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIYPPGPVTGIREAM  390

Query  1193  EDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLP  1372
             EDC+IG YH+PKGTRLI+N+ KLHRDPR+W  P EF+PER F   HA +    + FEY+P
Sbjct  391   EDCEIGGYHVPKGTRLIVNIWKLHRDPRMWENPCEFRPER-FLTTHADVDVNTQHFEYIP  449

Query  1373  FSGGRRMCPGMNFSLQVVQLTLARLLQGFNIST  1471
             FS GRR CPGM   LQ+VQLTLAR+LQGF+++T
Sbjct  450   FSFGRRSCPGMTSGLQIVQLTLARILQGFDLAT  482



>ref|XP_008372516.1| PREDICTED: cytochrome P450 82G1-like [Malus domestica]
Length=539

 Score =   498 bits (1283),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 267/511 (52%), Positives = 357/511 (70%), Gaps = 32/511 (6%)
 Frame = +2

Query  107   ILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRL  286
             I   K++  N    LP +VP+  GAWPF+GHL LL G  PVA  LG MAD++GP++ L+L
Sbjct  29    IANTKKNTINKNTTLP-KVPQPSGAWPFVGHLPLLRGENPVALILGAMADQHGPIYSLKL  87

Query  287   GSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMV  466
             G H  +++S+ E V+E FT ND VFA+RPS A GKYLGY+ A+F+LAPYG YWRDVRK+ 
Sbjct  88    GQHELLLLSAWEQVQELFTKNDRVFATRPSTAGGKYLGYDNAIFSLAPYGSYWRDVRKLA  147

Query  467   TLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG---------EVNLSEWFEHVTLNI  619
             TLEL++  R+K L H+R SEV   I  L+ +C ++           V+++E  EH+T NI
Sbjct  148   TLELLSSQRVKTLSHIRASEVGSFIKTLHLLCTKDNVGPSSTSSSSVHMTELLEHLTFNI  207

Query  620   TLRLLVGKRFS------------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGG  760
              ++L+ GKRF+            R  + LKE    AL+L GVFV SD +P   W+D + G
Sbjct  208   NVKLIAGKRFTAGQYNEKNSDVWRFERALKE----ALHLFGVFVWSDAMPCFGWLDSLFG  263

Query  761   YIKGLKEVSKEMDEIIGTWLQEHIRNRKEddddqsdf--mdVMLSSLPEDAVISGHKRDt  934
             ++  +K+  KE+D ++  WL+EH + R E   ++ +   MDV++S+  ED  ISGH RD 
Sbjct  264   HVSSMKKCFKELDYVLEKWLEEHQQRRLESKTNRVESDLMDVLISNFKEDE-ISGHCRDN  322

Query  935   iikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNL  1114
             +IKAT L+L+LTG+EST+ TL W  SLLLN+  A+K AQ+E+D+HVG+DR V+ESD+ NL
Sbjct  323   VIKATALVLMLTGTESTSVTLTWAISLLLNHQKALKSAQEELDIHVGRDRWVQESDLTNL  382

Query  1115  KYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPE  1294
             KY QAI+KE LRLYPPGP++G REAMEDC +G Y +PKGTRLI+N+ KL RDPR+W+ P 
Sbjct  383   KYLQAILKETLRLYPPGPVTGLREAMEDCHLGGYFVPKGTRLIVNIWKLQRDPRMWANPC  442

Query  1295  EFKPERWFRDEHASIGYVGK-SFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNIST  1471
             EF+PER F   HA + + G+ +FEY+PFS GRR CPGM   L VVQL LARL+QGFN++ 
Sbjct  443   EFQPER-FMTTHADVDFKGQCNFEYVPFSAGRRSCPGMTLGLHVVQLVLARLIQGFNMNR  501

Query  1472  PMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
                 PVDM EGLG+ALPK  P++VLLTPRLP
Sbjct  502   VGDGPVDMKEGLGLALPKANPLEVLLTPRLP  532



>ref|XP_002264464.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   497 bits (1279),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 255/479 (53%), Positives = 337/479 (70%), Gaps = 14/479 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE  GAWPF+GHLHLLHG++PV RTLG MADK GPVF +RLG +  +VVS+ E  KECFT
Sbjct  39    PEPSGAWPFVGHLHLLHGKVPVFRTLGAMADKVGPVFVIRLGMYRTLVVSNREAAKECFT  98

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND +FASRP+ +  K LGYN A FA AP+G YWR++RK+  LE+++  RL  L HV+ S
Sbjct  99    TNDKIFASRPNSSAAKILGYNYAAFAFAPHGPYWREMRKLSMLEILSTRRLGDLMHVQVS  158

Query  524   EVEHCIGDLYSMCHENGEVN-----LSEWFEHVTLNITLRLLVGKRFSRIAKHLKE----  676
             E+   I DLY +  +N  VN     +SEWFEH+T N+ LR++ GKR+     H  E    
Sbjct  159   ELHAGIKDLYILGKDNNWVNPKKVVISEWFEHLTFNVVLRMVAGKRYFNNVVHGGEEARS  218

Query  677   ---VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKE  847
                 + + L L G  V SDVIP LEW+D+ G++  +K V+KEMD +I +W++EH      
Sbjct  219   AIAAIKKVLLLVGASVASDVIPFLEWVDLQGHLSSMKLVAKEMDSLIESWVKEHTGRLNS  278

Query  848   ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
             +     DF+D+ML+ L +DA + G+ R+TIIKAT L +I+ GS++T+ T  W  S LLNN
Sbjct  279   EASSSLDFIDIMLTKL-KDASLFGYSRETIIKATVLTMIVAGSDTTSLTSTWLLSALLNN  337

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
              H +K AQ+E+D+ VG+DR VE+SDI+NL Y +AI+KE LRLY   PL  P EAMEDC +
Sbjct  338   KHVMKHAQEELDLKVGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHV  397

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
             G YHI KGTRL++N  KLHRDP VWS PEEF+PER F   HA++   G+ FE +PF  GR
Sbjct  398   GGYHISKGTRLLVNAWKLHRDPAVWSNPEEFQPER-FLTSHANVDVFGQHFELIPFGSGR  456

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             R CPG+N  LQ++ LT+ARLLQGF+++ P   PVDM+EG+ +AL KLTP++V+LTPRLP
Sbjct  457   RSCPGLNMGLQMLHLTIARLLQGFDMTKPSNSPVDMTEGISVALSKLTPLEVMLTPRLP  515



>ref|XP_009348374.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   491 bits (1264),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 245/488 (50%), Positives = 332/488 (68%), Gaps = 18/488 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+A GA P IGHLH L G+ P+ RTL  MADKYGP+F +RLG HPA+V+++ + VKECF
Sbjct  35    APQASGALPIIGHLHKLGGKKPLCRTLASMADKYGPIFTIRLGKHPALVINNYDAVKECF  94

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND+ FASR   A G+YLGYN A F  APYG YWR++RKMVT+EL++  RL+ L+HV+ 
Sbjct  95    TKNDIAFASRSKSAQGRYLGYNYAGFGFAPYGTYWRNMRKMVTVELLSSRRLQTLKHVQI  154

Query  521   SEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRFSRIA--------  661
              EV+  I  LY +C   GE     V +SEW EH+TLN+  +++ GKR+  +         
Sbjct  155   CEVDSFIKGLYEICKTKGENGQSKVVISEWIEHLTLNVITQMIAGKRYFDLGTVGNDSDN  214

Query  662   ----KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
                 K ++ +V   + + G    SDVI    W+D+ G +K +K + K+ D ++  W++EH
Sbjct  215   EGENKRIRGMVKEFMCVAGKPAVSDVIGFPHWIDLMGQVKNMKRIGKDFDSLMAGWIEEH  274

Query  830   IRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTT  1009
                RKE D         ++ S+ ED  + GH R+TIIKAT+  LIL GS++TA +L W  
Sbjct  275   KNARKEIDSRDKLDFIDVMLSVIEDNTVLGHTRETIIKATSQTLILAGSDTTATSLTWIL  334

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLNN H +K AQ+E+++ VG +R VE++DIK+L Y QAI+KE LRLYPP PLS   EA
Sbjct  335   SLLLNNRHVLKHAQEEINLQVGTERWVEDTDIKDLTYLQAIVKETLRLYPPAPLSTSHEA  394

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
             MEDC++  ++IPKGTRL  NL KLHRDP VWS+PE F P+R F    ASI   G+ FE++
Sbjct  395   MEDCQVCGFYIPKGTRLFTNLWKLHRDPSVWSDPEVFCPDR-FLTTQASIDVSGQHFEFI  453

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PF  GRR CPG+ F++QV+ LTL RL+QGF ++TP+ MPVDM+EGLG+ +PK T ++V+L
Sbjct  454   PFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELATPLDMPVDMAEGLGVTMPKATSLEVVL  513

Query  1550  TPRLPNLF  1573
             TPRLP  F
Sbjct  514   TPRLPCQF  521



>emb|CAN77159.1| hypothetical protein VITISV_019026 [Vitis vinifera]
Length=604

 Score =   493 bits (1270),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 255/483 (53%), Positives = 341/483 (71%), Gaps = 14/483 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWPFIGHLHLL+  +P+ RTL  MAD +GPVF +RLG   A+VVSS + VKEC 
Sbjct  123   APEPSGAWPFIGHLHLLNSPMPIFRTLTAMADXHGPVFMIRLGMXRALVVSSHKAVKECL  182

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND  FASRP  + GK LGYN A F  APYG  WR++RK+   EL++  RL +L+HV  
Sbjct  183   TTNDKAFASRPISSAGKLLGYNYAGFGFAPYGPLWREMRKLSVTELLSNRRLDELKHVLV  242

Query  521   SEVEHCIGDLYSMCHENGEVN-----LSEWFEHVTLNITLRLLVGKRF-------SRIAK  664
             SE++ CI DLYS+  E   VN     +SEW E  T N+ LR++ GKR+       +  A+
Sbjct  243   SELDVCIRDLYSLGKETNWVNPIKVAMSEWLEQXTFNVVLRMVAGKRYFGNGVHGNEEAR  302

Query  665   HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK  844
             H   V+ + L L G FV SDVIP +EWMD+ G++  +K V+ ++D  +  W++EH+    
Sbjct  303   HAIAVIKKFLSLTGAFVASDVIPFVEWMDLQGHLGSMKRVAGQLDPFVEGWVEEHVTKLN  362

Query  845   EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLN  1024
              D   + DF+DVMLS L +D  I GH R+T+IKAT + LI+ GSE+T+    W  S LLN
Sbjct  363   SDPSSRQDFIDVMLSVL-KDNSIFGHTRETVIKATVMTLIVGGSETTSIVSTWILSALLN  421

Query  1025  NPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCK  1204
             N HA+K AQ+E+D+ VG+ R VEESDI+NL Y QA++KE LRLYPP PLS P EA+EDC 
Sbjct  422   NRHALKRAQEEIDLKVGRGRWVEESDIZNLIYLQAVVKETLRLYPPAPLSIPHEAVEDCN  481

Query  1205  IGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGG  1384
             + +YHIPKGTRL +N+ KLHRDP VWS+PEEF+PER F   +A++   G+ FE +PFS G
Sbjct  482   VCEYHIPKGTRLFVNVWKLHRDPGVWSDPEEFQPER-FLTTNANLNVFGQHFELIPFSSG  540

Query  1385  RRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             RR CPG+  +LQ++ LT+ARLLQG++++TP+  PVDM+EG+GI +P+ TP++V+LTPRLP
Sbjct  541   RRSCPGIALALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGITMPRATPLEVMLTPRLP  600

Query  1565  NLF  1573
             +L 
Sbjct  601   SLL  603



>ref|XP_007134140.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
 gb|ESW06134.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
Length=530

 Score =   490 bits (1261),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 256/485 (53%), Positives = 333/485 (69%), Gaps = 17/485 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             +VPE   A PFIGHLHLL+ R+P  RT   MA+KYGP+F ++LG HP IVV+S E+ KEC
Sbjct  40    KVPEPGVALPFIGHLHLLNARIPYFRTFSAMAEKYGPIFCVKLGCHPTIVVNSREIAKEC  99

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
              T ND VFASRP+ + G+ LGYN AVF LAPYG YWR++RKM  LE+ +  RL+KL+HVR
Sbjct  100   LTKNDRVFASRPNTSAGRILGYNHAVFGLAPYGNYWREIRKMAVLEIFSSYRLEKLKHVR  159

Query  518   TSEVEHCIGDLYSMCHE------NGEVNLSEWFEHVTLNITLRLLVGKRF--------SR  655
              SE    + +LYS          + EV +S   EH+T NI +R++ GKRF          
Sbjct  160   DSETLSLVKELYSSISSIKNVKGSTEVAMSNLLEHMTFNIIVRMIAGKRFGGDTVNEEDN  219

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A  L++ +  A YL G+FV +D IPSL W D  G++  +K  +K++D I+  WL+EH++
Sbjct  220   EAWKLRKAIKDATYLCGIFVVADAIPSLSWFDFQGHLSFMKRTAKKLDFILQKWLEEHVK  279

Query  836   NRKEddd--dqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTT  1009
              R ++ +   + DFMDVMLSS        G+ R+ +IKAT+++L+LTGS STA TL W  
Sbjct  280   TRGDNMNGGCERDFMDVMLSSFEGQEDFCGYNREIVIKATSVLLVLTGSGSTAITLTWAL  339

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLN+P  +K AQ E+D  VGK+R V+ESDIKNL Y  AIIKE LRLYPP PL+G REA
Sbjct  340   SLLLNHPRVLKAAQQELDNSVGKERWVQESDIKNLNYLHAIIKETLRLYPPAPLTGIREA  399

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
             MEDC +  YH+PKG RL++NL +L RDP VWS P EF PER F   H  I ++ ++FE +
Sbjct  400   MEDCCVAGYHVPKGARLLINLWELQRDPEVWSNPNEFNPER-FLTTHRDIDFMSQNFELI  458

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PFS GRR CPG+ F LQV+ LTLARL+QGF++ST  G  VDM+EGLG+ALPK   +Q+ L
Sbjct  459   PFSFGRRSCPGVTFGLQVLHLTLARLIQGFDMSTKDGAEVDMTEGLGVALPKENELQLTL  518

Query  1550  TPRLP  1564
              PRLP
Sbjct  519   APRLP  523



>ref|XP_009348373.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=538

 Score =   490 bits (1261),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 246/488 (50%), Positives = 335/488 (69%), Gaps = 18/488 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+  GA P IGHLH L G+ P+ RTL  MADKYGP+F +RLG  PA+V+S+ + VKECF
Sbjct  49    TPQPSGALPIIGHLHKLGGKKPLCRTLASMADKYGPIFTIRLGKDPALVISNYDAVKECF  108

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND+VF +RP  A G+YLGYN A F  +PYG YWR++RK+V  EL++  RL+ L+HV+ 
Sbjct  109   TKNDIVFGARPKSAHGRYLGYNYAGFGFSPYGTYWRNMRKVVIAELLSSRRLQTLKHVQI  168

Query  521   SEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRFSRIAK-------  664
             SEV+  I  LY +C   GE     V +SEW EH+TLN+  +++ GKR+    K       
Sbjct  169   SEVDSFIKGLYEICKTKGENGQGKVVISEWIEHLTLNVITQMIAGKRYFDWGKVGNDSDN  228

Query  665   -----HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
                   ++E+V   + + G+ V SD+I   +W+D  G +K +K + KE+D +  +W++EH
Sbjct  229   EGENKRIREIVKEFMLVSGMPVISDMIGYPDWIDFLGEVKNMKRIGKELDSLTASWIEEH  288

Query  830   IRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTT  1009
                RKE D         ++ S+ ED  + G+ R+TIIKAT+  LI+ GS++TA +L W  
Sbjct  289   NNARKEIDSRDKLDFIDVMLSVIEDNTVLGYTRETIIKATSQNLIIAGSDTTAISLKWVI  348

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLNN H +K AQ+E+++ VG +R VE++DI+NL Y QAI+KE LRLYPPGPLS P EA
Sbjct  349   SLLLNNRHVLKHAQEEINLIVGTERWVEDTDIENLTYLQAIVKETLRLYPPGPLSVPHEA  408

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
             MEDC++  +HIPKGTRL +NL KLHRDP VWS+PE F P+R F    ASI   G  FE++
Sbjct  409   MEDCQVCGFHIPKGTRLFVNLWKLHRDPTVWSDPEMFYPDR-FLTTQASIDVSGNHFEFI  467

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PF  GRR CPG+ F++QV+ LTL RL+QGF ++TP+ MPVDM+EGLG+ LPK T ++V+L
Sbjct  468   PFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELATPLDMPVDMTEGLGVTLPKATSLEVVL  527

Query  1550  TPRLPNLF  1573
             TPRLP  F
Sbjct  528   TPRLPIEF  535



>ref|XP_007200049.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
 gb|EMJ01248.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
Length=517

 Score =   488 bits (1256),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 253/498 (51%), Positives = 348/498 (70%), Gaps = 16/498 (3%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             ++L   R    + K+  +  P+  GA P IGHLH L  R+PV +TL  MADKYGP+F + 
Sbjct  16    LVLYLWRVRIQSHKIKGMLAPQPSGALPIIGHLHKL--RVPVFKTLAAMADKYGPIFTIW  73

Query  284   LGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKM  463
             LG HP +V+S+ + VK+CFT ND VFA+RP  + GKYLGYN A F  +PYG YWRD+RKM
Sbjct  74    LGKHPVLVISNYDAVKQCFTKNDTVFATRPRSSHGKYLGYNYAGFGFSPYGPYWRDMRKM  133

Query  464   VTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG-------EVNLSEWFEHVTLNIT  622
             V +EL+++ RL+ L+HV+ SEV+  I  L+ +C   G       +V +S+W EH+TLN+ 
Sbjct  134   VMVELLSIRRLQNLKHVQISEVDAFIKGLFLLCKTEGLNGLNPTKVVISDWIEHLTLNVI  193

Query  623   LRLLVGKRFSRIA-----KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVS  787
              R++ GKR+   +     +   ++V   +Y+ G  V +DVI    W+D  G +K +K + 
Sbjct  194   TRMIAGKRYFDSSDEGDEQRFGKIVKEFMYVSGNPVAADVIGFPSWIDFKGQVKAMKRIM  253

Query  788   KEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlilil  967
             KE+D ++G+W++EH   ++ +  D+ DF+DVM+S + ED    G+ R+TIIKAT++ LIL
Sbjct  254   KELDSVMGSWVEEHYAKKETNSRDEHDFIDVMMSVI-EDNSTLGYTRETIIKATSMNLIL  312

Query  968   tGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGL  1147
              GSE+TA  LIW  SLLLNN HA+K+AQ+E+D+ VG+DR +E++DI+NL Y QAI+KE L
Sbjct  313   AGSETTAINLIWILSLLLNNRHALKLAQEELDLKVGRDRWIEDTDIENLPYLQAIVKETL  372

Query  1148  RLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDE  1327
             RLYPPGPLS P EAM+DC++  +HIPKGTRL +NL KLHRDP +W +PE F PER F   
Sbjct  373   RLYPPGPLSVPHEAMQDCQVCGFHIPKGTRLFVNLWKLHRDPCLWPDPEVFCPER-FLTT  431

Query  1328  HASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGL  1507
             H  I   GK FE++PF  GRR CPG  F+LQV  LTL RLLQGF ++TPM MPVD++EGL
Sbjct  432   HVGIDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFELATPMDMPVDLTEGL  491

Query  1508  GIALPKLTPIQVLLTPRL  1561
             GI +PK T ++V+LTPRL
Sbjct  492   GITMPKATSLEVILTPRL  509



>emb|CAN61061.1| hypothetical protein VITISV_018742 [Vitis vinifera]
Length=542

 Score =   488 bits (1255),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 258/507 (51%), Positives = 334/507 (66%), Gaps = 38/507 (7%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWPF+GHL LL G+ P+ RTLG MADK+GPVF +RLG H A+VVSS E VKECF
Sbjct  37    APEPSGAWPFLGHLPLLRGQTPIFRTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECF  96

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND VFASRPS + GK LGYN A F  APYG  WR++RK+  +E+++  RL  L+HV+ 
Sbjct  97    TTNDKVFASRPSSSAGKLLGYNYAGFGFAPYGALWREMRKLSMMEILSARRLDALKHVQI  156

Query  521   SEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVVS  685
             SE++  I DLYS+   +      +V +SEWF+H++ NI L+++ GKR+   + H  E   
Sbjct  157   SELDLSIKDLYSLGKGSDWVHPVKVVMSEWFQHLSFNIVLKMIAGKRYFNTSGHGIEEAR  216

Query  686   RA-------LYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK  844
             RA       L L G FV SD IP +EWMD+ GY+  +K V+KE+D ++G W++EH     
Sbjct  217   RAIATIQEFLSLSGAFVLSDAIPGVEWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLN  276

Query  845   EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlilil-------------------  967
              +     DF+DVMLS L ED  + GH R+T+IKAT ++                      
Sbjct  277   SEGSRMQDFIDVMLSVL-EDTSMFGHSRETVIKATIVVRSSPIHELLLLSWKSVFLQPTL  335

Query  968   -----tGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAI  1132
                   G+E+ A T  W  S LLNN HA+K AQ+E+D+ VG+ R VEESDI NL Y QA+
Sbjct  336   KILIVGGTETVATTSTWLLSALLNNKHALKRAQEELDLKVGRGRWVEESDIPNLLYLQAV  395

Query  1133  IKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPER  1312
             IKE LRLY   PLS P EAMEDC +  YHIPKGTRL +N  KLHRDP VWS+PE+F+PER
Sbjct  396   IKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPER  455

Query  1313  WFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVD  1492
              F   HA    +G+ FE +PF  GRR CPG+  +L+++ L + RLLQGF++STP+  PVD
Sbjct  456   -FLTSHADFDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVD  514

Query  1493  MSEGLGIALPKLTPIQVLLTPRLPNLF  1573
             M EGL I L KLTP++V+LTPRLP+ F
Sbjct  515   MREGLSITLAKLTPLEVILTPRLPSQF  541



>ref|XP_008382597.1| PREDICTED: cytochrome P450 82G1-like [Malus domestica]
Length=540

 Score =   488 bits (1255),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 257/492 (52%), Positives = 345/492 (70%), Gaps = 25/492 (5%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             +VP+  GAWPF+GHL LL    P+A  LG MAD+ GP++ L+LG H  +V+S+ E V+E 
Sbjct  44    KVPQPSGAWPFVGHLPLLRAENPIALILGAMADQVGPMYSLKLGQHELLVLSAWEQVQEL  103

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND VFA+RP+ A G+YLGY+ A+FALAPYG YWR+VRKM T+EL++  R+K L HVR
Sbjct  104   FTKNDRVFATRPNTAGGRYLGYDNAIFALAPYGDYWRNVRKMATMELLSSRRVKTLSHVR  163

Query  518   TSEVEHCIGDLYSM-CHENGE----------VNLSEWFEHVTLNITLRLLVGKRFSR---  655
              SEV+  I  L+S+ C ++            V++SE  EH+T NI ++L+ GKR +    
Sbjct  164   ASEVDSFIKTLHSLVCKKDNXDPSSASSSSSVHMSELLEHLTFNINMKLIAGKRLTAGQY  223

Query  656   IAKH-----LKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEIIGTW  817
               KH      ++ +   LYL GVFV SD +P  EW+D + G++  +K+  KE+D ++G W
Sbjct  224   NEKHGDVWRFEKAIKETLYLFGVFVWSDAMPCFEWLDGLFGHVSSMKKCFKELDYVLGKW  283

Query  818   LQEHIRNRKEddddqsdf--mdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAE  991
             L+EH R R E  +++ +   MDVM+S+  ED  I GH RD +IKAT L+L++TG+EST+ 
Sbjct  284   LEEHRRRRLESKNNRVESDLMDVMISNFEEDE-IYGHSRDNVIKATALMLMITGTESTSV  342

Query  992   TLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPL  1171
             TL W  SLLLNN   +K AQ+E+D+HVG+DR V+ESD+ NLKY QAI+KE +RLYPPGP+
Sbjct  343   TLTWAISLLLNNQKVLKSAQEELDIHVGRDRWVQESDLTNLKYLQAILKETIRLYPPGPI  402

Query  1172  SGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVG  1351
             +G REA EDC +G Y +PKGTRL++N+ KL RDPR+W+ P EF+PER F   HA + + G
Sbjct  403   TGLREATEDCHLGGYFVPKGTRLLVNIWKLQRDPRMWANPCEFQPER-FMTTHADVDFKG  461

Query  1352  KS-FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKL  1528
             +S FEY+PFS GRR CPGM   L VVQL LARL+QGFN+S      VDM E LG+ALPK 
Sbjct  462   QSNFEYIPFSAGRRSCPGMTLGLHVVQLVLARLIQGFNMSRVGDGAVDMKEALGLALPKA  521

Query  1529  TPIQVLLTPRLP  1564
              P++VLL PRLP
Sbjct  522   NPLEVLLAPRLP  533



>ref|XP_008382594.1| PREDICTED: cytochrome P450 82G1-like [Malus domestica]
Length=540

 Score =   488 bits (1255),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 261/495 (53%), Positives = 346/495 (70%), Gaps = 32/495 (6%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             +VP+  GAWP IGHL LL   +PVA  LG MAD++GP++ L+LG H  +V+S+ E V+E 
Sbjct  45    KVPQPSGAWPLIGHLPLLRSEIPVALILGAMADQHGPIYSLKLGQHELLVLSAWEQVQEL  104

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT  D VFA+RP+ A GKYLGY+ A FAL+PYG YWR+VRK+ T+EL++  R+K L HVR
Sbjct  105   FTKKDRVFATRPTTAGGKYLGYDNATFALSPYGDYWREVRKLTTMELLSSKRVKTLSHVR  164

Query  518   TSEVEHCIGDLYSM-CHEN---------GEVNLSEWFEHVTLNITLRLLVGKRFS-----  652
              SEV+  I +L+S+ C ++           V++SE  EH+T NI ++L+ GKRF+     
Sbjct  165   ASEVDSFIKNLHSLVCTKDNVDPSSTSSSPVHMSELLEHLTFNINVKLIAGKRFTVGQYN  224

Query  653   -------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEII  808
                    R  K +KE    AL+L GVFV SD +P  EW+D   G++  +K+  KE+D ++
Sbjct  225   EKNGEVWRFEKAVKE----ALHLFGVFVWSDAMPCFEWLDGWFGHVSSMKKCFKELDYVL  280

Query  809   GTWLQEHIRNRKEddddqsdf--mdVMLSSLPEDAVISGHKRDtiikattlililtGSES  982
             G WL+EH + R E  +++ +   MDVM+S+  ED  I GH RDT+IKAT L+L+ TG+ES
Sbjct  281   GKWLEEHRQRRLESKNNKVESDLMDVMISNFEEDE-IYGHNRDTVIKATALVLMATGTES  339

Query  983   TAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPP  1162
             T+ TL W  SLLLNN   +K AQ+E+D+HVGKDR V+ESD+ NLKY QAI+KE LRLYPP
Sbjct  340   TSVTLTWAMSLLLNNQKVLKSAQEELDIHVGKDRWVQESDLTNLKYLQAILKETLRLYPP  399

Query  1163  GPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIG  1342
             GP++G REAMEDC +G Y +PKGTRL++N+ KL RDPR+W+ P EF+PER F   HA + 
Sbjct  400   GPITGLREAMEDCHLGGYFVPKGTRLLVNIWKLQRDPRMWANPCEFQPER-FMTTHADVD  458

Query  1343  YVGKS-FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIAL  1519
             + G+S FEY+PFS GRR CPGM     VVQL LARL+QGFN+S      VDM EGLG+AL
Sbjct  459   FKGQSNFEYIPFSAGRRSCPGMTLGSHVVQLVLARLIQGFNMSRVGDGAVDMKEGLGLAL  518

Query  1520  PKLTPIQVLLTPRLP  1564
             PK  P++V L PRLP
Sbjct  519   PKANPLEVFLAPRLP  533



>gb|KDP45301.1| hypothetical protein JCGZ_15166 [Jatropha curcas]
Length=525

 Score =   487 bits (1253),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 349/481 (73%), Gaps = 15/481 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             VPE  G+WP IGHLHLL G+ P  + L  +AD+ GP F LRLG +  +V+SS E  KECF
Sbjct  38    VPEPSGSWPLIGHLHLLTGQKPACKILASVADESGPFFSLRLGFNQILVISSWEFAKECF  97

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND V A+R S+A GKY+GYN A+FALAPYG+YWRD+RK+ TL+L++ +RL+ L+HVR 
Sbjct  98    TKNDRVLATRASIAAGKYMGYNNAIFALAPYGQYWRDIRKLATLQLLSNNRLEALKHVRF  157

Query  521   SEVEHCIGDLYSMCHE--NGEVNLSEWFEHVTLNITLRLLVGKRFSRIAK--------HL  670
             SE++  + +LY +  +  N +V +S+  E +T NI LR++VGKRF   +           
Sbjct  158   SEIDLFLKELYDLYSQNHNQKVIISKLLERLTFNIILRMIVGKRFCSKSYSEENSEPWRY  217

Query  671   KEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK--  844
             K+ +  A YL G  V SD IP LEW+D  GYI  +K+  KE+D+++G WL+EH+  +K  
Sbjct  218   KKAIEEATYLFGSAVLSDAIPWLEWIDYKGYINRMKKTGKELDDLVGKWLEEHLMKKKWL  277

Query  845   -EddddqsdfmdVMLSSLPEDAVI-SGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
              E+++ ++DFMDVMLS L ED +  SG+ RD ++KAT ++L LTG+ STA TL W  +LL
Sbjct  278   NENENGENDFMDVMLSHLQEDEIANSGYSRDIVVKATAMVLSLTGAGSTAVTLTWALALL  337

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNNP A+K AQ+E++ +VGK + V+ESDI NLKY QAIIKE LRLYPPGP++G REAMED
Sbjct  338   LNNPDALKSAQEELNSYVGKSKWVQESDIPNLKYLQAIIKETLRLYPPGPITGIREAMED  397

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C I  ++IPKGTRLI+N+ KL RDPRVW+ P+EF PER F   H+ I   G++FE++PFS
Sbjct  398   CDINGHYIPKGTRLIVNIWKLQRDPRVWNNPDEFLPER-FLTTHSDIDLRGQNFEFIPFS  456

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CP +NF LQVV LTLARL+QGF++S    +PVDM EG G++LPK+ PI+V+L PR
Sbjct  457   SGRRACPAINFGLQVVHLTLARLIQGFDLSRIGNVPVDMKEGPGLSLPKVNPIEVILKPR  516

Query  1559  L  1561
             L
Sbjct  517   L  517



>ref|XP_008372515.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=524

 Score =   486 bits (1252),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 244/485 (50%), Positives = 333/485 (69%), Gaps = 18/485 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+  GA P IGHLH L G+ P+ RTL  MADKYGP+F +RLG HPA+V+S+ + VKECF
Sbjct  35    TPQPSGALPIIGHLHKLGGKNPLCRTLASMADKYGPIFTIRLGKHPALVISNHDAVKECF  94

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND+VFA+RP  A G+YLGYN A F  +PYG YWR++RKMV  EL++  RL+ L+HV+ 
Sbjct  95    TKNDIVFAARPKSAHGRYLGYNYAGFGFSPYGTYWRNMRKMVIAELLSSRRLQTLKHVQI  154

Query  521   SEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFSRIAK-------  664
             SEV+  I  LY +C   G     +V +SEW EH+TL +  +++ GKR+    K       
Sbjct  155   SEVDSFIKGLYEICKTKGXNGQSKVVISEWIEHLTLXVITQMIAGKRYFDWGKVGNDSDN  214

Query  665   -----HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
                   ++E+V   + + G+ V SD+I   +W+D  G +K +K + KE+D +  +W++EH
Sbjct  215   EGENKRIREIVKEFMLVSGMPVISDMIGYPDWIDFLGQVKNMKRIGKELDALTASWIEEH  274

Query  830   IRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTT  1009
                RKE D         ++ S+ ED  + GH R+TIIKAT+  LI+ GS++TA +L W  
Sbjct  275   NNARKEIDSRDKLDFIDVMLSVIEDNTVLGHTRETIIKATSQNLIIAGSDTTAISLKWII  334

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLNN H +K AQ+E+++ VG +R VE++DI+NL   QAI+KE LRLYPPGPLS P EA
Sbjct  335   SLLLNNRHVLKHAQEEINLKVGTERWVEDTDIENLTXLQAIVKETLRLYPPGPLSVPHEA  394

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
             MEDC++  +HI KGTRL +NL KLHRDP +WS+PE F P+R F    ASI   G  FE++
Sbjct  395   MEDCQVCGFHIXKGTRLFVNLWKLHRDPTMWSDPEMFYPDR-FLTTQASIDASGNHFEFI  453

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PF  GRR CPG+ F++QV+ LTL RL+QGF ++TP+ MPVDM+EGLG+ LPK T ++V+L
Sbjct  454   PFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELATPLDMPVDMTEGLGVTLPKATSLEVVL  513

Query  1550  TPRLP  1564
             TPRLP
Sbjct  514   TPRLP  518



>ref|XP_009372224.1| PREDICTED: cytochrome P450 82G1-like isoform X3 [Pyrus x bretschneideri]
Length=541

 Score =   487 bits (1254),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 259/504 (51%), Positives = 349/504 (69%), Gaps = 25/504 (5%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             + N+ N K +  +VP+  GAWP +GHL LL    PVA  LG MAD+ GP++ L+LG H  
Sbjct  33    KKNRTNKKTMMPKVPQPSGAWPIVGHLPLLRDENPVALILGAMADQLGPIYSLKLGQHEL  92

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +V+S+ E V+E FT ND VFA+R + A G+YLGY+ A+FALAPYG YWR+VRKM T+EL+
Sbjct  93    LVLSAWEQVQELFTKNDRVFATRANTAGGRYLGYDNAIFALAPYGDYWRNVRKMATMELL  152

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSM-CHENG----------EVNLSEWFEHVTLNITLR  628
             +  R+K   HVR SEV+  I  L+S+ C ++            V++SE  EH+T NI ++
Sbjct  153   SSRRVKTSSHVRASEVDSFIKTLHSLVCKKDNVDPSSPSSSSSVHMSELLEHLTFNINMK  212

Query  629   LLVGKRFSRIA---KH-----LKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKE  781
             L+ GKR +      KH      ++ +   LYL GVFV SD +P  EW+D + G++  +K+
Sbjct  213   LIAGKRLTADQYNEKHGDVWRFEKAIKETLYLFGVFVWSDAMPCFEWLDGLFGHVSSMKK  272

Query  782   VSKEMDEIIGTWLQEHIRNRKEddddqsdf--mdVMLSSLPEDAVISGHKRDtiikattl  955
               KE+D ++G WL+EH + R E  +++ +   MDVM+S+  ED  I GH  D +IKAT L
Sbjct  273   CFKELDYVLGKWLEEHRQRRLESKNNRVESDLMDVMISNFEEDE-IYGHSCDNVIKATAL  331

Query  956   ililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAII  1135
             +L++TG+EST+ TL W  SLLLNN   +K AQ+E+D+HVG+DR V+ESD+ NLKYFQAI+
Sbjct  332   VLMITGTESTSVTLTWAISLLLNNQKVLKSAQEELDIHVGRDRWVQESDLTNLKYFQAIL  391

Query  1136  KEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERW  1315
             KE LRLYPPGP++G REAMEDC +G Y +PKGTRL++N+ KL RDPR+W+ P EF+PER 
Sbjct  392   KETLRLYPPGPITGLREAMEDCHLGGYFVPKGTRLLVNIWKLQRDPRMWTNPCEFQPER-  450

Query  1316  FRDEHASIGYVGKS-FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVD  1492
             F   HA + + G+S FEY+PFS GRR CPGM   L VVQL LARL+QGF +S      VD
Sbjct  451   FMTTHADVDFKGQSNFEYIPFSAGRRSCPGMTLGLHVVQLVLARLIQGFEMSRVGDGAVD  510

Query  1493  MSEGLGIALPKLTPIQVLLTPRLP  1564
             M EGLG+ALPK  P++VLL PRLP
Sbjct  511   MKEGLGLALPKANPLEVLLAPRLP  534



>ref|XP_002323130.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
 gb|EEF04891.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
Length=499

 Score =   485 bits (1248),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 261/490 (53%), Positives = 340/490 (69%), Gaps = 14/490 (3%)
 Frame = +2

Query  125   DNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAI  304
              +K N  L P   PE  GAWP IGHL +L+ ++P  R LG +A K+GPVF +RLG    +
Sbjct  10    SHKRNKTLPP---PEPSGAWPLIGHLRILNSQIPFFRILGDLAVKHGPVFSIRLGMRRTL  66

Query  305   VVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMT  484
             V+SS E VKECF TND  F +RPS A  KY+GY++A F   PYG YW ++RK+ T EL++
Sbjct  67    VISSWESVKECFKTNDRKFLNRPSFAASKYMGYDDAFFGFHPYGEYWLEMRKIATQELLS  126

Query  485   VSRLKKLRHVRTSEVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRF-SR  655
               RL+ L+HVR SE+E CI +L++ C  NG   V++S+WF  V  N+  RL+ GKR+ S 
Sbjct  127   NRRLELLKHVRVSEIETCIKELHTTC-SNGSVLVDMSQWFSCVVANVMFRLIAGKRYCSG  185

Query  656   IAKH---LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQE  826
             I K       +V    YLGGV V SD+IP  EWMD+ G++K +K V+KE+D ++  WL E
Sbjct  186   IGKDSGAFGRLVREFFYLGGVLVISDLIPFTEWMDLQGHVKSMKRVAKELDHVVSGWLVE  245

Query  827   HIRNRKE--ddddqsdfmdVMLSSLP-EDAVISGHKRDtiikattlililtGSESTAETL  997
             H++ R+E     ++ DFMDVML SL   D  I G+KR+TI+KAT L LIL G+++T+ TL
Sbjct  246   HLQRREEGRVRKEEKDFMDVMLESLAVGDDPIFGYKRETIVKATALNLILAGTDTTSVTL  305

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
              W  SLLLN+   +K AQ E+D+HVG  R VEESDIKNL Y QAI+KE LRLYPPGPL  
Sbjct  306   TWALSLLLNHTEVLKRAQKEIDVHVGTTRWVEESDIKNLVYLQAIVKETLRLYPPGPLLV  365

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             PRE++EDC +  Y +P+GT+L++N  KLHRD R+W  P EF PER F   H S    G+ 
Sbjct  366   PRESLEDCYVDGYLVPRGTQLLVNAWKLHRDARIWENPYEFHPER-FLTSHGSTDVRGQQ  424

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FEY+PF  GRR+CPG++ SLQ++ LTL+RLLQGFN STPM   VDMSEGLG+ LPK TP+
Sbjct  425   FEYVPFGSGRRLCPGISSSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTLPKATPL  484

Query  1538  QVLLTPRLPN  1567
             +V+LTPRL N
Sbjct  485   EVVLTPRLEN  494



>ref|XP_009372225.1| PREDICTED: cytochrome P450 82G1-like isoform X4 [Pyrus x bretschneideri]
Length=541

 Score =   486 bits (1252),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 258/504 (51%), Positives = 348/504 (69%), Gaps = 25/504 (5%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             + N+ N K +  +VP+  GAWP +GHL LL    PVA  LG MAD+ GP++ L+LG H  
Sbjct  33    KKNRTNKKTMMPKVPQPSGAWPIVGHLPLLRDENPVALILGAMADQLGPIYSLKLGQHEL  92

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +V+S+ E V+E FT ND VFA+R + A G+YLGY+ A+FALAPYG YWR+VRKM T+EL+
Sbjct  93    LVLSAWEQVQELFTKNDRVFATRANTAGGRYLGYDNAIFALAPYGDYWRNVRKMATMELL  152

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSM-CHENG----------EVNLSEWFEHVTLNITLR  628
             +  R+K   HVR SEV+  I  L+S+ C ++            V++SE  EH+T NI ++
Sbjct  153   SSRRVKTSSHVRASEVDSFIKTLHSLVCKKDNVDPSSPSSSSSVHMSELLEHLTFNINMK  212

Query  629   LLVGKRFSRIA---KH-----LKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKE  781
             L+ GKR +      KH      ++ +   LYL GVFV SD +P  EW+D + G++  +K+
Sbjct  213   LIAGKRLTADQYNEKHGDVWRFEKAIKETLYLFGVFVWSDAMPCFEWLDGLFGHVSSMKK  272

Query  782   VSKEMDEIIGTWLQEHIRNRKEddddqsdf--mdVMLSSLPEDAVISGHKRDtiikattl  955
               KE+D ++G WL+EH + R E  +++ +   MDVM+S+  ED  I GH  D +IKAT L
Sbjct  273   CFKELDYVLGKWLEEHRQRRLESKNNRVESDLMDVMISNFEEDE-IYGHSCDNVIKATAL  331

Query  956   ililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAII  1135
             +L++TG+EST+ TL W  SLLLNN   +K AQ+E+D+HVG+DR V+ESD+ NLKYFQAI+
Sbjct  332   VLMITGTESTSVTLTWAISLLLNNQKVLKSAQEELDIHVGRDRWVQESDLTNLKYFQAIL  391

Query  1136  KEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERW  1315
             KE LRLYPPGP++G REAMEDC +G Y +PKGTRL++N+ KL RDPR+W+ P EF+PER 
Sbjct  392   KETLRLYPPGPITGLREAMEDCHLGGYFVPKGTRLLVNIWKLQRDPRMWTNPCEFQPER-  450

Query  1316  FRDEHASIGYVGKS-FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVD  1492
             F   HA + + G+S FEY+PFS GRR CPGM   L VVQL LARL+QGF +S      VD
Sbjct  451   FMTTHADVDFKGQSNFEYIPFSAGRRSCPGMTLGLHVVQLVLARLIQGFEMSRVGDGAVD  510

Query  1493  MSEGLGIALPKLTPIQVLLTPRLP  1564
             M EGLG+ALPK  P++V L PRLP
Sbjct  511   MKEGLGLALPKANPLEVFLAPRLP  534



>ref|XP_011040244.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=544

 Score =   485 bits (1249),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 257/494 (52%), Positives = 343/494 (69%), Gaps = 18/494 (4%)
 Frame = +2

Query  125   DNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAI  304
              +K N  LLP   PE  GAWP IGHL +L+ ++P+ RTLG +ADK+GPVF +RLG    +
Sbjct  51    SHKRNKTLLP---PEPSGAWPLIGHLRILNSQIPLFRTLGDLADKHGPVFSIRLGMRRTL  107

Query  305   VVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMT  484
             V+SS E VKECF TND  F +RPS+A  KY+GY++A F   PYG YW ++RK+ T EL++
Sbjct  108   VISSWESVKECFKTNDRKFLNRPSVAASKYMGYDDAFFGFHPYGEYWLEMRKIATQELLS  167

Query  485   VSRLKKLRHVRTSEVEHCIGDLYSMCHENGEV--NLSEWFEHVTLNITLRLLVGKRFS--  652
              SRL+ L+HVR SE+E CI +L++ C  NG V  ++S+WF  +  N+  RL+ GKR+   
Sbjct  168   NSRLELLKHVRVSEIETCIKELHTTC-SNGSVLLDMSQWFSCIVANVMFRLIAGKRYCGG  226

Query  653   --RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEII-GTWLQ  823
               + +     ++    YL GV V SD+IP  EWMD  G++K +K V+KE+D+++ G WL 
Sbjct  227   TGKDSGACGRLIKEFFYLSGVLVTSDLIPFTEWMDFQGHLKSMKRVAKELDDVVSGQWLV  286

Query  824   EHIRNRKE--ddddqsdfmdVMLSSLPEDAV----ISGHKRDtiikattlililtGSEST  985
             EH++ R+E     ++ DFMDVML SL   A+    I  +KR+TI+KAT L L+L G ++T
Sbjct  287   EHLQRREEGLVRKEEKDFMDVMLESLDSLAIGEEPIFVYKRETIVKATALNLLLAGIDTT  346

Query  986   AETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPG  1165
             + TL W  SLLLN+   +K AQ E+D+HVG  R VEESDIKNL Y QAI+KE LRLYPPG
Sbjct  347   SITLTWALSLLLNHTEVLKRAQKEIDIHVGTTRWVEESDIKNLVYLQAIVKETLRLYPPG  406

Query  1166  PLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGY  1345
             PL  PRE++EDC +  Y +P+GT+L++N  KLHRD R+W  P EF PER F   H S   
Sbjct  407   PLLVPRESLEDCYVDGYLVPRGTQLLVNAWKLHRDARIWENPYEFHPER-FLTSHGSTDV  465

Query  1346  VGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPK  1525
              G+ FEY+PF  GRR CPG++ SLQ++ LTL+RLLQGFN STPM   VDMSEGLG+ +PK
Sbjct  466   RGQQFEYVPFGSGRRSCPGISSSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTMPK  525

Query  1526  LTPIQVLLTPRLPN  1567
              TP++V+LTPRL N
Sbjct  526   ATPLEVVLTPRLEN  539



>emb|CBI36491.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   486 bits (1250),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 254/472 (54%), Positives = 329/472 (70%), Gaps = 14/472 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE  GAWPF+GHL LL G+ P+ RTLG MADK+GPVF +RLG H A+VVSS E VKECFT
Sbjct  64    PEPSGAWPFLGHLPLLRGQTPIFRTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECFT  123

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND VFASRPS + GK LGYN A F  APYG  WR++RK+  +E+++  RL  L+HV+ S
Sbjct  124   TNDKVFASRPSSSAGKLLGYNYAGFGFAPYGALWREMRKLSMMEILSARRLDALKHVQIS  183

Query  524   EVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVVSR  688
             E++  I DLYS+   +      +V +SEWF+H++ NI L+++ GKR+   + H  E   R
Sbjct  184   ELDLSIKDLYSLGKGSDWVHPVKVVMSEWFQHLSFNIVLKMIAGKRYFNTSGHGIEEARR  243

Query  689   A-------LYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKE  847
             A       L L G FV SD IP +EWMD+ GY+  +K V+KE+D ++G W++EH      
Sbjct  244   AIATIQEFLSLSGAFVLSDAIPGVEWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLNS  303

Query  848   ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
             +     DF+DVMLS L ED  + GH R+T+IKAT +ILI+ G+E+ A T  W  S LLNN
Sbjct  304   EGSRMQDFIDVMLSVL-EDTSMFGHSRETVIKATIVILIVGGTETVATTSTWLLSALLNN  362

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
              HA+K AQ+E+D+ VG+ R VEESDI NL Y QA+IKE LRLY   PLS P EAMEDC +
Sbjct  363   KHALKRAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHV  422

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
               YHIPKGTRL +N  KLHRDP VWS+PE+F+PER F   HA +  +G+ FE +PF  GR
Sbjct  423   AGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPER-FLTSHADLDVLGQHFELIPFGSGR  481

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
             R CPG+  +L+++ L + RLLQGF++STP+  PVDM EGL I L KLTP++V
Sbjct  482   RSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEV  533



>gb|KDP26344.1| hypothetical protein JCGZ_17502 [Jatropha curcas]
Length=528

 Score =   484 bits (1247),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 348/481 (72%), Gaps = 15/481 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             VPE  G+WP IGHLHLL G+ P  + L  +AD+ GP + LRLG +  +VVSS E  KECF
Sbjct  38    VPEPSGSWPLIGHLHLLTGQKPACKILASIADESGPFYSLRLGFNRILVVSSWEFAKECF  97

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND V A+R S+A GKY+GYN AVF+LAPYG+YWRD+RK+ TL+L++ +RL+ L+HVR 
Sbjct  98    TKNDRVLATRASIAAGKYMGYNNAVFSLAPYGQYWRDIRKLATLQLLSNNRLEALKHVRF  157

Query  521   SEVEHCIGDLYSMCHE--NGEVNLSEWFEHVTLNITLRLLVGKRFSRIAK--------HL  670
             SE++  + +LY +  +  N +V +S+  E +T NI+LR++VGKRF   +           
Sbjct  158   SEIDLFLKELYDLYSQNHNQKVIMSKLLERLTFNISLRMIVGKRFCSKSYSEENSEPWRY  217

Query  671   KEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK--  844
             K+ +  A YL G  V SD IP LEW+D  GYI  +K+  KE+D+++G WL+EH+  +K  
Sbjct  218   KKAIEEATYLSGSPVMSDAIPWLEWIDYKGYIGRMKKTGKELDDLVGKWLEEHLMKKKWL  277

Query  845   -EddddqsdfmdVMLSSLPEDAVI-SGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
              E+++ ++DFMDVMLS L ED +  SG+ RD ++KAT ++L LTG+ STA TL W  +LL
Sbjct  278   NENENGENDFMDVMLSHLQEDEIANSGYSRDIVVKATAVVLSLTGAGSTAVTLTWALALL  337

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNNP A+K AQ+E++ +VGK + V+ESDI NLKY QAIIKE LRLYPPGP++G REAMED
Sbjct  338   LNNPDALKSAQEELNSYVGKSKWVQESDIPNLKYLQAIIKETLRLYPPGPITGIREAMED  397

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C I  Y+IPKGTRLI+N+ KL RDPRVW+ P EF PER F   H+ I   G++FE++PFS
Sbjct  398   CDINGYYIPKGTRLIVNIWKLQRDPRVWNNPHEFLPER-FLTTHSGIDLRGQNFEFIPFS  456

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CP +NF LQVV LTLARL+QGF++S     PVDM EG G++LPK+ P++V+L PR
Sbjct  457   SGRRACPAINFGLQVVHLTLARLIQGFDLSRIGNEPVDMKEGPGLSLPKVNPVEVILKPR  516

Query  1559  L  1561
             L
Sbjct  517   L  517



>ref|XP_009372223.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Pyrus x bretschneideri]
Length=541

 Score =   483 bits (1242),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 257/504 (51%), Positives = 346/504 (69%), Gaps = 25/504 (5%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             + N+ N K +  +VP+  GAWP +GHL LL    PVA  LG MAD+ GP++ L+LG H  
Sbjct  33    KKNRTNKKTMMPKVPQPSGAWPIVGHLPLLRDENPVALILGAMADQLGPIYSLKLGQHEL  92

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +V+S+ E V+E FT ND VFA+R + A G+YLGY+ A+FALAPYG YWR+VRKM T+EL+
Sbjct  93    LVLSAWEQVQELFTKNDRVFATRANTAGGRYLGYDNAIFALAPYGDYWRNVRKMATMELL  152

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSM-CHENG----------EVNLSEWFEHVTLNITLR  628
             +  R+K   HVR SEV+  I  L+S+ C ++            V++SE  EH+T NI ++
Sbjct  153   SSRRVKTSSHVRASEVDSFIKTLHSLVCKKDNVDPSSPSSSSSVHMSELLEHLTFNINMK  212

Query  629   LLVGKRFSRIA---KH-----LKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKE  781
             L+ GKR +      KH      ++ +   LYL GVFV SD +P  EW+D + G++  +K+
Sbjct  213   LIAGKRLTADQYNEKHGDVWRFEKAIKETLYLFGVFVWSDAMPCFEWLDGLFGHVSSMKK  272

Query  782   VSKEMDEIIGTWLQEHIRNRKEddddqsdf--mdVMLSSLPEDAVISGHKRDtiikattl  955
               KE+D ++G WL+EH + R E  +++ +   MDVM+S+  ED  I GH  D +IKAT L
Sbjct  273   CFKELDYVLGKWLEEHRQRRLESKNNRVESDLMDVMISNFEEDE-IYGHSCDNVIKATAL  331

Query  956   ililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAII  1135
             +L++TG+EST+ TL W  SLLLNN   +K AQ+E+D+HVGKDR V+ESD+ NLKY QAI+
Sbjct  332   VLMITGTESTSVTLTWAISLLLNNQKVLKSAQEELDIHVGKDRWVQESDLTNLKYLQAIL  391

Query  1136  KEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERW  1315
             KE LRLYPPGP++G REAMEDC +G Y +PK TRL++N+ KL RDPR+W+ P EF+PER 
Sbjct  392   KETLRLYPPGPITGLREAMEDCHLGGYFVPKSTRLLVNIWKLQRDPRIWANPCEFQPER-  450

Query  1316  FRDEHASIGYVGKS-FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVD  1492
             F   HA + + G+S FEY+PFS GRR CPGM   L VVQL LARL+QGFN+S      VD
Sbjct  451   FMTTHADMDFKGQSNFEYIPFSAGRRSCPGMTLGLHVVQLILARLIQGFNMSRVGDGAVD  510

Query  1493  MSEGLGIALPKLTPIQVLLTPRLP  1564
             M EGLG+ LPK  P++V L PRLP
Sbjct  511   MKEGLGLPLPKANPLEVFLAPRLP  534



>emb|CBI37514.3| unnamed protein product [Vitis vinifera]
Length=1113

 Score =   500 bits (1287),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 257/499 (52%), Positives = 347/499 (70%), Gaps = 19/499 (4%)
 Frame = +2

Query  95    YNQIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVF  274
             YN+ I++    N        +  P+ PGAWP IGHLHLL G++P+ RTLG MADK+GPVF
Sbjct  618   YNRWIVRTLTHNSKG-----ISAPKPPGAWPIIGHLHLLSGQVPIFRTLGAMADKHGPVF  672

Query  275   GLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDV  454
              ++LG HPA+VVSS E VKECFTTND VFASRP  +V K LGYN A+F  APYG +WR++
Sbjct  673   MIQLGMHPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNYAMFGSAPYGLFWREM  732

Query  455   RKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNI  619
             RK+  +E+++  RL +L+ VR SE++ CI DLYS+  +N      +V +SEWFEH+T N 
Sbjct  733   RKLSVVEILSARRLNELKDVRISELDACIKDLYSLGKDNNWISPIKVVMSEWFEHLTFNF  792

Query  620   TLRLLVGKRFSRIAKHLKE-------VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLK  778
              LR++ GKR+   A H  E        + + L L G FVPSDV P LE +D+ GY+  +K
Sbjct  793   ALRMIAGKRYFDNAVHGNEEARGAIITIKKYLSLSGAFVPSDVFPFLERLDLQGYLGSMK  852

Query  779   EVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattli  958
              V++E+D ++G+W++EH+   K +   + DF+DV+LS++ +D  + GH R+T+IKAT + 
Sbjct  853   HVTEELDCLVGSWVEEHVMRLKSEPGCRHDFIDVLLSTV-QDTSMFGHTRETVIKATIVN  911

Query  959   liltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIK  1138
             LI+ GS+ST+ T  W  S LLNN  A+K AQ+E+D+ VG+ R VEESDI+ L Y +AIIK
Sbjct  912   LIVGGSDSTSITSTWILSALLNNREAMKHAQEELDLKVGRSRWVEESDIQKLDYLRAIIK  971

Query  1139  EGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWF  1318
             E LRLYP  PL  P EA +DC +  YHIPKGTRL +N  KLHRDPRVWS PEEF+PER F
Sbjct  972   ESLRLYPAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPER-F  1030

Query  1319  RDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMS  1498
                HA++   G  FE +PF  GRR CPG+N +LQ++ LT ARLLQGF+++TP   PVDM+
Sbjct  1031  LGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMT  1090

Query  1499  EGLGIALPKLTPIQVLLTP  1555
             EG+   +PKLTP++  + P
Sbjct  1091  EGISFTMPKLTPLRSSINP  1109


 Score =   497 bits (1280),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 265/537 (49%), Positives = 358/537 (67%), Gaps = 32/537 (6%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             +  P+ PGAWP IGHLHLL G++P+ RTLG MADK+GPVF ++LG HPA+VVSS E VKE
Sbjct  36    ISAPKPPGAWPIIGHLHLLSGQVPIFRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKE  95

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTTND VFASRP  +V K LGYN A F  APYG +WR++RK+  +E+++  RL +L+ V
Sbjct  96    CFTTNDKVFASRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVVEILSARRLNELKDV  155

Query  515   RTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE-  676
             R SE++ CI DLYS+  +N      EV +SEWFEH+T N  LR++ GKR+   A H  E 
Sbjct  156   RISELDACIQDLYSLGKDNNWISPIEVVMSEWFEHLTFNFVLRMIAGKRYFDNAVHGNEE  215

Query  677   ------VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
                    + + L L G FVPSDV P LE +D+ GY+  +K V++E+D ++G+W++EH+  
Sbjct  216   ARGAIIAIKKFLSLSGAFVPSDVFPFLERLDLKGYLGSMKHVAEELDCLVGSWVEEHVMR  275

Query  839   RKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
              K +   + DF+DV+LS++ +D  + GH R+T+IKAT   LI+ GS+ST+ T  W  S L
Sbjct  276   LKSEPGSRHDFIDVLLSAV-QDTSMFGHSRETVIKATIGNLIVGGSDSTSITSTWILSAL  334

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN  A+K AQ+E+D+ VG+ R VEESDI+ L Y +AIIKE LRLY   PL  P EA +D
Sbjct  335   LNNREAMKRAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYSAAPLLVPHEATQD  394

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C +  YHIPKGTRL +N  KLHRDPRVWS PEEF+PER F   HA++   G  FE +PF 
Sbjct  395   CHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPER-FLGSHANLDVFGHQFELIPFG  453

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTP--------  1534
              GRR CPG+N +LQ++ LT ARLLQGF+++TP   PVDM+EG+   +PKLTP        
Sbjct  454   SGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLCTKKPPT  513

Query  1535  IQVLLTPRLPNLFPTMLNKN**HFDCNPNLKC------CPFVLFQLIGTQKVITPLK  1687
             ++ LL     +LF ++L+    +F+ NP+ +        P+V        +V   LK
Sbjct  514   VESLLNLIDSHLFSSLLS----NFELNPSFELQWHRRQLPYVANNFNSLDQVTDALK  566



>ref|XP_008235431.1| PREDICTED: cytochrome P450 82C4-like [Prunus mume]
Length=517

 Score =   481 bits (1237),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 255/502 (51%), Positives = 346/502 (69%), Gaps = 16/502 (3%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             ++L   R    + K+  +  P+  GA P IGHLH L G  P+ +TL  MADKYGP+F + 
Sbjct  16    LVLYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRG--PIFKTLAAMADKYGPIFTIW  73

Query  284   LGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKM  463
             LG HP +V+S+ + VK+CFT ND VFA+RP  + GKYLGYN A F  +PYG YWRD+RKM
Sbjct  74    LGKHPVLVISNYDAVKQCFTKNDTVFATRPRSSHGKYLGYNYAGFGFSPYGPYWRDMRKM  133

Query  464   VTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMC---HENG----EVNLSEWFEHVTLNIT  622
             V +EL++  RL+ L+HV+ SEV+  I  L+ +C     NG    +V +S+W EH+TLN+ 
Sbjct  134   VMVELLSSRRLQNLKHVQISEVDAFIKGLFLLCKTEEHNGLNPTKVVISDWIEHLTLNVI  193

Query  623   LRLLVGKRFSRIA-----KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVS  787
              R++ GKR+   +     +   ++V   +Y+ G  V SDVI    W+D  G IK +K + 
Sbjct  194   TRMIAGKRYFDSSYEGDEQRFGKIVKEFMYVSGNPVASDVIGFPSWIDFKGQIKAMKRIM  253

Query  788   KEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlilil  967
             KE+D ++G+W++EH   ++ D  D  DF+DVM+S + ED    G+ R+TIIKAT+L LIL
Sbjct  254   KELDSVMGSWVEEHYAKKQTDSRDDHDFIDVMISVI-EDNSTLGYTRETIIKATSLNLIL  312

Query  968   tGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGL  1147
              GSE+TA  LIW  SLLLNN H +K+AQ+E+D+ VG+DR +E++DI+NL Y QA++KE L
Sbjct  313   AGSETTAINLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDTDIENLPYLQAMVKETL  372

Query  1148  RLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDE  1327
             RLYPPGPLS P EAM+DC++  + IPKGTRL +NL KLHRDP +W +PE F PER F   
Sbjct  373   RLYPPGPLSVPHEAMQDCQVCGFDIPKGTRLFVNLWKLHRDPSLWPDPEVFCPER-FLTT  431

Query  1328  HASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGL  1507
             H  I   GK FE++PF  GRR CPG  F+LQV  LTL RLLQGF ++TP+ MPVD++EGL
Sbjct  432   HVGIDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFELATPLDMPVDLTEGL  491

Query  1508  GIALPKLTPIQVLLTPRLPNLF  1573
             GI +PK T ++V+LTPRLP  F
Sbjct  492   GITMPKATSLEVILTPRLPFEF  513



>ref|XP_008372514.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=524

 Score =   481 bits (1238),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 329/488 (67%), Gaps = 18/488 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+  GA P IGHLH L G  P+ RTL  MADKYGP+F ++LG HPA+V+S+ + VKECF
Sbjct  35    APQPSGALPIIGHLHKLGGXNPLCRTLASMADKYGPIFTIQLGKHPALVISNYDAVKECF  94

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND+ FA+R   A G+YLGYN A    + YG YWR++RKM  +EL++  RL+ L+HV+ 
Sbjct  95    TKNDIAFATRSKSAQGRYLGYNYAALGFSQYGTYWRNMRKMAIVELLSSRRLQTLKHVQI  154

Query  521   SEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRFSRIAK-------  664
             SEV+  I  LY +C   GE     V +SEW EH+TLN+  +++ GKR+    K       
Sbjct  155   SEVDSFIKGLYEICKTKGENGQSKVVISEWIEHLTLNVITQMIAGKRYFDWGKVGNDSDN  214

Query  665   -----HLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
                   ++E+V   + + G  V SDVI   +W+D+ G +K +K + K+ D ++ +W++EH
Sbjct  215   EGENKRIREMVKEFMCVAGKPVVSDVIGFPDWIDLMGQVKNMKRIGKDFDSLMASWIEEH  274

Query  830   IRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTT  1009
                R+E D         ++ S+ ED  + GH R+TIIKAT+  LIL GS++TA +L W  
Sbjct  275   KNAREEIDSRDKLDFIDVMLSVIEDNTVLGHSRETIIKATSQNLILAGSDTTATSLTWIL  334

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLNN H +K AQ+ +++ VG +R VE++DIK+L Y QAI+KE LRLYPP PLS P EA
Sbjct  335   SLLLNNRHILKHAQEXINLQVGTERWVEDTDIKDLTYLQAIVKETLRLYPPAPLSVPHEA  394

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
              EDC++  +HIPKGTRL  NL KLHRDP VWS+PE F P+R F    AS    G+ FE++
Sbjct  395   XEDCQVCGFHIPKGTRLFANLWKLHRDPSVWSDPEVFCPDR-FLTTQASTDVSGQHFEFI  453

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PF  GRR CPG+ F++QV+ LTL RL+QGF ++TP+ MPVDM+EGLGI +PK T ++V+L
Sbjct  454   PFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELATPLDMPVDMAEGLGITMPKATSLEVVL  513

Query  1550  TPRLPNLF  1573
             TPRLP+ F
Sbjct  514   TPRLPSQF  521



>ref|XP_009372222.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Pyrus x bretschneideri]
Length=541

 Score =   481 bits (1238),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 259/495 (52%), Positives = 342/495 (69%), Gaps = 32/495 (6%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             +VP+  GAWP IGHL LL    P+A  LG MAD++GP++ L+LG H  +V+S+ E V+E 
Sbjct  46    KVPQPSGAWPLIGHLLLLRAENPIALILGAMADQHGPIYSLKLGQHELLVLSAWEQVQEL  105

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT  D VFA+RP+ A GKYLGY+ A FAL+PYG YWR+VRK+ T+EL++  R+K L HVR
Sbjct  106   FTKKDRVFATRPTTAGGKYLGYDHATFALSPYGDYWREVRKLATMELLSSKRVKTLSHVR  165

Query  518   TSEVEHCIGDLYSM-CHENG---------EVNLSEWFEHVTLNITLRLLVGKRFS-----  652
              SEV+  I  L+S+ C ++           V++SE  EH+T NI ++L+ GKRF+     
Sbjct  166   GSEVDSFIKTLHSLVCTKDNVDPSSTSSSPVHMSELLEHLTFNINVKLIAGKRFTAGQYN  225

Query  653   -------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEII  808
                    R  K +KE     L+L GVFV SD +P  EW+D   G++  +K+  KE+D ++
Sbjct  226   EKNGDVWRFEKAVKET----LHLFGVFVWSDAMPCFEWLDGWFGHVSSMKKCFKELDYVL  281

Query  809   GTWLQEHIRNRKEddddqsdf--mdVMLSSLPEDAVISGHKRDtiikattlililtGSES  982
             G WL+EH + R E  +++ +   MDVMLS+  ED  I GH RDT+IKAT L+L+ TG+ES
Sbjct  282   GKWLEEHRQRRLESKNNRVESDLMDVMLSNFEEDE-IYGHNRDTVIKATALVLMATGTES  340

Query  983   TAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPP  1162
             T+ TL W  SLLLNN   +K AQ+E+D+HVGKDR V+ESD+ NLKY QAI+KE LRLYPP
Sbjct  341   TSVTLTWAISLLLNNQKVLKSAQEELDIHVGKDRWVQESDLTNLKYLQAILKETLRLYPP  400

Query  1163  GPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIG  1342
             GP++G REAMEDC +G Y +PK TRL++N+ KL RDPR+W+ P EF+PER F   HA + 
Sbjct  401   GPITGLREAMEDCHLGGYFVPKSTRLLVNIWKLQRDPRIWANPCEFQPER-FMTTHADMD  459

Query  1343  YVGKS-FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIAL  1519
             + G+S FEY+PFS GRR CPGM   L VVQL LARL+QGFN+S      VDM EGLG+ L
Sbjct  460   FKGQSNFEYIPFSAGRRSCPGMTLGLHVVQLILARLIQGFNMSRVGDGAVDMKEGLGLPL  519

Query  1520  PKLTPIQVLLTPRLP  1564
             PK  P++V L PRLP
Sbjct  520   PKANPLEVFLAPRLP  534



>gb|KDP26345.1| hypothetical protein JCGZ_17503 [Jatropha curcas]
Length=532

 Score =   480 bits (1236),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 255/514 (50%), Positives = 341/514 (66%), Gaps = 36/514 (7%)
 Frame = +2

Query  95    YNQIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVF  274
             YNQ  L+    +KN G    L  PE  GA P +GHLHLL     +ARTL  +ADKYGP+F
Sbjct  23    YNQWRLR-DHSHKNKG----LLAPEPFGALPILGHLHLLGAEKTLARTLALLADKYGPIF  77

Query  275   GLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDV  454
              + LG H  + VSS E +KECFT ND V ASRP  + GKYL YN A F  A YG YWRD+
Sbjct  78    TIWLGVHRTVEVSSHEAIKECFTANDKVLASRPKSSHGKYLSYNYAAFGFASYGPYWRDM  137

Query  455   RKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVN---LSEWFEHVTLNITL  625
             RK+V ++L++  RLK L+HV+ SEV   I DLY +       N   +SE+FEH+TLN+  
Sbjct  138   RKLVVIQLLSSHRLKSLKHVQVSEVNTLIKDLYLLSLNQPSSNKIVISEFFEHLTLNMIT  197

Query  626   RLLVGKRFS-----------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKG  772
             R++ GKR+            RI K +KE     +Y+ GVFVPSDVIP L WM+  G +K 
Sbjct  198   RMIAGKRYCNCNGGNDEEGIRIGKLMKEF----MYVSGVFVPSDVIPFLWWMNFLGPVKA  253

Query  773   LKEVSKEMDEIIGTWLQEH----IRNRKEddddqsdfmd-------VMLSSLPEDAVISG  919
             +K +SKE+D ++ TW+ EH    I  R++      DF +       VMLS L ++    G
Sbjct  254   MKRLSKELDSLLQTWIDEHKLKGINKRRDGGGGGGDFKNIEEDFIDVMLSILEDN--FFG  311

Query  920   HKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEES  1099
             H RD IIK T + LI+ G+++T+ TL W  S LLNN HA+++AQ E+D+ VGK+R V++S
Sbjct  312   HSRDDIIKGTVMTLIIAGADTTSITLTWILSNLLNNRHALELAQQELDLKVGKERCVQDS  371

Query  1100  DIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRV  1279
             DI+NL Y QA++KE LRLYPPGPL+ P EA+ DC I  Y+IPKGTR++ NL KLHRDP +
Sbjct  372   DIENLVYLQAVVKETLRLYPPGPLAVPHEAINDCYISGYYIPKGTRVLANLWKLHRDPNI  431

Query  1280  WSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGF  1459
             WS P++F PER+  +   ++ + G++FEYLPF  GRR CPG+NF++Q + LTLARLLQ F
Sbjct  432   WSNPDKFLPERFLANRDNNVDFSGQNFEYLPFGSGRRSCPGLNFAIQAIHLTLARLLQAF  491

Query  1460  NISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             +++T    PVDM+EGLGI LPK TP+++ +TPRL
Sbjct  492   SLTTLFNQPVDMTEGLGITLPKATPLEIQITPRL  525



>ref|XP_010036785.1| PREDICTED: cytochrome P450 82G1 [Eucalyptus grandis]
 gb|KCW48425.1| hypothetical protein EUGRSUZ_K02129 [Eucalyptus grandis]
Length=523

 Score =   477 bits (1227),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 256/494 (52%), Positives = 334/494 (68%), Gaps = 17/494 (3%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHP  298
             K DNK        R  E PGAWP +GHLHLL G  P  R LG MAD  GPVF L+LG H 
Sbjct  28    KSDNKTATGS---RTLELPGAWPLVGHLHLLWGPGPAFRKLGAMADALGPVFSLQLGVHR  84

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
              +V+SS E  +EC T+ND   ASRP +A G+++GYN AV  LAPYG Y R VRK+ TLEL
Sbjct  85    VVVLSSREAARECLTSNDRALASRPDIAAGRHMGYNSAVLGLAPYGPYLRLVRKIATLEL  144

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFS--  652
              +  RLK+LR VR+SEV+    +L+     +G V + E  EH+T N+ LR++ G R+   
Sbjct  145   FSSQRLKELRPVRSSEVDALTKELWHQPASSG-VAIGEKLEHMTFNMNLRIITGNRYKDE  203

Query  653   ------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGT  814
                     A   K+ +++AL+L GVFV SD IP LEW+D  G+++ +KE  +E+D ++  
Sbjct  204   EFEEVGSDAWRFKKAINKALHLCGVFVLSDAIPWLEWLDFQGHVRSMKETGRELDSVLEK  263

Query  815   WLQEHIRNRKEddddq----sdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSES  982
             WL++H+  R           +DFMD++L SLPED V+ GH+R  IIKAT LILI+TG+ES
Sbjct  264   WLRQHLEKRSNKGIHVDGGDADFMDLLLESLPEDDVVLGHERKDIIKATALILIMTGTES  323

Query  983   TAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPP  1162
             T+ T+ W  SLLLN+P A+K AQ E+D  +G+++ V+ESDI NLKY QAI+KE LRLYPP
Sbjct  324   TSITMTWALSLLLNHPAALKSAQQELDTVIGREKWVQESDISNLKYVQAIVKETLRLYPP  383

Query  1163  GPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIG  1342
              PL+G REAMEDC I   H+PKGTR+++N+ KL RDPRVW EP+ F PER F +EH  + 
Sbjct  384   APLTGIREAMEDCYISGCHVPKGTRVLINIWKLQRDPRVWPEPDAFLPER-FLEEHKEVD  442

Query  1343  YVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALP  1522
                K+FE++PFS GRR CPG    LQVV+ TLAR+LQGF ++   G  VDM EG GIALP
Sbjct  443   LRAKNFEFIPFSSGRRSCPGATLGLQVVEFTLARILQGFEVTLAEGARVDMEEGPGIALP  502

Query  1523  KLTPIQVLLTPRLP  1564
             K+ P++V L PRLP
Sbjct  503   KVNPLRVALQPRLP  516



>ref|XP_006352674.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=520

 Score =   476 bits (1226),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 249/497 (50%), Positives = 343/497 (69%), Gaps = 13/497 (3%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             ++ K K   KN+ K++    PE PGA+  IGHL+L   + P+A  L ++ADKYG +F +R
Sbjct  19    MLWKTKIQAKNSSKVMINLPPEIPGAYFPIGHLYLFISKTPLALILANLADKYGHIFSIR  78

Query  284   LGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKM  463
             LG H AI+VS+ E+VKECFTTND V A RP+ + G YLGYN A F  A YG YWR++RK+
Sbjct  79    LGIHRAIIVSNWEIVKECFTTNDKVLAGRPASSAGIYLGYNNAAFGFADYGPYWRNIRKL  138

Query  464   VTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLR  628
             V LE+++  RL + +H+R +EVE  I +LYS   ++G     +VN+S+WFE +TLN+ ++
Sbjct  139   VLLEVLSSKRLDQFKHIRVTEVETNIKELYSSILKSGSTNPSKVNMSKWFEQLTLNVIMK  198

Query  629   LLVGKRF---SRIAKHLKEVVSRALYLGGVFVPSDVI--PSLEWMDIGGYIKGLKEVSKE  793
             ++ GKR+       +H        +Y    FV SDVI  P L+W D  G IK +K++S+E
Sbjct  199   MITGKRYKTEDEKGRHFTRTTKEYMYESVQFVLSDVIPLPFLKWFDFQGRIKSMKKLSQE  258

Query  794   MDEIIGTWLQEHIRNRK-EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililt  970
             MD+I+ +W+ EH+  R+    DD  DF+DVMLS + E   + G+ R+TIIKAT L +IL 
Sbjct  259   MDKIVTSWIDEHLMKRELAIKDDDQDFIDVMLSKIDEQ-FMYGYTRETIIKATILNIILA  317

Query  971   GSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLR  1150
             GS++T+  L W  SLL+NN H +  AQ+E+DM +GK+R VEE DIKNL Y QAI+KE LR
Sbjct  318   GSDTTSIHLTWLLSLLVNNKHVMDQAQEEIDMKIGKERWVEECDIKNLVYLQAIVKETLR  377

Query  1151  LYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEH  1330
             LYPPGPL+ P  AMEDC +G Y +PKGTRL++N+ KLHRDP++WS+PE+F PER F   H
Sbjct  378   LYPPGPLAIPHAAMEDCTVGGYKVPKGTRLMVNVWKLHRDPQIWSDPEKFMPER-FMKSH  436

Query  1331  ASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLG  1510
             + I   G++FE++PF  GRR CPG+ F++QV  LTLARLLQGFN ST   +PVD++ G  
Sbjct  437   SEIDISGQNFEFIPFGSGRRSCPGITFAMQVTHLTLARLLQGFNFSTLGDLPVDLTVGNS  496

Query  1511  IALPKLTPIQVLLTPRL  1561
             I LPK  P++V + PRL
Sbjct  497   ITLPKANPLEVFVMPRL  513



>gb|KDP26347.1| hypothetical protein JCGZ_17505 [Jatropha curcas]
Length=526

 Score =   476 bits (1225),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 249/493 (51%), Positives = 336/493 (68%), Gaps = 17/493 (3%)
 Frame = +2

Query  131   KNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVV  310
             KN G  LP   PE  GA PFIGHLH L  R P AR LG +AD YGP+F +RLG HP IV+
Sbjct  33    KNKGGSLP---PEVAGALPFIGHLHKLGDRKPFARILGEIADNYGPIFTVRLGKHPTIVI  89

Query  311   SSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVS  490
             S   ++KE +TT+D  FASRP  +  KYL YN A F  APY  YWRDVRK+  ++++++ 
Sbjct  90    SDQNILKEFYTTHDKFFASRPPSSQSKYLAYNYAAFGFAPYSTYWRDVRKLAMVQVLSLH  149

Query  491   RLKKLRHVRTSEVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRF-----  649
             RLK L+HVR +EV H + DL+  C ENG   V++SE  EH+ LNI  R++ GKR+     
Sbjct  150   RLKLLQHVRVTEVSHIVQDLFLKCKENGNCSVDMSELLEHLVLNIITRMVAGKRYFDGNS  209

Query  650   ---SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWL  820
                    + + +++   +YL GVFV SD+IP L W +  G +K +K+V KE D II  W+
Sbjct  210   TGNDENRRPIGQIMREFMYLAGVFVASDLIPFLGWSEFLGPVKTMKKVMKEFDNIIENWI  269

Query  821   QEHIRNR-KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETL  997
              EH   R   + +   DF+DV+LS + +D+   G+ R T+IKAT L +I+ G+++T+ T+
Sbjct  270   HEHESKRVNGESNVHQDFIDVLLSEIKDDSTF-GNSRKTVIKATILTVIVGGADTTSITM  328

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
              W  + LLNN  A+++AQ+E+D  VG+DR++EESD +NL Y +AIIKE LRLYP GPL+ 
Sbjct  329   TWILANLLNNKKALELAQEEIDQKVGRDRILEESDCENLVYLKAIIKETLRLYPAGPLAV  388

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             PRE+M DC    YHIP+GTR + NL KLHRDP+VW+ P+EFKPER F   HA +  VG++
Sbjct  389   PRESMVDCNFYGYHIPRGTRFLTNLWKLHRDPKVWANPDEFKPER-FLTSHADVDVVGQN  447

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FE LPF  GRR CPG+NF++QVVQL + RLLQGFN+ TP    VDM+E L I+L K TP+
Sbjct  448   FELLPFGSGRRSCPGLNFAMQVVQLGIGRLLQGFNLRTPSNELVDMTESLNISLSKETPL  507

Query  1538  QVLLTPRL-PNLF  1573
             +++LTPRL P L+
Sbjct  508   EIVLTPRLAPQLY  520



>ref|XP_007201695.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
 gb|EMJ02894.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
Length=517

 Score =   474 bits (1220),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 252/506 (50%), Positives = 343/506 (68%), Gaps = 24/506 (5%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             ++L   R    + K+  +  P+  GA P IGHLH L G  P+ +TL  MADKYGP+F + 
Sbjct  16    LVLYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRG--PIFKTLAAMADKYGPIFTIW  73

Query  284   LGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKM  463
             LG HP +V+S+ + VK+CFT ND VFA+R    VGKYLGYN A F  +PYG YWRD+RKM
Sbjct  74    LGKHPVLVISNYDAVKQCFTKNDTVFATRSRSTVGKYLGYNYAGFGFSPYGTYWRDMRKM  133

Query  464   VTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG-------EVNLSEWFEHVTLNIT  622
             V +EL++  RL+ L+ V+ SEV+  I  L+ +C   G       +V +S+W EH+TLN+ 
Sbjct  134   VMVELLSSRRLETLKRVQISEVDAFIKGLFLLCKTEGHNGLNPTKVVISDWIEHLTLNVI  193

Query  623   LRLLVGKRF---------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGL  775
              R++ GKR+          R  K LKE     +Y+ G  V +DVI    W+D  G +K +
Sbjct  194   TRMIAGKRYFDSSDEGDEQRFGKILKEF----MYVSGNPVAADVIGFPSWIDFKGQVKAM  249

Query  776   KEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattl  955
             K + KE+D ++G+W++EH   ++ +  D+ DF+DVM+S + ED    G+ R+TIIKAT+L
Sbjct  250   KRIMKELDSVMGSWVEEHYAKKETNSRDEHDFIDVMISVI-EDNSTLGYTRETIIKATSL  308

Query  956   ililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAII  1135
              LIL GSE+TA  LIW  SLLLNN H +K+AQ+E+D+ VG+DR +E++DI+NL Y QAI+
Sbjct  309   NLILAGSETTAINLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDTDIENLPYLQAIV  368

Query  1136  KEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERW  1315
             KE LRLYPP PLS P EAM+DC++  +HI KGT L +NL KLHRDP +W +PE F PER 
Sbjct  369   KETLRLYPPAPLSVPHEAMQDCQVCGFHIQKGTLLFVNLWKLHRDPSLWPDPEVFCPER-  427

Query  1316  FRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDM  1495
             F   H  I   G+ FE++PF  GRR CPG  F+LQV  LTL RLLQGF ++TPM MPVD+
Sbjct  428   FLTTHVGIDASGQHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFELATPMDMPVDL  487

Query  1496  SEGLGIALPKLTPIQVLLTPRLPNLF  1573
             +EG+GI +PK T ++V+LTPRLP +F
Sbjct  488   TEGVGITMPKSTSLEVILTPRLPLVF  513



>ref|XP_002531094.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31308.1| cytochrome P450, putative [Ricinus communis]
Length=525

 Score =   474 bits (1219),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 247/501 (49%), Positives = 338/501 (67%), Gaps = 17/501 (3%)
 Frame = +2

Query  110   LKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLG  289
             ++ KR N  + K L L  PE  GA P IGHLHLL     +ARTLG +AD YGP+F + LG
Sbjct  27    VRVKRQNYESNKSL-LLAPEPSGALPIIGHLHLLGKENTLARTLGRLADNYGPIFTIWLG  85

Query  290   SHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVT  469
              H  +VVSS E +KECF++ND + ASRP  + G+YL YN A F  A YG YW  +RK+V 
Sbjct  86    VHRTVVVSSYEAIKECFSSNDRILASRPRSSHGQYLSYNYAAFGFASYGPYWSHMRKLVA  145

Query  470   LELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEV-NLSEWFEHVTLNITLRLLVGKR  646
             ++L++  R+K L+HV+ SEV   I +LY     N ++ N+SE FEH+TLN+  R++ GKR
Sbjct  146   IQLLSSHRIKLLKHVQISEVNTLIKELYEKQGSNKKIINISECFEHLTLNMITRMIAGKR  205

Query  647   FSRIA--------KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDE  802
             +   A        K + +++   +Y+ GVFVPSD+IP L WM+  G +K +K +S+E+D 
Sbjct  206   YFSSADSDSEQEGKRIGKIMKEFMYISGVFVPSDLIPFLGWMNFAGPVKTMKRLSRELDS  265

Query  803   IIGTWLQEHIRNR---KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtG  973
             +  TW+ EH   R   +E  + + DF+DVMLS L +D    GH ++ IIK T   LI+ G
Sbjct  266   LTETWIDEHKLKRVKSEESKNMEEDFIDVMLSLLEDD--FFGHSKEDIIKGTVTNLIIAG  323

Query  974   SESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRL  1153
             +++T+ TL W  S LLNN   +++AQ E+D+ VG++R V++SDI NL Y  AI+KE LRL
Sbjct  324   ADTTSITLTWILSNLLNNRRTLELAQQELDLKVGRNRCVQDSDIDNLVYLNAIVKETLRL  383

Query  1154  YPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHA  1333
             YPPGPL+ P EA EDC I  YHIPKGTR+  NL KLHRDP VWS P EF PER F    A
Sbjct  384   YPPGPLAVPHEASEDCSIAGYHIPKGTRVFANLWKLHRDPNVWSSPNEFVPER-FLTSQA  442

Query  1334  SIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGI  1513
             ++   G++FEY+PF  GRR CPG+NF++Q + LTLA+LLQ F+ +TP+ +PVDM+EGLGI
Sbjct  443   NMDVSGQNFEYIPFGSGRRSCPGLNFAIQAIHLTLAKLLQAFSFTTPLNVPVDMTEGLGI  502

Query  1514  ALPKLTPIQVLLTPRL-PNLF  1573
              LPK TP+++ + PRL P L+
Sbjct  503   TLPKATPLEIHIIPRLSPELY  523



>ref|XP_007049687.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOX93844.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=527

 Score =   474 bits (1219),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 244/487 (50%), Positives = 335/487 (69%), Gaps = 19/487 (4%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             L  PE PGA P IGH+HLL G+  +A+TLG MADKYGP+F +R G+ PA+++S+ E VKE
Sbjct  36    LLAPEPPGALPIIGHIHLLGGKRTLAQTLGAMADKYGPIFSIRFGAFPALIISNHEAVKE  95

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTTND V ASRP    G YLGY+ A F  APYG YWR+ RK+  +EL++  RL+  +HV
Sbjct  96    CFTTNDRVLASRPKSNAGTYLGYDHAGFGFAPYGEYWRETRKLAVVELLSSHRLETSKHV  155

Query  515   RTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRF--------SR  655
                EV   I +LY  C +NG     +  +S  FE +TLN   R++ GKR+          
Sbjct  156   LDFEVNAFIKNLYLFCKKNGPDANPKAVISHKFEALTLNTITRMIAGKRYISDGDEEDDV  215

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMD--IGGYIKGLKEVSKEMDEIIGTWLQEH  829
              A+H+ +V+   +Y+ G+  PS+ +P L WM+   GG +K +K V+KE+D IIG W+ EH
Sbjct  216   EARHVIKVIKDFMYVSGLIAPSEAMPFLGWMESIFGGPVKSMKRVAKEIDSIIGRWVDEH  275

Query  830   IRNR--KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIW  1003
                R   E D +  DF+D++LS++ ED++  G+ R+TIIKAT + L L G+++T+  L W
Sbjct  276   KLKRLMSEADHNNQDFIDLLLSAIGEDSMF-GYTRETIIKATVMNLFLAGADTTSIALTW  334

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               S L+NN H +K AQ+E+D+ VG+D+ V++SDI+ L Y QA+IKE LRLYPPGP+S P 
Sbjct  335   ILSNLMNNRHTLKTAQEELDLTVGRDKWVQDSDIEKLVYLQAVIKETLRLYPPGPISVPH  394

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EA EDC I  YH+ KGTR+I+NL +LHRDPR+WS P+EF+PER F   HA++  +G+ FE
Sbjct  395   EAREDCSISGYHVQKGTRVIVNLRRLHRDPRIWSNPDEFQPER-FLTSHANVDVLGQHFE  453

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
              +PF  GRR CPGM  +LQ+  LT+AR LQGF+++TP    VDM+EGLGI +PK TP+ V
Sbjct  454   LIPFGSGRRSCPGMPLALQITHLTIARTLQGFDLTTPFNESVDMTEGLGITMPKATPLDV  513

Query  1544  LLTPRLP  1564
             LL+PRLP
Sbjct  514   LLSPRLP  520



>ref|XP_011089652.1| PREDICTED: cytochrome P450 82C2 [Sesamum indicum]
Length=528

 Score =   474 bits (1219),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 250/480 (52%), Positives = 338/480 (70%), Gaps = 14/480 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWP IGHLHLL GR+PV RTLG +AD+YGPVF +RLG H A+VVSS E VK+CF
Sbjct  45    APEPSGAWPVIGHLHLLGGRVPVYRTLGGLADRYGPVFTVRLGVHTALVVSSWEAVKDCF  104

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND +   RP+ + GKYLGY+ A F  + +G YWR +RK+V LE+++  RL+ L++V  
Sbjct  105   TTNDKILNKRPASSAGKYLGYDYAAFGFS-HGTYWRQMRKLVLLEVLSARRLESLKNVWE  163

Query  521   SEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFSRI--------AKHLKE  676
             SE+   I +LY   H    V +SEW E +TLN  + ++ GKR++          A+  +E
Sbjct  164   SEIHTSINELYKK-HSGKVVVISEWIERLTLNTIVMMIAGKRYTDSTQGDETVEARSFRE  222

Query  677   VVSRALYLGGVFVPSDVIP--SLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR-KE  847
             ++   +Y+ G FV SD IP   L WMD  G+IK +K +SKE+  +   W+ EH+R+  K 
Sbjct  223   LIKEFMYISGQFVASDAIPFPPLRWMDFQGHIKSMKRISKELSTVFERWITEHVRSDCKS  282

Query  848   ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
                ++ DF+DVMLS++ E     GH R+TIIKAT L LIL GS++T+  L W  SLLLNN
Sbjct  283   RLGNEQDFIDVMLSTIDEKFTSFGHTRETIIKATALNLILAGSDTTSIHLTWLLSLLLNN  342

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
                ++ AQ+E+DM VGK+R V+ESDIKNL Y QA++KE LRL+PPGPLS P EAMEDC +
Sbjct  343   RQVMQQAQEEIDMKVGKERWVQESDIKNLVYLQAVVKETLRLFPPGPLSVPHEAMEDCCV  402

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
               YH+PKGTRL++N+ KLHRDPR+W+EP+ F PER F   H ++ + G++ E++PF  GR
Sbjct  403   AGYHVPKGTRLLVNVWKLHRDPRIWAEPDNFVPER-FLTSHVAVDFTGQNHEFVPFGSGR  461

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLPN  1567
             R CPG+ F++QV  LTLARLLQGF+++TP   PVDM+EGL I LPK TP++V++TPRL +
Sbjct  462   RSCPGITFAMQVTHLTLARLLQGFDLATPSNGPVDMTEGLSITLPKATPLEVVITPRLSD  521



>emb|CAN75482.1| hypothetical protein VITISV_020998 [Vitis vinifera]
Length=500

 Score =   473 bits (1216),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 251/489 (51%), Positives = 329/489 (67%), Gaps = 26/489 (5%)
 Frame = +2

Query  128   NKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIV  307
              K+ GK      PE  GAWPF+GHL LL G+ P+ RTLG MADK+GPVF +RLG H A+V
Sbjct  30    GKSKGK----SAPEPSGAWPFLGHLPLLRGQTPIFRTLGAMADKHGPVFMIRLGVHRALV  85

Query  308   VSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTV  487
             VSS E VKECFTTND  FASRPS + GK LGYN A F  APYG  WR++RK+  +E+++ 
Sbjct  86    VSSREAVKECFTTNDKAFASRPSSSAGKILGYNHAGFGFAPYGALWREMRKLSMMEILSA  145

Query  488   SRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFSRIAKH  667
             S               C+       H   +V +SEWF+H++ NI L+++ GKR    + H
Sbjct  146   SS------------PQCVKSCSDWVHPV-KVVMSEWFQHLSFNIVLKMIAGKRSFNTSDH  192

Query  668   LKEVVSRA-------LYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQE  826
               E   RA       L+L G FV SD IP +EWMD+ GY+  +K V+KE+D ++G W++E
Sbjct  193   GNEEARRAIATIHKLLFLTGAFVLSDAIPGVEWMDLQGYLGSMKRVAKEVDSLVGGWVEE  252

Query  827   HIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWT  1006
             H      + + + DF+DVMLS L ED  + G+ R+T+IKAT +ILI+ G+++ + T  W 
Sbjct  253   HEMRLNREGNKRQDFIDVMLSVL-EDTSMFGYSRETVIKATIMILIVGGTDTLSTTSTWL  311

Query  1007  TSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPRE  1186
              S LLNN HA+K AQ+E+D+ VG+ R VEESDI NL Y QA+IKE LRLY   PLS P E
Sbjct  312   LSALLNNKHALKCAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTATPLSAPHE  371

Query  1187  AMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEY  1366
             AMEDC +  YHIPKGTRL +N  KLHRDP VWS+PE+F+PER F   HA +  +G+ FE 
Sbjct  372   AMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPER-FLTTHADLDVLGQHFEL  430

Query  1367  LPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVL  1546
             +PF  GRR CPG+  +L+++ L + RLLQGF++STP+  PVDM EGL I L KLTP++V+
Sbjct  431   IPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVM  490

Query  1547  LTPRLPNLF  1573
             LTPRLP+ F
Sbjct  491   LTPRLPSQF  499



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   471 bits (1211),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 241/481 (50%), Positives = 317/481 (66%), Gaps = 15/481 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEAPGAWP IGHLHLL G     +TLG MADKYGP+F +R+G + A+VVS+ ++ KECF
Sbjct  25    APEAPGAWPIIGHLHLLGGSELRHKTLGAMADKYGPIFKIRIGVNHALVVSNSDIAKECF  84

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND  FASRP+    K LGY+  +F +APYG+YW ++RK+   EL++  RL+ L+HVR 
Sbjct  85    TTNDKAFASRPTSTASKILGYDYVMFGMAPYGQYWVELRKITMSELLSNRRLELLKHVRD  144

Query  521   SEVEHCIGDLYSMC--HENGE----VNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVV  682
             SE++  I DLY +   H+  +    V++ +WF  +TLN+ LR++ GKR+S       E  
Sbjct  145   SEIDASIQDLYKVWKNHDKAKGPVLVDMKQWFGDLTLNVILRMIAGKRYSGSMSSCDETE  204

Query  683   SRALYLG--------GVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
             +R    G        G+F+  D +P L W D+ GY K +K  +KE+D +   WL+EH R 
Sbjct  205   ARTCQKGMRDFFRLLGLFIIEDALPYLSWFDLQGYKKEMKNTAKELDSVFQRWLEEHNRM  264

Query  839   RKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
             R+  + ++      +L S+ ED  IS +  DTIIK+T L ++  G ++T  TL W  SLL
Sbjct  265   RQTGELNREQDFMDVLMSILEDTRISEYDNDTIIKSTCLSIVTGGGDTTMVTLTWILSLL  324

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN HA+K AQDE+D HVGKDR VEESDIKNL Y QAI KE LRLYP GPLSGPR A  D
Sbjct  325   LNNKHALKKAQDELDSHVGKDRQVEESDIKNLVYLQAITKEALRLYPAGPLSGPRVADAD  384

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C +  YH+P GTRLI+N  K+ RDP VWSEP EF+PER F   H ++   G  +E +PF 
Sbjct  385   CTVAGYHVPAGTRLIVNTYKIQRDPLVWSEPSEFRPER-FLTSHVNMDVKGLHYELIPFG  443

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CPGM+F+LQVV L LAR L  F+  T M MPVDM+E  G+   K TP++V++TPR
Sbjct  444   AGRRSCPGMSFTLQVVPLVLARFLHEFDSKTEMDMPVDMTETAGLTNAKATPLEVVITPR  503

Query  1559  L  1561
             L
Sbjct  504   L  504



>ref|XP_008378409.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=529

 Score =   470 bits (1209),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 252/492 (51%), Positives = 333/492 (68%), Gaps = 25/492 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHG-RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PE  G WP IGHLHLL G    + RTLG MADKYGP F +RLGS  A VVSS EV K+C
Sbjct  36    APEPAGGWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAKDC  95

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP+    K++GYN AVF  APY  +WR++RK+ TLEL++  RL  LRHVR
Sbjct  96    FTVNDRALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLDMLRHVR  155

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF---------SR  655
             TSE++  I +LYS+  +NG      V L+ W E +TLN+ +R++ GKR+           
Sbjct  156   TSELDMGIKELYSLWVQNGGLRPAVVELNHWLEELTLNVVVRMVAGKRYFGASAKCEDGD  215

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A+  ++ + +  +L G+FV +D +P L W+D+ G+ K +K+ +KE+D I+G WL+EH +
Sbjct  216   EARRCQKAIGQFFHLIGIFVVADALPFLWWLDLQGHEKAMKKTAKELDGILGGWLEEHRQ  275

Query  836   NR------KEddddqsdfmdVMLSSLPEDAVISG--HKRDtiikattlililtGSESTAE  991
              R       ED+    DF+DVMLS L E+  +S   +  DT IK+T L LIL GS++TA 
Sbjct  276   RRGASHGEAEDEGGDEDFIDVMLS-LEEEGQLSNFQYSSDTSIKSTCLALILGGSDTTAG  334

Query  992   TLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPL  1171
             TL W  SLLLNNP A+KMAQ+E+D+HVG +R VEESDI NL Y QAIIKE LRLYP GPL
Sbjct  335   TLTWAISLLLNNPDAMKMAQEELDLHVGTERQVEESDITNLVYLQAIIKETLRLYPAGPL  394

Query  1172  SGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVG  1351
              GPREA+EDC +  Y +P GTRL++N+ K+ RDPRVW  P  F PER F + H+ +   G
Sbjct  395   LGPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWENPSAFVPER-FLESHSHVDVRG  453

Query  1352  KSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLT  1531
             + F  +PF  GRR CPG++F++QV+ LTLARLL GF I T  G  VD++E  G+ +PK T
Sbjct  454   QQFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQSVDLTESPGLTIPKAT  513

Query  1532  PIQVLLTPRLPN  1567
             P++VLL+PRLP+
Sbjct  514   PLEVLLSPRLPS  525



>ref|XP_010106089.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXC07359.1| Cytochrome P450 82C4 [Morus notabilis]
Length=528

 Score =   469 bits (1206),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 250/508 (49%), Positives = 332/508 (65%), Gaps = 21/508 (4%)
 Frame = +2

Query  98    NQIILKYK--RDNKNNGKLLP-LRVPEAPGAWPFIGHLHLLHG-RLPVARTLGHMADKYG  265
             + +IL Y   R      ++ P ++ PE  GAWP IGHLHLL G    + RTLG MAD YG
Sbjct  17    SSVILYYALLRKKSKPTRITPGVQAPEPEGAWPIIGHLHLLGGGDQLLYRTLGAMADNYG  76

Query  266   PVFGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYW  445
             P F +RLGS  A VV+S +V K+CFT ND   ASRP+    K++GYN AVF  APY  +W
Sbjct  77    PAFNIRLGSRRAFVVNSWDVAKDCFTANDKALASRPTTVAAKHMGYNYAVFGFAPYSPFW  136

Query  446   RDVRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTL  613
             R++RK+ TLEL++  RL+ L+HVR SE++  I DLY    +NG     V LS W + +TL
Sbjct  137   REMRKIATLELLSNRRLEMLKHVRISEIDTGIQDLYDRV-QNGAHPVVVELSRWLDELTL  195

Query  614   NITLRLLVGKRF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIK  769
             N+ +R++ GKR+           A+  ++ +    +L G+FV SD +P L W+D+ G+ +
Sbjct  196   NMVVRMVAGKRYFGALAECNGDEAQRCQKAICEFFHLIGIFVVSDALPFLWWLDLHGHER  255

Query  770   GLKEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISG--HKRDtiik  943
              +K  +KE+D I+G WL+EH R R     D       ++ SL E   +S   +  D  IK
Sbjct  256   AMKRTAKELDAILGGWLEEHRRRRASKMADSDQDFIDVMLSLQEGGELSNFQYDADISIK  315

Query  944   attlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYF  1123
             +T L LIL GS++TA TL W  SLLLNN HA+K AQ E+D+ VG +RLV++SDIKNL Y 
Sbjct  316   STCLALILGGSDTTAGTLTWAISLLLNNSHALKKAQQELDIEVGTNRLVDDSDIKNLVYL  375

Query  1124  QAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFK  1303
             QAIIKE LRLYP GPL GPREA+EDC +  YH+P GTRL++N+ K+ RDP VWS PE F+
Sbjct  376   QAIIKETLRLYPAGPLLGPREALEDCTVSGYHVPAGTRLVVNVWKIQRDPTVWSNPEAFE  435

Query  1304  PERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPM-G  1480
             PER F   HA +   G+ FE +PF  GRR CPG +F+LQV+ LTLARLLQ F  S P+ G
Sbjct  436   PER-FLTTHAHVDVRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLQAFEFSNPLDG  494

Query  1481  MPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
              PVDM+E  G+ +PK  P++VLL+PRLP
Sbjct  495   RPVDMTENPGLTIPKAHPLEVLLSPRLP  522



>ref|XP_006375022.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
 gb|ERP52819.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
Length=519

 Score =   468 bits (1203),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 244/486 (50%), Positives = 322/486 (66%), Gaps = 20/486 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHG-RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PE  GAWP IGHLHLL G    + RTLG MADK+G  F +RLGS  A VVSS EVVKEC
Sbjct  30    APEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKEC  89

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT N    ASRP+    K++GYN AVF  APY  +WR++RK+ TLEL++  RL+ L+HVR
Sbjct  90    FTINAKALASRPTTVAAKHMGYNYAVFGFAPYSSFWREMRKIATLELLSNRRLEMLKHVR  149

Query  518   TSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF--------SRIA  661
              SEV+  I +LY+    N      V L +W E +TLN+ +R++ GKR+           A
Sbjct  150   ASEVDIGIRELYNSWANNSSSPVVVELKQWLEDLTLNVVVRMVAGKRYFGSAAASDDGEA  209

Query  662   KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
             +  ++ +++   L G+FV SD +P L W+D+ G+ + +K  +KE+D I+  WL EH + R
Sbjct  210   RRCQKAINQFFRLIGIFVVSDALPFLGWLDLQGHERAMKNTAKELDAILEGWLDEHRQRR  269

Query  842   KEdddd---qsdfmdVMLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLIWT  1006
                      + DF+DVMLS L E+  +S  + D      +  L L   GS++TA TL W 
Sbjct  270   VSAGIKDEGEQDFIDVMLS-LKEEGQLSNFQYDANTSIKSTCLALILGGSDTTAGTLTWA  328

Query  1007  TSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPRE  1186
              SLLLNN H +K AQ+E+D+HVGK+R VE+SD+KNL Y QAIIKE LRLYP GPL GPRE
Sbjct  329   ISLLLNNRHMLKKAQEELDLHVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPLLGPRE  388

Query  1187  AMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEY  1366
             AMEDCK+  YH+P GTRLI+N+ K+ RDPRVW+ P  F PER F   H  +   G+ FE 
Sbjct  389   AMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPER-FLTSHGDVDVRGQQFEL  447

Query  1367  LPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVL  1546
             +PF  GRR CPG++F+LQV+ LTLARLL  F ++TPM  PVD++E  G+ +PK TP++V+
Sbjct  448   IPFGSGRRSCPGVSFALQVLHLTLARLLHSFELATPMDQPVDLTESSGLTIPKATPLEVI  507

Query  1547  LTPRLP  1564
             LTPRLP
Sbjct  508   LTPRLP  513



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   467 bits (1201),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 248/494 (50%), Positives = 332/494 (67%), Gaps = 25/494 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHG-RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PE  GAWP IGHLHLL G    + RTLG MADKYG  F +RLGS  A VVSS EV KEC
Sbjct  26    APEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGSAFNIRLGSRRAFVVSSWEVAKEC  85

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP+    K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HVR
Sbjct  86    FTFNDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATIELLSNRRLEMLKHVR  145

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF---------SR  655
             TSE++  I +L ++  +NG      V L+ W E +TLN+ +R++ GKR+           
Sbjct  146   TSELDTGIKELQNLWVQNGSSRPVVVELNRWLEELTLNVVVRMVAGKRYFGASAKCDDGD  205

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A+  ++ + +  +L G+FV SD +P L W+D+ G+ K +K+ +K++D I+G WL EH +
Sbjct  206   EARRCQKAIGQFFHLIGIFVVSDALPFLWWLDLQGHEKAMKKTAKDLDAILGGWLDEHRQ  265

Query  836   NR-----KEddddqsdfmdVMLSSLPEDAVISG--HKRDtiikattlililtGSESTAET  994
              R     K   +   DF+DVMLS L E+  +S   H  DT IK+T L +IL GS++TA T
Sbjct  266   RRVLSHEKGKTEADEDFIDVMLS-LQEEGQLSNFQHSSDTSIKSTCLAIILGGSDTTAGT  324

Query  995   LIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLS  1174
             L W  SLLLNNPH +K AQ+E+++ VG +R V+ESDIKNL Y QAIIKE LRLYP GPL 
Sbjct  325   LTWAISLLLNNPHVMKKAQEELELQVGTERQVDESDIKNLVYLQAIIKETLRLYPAGPLL  384

Query  1175  GPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGK  1354
             GPREA+EDC +  YH+P GTRL++N+ K+ RDP VW  P  F+PER F   H  +   G+
Sbjct  385   GPREALEDCTVAGYHVPAGTRLVVNVWKIQRDPSVWENPSAFEPER-FLTSHGHVDVRGQ  443

Query  1355  SFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTP  1534
              FE +PF  GRR CPG++F++QV+ LTLARLL  F   TP+G  +DM+E  G+ +PK TP
Sbjct  444   QFELMPFGSGRRSCPGVSFAMQVLHLTLARLLHAFEFETPLGQRIDMTESPGLTIPKATP  503

Query  1535  IQVLLTPRLP-NLF  1573
             ++VLLTPRLP NL+
Sbjct  504   LEVLLTPRLPGNLY  517



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   467 bits (1201),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 248/497 (50%), Positives = 334/497 (67%), Gaps = 20/497 (4%)
 Frame = +2

Query  128   NKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAI  304
              K N        P+  GAWP +GHLHLL G   +  RTLG MAD+YGP F +RLGS  A 
Sbjct  27    QKTNADDKTRTAPQPKGAWPILGHLHLLGGSDQLLYRTLGAMADEYGPAFTIRLGSRCAF  86

Query  305   VVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMT  484
             VVSS E+ KECFT ND   ASRP+    K++GYN AVF  APY  +WR++RK+ TLEL++
Sbjct  87    VVSSWELAKECFTINDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLS  146

Query  485   VSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF-  649
               RL+ L+HVR SEV+  I +LYS+ H+NG     V L +W E +TLN+ +R++ GKR+ 
Sbjct  147   NRRLEMLKHVRISEVDMGIRELYSLRHDNGSIPVLVELKQWLEDLTLNVVVRMVAGKRYF  206

Query  650   --SRI-----AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEII  808
               S +     A+  ++ +     L G+FV SD +P L W+D+ G+ K +K  +KE+D+++
Sbjct  207   GASAVCVDGEARRCQKAIKEFFRLIGMFVVSDALPLLWWLDVHGHEKAMKMTAKELDDLL  266

Query  809   GTWLQEHIRNRKE---ddddqsdfmdVMLSSLPEDAVISG--HKRDtiikattlililtG  973
               WL+EH + R       + + DF+DVMLS L E+  ++   +  D  IK+T L LIL G
Sbjct  267   EAWLKEHRQRRISGGIKAEGEQDFIDVMLS-LQEEGHLANFQYDADISIKSTCLALILGG  325

Query  974   SESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRL  1153
             +++TA TL W  SLLLNNP  +K AQ+E+D+ VG++RLV+ESDI+NL Y QAIIKE LRL
Sbjct  326   TDTTAGTLTWAISLLLNNPELLKKAQEELDLQVGRERLVDESDIQNLVYLQAIIKETLRL  385

Query  1154  YPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHA  1333
             YP GPL GPREAM DC +  YH+P GTRLI+N+ K+ RDPRVWS P  F PER F   HA
Sbjct  386   YPAGPLLGPREAMNDCTVAGYHVPAGTRLIVNVWKIQRDPRVWSNPSAFVPER-FLTSHA  444

Query  1334  SIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGI  1513
             ++   G+ FE +PF  GRR CPG +F+LQ++ LTLAR L  F +STP+  PVDM+E  G+
Sbjct  445   NVDVRGQQFELIPFGSGRRSCPGASFALQLLHLTLARFLHAFELSTPLDQPVDMTESPGL  504

Query  1514  ALPKLTPIQVLLTPRLP  1564
              +PK TP++VLL PR+P
Sbjct  505   TIPKATPLEVLLKPRVP  521



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   467 bits (1201),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 247/485 (51%), Positives = 327/485 (67%), Gaps = 20/485 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHG-RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PE  GAWP IGHLHLL G    + RTLG MADKYGP F +RLGS  A VVSS EV KEC
Sbjct  38    APEPGGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAKEC  97

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   A+RP+    K++GYN AVF  APY  +WR++RK+ TLEL++  RL+ L+HVR
Sbjct  98    FTINDKALATRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEILKHVR  157

Query  518   TSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF--------SRIA  661
             TSEV+  I +LY +  +N      V L+ W E +TLN+ +R++ GKR+        S  A
Sbjct  158   TSEVDMGIRELYGLWVKNSSRPLLVELNRWLEDMTLNVIVRMVAGKRYFGAAAASDSSEA  217

Query  662   KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
             +  ++ +S+   L G+FV SD +P L W+D+ G+ + +K  +KE+D I+  WL+EH + R
Sbjct  218   RRCQKAISQFFRLIGIFVVSDALPFLWWLDLQGHERAMKTTAKELDSILEGWLEEHRQRR  277

Query  842   KEddddq---sdfmdVMLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLIWT  1006
                        DF+DVMLS L E+  +SG + D+     +  L L   GS++TA TL W 
Sbjct  278   VSSLIKAEGEQDFIDVMLS-LQEEGRLSGFQYDSETSIKSTCLALILGGSDTTAGTLTWA  336

Query  1007  TSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPRE  1186
              SLLLNN HA+K AQ+E+D+ VG +R VEESD+KNL Y QAIIKE LRLYP GPL GPRE
Sbjct  337   ISLLLNNRHALKKAQEELDLCVGMERQVEESDVKNLVYLQAIIKETLRLYPAGPLLGPRE  396

Query  1187  AMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEY  1366
             A++DC +  Y++P GTRLI+N+ KL RDP VW+ P  F+PER F + HA +   G+ FE 
Sbjct  397   ALDDCTVAGYNVPAGTRLIVNIWKLQRDPSVWTNPCAFQPER-FLNAHADVDVKGQQFEL  455

Query  1367  LPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVL  1546
             +PF  GRR CPG++F+LQV+ LTLARLL  F +STP+  PVDM+E  G+ +PK TP++VL
Sbjct  456   MPFGSGRRSCPGVSFALQVLHLTLARLLHAFELSTPVDQPVDMTESSGLTIPKATPLEVL  515

Query  1547  LTPRL  1561
             LTPRL
Sbjct  516   LTPRL  520



>emb|CBI29738.3| unnamed protein product [Vitis vinifera]
Length=727

 Score =   473 bits (1218),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 246/470 (52%), Positives = 325/470 (69%), Gaps = 16/470 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE  GAWPF+GHLHLLHG++PV RTLG MADK GPVF +RLG +  +VVS+ E  KECFT
Sbjct  39    PEPSGAWPFVGHLHLLHGKVPVFRTLGAMADKVGPVFVIRLGMYRTLVVSNREAAKECFT  98

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND +FASRP+ +  K LGYN A FA AP+G YWR++RK+  LE+++  RL  L HV+ S
Sbjct  99    TNDKIFASRPNSSAAKILGYNYAAFAFAPHGPYWREMRKLSMLEILSTRRLGDLMHVQVS  158

Query  524   EVEHCIGDLYSMCHENGEVN-----LSEWFEHVTLNITLRLLVGKRFSRIAKHLKE----  676
             E+   I DLY +  +N  VN     +SEWFEH+T N+ LR++ GKR+     H  E    
Sbjct  159   ELHAGIKDLYILGKDNNWVNPKKVVISEWFEHLTFNVVLRMVAGKRYFNNVVHGGEEARS  218

Query  677   ---VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKE  847
                 + + L L G  V SDVIP LEW+D+ G++  +K V+KEMD +I +W++EH      
Sbjct  219   AIAAIKKVLLLVGASVASDVIPFLEWVDLQGHLSSMKLVAKEMDSLIESWVKEHTGRLNS  278

Query  848   ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
             +     DF+D+ML+ L +DA + G+ R+TIIKAT L +I+ GS++T+ T  W  S LLNN
Sbjct  279   EASSSLDFIDIMLTKL-KDASLFGYSRETIIKATVLTMIVAGSDTTSLTSTWLLSALLNN  337

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
              H +K AQ+E+D+ VG+DR VE+SDI+NL Y +AI+KE LRLY   PL  P EAMEDC +
Sbjct  338   KHVMKHAQEELDLKVGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHV  397

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
             G YHI KGTRL++N  KLHRDP VWS PEEF+PER F   HA++   G+ FE +PF  GR
Sbjct  398   GGYHISKGTRLLVNAWKLHRDPAVWSNPEEFQPER-FLTSHANVDVFGQHFELIPFGSGR  456

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             R CPG+N  LQ++ LT+ARLLQGF+++ P   PVDM+E  GI + KL P+
Sbjct  457   RSCPGLNMGLQMLHLTIARLLQGFDMTKPSNSPVDMTE--GITIKKLVPL  504


 Score =   162 bits (409),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 135/192 (70%), Gaps = 7/192 (4%)
 Frame = +2

Query  698   LGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmd  877
             L G FV SD+IP LEW+D+ G++  +K+V+KEMD ++ +W++EH      +   + DF+D
Sbjct  504   LAGAFVASDLIPFLEWVDLQGHLSSMKQVAKEMDSVLESWVEEHTGRLNTEASSRQDFID  563

Query  878   VMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDE  1057
             +ML+ L +DA + G+ R+TIIKAT LILI+ GS++T+ T  W  S LLNN H +K AQ+E
Sbjct  564   IMLTKL-KDASLFGYSRETIIKATVLILIVVGSDTTSITSTWLLSALLNNRHVMKHAQEE  622

Query  1058  MDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIG------KYH  1219
             +D+ VG+DR VE+SDI+NL Y +AI+KE LRL P  PL  P EAMED  +G       YH
Sbjct  623   LDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLCPAIPLLVPLEAMEDYHVGYHSNSPGYH  682

Query  1220  IPKGTRLILNLL  1255
             IPKGTRL+ + L
Sbjct  683   IPKGTRLLSHFL  694



>ref|XP_010069627.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW58035.1| hypothetical protein EUGRSUZ_H00764 [Eucalyptus grandis]
Length=539

 Score =   466 bits (1199),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 251/513 (49%), Positives = 335/513 (65%), Gaps = 31/513 (6%)
 Frame = +2

Query  137   NGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSS  316
              G +LP   PE PGAWP IGHLHLL G  P+ARTL  MADK GP+F + LG HP  V+SS
Sbjct  31    KGTILP---PELPGAWPIIGHLHLLRGETPLARTLAAMADKQGPMFRIWLGVHPTTVISS  87

Query  317   CEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRL  496
              E V+ECFTT+D   ASRP    G +LGY   VF  A YG  WR++RK+  LEL+   RL
Sbjct  88    REAVRECFTTHDKELASRPKSMAGVHLGYGHTVFVFAEYGDLWREMRKITMLELLCTRRL  147

Query  497   KKLRHVRTSEVEHCIGDLYSMCHENGE---------VNLSEWFEHVTLNITLRLLVGKR-  646
               L+HV+ SE++  + DL ++C  N +         V +SE  E +TLNI  R+L  KR 
Sbjct  148   DNLKHVQESEIDSFVKDLRTLCMTNTDDAQNGSSKGVVISELLELLTLNIMTRMLASKRY  207

Query  647   FSRI------------AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSK  790
             F ++            A HL+E++   +YL G+ V SD +P  EW D  G +K +K V++
Sbjct  208   FGQLSASTGSSTDYDEASHLRELIKDFMYLFGLPVVSDFLPFPEWTDCTGTVKTMKRVAR  267

Query  791   EMDEIIGTWLQEH----IRNRKEddddqsdfmdVMLSSLPEDAVIS-GHKRDtiikattl  955
             E+DEI+G W++EH      +R E  D + DF+DVMLS + ED+    GH  + +IKAT +
Sbjct  268   ELDEIVGKWVEEHKLKRCDHRGEAIDVREDFIDVMLSMIGEDSFAKFGHPPERLIKATVV  327

Query  956   ililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAII  1135
               I+ GS++T  TL W  SLLLN+ H +K AQ+EMD+ VGKD+ +++SDI+NL Y QAI+
Sbjct  328   NNIVAGSDTTYLTLTWVLSLLLNHKHILKRAQEEMDLMVGKDKWIQDSDIENLPYLQAIV  387

Query  1136  KEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERW  1315
             KE LRLYP  PL  P EA  DC +  Y IPKGTR+I+N+ KLHRDP+VWS PE+F PER 
Sbjct  388   KETLRLYPTAPLVAPHEARADCTVSGYRIPKGTRIIVNVWKLHRDPQVWSNPEKFLPER-  446

Query  1316  FRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDM  1495
             F   H+ +  +G+ FE++PF  GRR CPG   +L+V  LTLARLLQGF+++TP   PVDM
Sbjct  447   FLTNHSGMDALGQHFEFIPFGSGRRSCPGAMLALRVTHLTLARLLQGFDLATPSNKPVDM  506

Query  1496  SEGLGIALPKLTPIQVLLTPRLPNLFPTMLNKN  1594
             +EGLG+ LPK +P++V+LTPRLP      L +N
Sbjct  507   TEGLGVTLPKASPLRVILTPRLPPTLYEQLTEN  539



>ref|XP_011030904.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=526

 Score =   465 bits (1196),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 250/508 (49%), Positives = 333/508 (66%), Gaps = 25/508 (5%)
 Frame = +2

Query  95    YNQIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHG-RLPVARTLGHMADKYGPV  271
             YN +I K    N   G  +    PE  GAWP IGHLHLL G    + RTLG MADK+G  
Sbjct  20    YNALIKK----NSCKGNQIK-EAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSA  74

Query  272   FGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRD  451
             F +RLGS  A VVSS EVVKECFT ND   ASRP+    K++GYN AVF  APY  +WR+
Sbjct  75    FTIRLGSRRAFVVSSWEVVKECFTINDKALASRPTTVAAKHMGYNYAVFGFAPYSAFWRE  134

Query  452   VRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNI  619
             +RK+ T+EL++  RL+ L+HVR SEV+  I +LY+    N      V L +W E +TLN+
Sbjct  135   MRKIATIELLSNRRLEMLKHVRASEVDIGIRELYNSWANNSSSPVVVELKQWLEDLTLNV  194

Query  620   TLRLLVGKRF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGL  775
              +R++ GKR+           A+  ++ +++   L G+F+ SD +P L W+D+ G+ + +
Sbjct  195   VVRMVAGKRYFGSAAASDDGEARRCQKAINQFFRLIGIFLVSDALPFLGWLDLQGHERAM  254

Query  776   KEVSKEMDEIIGTWLQEHIRNRKEd---dddqsdfmdVMLSSLPEDAVISGHKRDtiika  946
             K  +KE+D I+  WL EH + R      D+D+ DF+DVMLS L E+  +S  + D     
Sbjct  255   KNTAKELDAILEGWLDEHRQRRVSAGIKDEDEQDFIDVMLS-LKEEGQLSNFQYDANTSI  313

Query  947   ttlililt--GSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKY  1120
              +  L L   GS++TA TL W  SLLLNN H +K AQ+E+D+ VGK+R VE+SD+KNL Y
Sbjct  314   KSTCLALILGGSDTTAGTLTWAISLLLNNRHMLKKAQEELDLLVGKERQVEDSDVKNLVY  373

Query  1121  FQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEF  1300
              QAIIKE LRLYP GPL GPREAMEDCK+  YH+P GTRLI+N+ K+ RDPRVW+ P  F
Sbjct  374   LQAIIKETLRLYPAGPLLGPREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAF  433

Query  1301  KPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMG  1480
              PER F   H  +   G+ FE +PF  GRR CPG++F+LQV+ LTLARLL  F ++TPM 
Sbjct  434   LPER-FLTSHGDVDVRGQQFELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFQLATPMD  492

Query  1481  MPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
              PVD++E  G+ +PK TP++V+LTPRLP
Sbjct  493   QPVDLTESSGLTIPKATPLEVILTPRLP  520



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 246/487 (51%), Positives = 328/487 (67%), Gaps = 20/487 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHG-RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             + PE  GAWP IGHLHLL G    + RTLG MADK+GP F +RLGS  A VVSS EVVKE
Sbjct  31    KAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKE  90

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFT ND   ASRP  A  K++GY+ AVF  APY  +WR++RK+ TLEL++  RL+ L+HV
Sbjct  91    CFTINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHV  150

Query  515   RTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF--------SRI  658
             R SEV+  + DLY +  +N      V L +W E +TLN+ +R++ GKR+           
Sbjct  151   RISEVDMGLRDLYGLWAKNDSRPVLVELKKWLEDMTLNMVVRMVAGKRYFGASATCDDSE  210

Query  659   AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
             A+  ++ +++  +L G+F  SD +P   W+D  G+   +K+ +KE+D I+  WL+EH + 
Sbjct  211   ARQCQKAINQFFHLIGIFTVSDALPFFWWLDWQGHEMAMKKTAKELDAILEGWLEEHRQR  270

Query  839   RKE---ddddqsdfmdVMLSSLPEDAVISG--HKRDtiikattlililtGSESTAETLIW  1003
             R     + + + DF+DVMLS L E+  +S   H  D  IK+T L LIL GS++T+ TL W
Sbjct  271   RVSGGIESESEQDFIDVMLS-LQEEGHLSQFQHSADISIKSTCLALILGGSDTTSGTLTW  329

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               SLLLNNP+ +K AQ+E+D  +G DR V++SDIKNL Y QAIIKE LRLYP GPL GPR
Sbjct  330   AISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPR  389

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EAMEDC +  YHIP GTRLI+N+ K+ RDPRVW  P  F+PER F   H  + + G+ FE
Sbjct  390   EAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPER-FLTSHTDVDFRGQQFE  448

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
              +PF  GRR CPG +F+LQV+ LTLARLL  F ++TP   PVDM+E  G+ +PK TP++V
Sbjct  449   LIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLEV  508

Query  1544  LLTPRLP  1564
             +L+PRLP
Sbjct  509   VLSPRLP  515



>ref|XP_009364162.1| PREDICTED: cytochrome P450 82C4-like [Pyrus x bretschneideri]
Length=529

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 247/492 (50%), Positives = 332/492 (67%), Gaps = 25/492 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHG-RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PE  G WP IGHLHLL G    + RTLG MADKYGP F +RLGS  A VVSS EV K+C
Sbjct  36    APEPAGGWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAKDC  95

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP+    K++GYN AVF  APY  +WR++RK+ TLEL++  RL  L+HVR
Sbjct  96    FTVNDRALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLDMLKHVR  155

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF---------SR  655
             TSE++  I +LY++  +NG      V L+ W E +TLN+ +R++ GKR+           
Sbjct  156   TSELDMGIKELYNLGVQNGGLRPAVVELNHWLEELTLNVVVRMVAGKRYFGASAKCEDGD  215

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A+  ++ + +  +L G+FV +D +P L W+D+ G+ K +K+ +KE+D I+G WL+EH +
Sbjct  216   EARRCQKAIGQFFHLIGIFVVADALPFLWWLDLQGHEKAMKKTAKELDGILGGWLEEHRQ  275

Query  836   NR------KEddddqsdfmdVMLSSLPEDAVISG--HKRDtiikattlililtGSESTAE  991
              R       ED+    DF+DVMLS L E+  +S   +  DT IK+T L LIL GS++TA 
Sbjct  276   RRGASHGKAEDEGGDEDFIDVMLS-LEEEGQLSNFQYSSDTSIKSTCLALILGGSDTTAG  334

Query  992   TLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPL  1171
             TL W  SLL+NNPHA+K AQ+E+D+HVG +R VEESDI NL Y QAIIKE LRLYP GPL
Sbjct  335   TLTWAISLLINNPHAMKKAQEELDLHVGTERQVEESDITNLVYLQAIIKETLRLYPAGPL  394

Query  1172  SGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVG  1351
              GPREA+EDC +  Y +P GTRL++N+ K+ RDPRVW  P  F PER F + H+ +   G
Sbjct  395   LGPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWESPSAFVPER-FLESHSHVDVRG  453

Query  1352  KSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLT  1531
             + F  +PF  GRR CPG++F++QV+ LTLARLL GF I T  G  +D++E  G+ +PK T
Sbjct  454   QQFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQAIDLTESPGLTIPKAT  513

Query  1532  PIQVLLTPRLPN  1567
             P++ LL+PRLP+
Sbjct  514   PLEALLSPRLPS  525



>gb|AJD25203.1| cytochrome P450 CYP82V2 [Salvia miltiorrhiza]
Length=534

 Score =   464 bits (1194),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 249/497 (50%), Positives = 331/497 (67%), Gaps = 25/497 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWP IGHLHLL G++P++R LG MADK GPVF LRLG H  +VVSS E VK+CF
Sbjct  43    APEPSGAWPIIGHLHLLGGKIPISRILGAMADKLGPVFTLRLGVHRTVVVSSREAVKDCF  102

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND V A RPS   G YLGYN A F  + +G YWR+VRK+V  E++T  RL  LR VR 
Sbjct  103   TTNDRVLAKRPSSTAGIYLGYNHAGFGFS-HGPYWREVRKLVLAEVLTPRRLDSLRPVRE  161

Query  521   SEVEHCIGDLYSMCH-----ENGEVNLSEWFEHVTLNITLRLLVGKRFSRI---------  658
             +E+   +G+L+ +       +  EV +SEW E +TL+  + +L GKR +           
Sbjct  162   AELAASLGELHELVRGSDDDQEREVAISEWLERLTLDTIMMMLAGKRCAERDGGDAAAEE  221

Query  659   -AKHLKEVVSRALYLGGVFVPSDVIP--SLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
              AK L+ ++ + +Y+ G FV SD IP   L W+D+ G+IK +K ++ E+ EI   W+ EH
Sbjct  222   EAKSLRHIIKQFMYISGQFVVSDSIPFPPLRWLDLQGHIKSMKRIADELSEICEGWIGEH  281

Query  830   IRNRK---EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLI  1000
             +  R+        + DF+DVMLS++ +  +  GH R+TIIKAT L LIL GS++T+  + 
Sbjct  282   VERRRIDDGGLGIERDFIDVMLSAIDDKFMRFGHTRETIIKATLLNLILAGSDTTSTHMT  341

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  SLLLNN  A++  Q E+D  VGKDR V+ESDIKNL Y QA++KE LRL+PPGPL+ P
Sbjct  342   WILSLLLNNTRAMQQTQAEIDDKVGKDRWVQESDIKNLVYLQAVVKEALRLFPPGPLAVP  401

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
              EAMEDC++  YH+ +GTR+++N+ KLHRDPRVW EP+EF PER F   HA + + G   
Sbjct  402   HEAMEDCRVAGYHVARGTRILVNVWKLHRDPRVWEEPDEFVPER-FLTRHADVDFTGHHH  460

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E++PF  GRR CPG+ F+ QV  LT+ARL+QGF   TP+  PVDM+EGLGI LPK T ++
Sbjct  461   EFIPFGSGRRSCPGITFATQVTHLTMARLIQGFEFRTPLDEPVDMTEGLGITLPKATLLR  520

Query  1541  VLLTPRLPNLFPTMLNK  1591
             VL+ PRL    P M  K
Sbjct  521   VLVAPRLA---PFMYQK  534



>gb|KDO84376.1| hypothetical protein CISIN_1g036812mg [Citrus sinensis]
Length=499

 Score =   462 bits (1190),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 245/487 (50%), Positives = 328/487 (67%), Gaps = 20/487 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHG-RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             + PE  GAWP IGHLHLL G    + RTLG MADK+GP F +RLGS  A VVSS EVVKE
Sbjct  9     KAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKE  68

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFT ND   ASRP  A  K++GY+ AVF  APY  +WR++RK+ TLEL++  RL+ L+HV
Sbjct  69    CFTINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHV  128

Query  515   RTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF--------SRI  658
             R SEV+  + DL+ +  +N      V L +W E +TLN+ +R++ GKR+           
Sbjct  129   RISEVDMGLRDLHGLWAKNNSRPVLVELKKWLEDMTLNMVVRMVAGKRYFGASATCDDSE  188

Query  659   AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
             A+  ++ +++  +L G+F  SD +P   W+D  G+   +K+ +KE+D I+  WL+EH + 
Sbjct  189   ARQCQKAINQFFHLIGIFTVSDALPFFWWLDWQGHEMAMKKTAKELDAILEGWLEEHRQR  248

Query  839   RKE---ddddqsdfmdVMLSSLPEDAVISG--HKRDtiikattlililtGSESTAETLIW  1003
             R     + + + DF+DVMLS L E+  +S   H  D  IK+T L LIL GS++T+ TL W
Sbjct  249   RVSGGIESESEQDFIDVMLS-LQEEGHLSQFQHSADISIKSTCLALILGGSDTTSGTLTW  307

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               SLLLNNP+ +K AQ+E+D  +G DR V++SDIKNL Y QAIIKE LRLYP GPL GPR
Sbjct  308   AISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPR  367

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EAMEDC +  YHIP GTRLI+N+ K+ RDPRVW  P  F+PER F   H  + + G+ FE
Sbjct  368   EAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPER-FLTSHTDVDFRGQQFE  426

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
              +PF  GRR CPG +F+LQV+ LTLARLL  F ++TP   PVDM+E  G+ +PK TP++V
Sbjct  427   LIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLEV  486

Query  1544  LLTPRLP  1564
             +L+PRLP
Sbjct  487   VLSPRLP  493



>ref|XP_002300088.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
 gb|EEE84893.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
Length=527

 Score =   463 bits (1192),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 246/496 (50%), Positives = 337/496 (68%), Gaps = 30/496 (6%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             L+ PE  GA P IGHLHLL  +  +ARTL  MADKYGP+F +RLG HP +VVS+ E +KE
Sbjct  36    LQPPEPSGALPLIGHLHLLGAQKTLARTLAAMADKYGPIFTIRLGKHPTVVVSNLEAIKE  95

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTT+D + +SRP  + G++L YN A F     G +WR++RK+VT++L++  RLK LRHV
Sbjct  96    CFTTHDRILSSRPRSSHGEHLSYNYAAFGFNNSGPFWREMRKIVTIQLLSSHRLKSLRHV  155

Query  515   RTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF-----------  649
             + SEV   I DLY +   N +    +++SE FE +T+N+  R++ GKR+           
Sbjct  156   QVSEVNTLINDLYLLSKSNKQGSTKIDISECFERMTINMITRMIAGKRYFSSTEAEKEDE  215

Query  650   -SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWM-DIGGYIKGLKEVSKEMDEIIGTWLQ  823
               RI K +KE     +Y+ GVFVPSDVIP L WM +  G +K +K +S+E+D ++ +W+Q
Sbjct  216   GKRIGKLMKEF----MYISGVFVPSDVIPFLGWMNNFLGSVKTMKRLSRELDSLMESWIQ  271

Query  824   EHIRNRKEddddqsdfm-----dVMLSSLPEDAVISGHKRDtiikattlililtGSESTA  988
             EH   R E  ++ +        DVMLS L  D  + G+ R+TIIKAT + LI+ G+++T+
Sbjct  272   EHKLKRLESTENTNKMEDDDFIDVMLSLL--DDSMFGYSRETIIKATAMTLIIAGADTTS  329

Query  989   ETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGP  1168
              TL W  S LLNN  ++++AQ+E+D+ VG++R  E+SDI NL Y QAIIKE LRLYPPGP
Sbjct  330   ITLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGP  389

Query  1169  LSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYV  1348
             LS P EA +D  +  YHIPKGTRL  NL KLHRDP +WS P+E+ PER+  D HA++  +
Sbjct  390   LSVPHEATKDFCVAGYHIPKGTRLFANLWKLHRDPNLWSNPDEYMPERFLTD-HANVDVL  448

Query  1349  GKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKL  1528
             G  FE +PF  GRR CPG+ F+LQV+ LT ARLLQGF++ TP G  VDM+EG+ I LPK 
Sbjct  449   GHHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPTGESVDMTEGVAITLPKA  508

Query  1529  TPIQVLLTPRL-PNLF  1573
             TP+++ +TPRL P L+
Sbjct  509   TPLEIQITPRLSPELY  524



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   463 bits (1192),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 250/508 (49%), Positives = 334/508 (66%), Gaps = 24/508 (5%)
 Frame = +2

Query  95    YNQIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHG-RLPVARTLGHMADKYGPV  271
             YN  +   K  N    K    + PE  GAWP IGHLHLL G    + RTLG MADK+GP 
Sbjct  21    YNASLRGRKSSNVRKTK----KAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPA  76

Query  272   FGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRD  451
             F +RLGS  A VVSS EVVKECFT ND   ASRP  A  K++GY+ AVF  APY  +WR+
Sbjct  77    FNIRLGSRSAFVVSSWEVVKECFTINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWRE  136

Query  452   VRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNI  619
             +RK+ TLEL++  RL+ L+HVR SEVE  + +L+ +  +N      V L +W E +TLN+
Sbjct  137   MRKIATLELLSNRRLEALKHVRISEVEMGLRELHGLWAKNNSRPVLVELKKWLEDMTLNM  196

Query  620   TLRLLVGKRF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGL  775
              +R++ GKR+           A+  ++ +++  +L G+F  SD +P   W+D  G+   +
Sbjct  197   VVRMVAGKRYFGASATCDDSEARQCQKAINQFFHLIGIFTVSDALPFFWWLDWQGHEMAM  256

Query  776   KEVSKEMDEIIGTWLQEHIRNRKE---ddddqsdfmdVMLSSLPEDAVISG--HKRDtii  940
             K+ +KE+D I+  WL+EH + R     + + + DF+DVMLS L E+  +S   H  D  I
Sbjct  257   KKTAKELDAILEGWLEEHRQRRVSGGIESESEQDFIDVMLS-LQEEGHLSQFQHSADISI  315

Query  941   kattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKY  1120
             K+T L LIL GS++T+ TL W  SLLLNNP+ +K AQ+E+D  +G DR V++SDIKNL Y
Sbjct  316   KSTCLALILGGSDTTSGTLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVY  375

Query  1121  FQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEF  1300
              QAIIKE LRLYP GPL GPREAMEDC +  YHIP GTRLI+N+ K+ RDPRVW  P  F
Sbjct  376   LQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAF  435

Query  1301  KPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMG  1480
             +PER F   H  + + G+ FE +PF  GRR CPG +F+LQV+ LTLARLL  F ++TP  
Sbjct  436   QPER-FLTSHTDVDFRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSD  494

Query  1481  MPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
              PVDM+E  G+ +PK TP++V+L+PRLP
Sbjct  495   QPVDMTESPGLTIPKATPLEVVLSPRLP  522



>ref|XP_011045174.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=531

 Score =   463 bits (1191),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 245/495 (49%), Positives = 338/495 (68%), Gaps = 29/495 (6%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             L+ PE  GA P IGHLHLL  +  +ARTL  +ADKYGP+F +RLG HP +VVS+ E +KE
Sbjct  40    LQAPEPSGALPLIGHLHLLGAQKTLARTLAAIADKYGPIFTIRLGKHPTVVVSNLEAIKE  99

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTT+D + +SRP  + G+YL YN A F     G +WR++RK+VT++L++  RLK LRHV
Sbjct  100   CFTTHDRILSSRPRSSHGEYLSYNYAAFGFTNSGPFWREMRKIVTIQLLSSHRLKSLRHV  159

Query  515   RTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF-----------  649
             + SEV   I DLY +   N +    + +SE FE +T+N+  R++ GKR+           
Sbjct  160   QVSEVNTLINDLYLLSKSNKQGSTKIVISECFERMTINMITRMIAGKRYFSSTEAEKEEG  219

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWM-DIGGYIKGLKEVSKEMDEIIGTWLQE  826
              RI K +KE     +Y+ GVFVPSD+IP L W+ +  G +K +K +S+E+D ++ +W+QE
Sbjct  220   KRIGKLMKEF----MYISGVFVPSDLIPFLGWINNFLGSVKTMKRLSRELDSLMESWIQE  275

Query  827   HIRNRKEddddqsdf-----mdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAE  991
             H   R E  ++ +       +DVMLS L  D  +SG+ R+TIIKAT + LI+ G+++T+ 
Sbjct  276   HKLKRLESTENTNKMDDDDFIDVMLSLL--DDSMSGYSRETIIKATAMTLIIAGADTTSI  333

Query  992   TLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPL  1171
             TL W  S LLNN  ++++AQ+E+D+ VG++R  E+SDI NL Y QAIIKE LRLYPPGPL
Sbjct  334   TLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPL  393

Query  1172  SGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVG  1351
             S P EA ED  +  YH+PKGTRL  NL KLHRDP +WS P+E+ PER+  D HA++  +G
Sbjct  394   SVPHEATEDFCVAGYHMPKGTRLFTNLWKLHRDPNLWSNPDEYMPERFLND-HANLDVLG  452

Query  1352  KSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLT  1531
               FE +PF  GRR CPG+ F+LQV+ LT ARLLQGF++ TP G  VDM+EG+ I LPK T
Sbjct  453   HHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPRGESVDMTEGVAITLPKAT  512

Query  1532  PIQVLLTPRL-PNLF  1573
             P+++ +TPRL P L+
Sbjct  513   PLEIHITPRLSPELY  527



>ref|XP_010036784.1| PREDICTED: cytochrome P450 82G1-like isoform X3 [Eucalyptus grandis]
Length=517

 Score =   462 bits (1188),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 252/494 (51%), Positives = 322/494 (65%), Gaps = 17/494 (3%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHP  298
             K DNKN       R PE PGAWP +GHLHLL G  P  + LG MAD  GPVF LRLG H 
Sbjct  22    KSDNKNATGS---RTPELPGAWPLVGHLHLLSGARPAFQKLGAMADALGPVFSLRLGIHR  78

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
              +V+SS E  KEC  T+D   ASRP +A  +Y+GYN A+  LAPYG Y R VRK   L L
Sbjct  79    VVVLSSWEAAKECLATSDHALASRPDIAASRYMGYNRALLGLAPYGPYLRLVRKTANLVL  138

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFS--  652
              +  RLK LR V  SEV+    +L+     +G V +SE  EH+T N+ LR++ G R+   
Sbjct  139   FSSQRLKALRPVWNSEVDSLTKELWHRPPGSG-VAISEKLEHMTFNMNLRMISGNRYEDE  197

Query  653   ------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGT  814
                     A   K  +++AL L G FV SD IP L W+D  G ++ +KE  +E+D ++  
Sbjct  198   EFEEVGSDAWRFKTAMNKALGLFGAFVLSDAIPWLGWLDFQGQVRSMKETGRELDYVLEK  257

Query  815   WLQEHIRNRKEddddq----sdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSES  982
             WL++H+  R           +D MD +L SLPED V+ GH+R  IIKAT  ILILTG+ES
Sbjct  258   WLRQHLEKRSNKGFRVDDGDADVMDHLLESLPEDDVVFGHERKNIIKATAWILILTGTES  317

Query  983   TAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPP  1162
             T+ T+ W  SLLLN+P A+K AQ E+D  VG+D+ V+ESDI NLKY QAI+KE LRLYP 
Sbjct  318   TSITITWALSLLLNHPAALKSAQQELDAIVGQDKWVQESDISNLKYLQAIVKETLRLYPA  377

Query  1163  GPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIG  1342
              PL+G REAMEDC I  YH+PKGTR+++N+ KL RDPRVW++P+EF+PER F +E   + 
Sbjct  378   APLTGIREAMEDCHISGYHVPKGTRVLVNIWKLQRDPRVWAKPDEFRPER-FLEEQEEVD  436

Query  1343  YVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALP  1522
                ++F ++PFS GRR CPG    LQVVQ TLAR+LQGF ++   G  VDM EG GIALP
Sbjct  437   LRDQNFVFIPFSSGRRSCPGSTLGLQVVQFTLARILQGFQVTPEEGATVDMEEGSGIALP  496

Query  1523  KLTPIQVLLTPRLP  1564
             K+ P++V L PRLP
Sbjct  497   KVKPLRVALEPRLP  510



>ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera]
Length=525

 Score =   462 bits (1189),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 240/484 (50%), Positives = 324/484 (67%), Gaps = 16/484 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTL-GHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PEA GAWP IGHLHLL G   +   L G MADKYGPVF +RLG   A+VVSS E+ KEC
Sbjct  38    APEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKEC  97

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTT+DL  ASRP +   KYLGYN A+F L+P+G YWR+VRK+ TLEL++  RL+ L++VR
Sbjct  98    FTTHDLALASRPELVAAKYLGYNYAMFGLSPHGAYWREVRKIATLELLSNRRLELLKNVR  157

Query  518   TSEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF--------SR  655
              SEVE C+ +LY +  +         V++ +WF H++LN+ L+++VGKR+         +
Sbjct  158   ISEVETCMKELYELWAKKKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEK  217

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A+  ++ +     L G+FV SD IP L W+D+GG++K +K+ +KE+D I   WL+EH R
Sbjct  218   EAQQFQKAIREFFRLMGLFVVSDAIPFLGWLDVGGHVKAMKKTAKELDGITQEWLEEHRR  277

Query  836   NRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
              +   + D       ++ S+      + +  DTI KAT+L++I  G+++T+ TL W  SL
Sbjct  278   RKDSGEADGDQDFMDVMLSILGGRDTTDYDADTINKATSLVMIGGGADTTSGTLTWAVSL  337

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             LLNNPH ++ AQ+E+D HVGK+RLV E DI  L Y QAI+KE LRL P  PLSGPR+ ++
Sbjct  338   LLNNPHILRKAQEELDAHVGKERLVNEMDISKLVYLQAIVKETLRLNPIAPLSGPRQFIQ  397

Query  1196  DCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPF  1375
             D  +G YHI KGTRLILNL K+ RDPRVW  P EF+P+R F   H  +   GK FE  PF
Sbjct  398   DSILGGYHISKGTRLILNLTKIQRDPRVWLNPMEFQPDR-FLTTHKDVDVRGKHFELTPF  456

Query  1376  SGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTP  1555
              GGRR+CPG+ F+LQV+ LTLA  L  F +STP   PVDMSEG G+   K TP++VL++P
Sbjct  457   GGGRRICPGIVFALQVLHLTLANFLHRFQLSTPSDAPVDMSEGFGLTNIKSTPLEVLISP  516

Query  1556  RLPN  1567
             RL +
Sbjct  517   RLAS  520



>ref|XP_010036782.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Eucalyptus grandis]
 gb|KCW48424.1| hypothetical protein EUGRSUZ_K02128 [Eucalyptus grandis]
Length=529

 Score =   462 bits (1188),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 252/494 (51%), Positives = 322/494 (65%), Gaps = 17/494 (3%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHP  298
             K DNKN       R PE PGAWP +GHLHLL G  P  + LG MAD  GPVF LRLG H 
Sbjct  34    KSDNKNATGS---RTPELPGAWPLVGHLHLLSGARPAFQKLGAMADALGPVFSLRLGIHR  90

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
              +V+SS E  KEC  T+D   ASRP +A  +Y+GYN A+  LAPYG Y R VRK   L L
Sbjct  91    VVVLSSWEAAKECLATSDHALASRPDIAASRYMGYNRALLGLAPYGPYLRLVRKTANLVL  150

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFS--  652
              +  RLK LR V  SEV+    +L+     +G V +SE  EH+T N+ LR++ G R+   
Sbjct  151   FSSQRLKALRPVWNSEVDSLTKELWHRPPGSG-VAISEKLEHMTFNMNLRMISGNRYEDE  209

Query  653   ------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGT  814
                     A   K  +++AL L G FV SD IP L W+D  G ++ +KE  +E+D ++  
Sbjct  210   EFEEVGSDAWRFKTAMNKALGLFGAFVLSDAIPWLGWLDFQGQVRSMKETGRELDYVLEK  269

Query  815   WLQEHIRNRKEddddq----sdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSES  982
             WL++H+  R           +D MD +L SLPED V+ GH+R  IIKAT  ILILTG+ES
Sbjct  270   WLRQHLEKRSNKGFRVDDGDADVMDHLLESLPEDDVVFGHERKNIIKATAWILILTGTES  329

Query  983   TAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPP  1162
             T+ T+ W  SLLLN+P A+K AQ E+D  VG+D+ V+ESDI NLKY QAI+KE LRLYP 
Sbjct  330   TSITITWALSLLLNHPAALKSAQQELDAIVGQDKWVQESDISNLKYLQAIVKETLRLYPA  389

Query  1163  GPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIG  1342
              PL+G REAMEDC I  YH+PKGTR+++N+ KL RDPRVW++P+EF+PER F +E   + 
Sbjct  390   APLTGIREAMEDCHISGYHVPKGTRVLVNIWKLQRDPRVWAKPDEFRPER-FLEEQEEVD  448

Query  1343  YVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALP  1522
                ++F ++PFS GRR CPG    LQVVQ TLAR+LQGF ++   G  VDM EG GIALP
Sbjct  449   LRDQNFVFIPFSSGRRSCPGSTLGLQVVQFTLARILQGFQVTPEEGATVDMEEGSGIALP  508

Query  1523  KLTPIQVLLTPRLP  1564
             K+ P++V L PRLP
Sbjct  509   KVKPLRVALEPRLP  522



>ref|XP_010036783.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Eucalyptus grandis]
Length=528

 Score =   461 bits (1187),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 252/494 (51%), Positives = 322/494 (65%), Gaps = 17/494 (3%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHP  298
             K DNKN       R PE PGAWP +GHLHLL G  P  + LG MAD  GPVF LRLG H 
Sbjct  33    KSDNKNATGS---RTPELPGAWPLVGHLHLLSGARPAFQKLGAMADALGPVFSLRLGIHR  89

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
              +V+SS E  KEC  T+D   ASRP +A  +Y+GYN A+  LAPYG Y R VRK   L L
Sbjct  90    VVVLSSWEAAKECLATSDHALASRPDIAASRYMGYNRALLGLAPYGPYLRLVRKTANLVL  149

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFS--  652
              +  RLK LR V  SEV+    +L+     +G V +SE  EH+T N+ LR++ G R+   
Sbjct  150   FSSQRLKALRPVWNSEVDSLTKELWHRPPGSG-VAISEKLEHMTFNMNLRMISGNRYEDE  208

Query  653   ------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGT  814
                     A   K  +++AL L G FV SD IP L W+D  G ++ +KE  +E+D ++  
Sbjct  209   EFEEVGSDAWRFKTAMNKALGLFGAFVLSDAIPWLGWLDFQGQVRSMKETGRELDYVLEK  268

Query  815   WLQEHIRNRKEddddq----sdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSES  982
             WL++H+  R           +D MD +L SLPED V+ GH+R  IIKAT  ILILTG+ES
Sbjct  269   WLRQHLEKRSNKGFRVDDGDADVMDHLLESLPEDDVVFGHERKNIIKATAWILILTGTES  328

Query  983   TAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPP  1162
             T+ T+ W  SLLLN+P A+K AQ E+D  VG+D+ V+ESDI NLKY QAI+KE LRLYP 
Sbjct  329   TSITITWALSLLLNHPAALKSAQQELDAIVGQDKWVQESDISNLKYLQAIVKETLRLYPA  388

Query  1163  GPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIG  1342
              PL+G REAMEDC I  YH+PKGTR+++N+ KL RDPRVW++P+EF+PER F +E   + 
Sbjct  389   APLTGIREAMEDCHISGYHVPKGTRVLVNIWKLQRDPRVWAKPDEFRPER-FLEEQEEVD  447

Query  1343  YVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALP  1522
                ++F ++PFS GRR CPG    LQVVQ TLAR+LQGF ++   G  VDM EG GIALP
Sbjct  448   LRDQNFVFIPFSSGRRSCPGSTLGLQVVQFTLARILQGFQVTPEEGATVDMEEGSGIALP  507

Query  1523  KLTPIQVLLTPRLP  1564
             K+ P++V L PRLP
Sbjct  508   KVKPLRVALEPRLP  521



>ref|XP_010069626.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=542

 Score =   462 bits (1189),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 249/519 (48%), Positives = 340/519 (66%), Gaps = 34/519 (7%)
 Frame = +2

Query  128   NKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIV  307
             NK  G  LP   PE PGAWP IGH+HLL G  P+ARTL  MADK GP+F +RLG HPA +
Sbjct  28    NKPKGTALP---PELPGAWPIIGHIHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATI  84

Query  308   VSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTV  487
             +SS E V+ECFTT+D   ASRP    G +LGY  A F    YG +WR++RK+  LEL++ 
Sbjct  85    ISSREAVRECFTTHDKDLASRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITMLELLST  144

Query  488   SRLKKLRHVRTSEVEHCIGDLYSMCH------ENGE---VNLSEWFEHVTLNITLRLLVG  640
              RL  L+HV+ SE++  + DL+++C       +NG    V +S+  E +TLNI +R++  
Sbjct  145   RRLDNLKHVQASEIDTFVKDLHALCRTNSIDAQNGSSKVVVISQLLELLTLNIIIRMIAS  204

Query  641   KRFSRI--------------AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLK  778
             KR+  +              A HL+ V+   +Y+ G    SD++P   W D  G +K +K
Sbjct  205   KRYFGLSSASTGSSADDDEEASHLRRVIKEFMYISGFPAVSDLVPFTGWTDCVGTVKTMK  264

Query  779   EVSKEMDEIIGTWLQEHIRNRKEdd------ddqsdfmdVMLSSLPEDAVIS-GHKRDti  937
              V++E+DEI+G W++EH   R+ D       D + DF+DVMLS + ED +   GH  +T+
Sbjct  265   RVARELDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETL  324

Query  938   ikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLK  1117
             IKAT + +I+ GS+ST+  L W  SLLLN+ H +K AQ+E+D+ VGKDR V++SDI+NL 
Sbjct  325   IKATIVNIIVAGSDSTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRWVQDSDIENLL  384

Query  1118  YFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEE  1297
             Y QAI+KE LRLYPPGPL  P EA  DC +  Y IPKGTR+ +N  KLHRDP+VWSEPE+
Sbjct  385   YLQAIVKETLRLYPPGPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHRDPQVWSEPEK  444

Query  1298  FKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPM  1477
             F PER F   H+ +   G+ FE++PF  GRR+CPG  F+L+   LTLARLLQGF+++T +
Sbjct  445   FLPER-FLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLATSL  503

Query  1478  GMPVDMSEGLGIALPKLTPIQVLLTPRLPNLFPTMLNKN  1594
                VDM+EGLG+ LPK TP++V+L PRLP++    L  N
Sbjct  504   DELVDMTEGLGVNLPKATPLRVVLNPRLPSVLYEKLTAN  542



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   461 bits (1186),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 246/503 (49%), Positives = 330/503 (66%), Gaps = 27/503 (5%)
 Frame = +2

Query  113   KYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLG  289
             K  +  +NN K  P+ V    GAWP IGHLHLL G   +  RTLG MAD+YGP F + LG
Sbjct  28    KRNKGGRNNSKEAPVPV----GAWPLIGHLHLLGGDDQLLYRTLGTMADQYGPAFNIWLG  83

Query  290   SHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVT  469
             +  A VVSS EV KECFTTND   ASRP+    K++GYN AVF  APY  +WR++RK+ T
Sbjct  84    TRRAFVVSSWEVAKECFTTNDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIAT  143

Query  470   LELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLV  637
             LEL++  RL+ L+HVR SE+   I +LY+   +N      V L+ W E +TLN+ +R++ 
Sbjct  144   LELLSNRRLEMLKHVRVSELNTGIKELYNSWVQNRSQPVVVELNRWLEDLTLNMVVRMVA  203

Query  638   GKRF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKE  793
             GKR+           A+  ++ +++  +L G+FV SD +P L W D+ G+ + +K+ +KE
Sbjct  204   GKRYFGASATCDDDEARRCQKAINQFFHLIGIFVVSDALPFLRWFDLQGHERAMKKTAKE  263

Query  794   MDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGH------KRDtiikattl  955
             +D I+  WLQEH   R + +       D +   L  D   +GH        DT IK+T L
Sbjct  264   LDSILEGWLQEHRMQRVDGEVKVEGEQDFIDVML--DLQKTGHLSNFQYDSDTSIKSTCL  321

Query  956   ililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAII  1135
              +IL GS+++A TL W  SLLLNN  A+K AQ+E+D++VG +R VEESDI+NL Y QAII
Sbjct  322   AIILGGSDTSAGTLTWAISLLLNNRQALKKAQEELDLNVGMERQVEESDIRNLAYLQAII  381

Query  1136  KEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERW  1315
             KE LRLYP GPL GPREA EDC +G Y +P GTRL++NL K+HRDPRVW EP  F+PER+
Sbjct  382   KETLRLYPAGPLLGPREAQEDCNVGGYDVPAGTRLVVNLWKIHRDPRVWEEPSAFRPERF  441

Query  1316  FRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDM  1495
                +  ++   G++FE +PF  GRR CPGM+F+LQV+ LTLARLL  F  +TP   PVDM
Sbjct  442   LTSD--AVDVRGQNFELIPFGSGRRSCPGMSFALQVLHLTLARLLHAFEFATPSDEPVDM  499

Query  1496  SEGLGIALPKLTPIQVLLTPRLP  1564
             +E  G+ +PK TP++VLLTPRLP
Sbjct  500   TESPGLTIPKATPLEVLLTPRLP  522



>ref|XP_010527268.1| PREDICTED: cytochrome P450 82G1-like isoform X4 [Tarenaya hassleriana]
Length=523

 Score =   460 bits (1184),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 249/485 (51%), Positives = 327/485 (67%), Gaps = 17/485 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P IGHLHLL G+  V +    M+DK GP+F L++G++  +VVS  E V++CF
Sbjct  42    MPEPSGALPLIGHLHLLRGKDLVFKKFAAMSDKLGPIFSLKIGTYRLVVVSDSETVRDCF  101

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T +D V A+RP++++G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +  R++ L HVR 
Sbjct  102   TASDQVLANRPNISLGRYVGYNNAILALAPYGDYWRELRKITTIHLFSNHRIEMLGHVRL  161

Query  521   SEVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFS-----RIAKHLKEV  679
             SEV   I  LY+   E G   V +    E +T NI LR +VGKR       R     K+ 
Sbjct  162   SEVSAFIKHLYTTTMERGSSMVGMDTLLEFMTFNIILRTVVGKRIEYGEVEREEWRYKKA  221

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEd---  850
             + +  +L G+F+  D IP LEW+D    +  +K  +KE+D +I  WLQEH+  R  +   
Sbjct  222   IKQMEHLAGIFMVGDAIPLLEWLDFAN-VSSMKNTAKELDAVISKWLQEHLEERSGNGND  280

Query  851   ---dddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
                 D     MD+++  LPED V+SGH RDTI+KATTLIL LTGS+ST  TLIW  SLLL
Sbjct  281   EIGLDQDKTVMDLLIDVLPEDVVMSGHTRDTIVKATTLILTLTGSDSTFITLIWAVSLLL  340

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NNP  +K AQDEMD  VGK R VEESDI+NLK+ QAIIKE  RLYPP PL+G REA EDC
Sbjct  341   NNPSVLKTAQDEMDDIVGKGRWVEESDIRNLKFLQAIIKETHRLYPPAPLTGIREASEDC  400

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +G Y I KGTRL++NL KLHRDP++W EPE F+PER+  +E  + G+    +EY+PFS 
Sbjct  401   YVGGYRISKGTRLLINLWKLHRDPKIWQEPEVFRPERFMVEE--TKGWDKSGYEYIPFSS  458

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPGMN  L+VV L LARLLQGF +      P+DM+EG G+ALPK+ PI+V + PRL
Sbjct  459   GRRSCPGMNLGLRVVYLVLARLLQGFELRRVSDEPLDMAEGPGLALPKVEPIEVSVMPRL  518

Query  1562  -PNLF  1573
              P+L+
Sbjct  519   EPDLY  523



>ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
 gb|KHN04535.1| Cytochrome P450 82C4 [Glycine soja]
Length=526

 Score =   460 bits (1183),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 241/505 (48%), Positives = 329/505 (65%), Gaps = 20/505 (4%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGL  280
             + L + + N+   K      P   GAWP IGHLHLL G   +  RTLG MAD+YGP F +
Sbjct  18    VFLWHTKRNRGGSKNKSKEAPIPAGAWPLIGHLHLLGGDDQLLYRTLGTMADQYGPAFNI  77

Query  281   RLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRK  460
              LG+  A VVSS EV KECFT+ND   ASRP+    K++GYN AVF  APY  +WR++RK
Sbjct  78    WLGTRRAFVVSSWEVAKECFTSNDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRK  137

Query  461   MVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLR  628
             + TLEL++  RL+ L+HV  SE+   + DLY+   +N      V L+ W E +TLN+ +R
Sbjct  138   IATLELLSNRRLEMLKHVMVSELNMVMRDLYNSWVQNRSRPVLVELNRWLEDLTLNMVVR  197

Query  629   LLVGKRF---------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKE  781
             ++ GKR+            A+  ++ +++  +L G+FV SD +P L W D+ G+ + +K+
Sbjct  198   MVAGKRYFGASASCDNDDEARRCQKAINQFFHLIGIFVVSDALPFLRWFDVQGHERAMKK  257

Query  782   VSKEMDEIIGTWLQEHIRNR--KEddddqsdfmdVMLSSLPEDAVISG--HKRDtiikat  949
              +KE+D I+  WL+EH   R   E   +       ++ SL +   +S   +  DT IK+T
Sbjct  258   TAKELDAILEGWLKEHREQRVDGEIKAEGEQDFIDIMLSLQKGGHLSNFQYDSDTSIKST  317

Query  950   tlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQA  1129
              L LIL GS++TA T+ W  SLLLNN  A+K AQ+E+D++VG +R VEESDI+NL Y QA
Sbjct  318   CLALILGGSDTTAGTVTWAISLLLNNRQALKKAQEELDLNVGMERQVEESDIRNLAYVQA  377

Query  1130  IIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPE  1309
             IIKE LRLYP GPL GPREA EDC +  YH+P GTRL++NL K+HRDPRVW EP  F+PE
Sbjct  378   IIKETLRLYPAGPLLGPREAQEDCNVAGYHVPAGTRLVVNLWKIHRDPRVWQEPSAFRPE  437

Query  1310  RWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPV  1489
             R+   +  ++   G++FE +PF  GRR CPGM+F+LQV+ LTLARLL  F  +TP   PV
Sbjct  438   RFLTSD--AVDVRGQNFELIPFGSGRRSCPGMSFALQVLHLTLARLLHAFEFATPSDQPV  495

Query  1490  DMSEGLGIALPKLTPIQVLLTPRLP  1564
             DM+E  G+ +PK TP++VLLTPRLP
Sbjct  496   DMTESPGLTIPKATPLEVLLTPRLP  520



>ref|XP_007017413.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14638.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   459 bits (1180),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 237/479 (49%), Positives = 321/479 (67%), Gaps = 14/479 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA  +WP IGHLHLL G  P    LG MA+KYGP+F +++G + A+VV++ E  KEC 
Sbjct  43    APEAGSSWPVIGHLHLLGGPQPAHIVLGDMAEKYGPIFTIKMGVYRALVVNNWETAKECL  102

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND  FASRP     + L Y+ A+F  APYG YWR +RK+ TLEL++  RL +L+HVR 
Sbjct  103   TTNDKAFASRPKTLAMELLSYDHAMFGFAPYGPYWRQMRKVATLELLSSYRLDRLKHVRQ  162

Query  521   SEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRFSRI-----AKH  667
             SE++  + +LY    EN +      V +  WF  VTLN+ LR++VGKR          + 
Sbjct  163   SEIKTSLKELYQHWSENKDSSDKVLVEMKAWFRDVTLNVILRMIVGKRIPSSDSDAEGER  222

Query  668   LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKE  847
              K+ +     L G FV SD +P L+W+DIGG  + +K+V+KE+DE+   WLQ+H R +  
Sbjct  223   WKDALRDFFDLSGKFVISDALPFLKWLDIGGDERFMKKVTKELDEVAEGWLQDHKRMKAS  282

Query  848   ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
              + +       ++ S+  D  +  H  DTI KAT L +IL  S++T  TL W  SLLLNN
Sbjct  283   GNQESDQDFMDVMFSILSD--VGKHDADTINKATCLAMILAASDTTMVTLTWALSLLLNN  340

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
               A+K AQ+E+D+HVG+D+LVEESDIK L Y +AI+KE LRLYP GPLS P E+MEDC +
Sbjct  341   RGALKKAQEELDIHVGRDKLVEESDIKKLVYLRAILKETLRLYPAGPLSLPHESMEDCIV  400

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
               YHIP GTRL++N+ K+HRDPRVWS+P EF+PER F   +      G++FE +PF  GR
Sbjct  401   SGYHIPAGTRLLINVYKIHRDPRVWSDPCEFQPER-FLTTYKDFDVRGQNFELIPFGSGR  459

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             RMCPG++F+LQV++LTLA LLQGF + TP+  PVDMSE +G+   K +P++VL+TPRLP
Sbjct  460   RMCPGVSFALQVLELTLANLLQGFELGTPLDEPVDMSEAMGLTNLKASPLEVLITPRLP  518



>emb|CAN74205.1| hypothetical protein VITISV_031127 [Vitis vinifera]
Length=525

 Score =   459 bits (1180),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 238/484 (49%), Positives = 320/484 (66%), Gaps = 16/484 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTL-GHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PEA GAWP IGHLHLL G   +   L G MADKYGPVF +RLG   A+VVSS E+ KEC
Sbjct  38    APEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGXKRAVVVSSWEMAKEC  97

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTT+DL  ASRP +   KYLGYN A+FA +P+G YWR+VRK+ TLEL++  RL+ L++VR
Sbjct  98    FTTHDLALASRPEVVAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVR  157

Query  518   TSEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF--------SR  655
              SEVE C+ +LY +  E         V++ +WF H++LN+ L+++VGKR+         +
Sbjct  158   ISEVETCMKELYKLWAEKKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEK  217

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A+  ++ +     L G+FV SD +P L W+D+GG++K +K+ +KE+D I   WL+EH R
Sbjct  218   EAQQCQKAIREFFRLLGLFVVSDALPFLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRR  277

Query  836   NRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
              +   + D       ++ S+      +G+  D I KAT+LILI  G+++T+ TL W  SL
Sbjct  278   RKDSGEADGDQDFMDVMLSILGATDPNGYDADXINKATSLILIAGGTDTTSXTLTWAISL  337

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             LLNNPH ++ AQ+E+D HVGK+RLV E DI  L Y QAI+KE LRLYP  PLSG R+ ++
Sbjct  338   LLNNPHVLRKAQEELDTHVGKERLVNEMDISKLVYLQAIVKETLRLYPAAPLSGQRQFIQ  397

Query  1196  DCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPF  1375
             D  +G YHIPKGTRL+LNL K+ RDPRVW  P  F+P R F   +  +   GK F   PF
Sbjct  398   DSVLGGYHIPKGTRLLLNLTKIQRDPRVWLNPTXFQPSR-FLTTYKDVDVKGKHFVLTPF  456

Query  1376  SGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTP  1555
              GGRR+CPG  F+LQV+ LTLA  L  F +STP   P+DMSE  GI   K TP++VL++P
Sbjct  457   GGGRRICPGAAFALQVLPLTLANFLHKFQLSTPSNSPIDMSESFGITNIKSTPLEVLISP  516

Query  1556  RLPN  1567
             RL +
Sbjct  517   RLAS  520



>ref|XP_010527267.1| PREDICTED: cytochrome P450 82G1-like isoform X3 [Tarenaya hassleriana]
Length=526

 Score =   459 bits (1180),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 248/488 (51%), Positives = 328/488 (67%), Gaps = 17/488 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P IGHLHLL G+  V +    M+DK GP+F L++G++  +VVS  E V++CF
Sbjct  42    MPEPSGALPLIGHLHLLRGKDLVFKKFAAMSDKLGPIFSLKIGTYRLVVVSDSETVRDCF  101

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T +D V A+RP++++G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +  R++ L HVR 
Sbjct  102   TASDQVLANRPNISLGRYVGYNNAILALAPYGDYWRELRKITTIHLFSNHRIEMLGHVRL  161

Query  521   SEVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFS-----RIAKHLKEV  679
             SEV   I  LY+   E G   V +    E +T NI LR +VGKR       R     K+ 
Sbjct  162   SEVSAFIKHLYTTTMERGSSMVGMDTLLEFMTFNIILRTVVGKRIEYGEVEREEWRYKKA  221

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEd---  850
             + +  +L G+F+  D IP LEW+D    +  +K  +KE+D +I  WLQEH+  R  +   
Sbjct  222   IKQMEHLAGIFMVGDAIPLLEWLDFAN-VSSMKNTAKELDAVISKWLQEHLEERSGNGND  280

Query  851   ---dddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
                 D     MD+++  LPED V+SGH RDTI+KATTLIL LTGS+ST  TLIW  SLLL
Sbjct  281   EIGLDQDKTVMDLLIDVLPEDVVMSGHTRDTIVKATTLILTLTGSDSTFITLIWAVSLLL  340

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NNP  +K AQDEMD  VGK R VEESDI+NLK+ QAIIKE  RLYPP PL+G REA EDC
Sbjct  341   NNPSVLKTAQDEMDDIVGKGRWVEESDIRNLKFLQAIIKETHRLYPPAPLTGIREASEDC  400

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +G Y I KGTRL++NL KLHRDP++W EPE F+PER+  +E  + G+    +EY+PFS 
Sbjct  401   YVGGYRITKGTRLLINLWKLHRDPKIWPEPEVFRPERFMVEE--TKGWDKSGYEYIPFSS  458

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPGMN  L+VV L LARLLQGF +      P+DM+EG G+ALPK+ P++V + PRL
Sbjct  459   GRRSCPGMNLGLRVVYLVLARLLQGFELRRVSDEPLDMAEGPGLALPKVEPVEVSVMPRL  518

Query  1562  -PNLFPTM  1582
              P+L+  +
Sbjct  519   EPDLYQVI  526



>ref|XP_004510285.1| PREDICTED: uncharacterized protein LOC101505071 [Cicer arietinum]
Length=1052

 Score =   475 bits (1222),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 254/495 (51%), Positives = 334/495 (67%), Gaps = 17/495 (3%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             ++PE  G+ PFIGHLHLL  ++P  RT   MA+KYG +F LRLG H  +VVSS E+ +EC
Sbjct  22    KIPEPCGSLPFIGHLHLLSTQVPYFRTFSTMAEKYGSIFSLRLGCHKTLVVSSREIAREC  81

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
              TTND VFASRP+++ G+YLGYN A+ ALAPYG YWRD+RK+ TLEL++  RL+KL HVR
Sbjct  82    LTTNDKVFASRPNISAGRYLGYNNAILALAPYGNYWRDMRKISTLELLSSHRLEKLMHVR  141

Query  518   TSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRF--------SRI  658
              SE+   + DLY+    N      EV +S++ +H+T NI +R++ GKRF           
Sbjct  142   DSEIFSLVKDLYTFLKNNNSNGLIEVPISKFLDHMTFNIIVRMIAGKRFRGETIYQEDSE  201

Query  659   AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR-  835
             A  L+  +    YL GVFV  D IP L W D  G++  +K   KEMD I+  W++EH   
Sbjct  202   AWRLRNAIKDTTYLSGVFVVGDAIPFLSWFDFQGHVGFMKRTFKEMDFILDKWMREHYTK  261

Query  836   -NRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
              N  +    ++DFMDV++S       I GHKR+ +IKATT+ILILT S STA TL W  S
Sbjct  262   INEGQHGKYENDFMDVLISMFDGYDEICGHKREIVIKATTMILILTASGSTAITLTWALS  321

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLNNP  +K AQ E+D ++GK + V+ES+IKNLKY QAIIKE LRLYPP PL+G RE++
Sbjct  322   LLLNNPRVLKQAQQELDNNIGKHKWVQESNIKNLKYLQAIIKETLRLYPPAPLTGLRESI  381

Query  1193  EDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLP  1372
             +DC +  YH+PKGTRL++N+ KL RDP +W  P EF+PER F   +  I      F ++P
Sbjct  382   DDCHVAGYHVPKGTRLLINIWKLQRDPHIWPNPNEFQPER-FLTSNGQIDSQHYDFGFVP  440

Query  1373  FSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLT  1552
             FS GRR C G  F LQV+ LTLARL+QGF+I T  G  VDMSEG+G+ALPK  P+ ++L 
Sbjct  441   FSYGRRSCVGSTFGLQVLHLTLARLIQGFDIYTKDGGVVDMSEGVGLALPKENPLSLMLQ  500

Query  1553  PRLP-NLFPTMLNKN  1594
             PRLP +L+  + N+N
Sbjct  501   PRLPLDLYEILNNRN  515


 Score =   455 bits (1171),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 239/502 (48%), Positives = 336/502 (67%), Gaps = 19/502 (4%)
 Frame = +2

Query  95    YNQIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVF  274
             YN   +K   +NK  GK    + P+   A PFIGHLHLL  + P+AR     ADKYGP+F
Sbjct  551   YNIWRIKKHSNNKLKGK----QPPQPSYALPFIGHLHLLGNQTPLARIFASFADKYGPIF  606

Query  275   GLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDV  454
              + LGS+PA+V+S+ E +KECFTTND + ASRP  + G YLGYN A F  APYG Y+  +
Sbjct  607   QIYLGSYPALVISNQESIKECFTTNDKILASRPKSSHGIYLGYNYAGFGFAPYGTYFTKL  666

Query  455   RKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVN----LSEWFEHVTLNIT  622
             RK+  LEL++  R++ LRH+  SE++  + DL+    +N +V     +S+W E +T NI 
Sbjct  667   RKLTMLELLSSRRIESLRHLYESEIDTLVNDLWLYVKDNNKVTKAVVISKWLEKLTFNII  726

Query  623   LRLLVGKRFSRIAKHLKEV--------VSRALYLGGVFVPSDVIPSLEWMDIGGYI-KGL  775
              +++ GKR+    + + +V        +   +++ G FVPSD+IP + W    G + K +
Sbjct  727   TKMISGKRYFEYLQDVDDVEAHGIVKLIKEFMHISGEFVPSDLIPIIGWFGFEGQVLKSM  786

Query  776   KEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattl  955
             K V +++D+++G W+ EH++   +  +++ DF+DVMLS + ED   SGH RDTIIKA  +
Sbjct  787   KRVGRDLDKVVGRWVDEHVQKIDDGVNEKHDFIDVMLSVI-EDDPSSGHDRDTIIKANIM  845

Query  956   ililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAII  1135
              L+L GS++T+ T+ W  ++LLNN +A+K AQ+E++ H+GK R VE SDIKNL Y QAI+
Sbjct  846   NLMLAGSDTTSTTMTWILAILLNNTNALKRAQEEINHHIGKKRRVESSDIKNLVYLQAIM  905

Query  1136  KEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERW  1315
             KE LRLYPPGPL  P EA +DC I  Y++PKGTR+  N+ KLHRDP +W E E+F PER+
Sbjct  906   KETLRLYPPGPLLVPHEATKDCYIQGYNVPKGTRVFANVWKLHRDPSIWLEAEKFSPERF  965

Query  1316  FRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDM  1495
               +++  + Y G +FEYLPF  GRR CPG  F+ QV  +TLARL+ GF++  PMG  VDM
Sbjct  966   INEKNGEL-YEGHNFEYLPFGLGRRACPGSMFATQVCLITLARLIHGFDLEVPMGEDVDM  1024

Query  1496  SEGLGIALPKLTPIQVLLTPRL  1561
              EGLGI LPKLTP+ V+LTPRL
Sbjct  1025  REGLGITLPKLTPLNVILTPRL  1046



>ref|XP_010064744.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=529

 Score =   458 bits (1179),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 242/479 (51%), Positives = 312/479 (65%), Gaps = 13/479 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             P A GAWP  GHLHLL G  P   TLG MADKYGP+F ++LGS  AIVVS  E+ KECFT
Sbjct  47    PSATGAWPITGHLHLLGGPDPAYITLGQMADKYGPIFSIKLGSQRAIVVSGSELAKECFT  106

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND  F +RP     K LGYN A+F  +PYG YWR VRK+ TLEL++   L+ LRHVR +
Sbjct  107   TNDKAFCNRPKYLAAKLLGYNYAMFGFSPYGPYWRHVRKIATLELLSNHTLENLRHVREA  166

Query  524   EVEHCIGDLY--SMCHENGEVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE-------  676
              V     + Y  S   EN  + +  WF  +T N+  +++VGK++       ++       
Sbjct  167   VVRASTKEAYERSNAQENTPIEMKSWFNALTFNLIFKMVVGKQYDGTTASEEDEGQNDRC  226

Query  677   -VVSRALY-LGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK-E  847
              +  ++ + LGG FV SDV+P   W+DIGGY+K +K  +KE+D+++G WL EH R R   
Sbjct  227   RIALKSFFELGGQFVASDVLPFFRWLDIGGYVKAMKRTAKELDDVVGGWLDEHKRKRACG  286

Query  848   ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
             + +   DFMDVMLS L    V+  +  DTI KAT L LI  G+++TA TL W  SLLLNN
Sbjct  287   EAEGDRDFMDVMLSILGTADVLPSYDADTINKATCLALISGGTDTTAVTLTWALSLLLNN  346

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
              H +K AQ E+D  +G++R V ESDIKN  Y QAIIKE LRLYP  PLS P E+++DC I
Sbjct  347   RHVLKQAQQELDSQIGRERRVTESDIKNQVYIQAIIKETLRLYPAAPLSVPHESVKDCTI  406

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
             G Y +P GTRL+LN+ KLH +P VW  P EF+PER F   H  +G  G++FEYLPF  GR
Sbjct  407   GSYRVPAGTRLLLNISKLHWNPLVWPAPLEFRPER-FLTTHKDLGVWGQNFEYLPFGSGR  465

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             RMCPG++F+LQV+ + LA LL  F I T    P DM  G+GI  PK+TP++V+LTPRLP
Sbjct  466   RMCPGVSFALQVLHIVLATLLHSFEIETASVGPADMRAGMGITSPKVTPLEVVLTPRLP  524



>gb|KCW68806.1| hypothetical protein EUGRSUZ_F02405 [Eucalyptus grandis]
Length=524

 Score =   457 bits (1177),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 242/479 (51%), Positives = 312/479 (65%), Gaps = 13/479 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             P A GAWP  GHLHLL G  P   TLG MADKYGP+F ++LGS  AIVVS  E+ KECFT
Sbjct  42    PSATGAWPITGHLHLLGGPDPAYITLGQMADKYGPIFSIKLGSQRAIVVSGSELAKECFT  101

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND  F +RP     K LGYN A+F  +PYG YWR VRK+ TLEL++   L+ LRHVR +
Sbjct  102   TNDKAFCNRPKYLAAKLLGYNYAMFGFSPYGPYWRHVRKIATLELLSNHTLENLRHVREA  161

Query  524   EVEHCIGDLY--SMCHENGEVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE-------  676
              V     + Y  S   EN  + +  WF  +T N+  +++VGK++       ++       
Sbjct  162   VVRASTKEAYERSNAQENTPIEMKSWFNALTFNLIFKMVVGKQYDGTTASEEDEGQNDRC  221

Query  677   -VVSRALY-LGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK-E  847
              +  ++ + LGG FV SDV+P   W+DIGGY+K +K  +KE+D+++G WL EH R R   
Sbjct  222   RIALKSFFELGGQFVASDVLPFFRWLDIGGYVKAMKRTAKELDDVVGGWLDEHKRKRACG  281

Query  848   ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
             + +   DFMDVMLS L    V+  +  DTI KAT L LI  G+++TA TL W  SLLLNN
Sbjct  282   EAEGDRDFMDVMLSILGTADVLPSYDADTINKATCLALISGGTDTTAVTLTWALSLLLNN  341

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
              H +K AQ E+D  +G++R V ESDIKN  Y QAIIKE LRLYP  PLS P E+++DC I
Sbjct  342   RHVLKQAQQELDSQIGRERRVTESDIKNQVYIQAIIKETLRLYPAAPLSVPHESVKDCTI  401

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
             G Y +P GTRL+LN+ KLH +P VW  P EF+PER F   H  +G  G++FEYLPF  GR
Sbjct  402   GSYRVPAGTRLLLNISKLHWNPLVWPAPLEFRPER-FLTTHKDLGVWGQNFEYLPFGSGR  460

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             RMCPG++F+LQV+ + LA LL  F I T    P DM  G+GI  PK+TP++V+LTPRLP
Sbjct  461   RMCPGVSFALQVLHIVLATLLHSFEIETASVGPADMRAGMGITSPKVTPLEVVLTPRLP  519



>emb|CDP15065.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   457 bits (1176),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 240/494 (49%), Positives = 327/494 (66%), Gaps = 20/494 (4%)
 Frame = +2

Query  137   NGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSS  316
             N +   +  PEA G WPFIGHL  L   +P+AR LG MADKYGPVF LRLG    +VVSS
Sbjct  30    NPRSKAVSAPEAAGGWPFIGHLLQLSPNVPIARNLGAMADKYGPVFSLRLGMRQTLVVSS  89

Query  317   CEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRL  496
              E VKECFTTND  F+ RP  +  +Y+GYN A    APYG YWR++RK+V LEL++  RL
Sbjct  90    WEAVKECFTTNDKAFSYRPPSSFNEYVGYNYAAIGFAPYGPYWREIRKIVMLELLSNRRL  149

Query  497   KKLRHVRTSEVEHCIGDLY-----SMCHENGEVNLSEWFEHVTLNITLRLLVGKRF----  649
             ++L+HVR SE+E+ I  L+     S      +VN+ +WFE + LNI +R + G R+    
Sbjct  150   ERLKHVRISEIENNIKVLFDGWKSSSNDPPAKVNMGKWFEDLFLNIMVRKISGTRYTDSE  209

Query  650   --SRIAKHLKEVVSRALYLGGVFVPSDVIPS--LEWMDIGGYIKGLKEVSKEMDEIIGTW  817
               S+     + VV   ++  G FV SDVIP   L+W+D+ G++K +K VSKE+D II  W
Sbjct  210   VGSKRNAQFRRVVKEFVHFLGQFVVSDVIPFPLLKWIDMQGHLKSIKRVSKELDSIIQIW  269

Query  818   LQEHIRNRKEddddqsdfmdVM--LSSLPEDAVISGHKRDtiikattlililtGSESTAE  991
             + EH   R +  +   +  D +  L S+ +D  + GH R+T+IKAT + L++   E+T+ 
Sbjct  270   IDEHNERRMKISEQGDEQQDFIDALLSVTKDEYLFGHSRETVIKATLMSLVIAAFETTSI  329

Query  992   TLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPL  1171
              L WT SLLLNN H ++ AQ+E+D +VGK+R  EESDI NL Y QAI+KE +RLYPP PL
Sbjct  330   HLTWTLSLLLNNKHVMRQAQEEIDSNVGKERWAEESDINNLVYLQAIVKESIRLYPPAPL  389

Query  1172  SGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVG  1351
             S PR+AMEDC +  Y I  GT+L +N+ KL RDPR+WSEP++F PER+   E   + + G
Sbjct  390   SLPRQAMEDCNVSGYRISMGTQLFVNVWKLQRDPRIWSEPDQFLPERFLNGE---VDFSG  446

Query  1352  KSFE--YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPK  1525
             K+FE  + PF  GRR CPG+  + QV  LTLARLLQGF+++TP  +PVDM+E   I++ K
Sbjct  447   KNFEFSFTPFGSGRRSCPGIPLATQVTHLTLARLLQGFDLTTPSDLPVDMTEDTSISMGK  506

Query  1526  LTPIQVLLTPRLPN  1567
              TP++V++ PRLPN
Sbjct  507   ATPLEVVILPRLPN  520



>ref|XP_007224171.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
 gb|EMJ25370.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
Length=517

 Score =   456 bits (1174),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 248/493 (50%), Positives = 319/493 (65%), Gaps = 27/493 (5%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             P+A GAWP IGHLHLL G  P    LG MA++YGP+F + +G   A++VSS E+ KECFT
Sbjct  21    PKAGGAWPIIGHLHLLGGSKPPHLVLGKMAERYGPIFTVNIGVQKALIVSSSEIAKECFT  80

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND VFASRP     + + YN A+F  +PY  Y R VRK+V LE+++ SRL+ L+HVR S
Sbjct  81    TNDKVFASRPKFMAAEIMAYNYALFPFSPYSHYSRQVRKIVLLEVLSNSRLEMLKHVRES  140

Query  524   EVEHCIGDLYSMCHENGE---------VNLSEWFEHVTLNITLRLLVGKRFSRIAKH---  667
             EV+  +  +Y  C  NG+         V + EWF  +  NI +R++VGKRF         
Sbjct  141   EVKASMKGIYERCVTNGKSSTSSNKALVEMREWFLDINENIVIRMIVGKRFREATSSNSK  200

Query  668   ------LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
                    KE     L L G FV SD IP L W+D+GG+ + +K+V+KE+D +   WL+EH
Sbjct  201   GSNYYLKKETYMDFLRLSGTFVLSDAIPWLRWLDLGGHERAMKKVAKELDLVFNGWLEEH  260

Query  830   IRNRK-----EddddqsdfmdVMLSSLPEDA---VISGHKRDtiikattlililtGSEST  985
              + RK     +  DDQ DFMDVMLS L  D    + S +  DT+ KAT++ LI+ G E+ 
Sbjct  261   KQRRKISGQVKGGDDQLDFMDVMLSILDVDGANEITSDYDADTVNKATSMALIVAGVEAP  320

Query  986   AETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPG  1165
             A  + W  +LLLNN  A+K AQ+E+D  +GKDR V+ESDIKNL Y QAIIKE +RLYP G
Sbjct  321   AVQMTWALALLLNNREALKKAQEELDQIIGKDRQVKESDIKNLVYLQAIIKESMRLYPAG  380

Query  1166  PLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGY  1345
             PLS P E+ EDC +G YH+P GTRL++NL KLHRDPRVWS+P EF+PER F   H S   
Sbjct  381   PLSLPHESTEDCMVGDYHVPAGTRLLVNLSKLHRDPRVWSDPNEFRPER-FLTTHKSFDV  439

Query  1346  VGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPK  1525
              G  FE +PF  GRRMCPGM+ +L+V+ LTLA LL GF I TP    VDM E +G+   K
Sbjct  440   KGHDFELIPFGSGRRMCPGMSLALKVIALTLASLLHGFEIGTPTDETVDMGETVGVTNNK  499

Query  1526  LTPIQVLLTPRLP  1564
              TP++VL TPRLP
Sbjct  500   ATPLEVLFTPRLP  512



>ref|XP_006379218.1| hypothetical protein POPTR_0009s11180g [Populus trichocarpa]
 gb|ERP57015.1| hypothetical protein POPTR_0009s11180g [Populus trichocarpa]
Length=487

 Score =   455 bits (1170),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 237/483 (49%), Positives = 325/483 (67%), Gaps = 16/483 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             PE  G+WP IGHLHLL  R  +  +TLG MAD YG +F +RLG HP IVVS  E+VKECF
Sbjct  3     PEVAGSWPVIGHLHLLGRRNQLLHKTLGGMADDYGSIFSIRLGIHPTIVVSDWEIVKECF  62

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND VF++RP     K +GYN+  FA APYGRYWRD+RK+V +EL++  RL+ L+HVR 
Sbjct  63    TANDRVFSTRPKSLALKIMGYNQTTFAFAPYGRYWRDMRKLVMVELLSNHRLELLKHVRD  122

Query  521   SEVEHCIGDLYSMCHENGE---VNLSEWFEHVTLNITLRLLVGKRF-------SRIAKHL  670
             +E    + D Y     NG    V + +    +  NIT+R++ GKR+       ++ AK  
Sbjct  123   TETSLLMKDFYEKSSRNGGQVVVEMKQRLADMATNITVRMISGKRYFSADAKGNQQAKRC  182

Query  671   KEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEIIGTWLQEH--IRNR  841
             +E +    YL G+ + SD +P   W+D + GYI  +K  ++E+D ++G+W+ EH  IR  
Sbjct  183   QEALRNFFYLVGLNLASDAVPLFSWLDLVKGYIGKMKRTARELDCVLGSWVDEHRRIRLN  242

Query  842   KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
             +   +++ DF+ VMLS + +D  IS  + DT +KA+ L L+L GS++TA  L W  + LL
Sbjct  243   RSISEEEKDFIYVMLSIM-DDGNISVDEADTTVKASCLSLLLGGSDTTAIALTWALASLL  301

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NN + +K AQ E+D HVGK R V E+DIKNL Y QAI+KE  RL+ P PLSGPREAMEDC
Sbjct  302   NNRNMLKKAQCELDTHVGKHREVAETDIKNLVYMQAIVKETFRLHQPAPLSGPREAMEDC  361

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +  +HIP GTRL++NL KLHRDP +WS P EF+PER+ + EHA++   G+ FE+ PF  
Sbjct  362   TVAGFHIPAGTRLVVNLWKLHRDPNIWSNPLEFQPERFLK-EHANLDVRGQDFEFTPFGS  420

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRRMCP ++F++QVV LTLARLL GF + T    PVDM+E  G+ +PK TP++V+L PRL
Sbjct  421   GRRMCPAVSFAVQVVHLTLARLLHGFELRTVSDNPVDMTESPGLTVPKATPLEVVLRPRL  480

Query  1562  PNL  1570
             P++
Sbjct  481   PSI  483



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   456 bits (1173),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 239/510 (47%), Positives = 321/510 (63%), Gaps = 23/510 (5%)
 Frame = +2

Query  95    YNQIILKYKRDNK-NNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPV  271
             +  II+ Y    +    KL+P    EA GAWP  GHL LL G  P    L  MADKYGP+
Sbjct  16    FTIIIVSYYFSRRWRPAKLVPT---EAKGAWPIFGHLPLLGGSTPPHIKLAAMADKYGPL  72

Query  272   FGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRD  451
             F +RLG +P++V+SS E+ KECFTTNDLV  SRP +AV  ++GYN A+F  AP G +WR+
Sbjct  73    FTIRLGVYPSLVISSSEIAKECFTTNDLVLNSRPKLAVVDHIGYNCAMFGFAPSGPFWRE  132

Query  452   VRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSM--CHENGEVN--------LSEWFE  601
             +RK+ TLEL++  RL+ LRH+R SEV   + +L+      E  E N        L +WF 
Sbjct  133   MRKITTLELLSNRRLELLRHIRVSEVTTFLQELFKTWSTAEKRESNNSDGVLVELKQWFG  192

Query  602   HVTLNITLRLLVGKRFSRIA--------KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIG  757
              +TLN+ LR++ GKR+S  A        + ++  +    Y  G+FV  D +P L W+D+G
Sbjct  193   DMTLNVILRMVAGKRYSVAADEDEKTEARRVQSALKEFFYYVGLFVVGDAVPYLRWLDLG  252

Query  758   GYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDti  937
             G+ K +K ++KE+D I+G W++EH R R   D          + S+ + A + G   DT+
Sbjct  253   GHEKAMKRIAKELDAIVGGWVEEHKRRRARGDAKGEPDFIDAMLSVLDGADLGGFDADTV  312

Query  938   ikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLK  1117
              KAT+L +I  GS++T  TLIW  SLLLNNPH +K AQ+E+D  +G+ R+V ESDI  L 
Sbjct  313   NKATSLNMIAGGSDTTMVTLIWAISLLLNNPHVLKSAQNELDTEIGRQRVVSESDISKLV  372

Query  1118  YFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEE  1297
             Y QAI+KE LRLYP  PLSGPRE  +DC IG YH+ KGTRLI NL K+  DPR+W +P E
Sbjct  373   YIQAIVKETLRLYPAAPLSGPREFTKDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLE  432

Query  1298  FKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPM  1477
             FKPER F   H  +   G  FE +PF  GRR CPG+ F+LQ+VQ TLA  +  F+IS P 
Sbjct  433   FKPER-FLTSHRDVDVKGLHFELIPFGSGRRACPGLAFALQMVQFTLASFVHAFDISNPS  491

Query  1478  GMPVDMSEGLGIALPKLTPIQVLLTPRLPN  1567
               P+DM+E  G+   K TP+QVL+ PRLP+
Sbjct  492   NSPIDMTESFGLTNIKATPLQVLIKPRLPS  521



>ref|XP_010527265.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Tarenaya hassleriana]
Length=526

 Score =   456 bits (1172),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 244/488 (50%), Positives = 327/488 (67%), Gaps = 17/488 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P IGHLHLL G+  V +    M+DK GP+F L++G++  +VVS  E  +ECF
Sbjct  42    MPEPSGALPLIGHLHLLRGKDLVFKKFAAMSDKLGPIFSLKIGTYRLVVVSDSETARECF  101

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T +D V A+RP++++G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +  R++ L HVR 
Sbjct  102   TASDQVLANRPNISLGRYVGYNNAILALAPYGDYWRELRKITTIHLFSNHRIEMLGHVRL  161

Query  521   SEVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE-----V  679
             SEV   I  LY+   E G   V +    E +T N  L+ LVGKR        +E      
Sbjct  162   SEVNAFIKHLYTTTMERGSSVVGMDTLLEFMTFNSILKKLVGKRIEYGEVECEEWRYKKA  221

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR------  841
             + +A +L G+F+  D IP LEW+D    +  +K  +KE+D +I  WLQEH+  R      
Sbjct  222   IKQAEHLAGIFMVGDAIPWLEWLDFAK-VSSMKNTAKELDAVISKWLQEHLEKRSGNGND  280

Query  842   KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
             +   D     MD+++  LPED V+SGH RDTI+KAT LIL +TGS+ST  TLIWT SLLL
Sbjct  281   EMGLDQDKTIMDLLIDVLPEDVVMSGHTRDTIVKATILILTVTGSDSTFITLIWTVSLLL  340

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NNP  +K AQDE+D+ VGK R VEESD++NLK+ QAIIKE  RLYPP PL+G REA EDC
Sbjct  341   NNPSVLKTAQDEIDVIVGKGRWVEESDVRNLKFLQAIIKETHRLYPPAPLTGIREASEDC  400

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +G Y I KGTRL++NL KLHRDP++W EPE F+PER+  +E  + G+    +EY+PFS 
Sbjct  401   YVGGYRITKGTRLLINLWKLHRDPKIWPEPEVFRPERFMVEE--TKGWDKSGYEYIPFSS  458

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPGMN  L+VV L LARLLQGF +      P+DM+EG G+ALPK+ P++V + PRL
Sbjct  459   GRRSCPGMNLGLRVVYLVLARLLQGFELRRVSDEPLDMAEGPGLALPKVEPVEVSVMPRL  518

Query  1562  -PNLFPTM  1582
              P+L+  +
Sbjct  519   EPDLYQVI  526



>ref|XP_010527266.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Tarenaya hassleriana]
Length=526

 Score =   456 bits (1172),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 244/488 (50%), Positives = 328/488 (67%), Gaps = 17/488 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P IGHLHLL G+  V +    M+DK GP+F L++G++  +VVS  E V++CF
Sbjct  42    MPEPSGALPLIGHLHLLRGKDLVFKKFAAMSDKLGPIFSLKIGTYRLVVVSDSETVRDCF  101

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T +D V A+RP++++G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +  R++ L HVR 
Sbjct  102   TASDQVLANRPNISLGRYVGYNNAILALAPYGDYWRELRKITTIHLFSNHRIEMLGHVRL  161

Query  521   SEVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE-----V  679
             SEV   I  LY+   E G   V +    E +T N  L+ LVGKR        +E      
Sbjct  162   SEVSAFIKHLYTTTMERGSSVVGMDTLLEFMTFNSILKKLVGKRIEYGEVECEEWRYKKA  221

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR------  841
             + +A +L G+F+  D IP LEW+D    +  +K  +KE+D +I  WLQEH+  R      
Sbjct  222   IKQAEHLAGIFMVGDAIPWLEWLDFAK-VSSMKNTAKELDAVISKWLQEHLEKRSGNGND  280

Query  842   KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
             +   D     MD+++  LPED V+SGH RDTI+KAT LIL +TGS+ST  TLIWT SLLL
Sbjct  281   EMGLDQDKTIMDLLIDVLPEDVVMSGHTRDTIVKATILILTVTGSDSTFITLIWTVSLLL  340

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NNP  +K AQDE+D+ VGK R VEESD++NLK+ QAIIKE  RLYPP PL+G REA EDC
Sbjct  341   NNPSVLKTAQDEIDVIVGKGRWVEESDVRNLKFLQAIIKETHRLYPPAPLTGIREASEDC  400

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +G Y I KGTRL++NL KLHRDP++W EPE F+PER+  +E  + G+    +EY+PFS 
Sbjct  401   YVGGYRITKGTRLLINLWKLHRDPKIWPEPEVFRPERFMVEE--TKGWDKSGYEYIPFSS  458

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPGMN  L+VV L LARLLQGF +      P+DM+EG G+ALPK+ P++V + PRL
Sbjct  459   GRRSCPGMNLGLRVVYLVLARLLQGFELRRVSDEPLDMAEGPGLALPKVEPVEVSVMPRL  518

Query  1562  -PNLFPTM  1582
              P+L+  +
Sbjct  519   EPDLYQVI  526



>ref|XP_008235430.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=517

 Score =   455 bits (1170),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 252/493 (51%), Positives = 335/493 (68%), Gaps = 24/493 (5%)
 Frame = +2

Query  143   KLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCE  322
             K+  +  P+  GA P IGHLH L G  P+ +TL  MADKYGP+F + LG HP +V+S+ +
Sbjct  29    KIKGMLAPQPSGALPIIGHLHKLRG--PIFKTLAAMADKYGPIFTIWLGKHPVLVISNYD  86

Query  323   VVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKK  502
              VK+CFT ND VFA+RP    GKYLGYN A F  +PYG YWRD+RKMV +EL++  RL+ 
Sbjct  87    AVKQCFTKNDTVFATRPRSTTGKYLGYNYAGFGFSPYGTYWRDMRKMVMVELLSSRRLET  146

Query  503   LRHVRTSEVEHCIGDLYSMCHENG-------EVNLSEWFEHVTLNITLRLLVGKRF----  649
             L+HV+ SEV+  I  L+ +C   G       +V +S+W E +TLN+  R++ GKR+    
Sbjct  147   LKHVQISEVDAFIKGLFLLCKTEGHNGLNPTKVVISDWIERLTLNVITRMIAGKRYFDSS  206

Query  650   -----SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGT  814
                   R  K LKE     +Y+ G  V SDVI    W+D  G IK +K + KE+D  +G 
Sbjct  207   DEGDEQRFGKILKEF----MYVSGKPVASDVIGFPSWIDFKGQIKAMKRIMKELDSFMGN  262

Query  815   WLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAET  994
              ++EH   ++ +  D+ DF+DVM+S + ED    G+ R+TIIKAT+L LIL GSE+TA +
Sbjct  263   LVEEHYAKKETNSRDEHDFIDVMISVI-EDNSTLGYTRETIIKATSLNLILAGSETTAIS  321

Query  995   LIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLS  1174
             LIW  SLLLNN H +K+AQ+E+D+ VG+DR +E++DI+NL Y QAI+KE LRLYPP PLS
Sbjct  322   LIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDTDIENLPYLQAIVKETLRLYPPAPLS  381

Query  1175  GPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGK  1354
              P EAM+DC++  +HI KGT L +NL KLHRDP +W +PE F PER F   H  I   G+
Sbjct  382   VPHEAMQDCQVCGFHIQKGTLLFVNLWKLHRDPSLWPDPEVFCPER-FLTTHVGIDASGQ  440

Query  1355  SFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTP  1534
              FE++PF  GRR CPG  F+LQV  LTL RLLQGF ++TPM MPVD++EGLGI +PK T 
Sbjct  441   HFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFELATPMDMPVDLTEGLGITMPKSTS  500

Query  1535  IQVLLTPRLPNLF  1573
             ++V+LTPRLP  F
Sbjct  501   LEVILTPRLPFEF  513



>ref|XP_004517185.1| PREDICTED: cytochrome P450 82C4-like [Cicer arietinum]
Length=522

 Score =   455 bits (1171),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 239/502 (48%), Positives = 336/502 (67%), Gaps = 19/502 (4%)
 Frame = +2

Query  95    YNQIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVF  274
             YN   +K   +NK  GK    + P+   A PFIGHLHLL  + P+AR     ADKYGP+F
Sbjct  21    YNIWRIKKHSNNKLKGK----QPPQPSYALPFIGHLHLLGNQTPLARIFASFADKYGPIF  76

Query  275   GLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDV  454
              + LGS+PA+V+S+ E +KECFTTND + ASRP  + G YLGYN A F  APYG Y+  +
Sbjct  77    QIYLGSYPALVISNQESIKECFTTNDKILASRPKSSHGIYLGYNYAGFGFAPYGTYFTKL  136

Query  455   RKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVN----LSEWFEHVTLNIT  622
             RK+  LEL++  R++ LRH+  SE++  + DL+    +N +V     +S+W E +T NI 
Sbjct  137   RKLTMLELLSSRRIESLRHLYESEIDTLVNDLWLYVKDNNKVTKAVVISKWLEKLTFNII  196

Query  623   LRLLVGKRFSRIAKHLKEV--------VSRALYLGGVFVPSDVIPSLEWMDIGGYI-KGL  775
              +++ GKR+    + + +V        +   +++ G FVPSD+IP + W    G + K +
Sbjct  197   TKMISGKRYFEYLQDVDDVEAHGIVKLIKEFMHISGEFVPSDLIPIIGWFGFEGQVLKSM  256

Query  776   KEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattl  955
             K V +++D+++G W+ EH++   +  +++ DF+DVMLS + ED   SGH RDTIIKA  +
Sbjct  257   KRVGRDLDKVVGRWVDEHVQKIDDGVNEKHDFIDVMLSVI-EDDPSSGHDRDTIIKANIM  315

Query  956   ililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAII  1135
              L+L GS++T+ T+ W  ++LLNN +A+K AQ+E++ H+GK R VE SDIKNL Y QAI+
Sbjct  316   NLMLAGSDTTSTTMTWILAILLNNTNALKRAQEEINHHIGKKRRVESSDIKNLVYLQAIM  375

Query  1136  KEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERW  1315
             KE LRLYPPGPL  P EA +DC I  Y++PKGTR+  N+ KLHRDP +W E E+F PER+
Sbjct  376   KETLRLYPPGPLLVPHEATKDCYIQGYNVPKGTRVFANVWKLHRDPSIWLEAEKFSPERF  435

Query  1316  FRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDM  1495
               +++  + Y G +FEYLPF  GRR CPG  F+ QV  +TLARL+ GF++  PMG  VDM
Sbjct  436   INEKNGEL-YEGHNFEYLPFGLGRRACPGSMFATQVCLITLARLIHGFDLEVPMGEDVDM  494

Query  1496  SEGLGIALPKLTPIQVLLTPRL  1561
              EGLGI LPKLTP+ V+LTPRL
Sbjct  495   REGLGITLPKLTPLNVILTPRL  516



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   455 bits (1171),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 241/502 (48%), Positives = 323/502 (64%), Gaps = 18/502 (4%)
 Frame = +2

Query  110   LKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLG  289
             L + R     G  +  + PEA GA PF+GHLHLL G  P    LG +AD YGP+F +RLG
Sbjct  24    LLFTRVINRTGSGMKRKAPEASGARPFLGHLHLLGGSKPAHVVLGDLADTYGPIFTIRLG  83

Query  290   SHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVT  469
                 +VVS+ E+ KECFTTND  FA+RP     + LGYN A+F  +PYG YWR +RK+VT
Sbjct  84    VRLTLVVSNWEIAKECFTTNDKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVT  143

Query  470   LELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE--------VNLSEWFEHVTLNITL  625
             LE+++  RL+KL+H+R SEV   I +LY +  E           V +  WF  + +N+  
Sbjct  144   LEVLSNHRLEKLKHIRESEVRTSIKELYKLGVEGVSNSSSGKVLVEMKRWFWTLNINMVF  203

Query  626   RLLVGKRFSRI-AKHLKEVVSRA-------LYLGGVFVPSDVIPSLEWMDIGGYIKGLKE  781
             +++VGKR+S     H K+   R          L G F   D +P L W+D+GG+ K +K+
Sbjct  204   KMVVGKRYSEAETSHGKDENDRRRKALRDFFELTGTFTVGDSLPFLRWLDLGGHEKAMKK  263

Query  782   VSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAV-ISGHKRDtiikattli  958
              +KE+D I+  WL+EH + R   + +       M+ SL  DA  +  +  DTI KAT L 
Sbjct  264   TAKELDHILEEWLEEHKQKRNSGNAESEHDFMGMMLSLLNDAAELPSYDADTINKATCLS  323

Query  959   liltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIK  1138
             LIL  S++T  TL W  SLLLNN +A+K AQ+E+D+HVG+D+LVEESDIK L Y QAIIK
Sbjct  324   LILAASDTTMVTLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIK  383

Query  1139  EGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWF  1318
             E LRLYP  PLS P E+MEDC +  YHIP GTRL++NL K+HRDP  WS+P EF+PER F
Sbjct  384   ETLRLYPAAPLSVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPER-F  442

Query  1319  RDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMS  1498
                +      G++FE +PF  GRRMCPG++ +LQV++LTLA LLQGF + TP+  PVDM 
Sbjct  443   LTTYKDFDVRGQNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMG  502

Query  1499  EGLGIALPKLTPIQVLLTPRLP  1564
             E +GI   K++P++VL+TPRLP
Sbjct  503   EAIGITNLKVSPLEVLITPRLP  524



>ref|XP_011045172.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
 ref|XP_011045173.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=541

 Score =   455 bits (1171),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 245/505 (49%), Positives = 337/505 (67%), Gaps = 39/505 (8%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             L+ PE  GA P IGHLHLL  +  +ARTL  +ADKYGP+F +RLG HP +VVS+ E +KE
Sbjct  40    LQAPEPSGALPLIGHLHLLGAQKTLARTLAAIADKYGPIFTIRLGKHPTVVVSNLEAIKE  99

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTT+D + +SRP  + G+YL YN A F     G +WR++RK+VT++L++  RLK LRHV
Sbjct  100   CFTTHDRILSSRPRSSHGEYLSYNYAAFGFTNSGPFWREMRKIVTIQLLSSHRLKSLRHV  159

Query  515   RTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF-----------  649
             + SEV   I DLY +   N +    + +SE FE +T+N+  R++ GKR+           
Sbjct  160   QVSEVNTLINDLYLLSKSNKQGSTKIVISECFERMTINMITRMIAGKRYFSSTEAEKEEG  219

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWM-DIGGYIKGLKEVSKEMDEIIGTWLQE  826
              RI K +KE     +Y+ GVFVPSD+IP L W+ +  G +K +K +S+E+D ++ +W+QE
Sbjct  220   KRIGKLMKEF----MYISGVFVPSDLIPFLGWINNFLGSVKTMKRLSRELDSLMESWIQE  275

Query  827   HIRNRKEddddqsdf-----mdVMLSSLPEDAVISGHKRDtiikatt----------lil  961
             H   R E  ++ +       +DVMLS L  D  +SG+ R+TIIKAT             L
Sbjct  276   HKLKRLESTENTNKMDDDDFIDVMLSLL--DDSMSGYSRETIIKATAMDQDVLFLHEQTL  333

Query  962   iltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKE  1141
             I+ G+++T+ TL W  S LLNN  ++++AQ+E+D+ VG++R  E+SDI NL Y QAIIKE
Sbjct  334   IIAGADTTSITLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAIIKE  393

Query  1142  GLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFR  1321
              LRLYPPGPLS P EA ED  +  YH+PKGTRL  NL KLHRDP +WS P+E+ PER+  
Sbjct  394   TLRLYPPGPLSVPHEATEDFCVAGYHMPKGTRLFTNLWKLHRDPNLWSNPDEYMPERFLN  453

Query  1322  DEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSE  1501
             D HA++  +G  FE +PF  GRR CPG+ F+LQV+ LT ARLLQGF++ TP G  VDM+E
Sbjct  454   D-HANLDVLGHHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPRGESVDMTE  512

Query  1502  GLGIALPKLTPIQVLLTPRL-PNLF  1573
             G+ I LPK TP+++ +TPRL P L+
Sbjct  513   GVAITLPKATPLEIHITPRLSPELY  537



>ref|XP_010069621.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Eucalyptus 
grandis]
Length=542

 Score =   454 bits (1169),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 244/519 (47%), Positives = 338/519 (65%), Gaps = 34/519 (7%)
 Frame = +2

Query  128   NKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIV  307
             NK  G  LP   PE PGAWP IGHLHLL G  P+ARTL  MADK GP+F +RLG HPA +
Sbjct  28    NKPKGTALP---PELPGAWPIIGHLHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATI  84

Query  308   VSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTV  487
             +SS E V++CFTT+D   ASRP   VG + GY  A F  A YG  WR++RK+  LEL++ 
Sbjct  85    ISSQEAVRKCFTTHDKDLASRPKSKVGIHFGYGYAGFGFAEYGDLWREMRKITMLELLST  144

Query  488   SRLKKLRHVRTSEVEHCIGDLYSMCHENG---------EVNLSEWFEHVTLNITLRLLVG  640
              RL  L+HV+ SE++  + DL+++C  N           V +S+  E +TLNI +R++  
Sbjct  145   RRLDNLKHVQASEIDTFVKDLHALCRTNAIDAQNGSSKVVVISQLLELLTLNIIIRMIAS  204

Query  641   KRFSRI--------------AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLK  778
             KR+  +              A HL++V+   +Y+ G    S+++P   W D  G +K +K
Sbjct  205   KRYFGLLSASTGSSTDDDEEASHLRKVIKEFMYISGFPTVSELVPFTGWTDCVGTVKTMK  264

Query  779   EVSKEMDEIIGTWLQEHIRNRKEdd------ddqsdfmdVMLSSLPEDAVIS-GHKRDti  937
              V++EMDEI+G W++EH   R+ D       D + DF+DVMLS + ED +   GH  +T+
Sbjct  265   RVAREMDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETL  324

Query  938   ikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLK  1117
             IKAT + +I+ GS++T+  L W  SLLLN+ H +K AQ+E+D+ VGKD+ V++SDI +L 
Sbjct  325   IKATVVNIIVAGSDTTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDKWVQDSDIGSLH  384

Query  1118  YFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEE  1297
             Y QAI+KE LRLYPPGPLS P EA  DC +  Y IPKGTR+ +N+ KLHRDP+VWS+PE+
Sbjct  385   YLQAIVKETLRLYPPGPLSIPHEARADCNVRGYLIPKGTRIFVNVWKLHRDPQVWSDPEK  444

Query  1298  FKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPM  1477
             F PER F   H+ +   G+ FE++PF  GRR+CPG  F+L+   LTLARLLQGF+++   
Sbjct  445   FLPER-FLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLAISS  503

Query  1478  GMPVDMSEGLGIALPKLTPIQVLLTPRLPNLFPTMLNKN  1594
                VDM+EG+G+ LPK TP++V+L PRLP++    L  N
Sbjct  504   DELVDMTEGIGLNLPKATPLRVVLNPRLPSMLYEKLTAN  542



>ref|XP_009599169.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=523

 Score =   454 bits (1167),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 245/511 (48%), Positives = 332/511 (65%), Gaps = 24/511 (5%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGL  280
             I L +   NKN+        PE  GAWP IGHLHLL G   +  RTLG MAD YGP F +
Sbjct  14    IFLYFLFKNKNSTS--KKHAPEPAGAWPIIGHLHLLGGAEQLLYRTLGAMADNYGPAFSI  71

Query  281   RLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRK  460
             RLGS  A VVSS E+ KECFT ND   ASRP+    K++GY  AVF  APY  +WR++RK
Sbjct  72    RLGSRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSTFWREMRK  131

Query  461   MVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNIT  622
             +   EL++  RL  L+HV+ SEVE  I +LY +   N        V L  WFE +TLN+ 
Sbjct  132   IAMYELLSNRRLDTLKHVQVSEVEMGIQELYKLWVNNNSGYRPILVELKHWFEDLTLNVI  191

Query  623   LRLLVGKRF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLK  778
             +R++ GKR+           A+  ++ +++  +L G+FVPSD  P L W DI G+ K +K
Sbjct  192   VRMVAGKRYFGAGASCDDDEARRCQKAINQFFHLIGIFVPSDAFPILGWFDIQGHEKAMK  251

Query  779   EVSKEMDEIIGTWLQEHIRNRK--EddddqsdfmdVMLSSLPEDAVISG--HKRDtiika  946
               +KE+D I+ +WLQEH   R+  E  ++ +     ++ SL E+  +S   +  DT IK+
Sbjct  252   RTAKELDSILESWLQEHREKRRLSEGKNEGAQDFIDVMLSLQEEGRLSNFQYDADTSIKS  311

Query  947   ttlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQ  1126
             T L LIL GS++TA TL W  SLLLNNP  ++ AQ+E+D+HVGKDR V+ESDI+NL Y Q
Sbjct  312   TCLALILGGSDTTAGTLTWAISLLLNNPEILRKAQEEIDVHVGKDRQVDESDIQNLAYIQ  371

Query  1127  AIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKP  1306
             AIIKE LRLYP GPL GPREAM++C++G Y I  GTRLI+N+ K+ RDPR+W +P+ FKP
Sbjct  372   AIIKETLRLYPAGPLLGPREAMDECEVGGYKITPGTRLIVNVWKIQRDPRIWEDPDSFKP  431

Query  1307  ERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMG-M  1483
             +R F   ++++   G+ FE +PF  GRR CPG++ +LQV+ LTLAR LQ F  S P+G  
Sbjct  432   DR-FLMSNSNVDVKGQDFELIPFGSGRRSCPGVSLALQVLHLTLARFLQAFEFSKPVGDQ  490

Query  1484  PVDMSEGLGIALPKLTPIQVLLTPRL-PNLF  1573
              +D++E  G+ +PK TP+ VL+TPRL  NL+
Sbjct  491   LIDLTESPGLTIPKATPLDVLITPRLNANLY  521



>ref|XP_002283952.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   454 bits (1167),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 241/485 (50%), Positives = 321/485 (66%), Gaps = 18/485 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTL-GHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PEA GAWP IGHLHLL G   +   L G MADKYGPVF +RLG   A+VV+S E+ KEC
Sbjct  38    APEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVNSWEMAKEC  97

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTT+DL  ASRP +   KYLGYN A+FA +P+G YWR+VRK+ TLEL++  RL+ L++VR
Sbjct  98    FTTHDLALASRPEVEAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVR  157

Query  518   TSEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF--------SR  655
              SEVE C+ +LY +  E         V++ EWF H+TLN+ L ++ GKR+         +
Sbjct  158   ISEVETCMKELYKLWAEKKNEAGVVLVDMKEWFGHLTLNVILMMVAGKRYFGYTGESKEK  217

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A+  ++ +     L G+FV SD IP   W+D+GG++K +K+ +KE+D I   WL+EH R
Sbjct  218   EAQQCRKAIREFFRLWGLFVVSDAIPFFGWLDVGGHLKAMKKTAKELDGIAQEWLEEH-R  276

Query  836   NRKEddddqsdfmdVMLS-SLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
              RK+  +   +   + ++ S+     I+ +  DTI KAT LILI  G+++T+ TL W  S
Sbjct  277   QRKDSGEADGNQDFMDVTLSILGGRDITDYDADTINKATALILIGGGTDTTSATLTWVIS  336

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLNNP  ++ AQ+E+D HVGK+RLV E DI  L Y QAI+KE LR+ P  PLSGPR+ +
Sbjct  337   LLLNNPDVLRKAQEELDAHVGKERLVNEMDISKLVYLQAIVKETLRINPTAPLSGPRQFI  396

Query  1193  EDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLP  1372
             +D  +G YHI KGTRLILNL K+ RDPRVW  P EF+P+R F   H  +   GK FE  P
Sbjct  397   QDSILGGYHISKGTRLILNLTKIQRDPRVWLNPMEFQPDR-FLTTHKDVDVRGKQFELTP  455

Query  1373  FSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLT  1552
             F GGRR+CPG  F+LQV+ LTLA  L  F +STP   PVDMSE  G+   K TP++VL++
Sbjct  456   FGGGRRICPGAVFALQVLHLTLANFLHRFQLSTPSDAPVDMSESFGLTNIKSTPLEVLIS  515

Query  1553  PRLPN  1567
             PRL +
Sbjct  516   PRLAS  520



>ref|XP_007200972.1| hypothetical protein PRUPE_ppa004569mg [Prunus persica]
 gb|EMJ02171.1| hypothetical protein PRUPE_ppa004569mg [Prunus persica]
Length=502

 Score =   452 bits (1164),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 255/485 (53%), Positives = 327/485 (67%), Gaps = 50/485 (10%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             VP+  GAWPFIGHL LL  + PVA TLG MAD +GP+F L+LG H  +V+S+ E VKEC 
Sbjct  46    VPQPSGAWPFIGHLPLLRSKDPVAITLGAMADDHGPIFSLKLGQHQVLVLSAWETVKECL  105

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND VFA+R S+A GK+LGY+ A+FALAPYG YWR VRK+ TLEL++  R++ L HVRT
Sbjct  106   TTNDRVFATRASIAGGKHLGYDNALFALAPYGPYWRHVRKLATLELLSTKRVEMLSHVRT  165

Query  521   SEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRFS--------RIAK  664
             S+V+  I +L S+C +NG     V+LSE  E +T NI +RL+ GKRF+          A 
Sbjct  166   SKVDLFIKNLLSLCTKNGASPTPVHLSELIEFLTFNINVRLIAGKRFTAEQYNEKNSEAW  225

Query  665   HLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEIIGTWLQEH---I  832
               ++ V  ALYL GVFV SD +P LEW+D + G++  +K   KE+D ++G WL+EH    
Sbjct  226   RFEKAVKEALYLFGVFVWSDAMPWLEWLDSLFGHVGSMKRCFKELDCVLGKWLEEHRQRS  285

Query  833   RNRKEddddqsdfmdVMLSSLP-EDAVISGHKRDtiikattlililtGSESTAETLIWTT  1009
             R + + D  +SD MDVM+SSL  ED VISGH  D +IK+T L+LILTG+EST+ TL W  
Sbjct  286   RPQGKIDRVESDLMDVMISSLQEEDDVISGHSLDNVIKSTALVLILTGTESTSVTLTWAL  345

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             SLLLNNP  +K AQ E+D+ VG+DR V+ESD+ NLKY QAI+KE LR+YPPGPL+G REA
Sbjct  346   SLLLNNPKTLKAAQQELDIQVGRDRWVQESDLPNLKYLQAILKETLRVYPPGPLTGLREA  405

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
              EDC +  YH+PKGTR+++N+ KL RDPR+                              
Sbjct  406   TEDCHLAGYHVPKGTRVLVNIWKLQRDPRI------------------------------  435

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
                 GRR CPGM   LQVVQL LARL+QGF++S      VDM EGLG+ALPK  P++ LL
Sbjct  436   ---SGRRSCPGMVLGLQVVQLILARLVQGFDMSRVGEEAVDMREGLGLALPKANPLEALL  492

Query  1550  TPRLP  1564
             +PRLP
Sbjct  493   SPRLP  497



>ref|XP_006418652.1| hypothetical protein EUTSA_v10002489mg [Eutrema salsugineum]
 gb|ESQ37088.1| hypothetical protein EUTSA_v10002489mg [Eutrema salsugineum]
Length=515

 Score =   453 bits (1165),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 243/481 (51%), Positives = 324/481 (67%), Gaps = 12/481 (2%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             L +PE  GA P  GHLHLL GR  V + L  ++DK GP+F L+LGS+  +V S  E+VK+
Sbjct  36    LTIPEPLGALPLFGHLHLLRGRELVCKKLAAISDKLGPIFSLKLGSYRLVVASDAEIVKD  95

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTTNDLV A+RP++A G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +   ++ L H+
Sbjct  96    CFTTNDLVLATRPNIAFGRYVGYNNAILALAPYGDYWRELRKISTVHLFSNQSMEMLGHI  155

Query  515   RTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKR--FSRIAKH---LKEV  679
             R SE+   I  LY        V +   FE +T NI L  +VGKR  F ++       KE 
Sbjct  156   RYSEINEFIKHLYIGSDGTSMVKIDMLFEFLTFNIILTKMVGKRIGFGKVKSEEWCYKEA  215

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI--RNRKEdd  853
             ++++ YL  VF+  DVIP L W+D    I  +K+  KE+D +I  WLQEH+  R+R + D
Sbjct  216   MNQSEYLAAVFMIGDVIPWLGWLDFAK-ISQMKKTFKELDSVITKWLQEHLKKRSRNDKD  274

Query  854   ddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPH  1033
               +   MD++L  LPE+ VI GH RD IIKAT L+L LTGS+ST+ TL W  SLLLNNP 
Sbjct  275   HQEKTIMDLLLDILPENVVICGHVRDVIIKATILVLTLTGSDSTSITLTWAVSLLLNNPT  334

Query  1034  AIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGK  1213
             A+K AQ+E+D  VGK R VEESD++NLKY QAI+KE  RLYPP PL+G REA E C +G 
Sbjct  335   ALKSAQEEIDNSVGKSRWVEESDLQNLKYLQAIVKETHRLYPPAPLTGIREASEACNLGG  394

Query  1214  YHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRM  1393
             Y + KGTRL++N+ KLHRDP++W +P+ FKPER F +E +       +FEY+PFS GRR 
Sbjct  395   YRVEKGTRLLINIWKLHRDPKMWPDPKTFKPER-FMEEKSQCQ--KSNFEYIPFSSGRRS  451

Query  1394  CPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL-PNL  1570
             CPGMN  L+VV   LARL+QGF +       +DM+EG G+ALPK+  ++VL+ PRL P L
Sbjct  452   CPGMNLGLRVVHFALARLIQGFELRKVTSEQLDMAEGPGLALPKIKAVEVLVMPRLDPEL  511

Query  1571  F  1573
             +
Sbjct  512   Y  512



>gb|KCW58034.1| hypothetical protein EUGRSUZ_H00762, partial [Eucalyptus grandis]
Length=529

 Score =   453 bits (1165),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 244/506 (48%), Positives = 333/506 (66%), Gaps = 34/506 (7%)
 Frame = +2

Query  128   NKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIV  307
             NK  G  LP   PE PGAWP IGH+HLL G  P+ARTL  MADK GP+F +RLG HPA +
Sbjct  28    NKPKGTALP---PELPGAWPIIGHIHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATI  84

Query  308   VSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTV  487
             +SS E V+ECFTT+D   ASRP    G +LGY  A F    YG +WR++RK+  LEL++ 
Sbjct  85    ISSREAVRECFTTHDKDLASRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITMLELLST  144

Query  488   SRLKKLRHVRTSEVEHCIGDLYSMCH------ENGE---VNLSEWFEHVTLNITLRLLVG  640
              RL  L+HV+ SE++  + DL+++C       +NG    V +S+  E +TLNI +R++  
Sbjct  145   RRLDNLKHVQASEIDTFVKDLHALCRTNSIDAQNGSSKVVVISQLLELLTLNIIIRMIAS  204

Query  641   KRFSRI--------------AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLK  778
             KR+  +              A HL+ V+   +Y+ G    SD++P   W D  G +K +K
Sbjct  205   KRYFGLSSASTGSSADDDEEASHLRRVIKEFMYISGFPAVSDLVPFTGWTDCVGTVKTMK  264

Query  779   EVSKEMDEIIGTWLQEHIRNRKEdd------ddqsdfmdVMLSSLPEDAVIS-GHKRDti  937
              V++E+DEI+G W++EH   R+ D       D + DF+DVMLS + ED +   GH  +T+
Sbjct  265   RVARELDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETL  324

Query  938   ikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLK  1117
             IKAT + +I+ GS+ST+  L W  SLLLN+ H +K AQ+E+D+ VGKDR V++SDI+NL 
Sbjct  325   IKATIVNIIVAGSDSTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRWVQDSDIENLL  384

Query  1118  YFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEE  1297
             Y QAI+KE LRLYPPGPL  P EA  DC +  Y IPKGTR+ +N  KLHRDP+VWSEPE+
Sbjct  385   YLQAIVKETLRLYPPGPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHRDPQVWSEPEK  444

Query  1298  FKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPM  1477
             F PER F   H+ +   G+ FE++PF  GRR+CPG  F+L+   LTLARLLQGF+++T +
Sbjct  445   FLPER-FLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLATSL  503

Query  1478  GMPVDMSEGLGIALPKLTPIQVLLTP  1555
                VDM+EGLG+ LPK TP++V+L P
Sbjct  504   DELVDMTEGLGVNLPKATPLRVVLNP  529



>ref|XP_008372381.1| PREDICTED: cytochrome P450 82G1-like [Malus domestica]
Length=532

 Score =   453 bits (1166),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 250/517 (48%), Positives = 334/517 (65%), Gaps = 45/517 (9%)
 Frame = +2

Query  101   QIILKYKRDNK-----NNGKLLP---LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMAD  256
             +II  Y + NK     NN K       +VP+ PGAWPFIGHLHLLHG+ PVA  LG MAD
Sbjct  27    RIIAAYTKQNKKKNIINNTKTETRSLTKVPQPPGAWPFIGHLHLLHGKDPVALILGAMAD  86

Query  257   KYGPVFGLRLGSHPAIVV-SSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPY  433
             K+GP++ L+LG    +VV S+ E VKE FT ND+ F++RPS A GK+LGYN A+FALAPY
Sbjct  87    KFGPIYSLKLGPRQVMVVLSAWEQVKERFTKNDIAFSTRPSTAAGKHLGYNNAIFALAPY  146

Query  434   GRYWRDVRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG-----------EV  580
             G YWRD+RK+ T E ++  +++   HVR  EV+  I  L+ +   +G            V
Sbjct  147   GPYWRDIRKLATQEYLSAQKVEMHSHVRAEEVDSFIKKLFDVVGSSGLTTSPPTSPTVVV  206

Query  581   NLSEWFEHVTLNITLRLLVGKRFS--------RIAKHLKEVVSRALYLGGVFVPSDVIPS  736
             +LSE  EH+T NI++RL+ GKRFS          A   ++ +  A++L G FV SD +P 
Sbjct  207   HLSELVEHLTFNISVRLIAGKRFSDGEYNEKGSEAWRFEKAMQEAMHLLGNFVWSDAMPY  266

Query  737   LEWMD-IGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVI  913
              EW+D + G +  +K   KE+D ++ +W++  + +              M+S+  E+AVI
Sbjct  267   FEWLDSLFGPVSFMKRTFKELDSVLSSWVESDLID-------------AMISNFGEEAVI  313

Query  914   SGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVE  1093
             SGH  D +IKAT+LILI+ G++ST+  L W  SLLLNNP A+K AQ E+D++VG DR V+
Sbjct  314   SGHSCDNVIKATSLILIIGGTQSTSVALTWALSLLLNNPSALKSAQQELDINVGSDRWVQ  373

Query  1094  ESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDP  1273
             ESD+ NLKY QAI+KE LRLYP  P++   E  ED  +  YH+PKGTR+++NL KLHRDP
Sbjct  374   ESDLPNLKYLQAIVKETLRLYPSVPIT-VHEGTEDSHLSGYHVPKGTRIVVNLWKLHRDP  432

Query  1274  RVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQ  1453
              VW+ P EF+PER F  +HA + Y  K FEY+PFS GRR CPG    L VVQL LARLLQ
Sbjct  433   SVWANPCEFQPER-FMTDHADVDYF-KGFEYIPFSSGRRSCPGATLGLHVVQLLLARLLQ  490

Query  1454  GFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             GF++S     PVDM E +G+AL K  P++  L PRLP
Sbjct  491   GFDMSRVGDGPVDMRERVGLALTKADPLKAFLAPRLP  527



>gb|KEH18124.1| cytochrome P450 family 82 protein [Medicago truncatula]
Length=458

 Score =   450 bits (1157),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 240/451 (53%), Positives = 315/451 (70%), Gaps = 12/451 (3%)
 Frame = +2

Query  248   MADKYGPVFGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALA  427
             MA+KYG +F LRLG +  +VV+S E+ KEC T ND VFASRP++A G+YLGYN A+ ALA
Sbjct  1     MAEKYGSIFSLRLGCNQTLVVNSREIAKECLTKNDKVFASRPNVAAGRYLGYNNAILALA  60

Query  428   PYGRYWRDVRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHE-NG--EVNLSEWF  598
             PYG YWR +RK+ TLEL++  RL+KL+HVR  E+   + +LY+   + NG  EV +S++ 
Sbjct  61    PYGDYWRYMRKISTLELLSSHRLEKLKHVRDFEIYSLVKNLYTFVKKTNGSIEVPISKFL  120

Query  599   EHVTLNITLRLLVGKRFS--------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDI  754
             +H+T NI ++++ GKRFS          A  L+  +    YL GVFV +D IPSL W+D 
Sbjct  121   DHMTFNIIVKMIAGKRFSGETINQEDSEAWRLRNAIKDTTYLCGVFVMADAIPSLSWIDF  180

Query  755   GGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddd-dqsdfmdVMLSSLPEDAVISGHKRD  931
              G++  +K  +KEMD I+  WL EH + R E     + DFMDV++S   ED  I GHKR+
Sbjct  181   QGHVGFMKRTAKEMDFILDKWLSEHYKKRDEVQSGKEDDFMDVLISMFEEDDEICGHKRE  240

Query  932   tiikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKN  1111
             T+IKATTLILILT S ST+ TL W  SLL+N+P  +K A++E+D ++GKD+ V+ESDIKN
Sbjct  241   TVIKATTLILILTASGSTSITLGWALSLLINHPKVLKQAKEELDTNIGKDKWVQESDIKN  300

Query  1112  LKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEP  1291
             LKY QAIIKE LRLYPP PL+G REA +DC +  Y + KGTRL +NL KL RDP VWS P
Sbjct  301   LKYLQAIIKETLRLYPPAPLTGIREATDDCHVAGYKVTKGTRLFINLWKLQRDPLVWSNP  360

Query  1292  EEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNIST  1471
              +F+PER+F        +  + F YLPFS GRR C G  F +QV+ LTLARL+QGF+I+T
Sbjct  361   NKFQPERFFNIHDQIDNFQNQEFGYLPFSYGRRSCAGATFGMQVLHLTLARLIQGFDINT  420

Query  1472  PMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
               G PVDM EG+G+ALPK  P+ V+L PRLP
Sbjct  421   KDGGPVDMIEGVGLALPKENPLDVMLQPRLP  451



>ref|XP_006423130.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
 ref|XP_006479372.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
 ref|XP_006479373.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
 ref|XP_006479374.1| PREDICTED: cytochrome P450 82C4-like isoform X3 [Citrus sinensis]
 gb|ESR36370.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
Length=524

 Score =   452 bits (1163),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 249/497 (50%), Positives = 334/497 (67%), Gaps = 21/497 (4%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLP-VARTLGHMADKYGPVFGLRLGSHP  298
             + NK  G+    + PEA GAWP +GHLHLL G    + +TLG MADKYG  F + LG H 
Sbjct  31    KRNKKGGR----KPPEAAGAWPCVGHLHLLAGSNQLIHQTLGEMADKYGKAFLIHLGIHR  86

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
             A+V+SS EV KECFTTND +F++RP     K +GY+ A+   APYG YWR+VRK+ T++L
Sbjct  87    ALVISSWEVTKECFTTNDKLFSTRPKSLAVKLMGYDHAMIGFAPYGSYWREVRKLSTVQL  146

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG---EVNLSEWFEHVTLNITLRLLVGKRF  649
             ++  RL+ L+HVR +EV+  I +L+  C +NG    V + E F+ + +NI +R++ GKR+
Sbjct  147   LSNHRLELLKHVRDTEVKVFIKELHEQCAKNGGHVAVEMKERFKDLAMNIIVRMIAGKRY  206

Query  650   SRI--------AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDI-GGYIKGLKEVSKEMDE  802
              R         +K  ++ +   LYL G+F+ SD IP L W+DI  GY   +K  +KE+D+
Sbjct  207   YRSETNADDQESKRFQKALGDFLYLLGLFLASDNIPFLGWLDIVKGYTGQMKRTAKELDD  266

Query  803   IIGTWLQEHIRNR--KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGS  976
             + G  +QEH   R     + D+ DF+DVMLS + +D   S    DT+IKAT L LI  G+
Sbjct  267   VFGRLVQEHRHKRLNGSINKDEEDFIDVMLSVM-DDGKTSPEDADTVIKATCLSLISGGN  325

Query  977   ESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLY  1156
             ++T  T+ W  SLLLNN H +K AQDE+D+HVGK+R VEESDIKNL Y QAI+KE LRL 
Sbjct  326   DTTVTTITWALSLLLNNRHVLKKAQDELDIHVGKNRQVEESDIKNLIYLQAIVKETLRLC  385

Query  1157  PPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHAS  1336
             PP PLS PREAMEDC I  +HIP GTRLI+NL K+HRDP +W+ P EF P+R F +E+A 
Sbjct  386   PPLPLSAPREAMEDCTIDGFHIPAGTRLIVNLWKMHRDPSIWANPSEFIPDR-FLNENAK  444

Query  1337  IGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIA  1516
             +   G+ FE+LPF  GRR CPG++F+LQV  LTLARLL  F++ T     VDMS   GI 
Sbjct  445   LDVNGQDFEFLPFGSGRRKCPGISFALQVQHLTLARLLHAFSLGTVSDTLVDMSGSPGIT  504

Query  1517  LPKLTPIQVLLTPRLPN  1567
             +PK TP++V LTPR+P+
Sbjct  505   VPKATPLEVTLTPRVPS  521



>emb|CAN66023.1| hypothetical protein VITISV_042713 [Vitis vinifera]
Length=491

 Score =   451 bits (1159),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 237/451 (53%), Positives = 309/451 (69%), Gaps = 14/451 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PE  GAWPF+GHL LL G+ P+ RTLG MADK+GPVF +RLG   A+VVSS E VKECF
Sbjct  37    APEPSGAWPFLGHLPLLRGQTPIFRTLGAMADKHGPVFMIRLGVQRALVVSSREAVKECF  96

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND VFASRPS + GK LGYN A F  APYG  WR++RK+  +E+++  RL   +HV+ 
Sbjct  97    TTNDKVFASRPSXSAGKJLGYNXAGFXFAPYGALWREMRKLSMMEILSARRLDAJKHVQI  156

Query  521   SEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVVS  685
             SE++  I DLYS+   +      +V +SEWF+H++ NI L+++ GKR+   + H  E   
Sbjct  157   SELDLSIKDLYSLGKGSDWVHPVKVVMSEWFQHLSFNIXLKMIXGKRYFNTSGHGIEEAR  216

Query  686   RA-------LYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK  844
             RA       L L G FV SD IP +EWMD+ GY+  +K V+KE D ++G W++EH     
Sbjct  217   RAIATIQEFLSLXGAFVLSDAIPGVEWMDLQGYLGSMKRVAKEXDSLVGGWVEEHEXRLN  276

Query  845   EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLN  1024
              + +   DF+DVMLS L ED  + GH R+T+IKAT +ILI+ G+E+ A T  W  S LLN
Sbjct  277   SEGNKXQDFIDVMLSVL-EDTSMFGHSRETVIKATIMILIVGGTETVATTSTWLLSALLN  335

Query  1025  NPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCK  1204
               HA+K AQ+E+D+ VG+ R VEESDI NL Y QA+IKE LRLY   PLS P EAMEDC 
Sbjct  336   XKHALKRAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCH  395

Query  1205  IGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGG  1384
             +  YHIPKGTRL +N  KLHRDP VWS+PE+F+PER F   HA    +G+ FE +PF  G
Sbjct  396   VAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPER-FLTSHADXDVLGQHFELIPFGSG  454

Query  1385  RRMCPGMNFSLQVVQLTLARLLQGFNISTPM  1477
             RR CPG+  +L+++ L + RLLQGF++STP+
Sbjct  455   RRSCPGITMALKLLPLVIGRLLQGFDLSTPL  485



>ref|XP_006423133.1| hypothetical protein CICLE_v10028201mg [Citrus clementina]
 ref|XP_006479370.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR36373.1| hypothetical protein CICLE_v10028201mg [Citrus clementina]
Length=524

 Score =   451 bits (1161),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 246/502 (49%), Positives = 331/502 (66%), Gaps = 16/502 (3%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             I L    +  N  +    R PE  GAWPFIGHLHLL     + +TLG MADKYG  F +R
Sbjct  21    ICLYVATNTTNRNRKRGSRPPEPEGAWPFIGHLHLLEKNQLLHQTLGKMADKYGKAFMIR  80

Query  284   LGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKM  463
             LG   A+V+SS EV KECFTTND +F+SRP     K +GY+ A+   APYG YWR++RK+
Sbjct  81    LGIRQALVISSWEVAKECFTTNDKLFSSRPKFLAVKLMGYDHAMLGFAPYGPYWRNIRKL  140

Query  464   VTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG---EVNLSEWFEHVTLNITLRLL  634
              T+EL++  +L+ ++HVR  E +  I +LY +C +NG   +V + E F  + +NI LR++
Sbjct  141   ATVELLSNHQLELIKHVRDIETKIFIKELYELCVKNGGLVDVEMKERFGDLAMNIILRVI  200

Query  635   VGKRF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDI-GGYIKGLKEVS  787
              GKRF         + ++  ++ +    YL G+ +PSD IP L W+D+  GY   +K+ +
Sbjct  201   AGKRFFGRDTNADDQDSRQCQKALGNFFYLVGLLLPSDNIPFLGWLDVVNGYTGQMKKTA  260

Query  788   KEMDEIIGTWLQEHIRNR--KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlil  961
             KE+D + G  + EH   R  +   +++ DF+DVMLS L +D   S    DT+IK+T L L
Sbjct  261   KELDTLFGRLVHEHRHKRLNESIKEEEKDFIDVMLSVL-DDGKTSAEDADTVIKSTCLSL  319

Query  962   iltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKE  1141
             IL G+++T  TL W  SLLLNN H +K AQDE+ +HVG +R VEESDIKNL Y QAI+KE
Sbjct  320   ILGGNDTTVVTLTWALSLLLNNHHVLKKAQDELSIHVGNNRQVEESDIKNLIYLQAIVKE  379

Query  1142  GLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFR  1321
              LRLYP  PLS PREAMEDC IG +HIP GTRLI+NL K+HRDP +W+ P EF PER F 
Sbjct  380   TLRLYPALPLSAPREAMEDCIIGGFHIPAGTRLIVNLWKMHRDPSIWANPSEFIPER-FL  438

Query  1322  DEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSE  1501
             +E+A++   G+ FE+LPF  GRR CPG++F+LQV+ LTLARLL  F + T     VDM E
Sbjct  439   NENANLEVKGQDFEFLPFGSGRRKCPGISFALQVLHLTLARLLHAFELGTVSDTLVDMRE  498

Query  1502  GLGIALPKLTPIQVLLTPRLPN  1567
               G+ +PK T ++V LTPRLP+
Sbjct  499   SPGMTVPKATALEVTLTPRLPS  520



>ref|XP_006432710.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
 ref|XP_006471501.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45950.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
Length=524

 Score =   451 bits (1160),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 232/475 (49%), Positives = 316/475 (67%), Gaps = 9/475 (2%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA GAWP IGHLHLL G  P  R    MADKYGP+F +R+G +PA++VS+ E+ KEC 
Sbjct  45    APEAGGAWPVIGHLHLLRGPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEIAKECL  104

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT+D VFA+RP     + LGYN ++F  +PYG YWR+ RK+ TL L++  RL+KL+HVR 
Sbjct  105   TTHDKVFANRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKLKHVRE  164

Query  521   SEVEHCIGDLYSMCHENGEVN------LSEWFEHVTLNITLRLLVGKRFSRI-AKHLKEV  679
              EV+ C+ +LY + H+N   N      + +WF     N+ LR++VGK  + + ++  KE+
Sbjct  165   YEVKTCLKELYELWHKNKSTNKILLVEMKKWFGDTLRNVVLRMVVGKGCNSVDSEEWKEL  224

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR-KEddd  856
             ++R   + G FV SD +P + W+DIGG  + +K+++KE+D +   WL+EH R R  ++  
Sbjct  225   LTRFFEMSGKFVVSDALPFMRWLDIGGDERSMKKIAKELDVVAQGWLEEHKRKRDSQEIK  284

Query  857   dqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHA  1036
              + DFM VMLS L +     G   DTI KA  L LIL  +++T  TL W  SLLLN+   
Sbjct  285   KEEDFMYVMLSILGDTEQYLGRDVDTINKAICLALILGAADTTTVTLTWVMSLLLNHRDI  344

Query  1037  IKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKY  1216
             +  AQ+E+D+ VG  R V ESDIKNL Y QAI+KE +RLYP GPL  P E++E+C +  Y
Sbjct  345   LNKAQNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLYPAGPLLVPHESIEECTVNGY  404

Query  1217  HIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMC  1396
             H+P  T+L +N  K+ RDP VW EP +F+PER F   H  I   G++FE LPFS GRRMC
Sbjct  405   HVPASTQLFINAWKIQRDPSVWEEPSKFQPER-FLTRHKDIDVKGQNFELLPFSSGRRMC  463

Query  1397  PGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             PG++F+LQV+Q TLA LLQGFN +TP   PVDM EGLG+ + K  P +VL+TPRL
Sbjct  464   PGVSFALQVMQFTLASLLQGFNFATPSNEPVDMGEGLGLTMEKSQPFEVLVTPRL  518



>ref|XP_004292356.1| PREDICTED: cytochrome P450 82C4-like [Fragaria vesca subsp. vesca]
Length=492

 Score =   449 bits (1156),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 233/483 (48%), Positives = 329/483 (68%), Gaps = 15/483 (3%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             L  PE  GA P +GHLH L GR P+ +TL +MADKYGP+F + LG + A+V+S+ E  KE
Sbjct  4     LMSPEPYGALPILGHLHQLGGRNPLFQTLANMADKYGPIFTIWLGKNRALVISNYEAAKE  63

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTTND VFA+RPS A GKYLGYN A F ++PYG+YWRD RK+V +EL++  RL+ L+HV
Sbjct  64    CFTTNDRVFATRPSSAQGKYLGYNYAAFGVSPYGKYWRDTRKLVVMELLSSRRLETLKHV  123

Query  515   RTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFSRI-------  658
             + SEV+  +  LYS+    G     +V +S   EH+T N+  +++ GKR+  +       
Sbjct  124   QISEVDAFVIGLYSVWKNKGHDGPSKVVISTGIEHLTCNVMTKIIAGKRYFGVKSDEFDG  183

Query  659   -AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH-I  832
               K +++++   +Y     V S V+   EW+D  G+++ +K V  ++D ++ +W++EH  
Sbjct  184   EVKKIRKLMKEFMYAAVNRVVSYVVGIPEWIDFKGHLRTMKNVGGQLDSLMTSWVEEHNT  243

Query  833   RNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
             + RK D  ++      +L S  ED  + GH RDTIIK+T LIL+L GSE+T+ +L W  S
Sbjct  244   KKRKNDSSNEEQDFIDVLLSEIEDGSMLGHTRDTIIKSTALILVLAGSETTSVSLTWMLS  303

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLNN   +K+AQ+E+D  VG+ R VE++DIKNL Y QAI KE LRLYPPGPLS P EAM
Sbjct  304   LLLNNRRTLKLAQEELDRIVGRHRWVEDTDIKNLVYLQAIAKETLRLYPPGPLSVPHEAM  363

Query  1193  EDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLP  1372
             EDCK+G +H+PKGT L +NL KLHRDP VW +PE F PER F    AS+   G+ FE++P
Sbjct  364   EDCKVGGFHVPKGTHLYVNLWKLHRDPNVWPDPEVFSPER-FLTTQASVDAFGQHFEFIP  422

Query  1373  FSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLT  1552
             F  GRR+CPG+  + Q++ LT+ARL+QGF ++TP+   VDM+EG G+++ + T ++V+LT
Sbjct  423   FGAGRRICPGITLAFQLMHLTVARLIQGFELATPLDKAVDMTEGSGLSMARATALEVVLT  482

Query  1553  PRL  1561
              RL
Sbjct  483   ARL  485



>ref|XP_007134137.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
 gb|ESW06131.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
Length=526

 Score =   450 bits (1158),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 238/486 (49%), Positives = 329/486 (68%), Gaps = 22/486 (5%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE  GA P IGHLHLL  + P+ART   +ADKYGP+F +RLG++PA+V+ + E +KECFT
Sbjct  39    PEPSGALPLIGHLHLLGAQTPLARTFAALADKYGPMFQIRLGAYPALVICNQEAIKECFT  98

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND V ASRP  + G +LGYN A F  APYG YW  +RK+  LEL++  RL+ L HV  S
Sbjct  99    TNDKVLASRPKSSHGVHLGYNFAGFGFAPYGTYWTKIRKLTMLELLSARRLQFLSHVYES  158

Query  524   EVEHCIGDL--YSMCHENGEVNLSEWFEHVTLNITLRLLVGKR-FSRI-------AKHLK  673
             E++  + DL  Y     + +V +SEW E  T NI ++++ GKR FS +       A  + 
Sbjct  159   EIDTLVKDLWLYLGGKTHVKVTISEWLERFTFNIIIKMIAGKRYFSYLEDVDDAEAHGVV  218

Query  674   EVVSRALYLGGVFVPSDVIPSLEWMDI-GGYIKGLKEVSKEMDEIIGTWLQEH-----IR  835
             +++   +++ G FVPSD+IP L W  + G  +K +K ++K++D ++G W++EH     +R
Sbjct  219   KLIKEFMHISGEFVPSDLIPVLGWFGVHGKVLKSMKRIAKDLDSLVGGWVEEHKNSDPLR  278

Query  836   NRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
             N+     ++ DF+DVMLS + +D  +SGH RDTIIKA    L+L GS++T+ T+ W  ++
Sbjct  279   NKS---LEKHDFIDVMLSVIQDDP-LSGHDRDTIIKANVTNLVLAGSDTTSTTMTWILAM  334

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             L+ NP A+K AQ+E++  VG++R VE  D+KNL Y QA++KE LRLYPPGPL  P EA E
Sbjct  335   LMKNPEALKRAQEEIEDEVGRERKVEACDLKNLIYLQAVVKETLRLYPPGPLLVPHEARE  394

Query  1196  DCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPF  1375
             DC I  Y +PKGTR+  N+ KLHRDPRVWSE E+F PER F +E+  +   G+ FEYLPF
Sbjct  395   DCCIQGYRVPKGTRVFANVWKLHRDPRVWSEAEKFSPER-FLNENGEVDE-GQRFEYLPF  452

Query  1376  SGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTP  1555
               GRR CPG  F+ Q+  +TLARLLQ F++  P+  PVD+ EGLGI LPK+ P+Q+L T 
Sbjct  453   GSGRRACPGSTFATQLTLITLARLLQAFHLDEPLDEPVDLEEGLGITLPKINPLQILFTS  512

Query  1556  RLPNLF  1573
             RLPN F
Sbjct  513   RLPNQF  518



>ref|XP_010436299.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   450 bits (1157),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 228/493 (46%), Positives = 313/493 (63%), Gaps = 20/493 (4%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVK  331
             ++ P+  GAWP IGHLHLL G+  +  RTLG MAD YG    L+LGS  A VVSS EV K
Sbjct  30    VKAPKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAK  89

Query  332   ECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRH  511
              CFT ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+H
Sbjct  90    NCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKH  149

Query  512   VRTSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF---------  649
             VR SE+   + DLYS+  +NG      V+L  W E +TLN+ +R++ GKR+         
Sbjct  150   VRVSEISMGVKDLYSLWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRYFGGAGSESS  209

Query  650   --SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQ  823
               +  A   K  +S+  +L G+F  SD  P+L W D+ G+ K +K+   E+D I+  W++
Sbjct  210   EDTEEASQCKRAISKFFHLIGIFTVSDAFPALRWFDLQGHEKEMKQTGSELDVILERWIE  269

Query  824   EHIRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAET  994
              H + RK     ++D   + ++ SL +   +S  + D      +  L L   GS++TA T
Sbjct  270   NHRQERKVSGTKENDSDFIDVMLSLAKQGKLSHLQYDATTSIKSTCLALILGGSDTTAST  329

Query  995   LIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLS  1174
             L W  +LLLNN   +K AQDE+D+HVG+DR VE+SDIKNL Y QAIIKE LRLYP GPL 
Sbjct  330   LTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDIKNLVYLQAIIKETLRLYPAGPLL  389

Query  1175  GPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGK  1354
             GPREAMEDC +  Y++  GTRLI+N+ K+ RDP+V+ EP EF+PER+   E       G+
Sbjct  390   GPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYVEPNEFRPERFITGEAKEFDVRGQ  449

Query  1355  SFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTP  1534
             +FE +PF  GRR CPG + ++QV+ L LAR L  F + T + MPVDMSE  G+ +PK TP
Sbjct  450   NFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTIPKATP  509

Query  1535  IQVLLTPRLPNLF  1573
             ++VL++PRL   F
Sbjct  510   LEVLISPRLNEQF  522



>ref|XP_010513989.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Camelina sativa]
Length=515

 Score =   449 bits (1156),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 241/481 (50%), Positives = 322/481 (67%), Gaps = 11/481 (2%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P  GHLHLL G+  + + L  M+DK GP+F L+LG +  +V S  + VK+CF
Sbjct  39    IPEPLGALPLFGHLHLLRGKELICKKLAAMSDKLGPIFSLKLGFYKLVVASDPKTVKDCF  98

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTNDL  A+RP++A G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +   ++ L HVR+
Sbjct  99    TTNDLALATRPNIAFGRYVGYNNAIMALAPYGEYWRELRKIATVHLFSNQSIEMLGHVRS  158

Query  521   SEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKR--FSRIAKH---LKEVVS  685
             SEV   I  LY        VN+   FE +T NI  R +VGKR  F  +       KE + 
Sbjct  159   SEVNTFIKHLYEKSGSTSTVNIDMLFEFLTFNIIHRKMVGKRIGFGEVKSEEWRYKEAMK  218

Query  686   RALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR-KEddddq  862
             R+ YL  V +  DVIP L W+D    I  +K   KE+D +I  WLQEH++ R + + D +
Sbjct  219   RSEYLAVVPMIGDVIPWLGWLDFAK-ISQMKRTFKELDVVITKWLQEHLKKRSRNEKDGE  277

Query  863   sdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIK  1042
                MD++L  LPED VI GH  D I+KAT L+L +TGS+ST+ TL W  SLLLNNP  +K
Sbjct  278   RTIMDLLLDILPEDVVICGHVHDVIVKATILVLTVTGSDSTSITLTWAVSLLLNNPATLK  337

Query  1043  MAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHI  1222
              AQ+E+D  VGK R VEESDI NLKY QAI+KE  RLYPP PL+G REA EDC +G Y +
Sbjct  338   AAQEEIDSCVGKGRWVEESDIPNLKYLQAIVKETHRLYPPAPLTGIREASEDCFVGGYRV  397

Query  1223  PKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPG  1402
              KGTRL++N+ KLHRDP++W +P+ FKPER F +E +  G     FEY+PFS GRR CPG
Sbjct  398   EKGTRLLVNIWKLHRDPKIWPDPKIFKPER-FMEEKSQCG--KSDFEYIPFSSGRRSCPG  454

Query  1403  MNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL-PNLFPT  1579
             +N  L+VV + LA+LLQGF +    G P+DM+EG G+ALPK+ P++V++ PRL P L+ +
Sbjct  455   INLGLRVVHIVLAKLLQGFELRKASGEPLDMAEGPGLALPKINPVEVVVMPRLNPELYCS  514

Query  1580  M  1582
             +
Sbjct  515   L  515



>ref|XP_006297446.1| hypothetical protein CARUB_v10013469mg [Capsella rubella]
 gb|EOA30344.1| hypothetical protein CARUB_v10013469mg [Capsella rubella]
Length=515

 Score =   449 bits (1156),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 240/478 (50%), Positives = 322/478 (67%), Gaps = 11/478 (2%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GAWP  GHLHLL G+  + + L  M+DK GP+F L+LG +  +V S  + VK+CF
Sbjct  39    IPEPSGAWPLFGHLHLLRGKDLIFKKLAAMSDKLGPIFSLKLGFYKLVVASDPKTVKDCF  98

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTNDL  A+RP++A G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +   ++ L HVR+
Sbjct  99    TTNDLALATRPNIAFGRYVGYNNAILALAPYGDYWRELRKISTVHLFSNQSIEMLGHVRS  158

Query  521   SEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKR--FSRIAKH---LKEVVS  685
              EV   +  LY  C     V +   FE +T NI LR +VGKR  F ++       KE + 
Sbjct  159   FEVNALMKHLYKECGGTSTVKIDMLFEFLTFNIILRKMVGKRVGFGKVNSEEWRYKEAMK  218

Query  686   RALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR-KEddddq  862
              + YL  V +  DVIP L W+D    I  +K   KE+D +I  WLQE ++ R + + D +
Sbjct  219   NSEYLAVVPMIGDVIPWLGWLDFVK-ISQMKRTFKELDVVITKWLQERLKKRSRNEKDGE  277

Query  863   sdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIK  1042
                MD++L  LPED VI GH+RD I+KAT L+L LTGS+ST+ TL W  SLLLNNP  +K
Sbjct  278   KTIMDLLLDILPEDIVICGHERDVIVKATILVLTLTGSDSTSITLTWAVSLLLNNPSTLK  337

Query  1043  MAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHI  1222
              AQ+E++  VGK R VEESDI NLKY QAI+KE  RLYPP PL+G REA EDC +G Y +
Sbjct  338   AAQEEIEKCVGKGRWVEESDIGNLKYLQAIVKETHRLYPPAPLTGIREASEDCFVGGYRV  397

Query  1223  PKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPG  1402
              KGTRL++N+ KLHRDP++W++P+ FKPER F DE +  G     FEY+PFS GRR CPG
Sbjct  398   EKGTRLLVNIWKLHRDPKIWTDPKTFKPER-FMDEKSQCG--KSDFEYIPFSSGRRSCPG  454

Query  1403  MNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL-PNLF  1573
             +N  L+VV + LA+LLQGF +      P+DM+EG G+ALPK+ P++V++ PRL P L+
Sbjct  455   INLGLRVVHIVLAQLLQGFELRKVSNEPLDMAEGPGLALPKINPVEVVVMPRLNPELY  512



>ref|NP_194922.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9SZ46.1|C82C4_ARATH RecName: Full=Cytochrome P450 82C4 [Arabidopsis thaliana]
 emb|CAA16595.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79912.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85981.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
Length=524

 Score =   449 bits (1156),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 227/487 (47%), Positives = 315/487 (65%), Gaps = 20/487 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              P   GAWP IGHLHLL G+  +  RTLG MAD YGP   L+LGS+ A VVSS EV K+C
Sbjct  32    APAPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGPAMSLQLGSNEAFVVSSFEVAKDC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HVR
Sbjct  92    FTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF-----------  649
              SE+   + DLYS+  +NG      V+L  W E +TLN+ +R++ GKR+           
Sbjct  152   VSEITMGVKDLYSLWFKNGGTKPVMVDLKSWLEDMTLNMIVRMVAGKRYFGGGGSVSSED  211

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
             +  A   K+ +++  +L G+F  SD  P+L + D+ G+ K +K+   E+D I+  W++ H
Sbjct  212   TEEAMQCKKAIAKFFHLIGIFTVSDAFPTLSFFDLQGHEKEMKQTGSELDVILERWIENH  271

Query  830   IRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLI  1000
              + RK     ++D   + ++ SL E   +S  + D      +  L L   GS+++A TL 
Sbjct  272   RQQRKFSGTKENDSDFIDVMMSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTSASTLT  331

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  SLLLNN   +K AQDE+D+HVG+DR VE+SDI+NL Y QAIIKE LRLYP GPL GP
Sbjct  332   WAISLLLNNKEMLKKAQDEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGP  391

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
             REAMEDC +  Y++P GTRLI+N+ K+ RDP+V+ EP EF+PER+   E       G++F
Sbjct  392   REAMEDCTVAGYYVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVRGQNF  451

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PF  GRR CPG + ++QV+ L LAR L  F++ T M MPVDMSE  G+ +PK TP++
Sbjct  452   ELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTVMDMPVDMSENPGLTIPKATPLE  511

Query  1541  VLLTPRL  1561
             VL++PR+
Sbjct  512   VLISPRI  518



>ref|XP_007224041.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
 gb|EMJ25240.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
Length=517

 Score =   449 bits (1155),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 248/493 (50%), Positives = 316/493 (64%), Gaps = 27/493 (5%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             P+A GA P IGHLHLL G  P    LG MA++YGP+F + +G H A++VSS E+ KECFT
Sbjct  21    PKAGGARPIIGHLHLLGGSKPPHLVLGKMAERYGPIFTVNIGVHKALIVSSSEIAKECFT  80

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND VFASRP     + + YN A    +PY  Y R VRK+V LE+++ SRL+ L+HVR S
Sbjct  81    TNDKVFASRPKFMAAEIMAYNYAFLPFSPYSHYSRQVRKIVLLEVLSNSRLEMLKHVRES  140

Query  524   EVEHCIGDLYSMCHENGE---------VNLSEWFEHVTLNITLRLLVGKRFSRIAKH---  667
             EV+  +  +Y  C  NG+         V + EWF  +  NI  R++VGKRF         
Sbjct  141   EVKASMKGIYERCVTNGKSSTGSNKALVEMREWFLDINENIVFRMIVGKRFGEATSSNSK  200

Query  668   ------LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
                    KE     L L G FV SD IP L W+D+GG+ + +K+V+KE+D +   WL+EH
Sbjct  201   GSNYYLKKETYMDFLRLSGTFVLSDAIPWLRWLDLGGHERAMKKVAKELDLVFNGWLEEH  260

Query  830   IRNRK-----EddddqsdfmdVMLSSLPEDA---VISGHKRDtiikattlililtGSEST  985
              + RK     + DDDQ DFMDVMLS L  D    + + +  DT+ KAT++ LI+ G E+ 
Sbjct  261   KQKRKISGQVKGDDDQLDFMDVMLSILDVDGANEITTDYDADTVNKATSMALIVAGVEAP  320

Query  986   AETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPG  1165
             A  + W  +LLLNN  A+K AQ+E+D  +GK R V+ESDIKNL Y QAIIKE  RLYP G
Sbjct  321   AVQMTWALALLLNNREALKKAQEELDQIIGKGRQVKESDIKNLVYLQAIIKESTRLYPAG  380

Query  1166  PLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGY  1345
             PLS P E+ EDC +G YH+P GTRL +NL KLHRDPRVWSEP EF+PER F   H S   
Sbjct  381   PLSLPHESTEDCMVGDYHVPAGTRLFVNLSKLHRDPRVWSEPNEFRPER-FLTTHKSFDV  439

Query  1346  VGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPK  1525
              G  FE +PF  GRRMCPGM+ +L+V+ LTLA LL GF I+TP   PVDM E +G+   K
Sbjct  440   KGHDFELIPFGSGRRMCPGMSLALKVIALTLASLLHGFEIATPTDEPVDMVETVGLTNNK  499

Query  1526  LTPIQVLLTPRLP  1564
              TP++VL TPRLP
Sbjct  500   ATPLEVLFTPRLP  512



>emb|CDY53704.1| BnaC03g67210D [Brassica napus]
Length=523

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 227/486 (47%), Positives = 313/486 (64%), Gaps = 19/486 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PE  GAWP IGHLHLL G+  +  RTLG MA++YGP   LRLGS  A VVSS EV KEC
Sbjct  32    APEPSGAWPIIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSSEAFVVSSFEVAKEC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HVR
Sbjct  92    FTVNDKALASRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATIELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF----------S  652
              SE+   + DLYS+  + G      VNL  W E +TLN+ +R++ GKR+          +
Sbjct  152   VSEISMGVKDLYSLWVKKGGSEPVMVNLKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDT  211

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
               A+  ++ +++  +L G+F  SD  P+L W D+ G+ K +K+   E+D I+  W++ H 
Sbjct  212   EEARQCQKAITKFFHLIGIFTMSDAFPTLGWFDLQGHEKEMKKTGSELDVILERWIENHR  271

Query  833   RNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLIW  1003
             + RK   + ++D   + ++ SL E   +S  + D      +  L L   GS++TA TL W
Sbjct  272   QQRKVSGNKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTW  331

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               +LLLNN   +K AQDE+D+ VG DR VE+SDI+NL Y QAIIKE LRLYP GPL GPR
Sbjct  332   AIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPR  391

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EAMEDC I  YH+  GTRLI+N+ K+ RDP+VW EP EF+PER+   E       G++FE
Sbjct  392   EAMEDCTIAGYHVSCGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNFE  451

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
              +PF  GRR CPG + ++QV+ L LAR L  F++ T + + VDMSE  G+ +PK TP++V
Sbjct  452   LIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEV  511

Query  1544  LLTPRL  1561
             +++PRL
Sbjct  512   MISPRL  517



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 237/482 (49%), Positives = 314/482 (65%), Gaps = 15/482 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA GAWP IGHLHLL G      TLG MADKYGP+F +RLG H A+VVSS EV KECF
Sbjct  43    APEAAGAWPIIGHLHLLGGSQLPHVTLGTMADKYGPIFTIRLGVHRALVVSSREVAKECF  102

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND   + RP +   ++LGYN A+FA +PY  YWR+VRK+V  EL++  RL+ L+ VR 
Sbjct  103   TTNDSAVSGRPKLVAPEHLGYNYAMFAFSPYDAYWREVRKIVNTELLSNRRLELLKDVRA  162

Query  521   SEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF--------SRI  658
             SEVE  I +LY +  E         V + +WF  +++N+ LR++VGKR+           
Sbjct  163   SEVETSIKELYKLWAEKKNELGHVLVEMKQWFGDLSMNVILRMVVGKRYFGVGAGGEEEE  222

Query  659   AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
             A+  ++ +     L G+FV  D IPSL W+D+GG+ K +K+ +KE+D I   WL+EH R 
Sbjct  223   ARRCQKAIREFFRLLGLFVVKDGIPSLGWLDLGGHEKAMKKTAKEIDSIAQEWLEEHRRR  282

Query  839   RKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
             +   +D+       +L S+ +   +  +  DTI KAT++ LI  G+++   TL W  SL+
Sbjct  283   KDWGEDNGMHDFMDVLLSVLDGKALPEYDADTINKATSMALISGGTDTMTVTLTWALSLI  342

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN   +K A++E+D HVGK+RLV  SDI  L Y QAI+KE LRL PPGPLSGPR+  ED
Sbjct  343   LNNRETLKKAKEELDTHVGKERLVNASDISKLVYLQAIVKETLRLRPPGPLSGPRQFTED  402

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C IG YH+PKGTRL+LNL KLHRDP VW +PEEF+PER F   H  +   G+ F+ LPF 
Sbjct  403   CIIGGYHVPKGTRLVLNLSKLHRDPSVWLDPEEFQPER-FLTTHRDVDARGQHFQLLPFG  461

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CPG+ F+LQ++ L LA  L GF +STP   PVDMSE  G+   K TP+++L+ PR
Sbjct  462   AGRRSCPGITFALQMLHLALASFLHGFEVSTPSNAPVDMSEIPGLTNIKSTPLEILIAPR  521

Query  1559  LP  1564
             LP
Sbjct  522   LP  523



>ref|XP_010437977.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=525

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 229/491 (47%), Positives = 313/491 (64%), Gaps = 21/491 (4%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             P+  GAWP IGHLHLL G+  +  RTLG MAD+YGPV  LRLGS  A VVSS EV K+CF
Sbjct  33    PKLSGAWPIIGHLHLLVGKEQLLYRTLGRMADRYGPVMSLRLGSSEAFVVSSFEVAKDCF  92

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HV  
Sbjct  93    TVNDKALASRPMTAAAKHMGYNYAVFGFAPYNAFWREMRKIATIELLSNRRLQMLKHVSV  152

Query  521   SEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRF------------  649
             SE+   + DLYS+  +NG      V+L  W +++TLN+ +R++ GKR+            
Sbjct  153   SEISMGVKDLYSLWVKNGGSEPVMVDLKRWLDNMTLNMIVRMVAGKRYFGGVVGSESSED  212

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
             +  A+  K  +S+  +L G+F  SD  P L W D  G+ K +K+   E+D I+  W+  H
Sbjct  213   TEEARQCKMAISKFFHLIGIFTVSDAFPRLRWFDFQGHEKEMKQTGSELDVILERWIDNH  272

Query  830   IRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLI  1000
              + RK     ++D   + ++ SL E   +S  + D  I   +  L L   GSE+T+ TL 
Sbjct  273   RQERKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDANISIKSTCLALILGGSETTSSTLT  332

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  +LLLNN   +K AQDE+D+HVG+DR VE+SDI NL Y QAIIKE LRLYP GPL GP
Sbjct  333   WAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGPLLGP  392

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
             REAMEDC +  Y++  GTRLI+N+ K+ RDP+V+ EP EF+PER+   E       G++F
Sbjct  393   REAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVRGQNF  452

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PF  GRR CPG + ++QV+ L LAR L  F + T + MPVDM+E  G+ +PK TP++
Sbjct  453   ELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKATPLE  512

Query  1541  VLLTPRLPNLF  1573
             VL++PRL   F
Sbjct  513   VLISPRLNEHF  523



>ref|XP_010445016.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 228/487 (47%), Positives = 309/487 (63%), Gaps = 20/487 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              P+  GAWP IGHLHLL G+  +  RTLG MAD YG    L+LGS  A VVSS EV K C
Sbjct  32    APKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HVR
Sbjct  92    FTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF-----------  649
              SE+   + DLYS+  +NG      V+L  W E +TLN+ +R++ GKR+           
Sbjct  152   VSEISMGVKDLYSLWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRYFGGAGSESSED  211

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
             +  A   K  +S+  +L G+F  SD  PSL W D+ G+ K +K+   E+D I+  W++ H
Sbjct  212   TEEASQCKRAISKFFHLIGIFTVSDAFPSLRWFDLQGHEKEMKQTGSELDVILERWIENH  271

Query  830   IRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLI  1000
              + RK     ++D   + ++ SL E   +S  + D      +  L L   GS++TA TL 
Sbjct  272   RQERKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDATTSIKSTCLALILGGSDTTASTLT  331

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  +LLLNN   +K AQDE+D+HVG+DR VE+SDI NL Y QAIIKE LRLYP GPL GP
Sbjct  332   WAIALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGPLLGP  391

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
             REAMEDC +  Y++  GTRLI+N+ K+ RDP+V+ EP EF+PER+   E       G++F
Sbjct  392   REAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYEEPNEFRPERFITGEAKEFDVRGQNF  451

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PF  GRR CPG + ++QV+ L LAR L  F + T + MPVDMSE  G+ +PK TP++
Sbjct  452   ELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTIPKATPLE  511

Query  1541  VLLTPRL  1561
             VL++PRL
Sbjct  512   VLISPRL  518



>ref|XP_002282133.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=525

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 239/485 (49%), Positives = 319/485 (66%), Gaps = 18/485 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHG--RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
              PEA GAWP IGHLHLL G   LP    LG MADKYG VF +RLG   A+VVSS ++ KE
Sbjct  38    APEAAGAWPIIGHLHLLGGSKNLP-HLLLGTMADKYGAVFSVRLGLKRAVVVSSWQMAKE  96

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTT+DL  ASRP + + K LGYN+A+FA +P+G YWR+VRK+ TLEL++  RL+ L++V
Sbjct  97    CFTTHDLALASRPQLVISKQLGYNDAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNV  156

Query  515   RTSEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF--------S  652
             R SEVE C+ +LY +  E         V++ +WF  +TLN+ L ++VGKR+         
Sbjct  157   RISEVETCMKELYKLWAEKKNEAGVVLVDMKQWFGDLTLNVILMMVVGKRYFGYTAESQE  216

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
             +  +  ++ +     L G+FV SD +P L W+D+GG++K  K+ +KEMD I   WL+EH 
Sbjct  217   KETQRCQKSIREFFRLLGLFVVSDALPFLGWLDVGGHLKATKKTAKEMDGIAQEWLEEHR  276

Query  833   RNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
             R +   +   +  +  ++ S+      +G+  DTI KAT+LILI  GS++T+ TL W  S
Sbjct  277   RRKDSGEASGNQDLMDVMLSILAGTDPTGYDADTINKATSLILIAGGSDTTSVTLTWVIS  336

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLNNP  ++ AQ+E+D HVGK RLV E D+  L Y QAI+KE LRLYP  PLSGPR+  
Sbjct  337   LLLNNPCMLRKAQEELDTHVGKGRLVNEVDLSKLVYLQAIVKETLRLYPALPLSGPRQFN  396

Query  1193  EDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLP  1372
             +D  +G Y IP GTRL+LNL K+ RDP VW  P EF+PER F   H  +   GK+FE+ P
Sbjct  397   QDSILGGYRIPNGTRLVLNLTKIQRDPSVWLNPTEFQPER-FLTTHKDVDMRGKNFEFTP  455

Query  1373  FSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLT  1552
             F GGRR+CPG  F+LQV+ LTLA  L  F +STP    VDMSE LGI   K TP++VL++
Sbjct  456   FGGGRRICPGATFALQVLHLTLANFLHKFQLSTPSNATVDMSESLGITNIKSTPLEVLIS  515

Query  1553  PRLPN  1567
             PRL +
Sbjct  516   PRLSS  520



>ref|XP_010451089.1| PREDICTED: cytochrome P450 82C4 [Camelina sativa]
Length=524

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 228/487 (47%), Positives = 311/487 (64%), Gaps = 20/487 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              P+  GAWP IGHLHLL G+  +  RTLG MAD YG    L+LGS  A VVSS EV K C
Sbjct  32    APKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HVR
Sbjct  92    FTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF-----------  649
              SE+   + DLYS+  +NG      V+L  W E +TLN+ +R++ GKR+           
Sbjct  152   VSEISMGVKDLYSLWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRYFGGTGSETSED  211

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
             +  A+  K  +S+  +L G+F  SD  P+L W D+ G+ K +K+   E+D I+  W++ H
Sbjct  212   TEEARQCKIAISKFFHLIGIFTVSDAFPALRWFDLQGHEKEMKQTGSELDVILEKWIENH  271

Query  830   IRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLI  1000
              + RK     ++D   + ++ SL E   +S  + D      +  L L   GS++TA TL 
Sbjct  272   RQQRKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLT  331

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  +LLLNN   +K AQDE+D+HVG+DR VE+SDIKNL Y QAIIKE LRLYP GPL GP
Sbjct  332   WAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDIKNLVYLQAIIKETLRLYPAGPLLGP  391

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
             REAMEDC +  Y++  GTRLI+N+ K+ RDP+V+ EP EF+PER+   E       G++F
Sbjct  392   REAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYMEPNEFRPERFVTGEAKEFDVRGQNF  451

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PF  GRR CPG + ++QV+ L LAR L  F + T + MPVDMSE  G+ +PK TP++
Sbjct  452   ELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTIPKATPLE  511

Query  1541  VLLTPRL  1561
             VL++PRL
Sbjct  512   VLMSPRL  518



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 245/487 (50%), Positives = 321/487 (66%), Gaps = 20/487 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA GAWP IGHL LL G      TLG MADKYGP F +RLG   A+VVS  EV KECF
Sbjct  40    APEAAGAWPVIGHLPLLGGPELPHITLGAMADKYGPAFTIRLGVRRALVVSDWEVAKECF  99

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND   A+RPS    K++GYN A+FA APYG YWR+VRK+ TLEL++  RL+ L+HVR 
Sbjct  100   TINDRALATRPSGVAMKHMGYNYAMFAFAPYGPYWREVRKIATLELLSNRRLEMLKHVRV  159

Query  521   SEVEHCIGDLYSMCHENG--------EVNLSEWFEHVTLNITLRLLVGKRF--------S  652
             SEV   + +LY +  +N         +V +  WF  +TLN  LR++ GKR+        S
Sbjct  160   SEVNMSVRELYGLWLKNKNATGADSVKVEMKRWFGDLTLNNVLRMVAGKRYFGATAACGS  219

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH-  829
               A   + V+     L G FV +D IP L W+D+ G+ K +K  +KE+D I+  W++EH 
Sbjct  220   AEAVRCQTVMRSFFRLVGQFVIADAIPFLGWLDMQGHEKAMKRTAKELDSILEGWMEEHR  279

Query  830   -IRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWT  1006
              +R   ++ + + DFMDVMLS L +D+ +SG+  DTI KAT + LIL G+++    L W 
Sbjct  280   KMRLSNDEANGEQDFMDVMLSIL-KDSKLSGYDADTINKATCMNLILGGNDTIKVCLTWA  338

Query  1007  TSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPRE  1186
              SLL+NN   +K  QDE+D HVGKDR VEESD+K L+Y QA++KE LRLYPP PLSGP E
Sbjct  339   LSLLVNNQEVLKRVQDELDRHVGKDRNVEESDMKKLEYLQAVVKEALRLYPPAPLSGPHE  398

Query  1187  AMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEY  1366
             AME+C +  YH+P GTR+++NL K+ RDPRVWS+P EF+PER F   H  +  +G+ FE 
Sbjct  399   AMEECTVAGYHVPVGTRILVNLSKIQRDPRVWSDPLEFRPER-FLTSHVGVDVLGQHFEL  457

Query  1367  LPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVL  1546
             +PF  GRR CPG +  L+VV L LARLL  F++ TP G PVDM+E  G+   K TP++VL
Sbjct  458   IPFGSGRRACPGTSLGLKVVHLALARLLHAFHLHTPSGAPVDMTESFGLTNLKATPLEVL  517

Query  1547  LTPRLPN  1567
             L PRLP+
Sbjct  518   LLPRLPS  524



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   449 bits (1154),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 246/492 (50%), Positives = 322/492 (65%), Gaps = 28/492 (6%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PEA GAWP IGHLHLL GR P+ R LG MADKYGP+F +R+G H A+VVS+ E+ KEC T
Sbjct  42    PEAGGAWPVIGHLHLL-GRFPLHRVLGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLT  100

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             T+D VFASRP   V + LG+N ++F  +PYG +WR +RK+ TLEL++  RL+KL+HVR  
Sbjct  101   THDRVFASRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKLKHVREG  160

Query  524   EVEHCIGDLY----------SMCHENGE---VNLSEWFEHVTLNITLRLLVGKRFSRIAK  664
             EV+ C+ +LY          S  H N +   V +++WFE VTLN  LR+ VG+R +  + 
Sbjct  161   EVKTCLKELYEFWERTNNYKSSDHNNNKKVLVEMNKWFEDVTLNTILRVTVGQRCNSSSS  220

Query  665   H--------LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWL  820
                       KE +++     G FV SD +P L W DIGG  + +K+ ++E+D +   WL
Sbjct  221   QEDTDHEGAWKEELTKFFAFSGKFVVSDSLPFLRWFDIGGDERAMKKNARELDVLAQGWL  280

Query  821   QEHIRNRKEddddqsd----fmdVMLSSLPEDAV-ISGHKRDtiikattlililtGSEST  985
              EH R R+       +    FMDVMLS L +DA  + G   DTI KAT L LIL  S+++
Sbjct  281   DEHKRKRESGQMINKEGHEDFMDVMLSILRDDAQQLPGDDADTINKATCLALILAASDTS  340

Query  986   AETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPG  1165
               TL W  SLLLN+   +K AQ+E+D+H+GK R V E DIKNL Y QAIIKE +RLYP G
Sbjct  341   KITLTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAG  400

Query  1166  PLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGY  1345
             PL+ P  + EDC +  Y +P GT L +N+ K+HRDPRVW EP +FKPER F   H  I  
Sbjct  401   PLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPER-FLTTHKHIDV  459

Query  1346  VGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPK  1525
              G++FE LPFS GRRMCPG +F++ V  LTLA LL GF+  TP+  PVDMSEG+ + L K
Sbjct  460   RGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVK  519

Query  1526  LTPIQVLLTPRL  1561
              TP++VL+TPRL
Sbjct  520   TTPVKVLITPRL  531



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   449 bits (1154),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 246/492 (50%), Positives = 322/492 (65%), Gaps = 28/492 (6%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PEA GAWP IGHLHLL GR P+ R LG MADKYGP+F +R+G H A+VVS+ E+ KEC T
Sbjct  42    PEAGGAWPVIGHLHLL-GRFPLHRVLGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLT  100

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             T+D VFASRP   V + LG+N ++F  +PYG +WR +RK+ TLEL++  RL+KL+HVR  
Sbjct  101   THDRVFASRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKLKHVREG  160

Query  524   EVEHCIGDLY----------SMCHENGE---VNLSEWFEHVTLNITLRLLVGKRFSRIAK  664
             EV+ C+ +LY          S  H N +   V +++WFE VTLN  LR+ VG+R +  + 
Sbjct  161   EVKTCLKELYDFWERTNNYKSSDHNNNKKVLVEMNKWFEDVTLNAILRVTVGQRCNSSSS  220

Query  665   H--------LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWL  820
                       KE +++     G FV SD +P L W DIGG  + +K+ ++E+D +   WL
Sbjct  221   QEDTDHEGAWKEELTKFFAFSGKFVVSDSLPFLRWFDIGGDERAMKKNARELDVLAQGWL  280

Query  821   QEHIRNRKEddddqsd----fmdVMLSSLPEDAV-ISGHKRDtiikattlililtGSEST  985
              EH R R+       +    FMDVMLS L +DA  + G   DTI KAT L LIL  S+++
Sbjct  281   DEHKRKRESGQMINKEGHEDFMDVMLSILRDDAQQLPGDDADTINKATCLALILAASDTS  340

Query  986   AETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPG  1165
               TL W  SLLLN+   +K AQ+E+D+H+GK R V E DIKNL Y QAIIKE +RLYP G
Sbjct  341   KITLTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAG  400

Query  1166  PLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGY  1345
             PL+ P  + EDC +  Y +P GT L +N+ K+HRDPRVW EP +FKPER F   H  I  
Sbjct  401   PLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPER-FLTTHKHIDV  459

Query  1346  VGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPK  1525
              G++FE LPFS GRRMCPG +F++ V  LTLA LL GF+  TP+  PVDMSEG+ + L K
Sbjct  460   RGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVK  519

Query  1526  LTPIQVLLTPRL  1561
              TP++VL+TPRL
Sbjct  520   TTPVKVLITPRL  531



>emb|CDY23316.1| BnaA08g12300D [Brassica napus]
Length=523

 Score =   448 bits (1152),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 225/486 (46%), Positives = 313/486 (64%), Gaps = 19/486 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PE  G+WP IGHLHLL G+  +  RTLG MA++YGP   LRLGS  A VVSS EV KEC
Sbjct  32    APEPSGSWPIIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSSEAFVVSSFEVAKEC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HVR
Sbjct  92    FTVNDKALASRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATIELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF----------S  652
              SE+   + DLYS+  + G      VNL  W E +TLN+ +R++ GKR+          +
Sbjct  152   VSEISMGVKDLYSLWVKKGGSEPVMVNLKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDT  211

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
               A+  ++ +++  +L G+F  SD  P+L W D+ G+ K +K+   E+D I+  W++ H 
Sbjct  212   EEARQCQKAITKFFHLIGIFTMSDAFPTLGWFDLQGHEKEMKKTGSELDVILERWIENHR  271

Query  833   RNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLIW  1003
             + RK   + ++D   + ++ SL E   +S  + D      +  L L   GS++TA TL W
Sbjct  272   QQRKVSGNKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTW  331

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               +LLLNN   +K AQDE+D+ VG DR VE+SDI+NL Y QAIIKE LRLYP GPL GPR
Sbjct  332   AIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPR  391

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EAMEDC +  YH+  GTRLI+N+ K+ RDP+VW EP EF+PER+   E       G++FE
Sbjct  392   EAMEDCTVAGYHVACGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNFE  451

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
              +PF  GRR CPG + ++QV+ L LAR L  F++ T + + VDMSE  G+ +PK TP++V
Sbjct  452   LIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEV  511

Query  1544  LLTPRL  1561
             +++PRL
Sbjct  512   MISPRL  517



>gb|KCW68803.1| hypothetical protein EUGRSUZ_F02402, partial [Eucalyptus grandis]
Length=525

 Score =   448 bits (1152),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 240/499 (48%), Positives = 316/499 (63%), Gaps = 16/499 (3%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             +I +  R  +  G   P   P A GAWP  GHLHLL G  P   TLG MADKYGP+F ++
Sbjct  27    LITRILRKKRTTGDQPP---PSAAGAWPITGHLHLLGGPDPPHITLGQMADKYGPIFAIK  83

Query  284   LGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKM  463
             LGSH AIVVS  E+ KECFTTND  F +RP     + LGYN A+   +PYG YWR VRK+
Sbjct  84    LGSHQAIVVSGSELAKECFTTNDKAFCNRPKYLAAELLGYNYAMLGFSPYGPYWRHVRKI  143

Query  464   VTLELMTVSRLKKLRHVRTSEVEHCIGDLY--SMCHENGEVNLSEWFEHVTLNITLRLLV  637
              TLEL++   L+KLRHVR + V   I + Y  S    N  + +  WF  +T N+  +++ 
Sbjct  144   ATLELLSNHTLEKLRHVREAVVRASIKEAYERSNAQGNTPIEMKSWFHALTFNVIFKMVG  203

Query  638   GKRF--SRIAKHLKEVVSRA-------LYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSK  790
             GK+   +  ++  K+   R          L G FV SDV+P L W D+GGY+K +K  +K
Sbjct  204   GKQSDGTTASEEDKDQNDRCRIALKSFFVLSGQFVASDVLPYLRWFDVGGYVKAMKRTAK  263

Query  791   EMDEIIGTWLQEHIRNRK-EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlilil  967
             E+D+++  WL EH R R   + +   DFMDVMLS L     +  +  DTI KAT L LI 
Sbjct  264   ELDDVVEGWLDEHKRKRACGEAEGDRDFMDVMLSILGTADELPSYDADTINKATCLALIS  323

Query  968   tGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGL  1147
              G+++TA TL W  SLLLNN H +K AQ E+D  +G++R V ESD+KNL Y QAIIKE L
Sbjct  324   GGTDTTAVTLTWALSLLLNNRHVLKKAQQELDSQIGRERQVTESDVKNLVYLQAIIKETL  383

Query  1148  RLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDE  1327
             RLYP  PLS P E++EDC IG Y +P GTRL+LN+ KLH++P VW  P EF+PER F   
Sbjct  384   RLYPAAPLSVPHESVEDCTIGGYRVPAGTRLLLNISKLHKNPLVWPAPLEFRPER-FLTT  442

Query  1328  HASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGL  1507
             H  +   G++FEYLPF  GRRMCP ++F+LQ + + LA +L  F I T    PVDM+ G+
Sbjct  443   HKDLDVRGQNFEYLPFGSGRRMCPAVSFALQALHIVLATVLHSFEIETASDGPVDMTAGM  502

Query  1508  GIALPKLTPIQVLLTPRLP  1564
             G+  P++TP++V+LTPRLP
Sbjct  503   GVTSPRVTPLEVILTPRLP  521



>ref|XP_010064743.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   447 bits (1151),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 240/499 (48%), Positives = 316/499 (63%), Gaps = 16/499 (3%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             +I +  R  +  G   P   P A GAWP  GHLHLL G  P   TLG MADKYGP+F ++
Sbjct  27    LITRILRKKRTTGDQPP---PSAAGAWPITGHLHLLGGPDPPHITLGQMADKYGPIFAIK  83

Query  284   LGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKM  463
             LGSH AIVVS  E+ KECFTTND  F +RP     + LGYN A+   +PYG YWR VRK+
Sbjct  84    LGSHQAIVVSGSELAKECFTTNDKAFCNRPKYLAAELLGYNYAMLGFSPYGPYWRHVRKI  143

Query  464   VTLELMTVSRLKKLRHVRTSEVEHCIGDLY--SMCHENGEVNLSEWFEHVTLNITLRLLV  637
              TLEL++   L+KLRHVR + V   I + Y  S    N  + +  WF  +T N+  +++ 
Sbjct  144   ATLELLSNHTLEKLRHVREAVVRASIKEAYERSNAQGNTPIEMKSWFHALTFNVIFKMVG  203

Query  638   GKRF--SRIAKHLKEVVSRA-------LYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSK  790
             GK+   +  ++  K+   R          L G FV SDV+P L W D+GGY+K +K  +K
Sbjct  204   GKQSDGTTASEEDKDQNDRCRIALKSFFVLSGQFVASDVLPYLRWFDVGGYVKAMKRTAK  263

Query  791   EMDEIIGTWLQEHIRNRK-EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlilil  967
             E+D+++  WL EH R R   + +   DFMDVMLS L     +  +  DTI KAT L LI 
Sbjct  264   ELDDVVEGWLDEHKRKRACGEAEGDRDFMDVMLSILGTADELPSYDADTINKATCLALIS  323

Query  968   tGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGL  1147
              G+++TA TL W  SLLLNN H +K AQ E+D  +G++R V ESD+KNL Y QAIIKE L
Sbjct  324   GGTDTTAVTLTWALSLLLNNRHVLKKAQQELDSQIGRERQVTESDVKNLVYLQAIIKETL  383

Query  1148  RLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDE  1327
             RLYP  PLS P E++EDC IG Y +P GTRL+LN+ KLH++P VW  P EF+PER F   
Sbjct  384   RLYPAAPLSVPHESVEDCTIGGYRVPAGTRLLLNISKLHKNPLVWPAPLEFRPER-FLTT  442

Query  1328  HASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGL  1507
             H  +   G++FEYLPF  GRRMCP ++F+LQ + + LA +L  F I T    PVDM+ G+
Sbjct  443   HKDLDVRGQNFEYLPFGSGRRMCPAVSFALQALHIVLATVLHSFEIETASDGPVDMTAGM  502

Query  1508  GIALPKLTPIQVLLTPRLP  1564
             G+  P++TP++V+LTPRLP
Sbjct  503   GVTSPRVTPLEVILTPRLP  521



>ref|XP_007017410.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14635.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=628

 Score =   451 bits (1160),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 244/482 (51%), Positives = 323/482 (67%), Gaps = 17/482 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA  +WP +GHLHLL GR P   TL  MADKYGP+F ++LG   A+VVSS E  KEC 
Sbjct  145   APEAGNSWPVLGHLHLLAGRQPAHLTLSAMADKYGPIFTIKLGVRRALVVSSWETAKECL  204

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND  FA+RP     + LGYN A+F  APYG YWR++RK+ TLEL++  RL  L+HVR 
Sbjct  205   TTNDKAFATRPKNISMEVLGYNHAMFGFAPYGPYWRNMRKITTLELLSNHRLDMLKHVRE  264

Query  521   SEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRFSRIAK-----H  667
             SE++  + +LY +  EN        V + +WF   T N+ L+++VGKR S +        
Sbjct  265   SEMKVSLQELYQLWKENKNSSDKVLVEMDKWFRDATANVILKMIVGKRISSLGNDAESGR  324

Query  668   LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK-  844
              K+ +     L G F+ +D  P L W+DIGG  + +K+V K ++E+   WLQEH + R  
Sbjct  325   WKKALKEFFELSGKFLVADAFPFLRWLDIGGDERLMKKVKKVLNEVAEEWLQEHKQKRAS  384

Query  845   -EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
              E  D++ DFMDVMLS L +      +  DTI KAT LILIL  ++ TA TL W  +LLL
Sbjct  385   GEFRDEEEDFMDVMLSILTD---AKEYDADTINKATCLILILAATDPTAVTLTWCLALLL  441

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NN  A+K AQ E+D+H+GKD+ VEE+DIKNL Y QAIIKE LRL+P GPL+ P E+ME+C
Sbjct  442   NNRDALKKAQQEIDIHIGKDKPVEENDIKNLVYLQAIIKETLRLHPAGPLAVPHESMENC  501

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +  YHIP GT L++NL K+HRD RVWS+P +F+PER F   H +    G++FE +PFS 
Sbjct  502   TVNGYHIPAGTELLINLYKIHRDSRVWSDPYKFQPER-FLTTHKNFDVRGQNFELIPFSS  560

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRRMCPG++F+LQVVQLTLA LL GF+++TP   PVDM E  G++  K TP++V ++PRL
Sbjct  561   GRRMCPGVSFALQVVQLTLANLLHGFDLATPFDEPVDMREAAGLSNFKATPLEVSISPRL  620

Query  1562  PN  1567
             PN
Sbjct  621   PN  622


 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = +2

Query  233  RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEA  412
            R L   A  YGP+F ++LG   A++VS+ E+ KEC +TND VFA+RP     + LGYN A
Sbjct  21   RLLFKRAGNYGPIFTIKLGLSQAVIVSNRELAKECLSTNDKVFATRPKSIAFEILGYNYA  80

Query  413  VFALAPYGRYWRDVRKMVT-LELMTVSRLKKLRHV  514
            VF  +PYG YW  +RK+ T L+++ V+   KL  V
Sbjct  81   VFGFSPYGSYWHHIRKLATVLQVLLVAINFKLASV  115



>gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita]
Length=516

 Score =   447 bits (1150),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 235/479 (49%), Positives = 315/479 (66%), Gaps = 13/479 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVAR-TLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             PEA GAWPF+GHL+++ G   +   +LG++ADK+GP+FG+R+G H A+VVSS EV+KE F
Sbjct  34    PEAGGAWPFLGHLNIISGHTGLPHVSLGNLADKHGPIFGIRIGVHRAVVVSSSEVIKELF  93

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND   +SRPS+  GK+L Y+ A+   + YG YWR +RK+V+LEL +  R++  R+VR 
Sbjct  94    TTNDAAVSSRPSVKAGKHLAYDYAMLGFSSYGTYWRQMRKLVSLELFSARRVELQRNVRV  153

Query  521   SEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRFS-----RIAKH  667
             SE  H I +LYS   E  +      V + E F  +++N+ L+++ GKRFS       A+ 
Sbjct  154   SETAHFINELYSAWEERRDGSSRVSVEMKELFGELSMNVILKMVAGKRFSGGDDAEEARR  213

Query  668   LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKE  847
              + V+    +L G+FV SD  P L W+D+GG+ + +K  ++EMDE++G WL EH R    
Sbjct  214   CRRVMREFFHLAGLFVLSDAFPYLGWLDLGGHERRMKRTAEEMDELVGEWLAEHRRKEYS  273

Query  848   ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
              +    DFMDVMLS +        +  DTIIKAT   LI  G+++TA   IW  +LLLNN
Sbjct  274   GEGKAQDFMDVMLSEVKGANFECEYDVDTIIKATCGTLIAGGTDTTAVVFIWALALLLNN  333

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
             PH ++ AQ E+D HVGK R V ESD+ NL Y QAI KE LRLYPPGPL G R   +DC +
Sbjct  334   PHVLQKAQHELDTHVGKQRRVNESDLNNLVYLQAITKETLRLYPPGPLGGTRRLTQDCHV  393

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
             G YHIPK T LI+NL KLHRDPRVWS+P EF+PER+   E  S+   G+ FE +PFS GR
Sbjct  394   GGYHIPKETWLIVNLWKLHRDPRVWSDPSEFRPERFLNGE-KSMDVKGQDFELIPFSAGR  452

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             R+CPG NF LQ++ L LA LLQ F++S      +DMSE  G+   K TP+ VL+ PRLP
Sbjct  453   RICPGTNFGLQMLHLVLASLLQAFDLSRVSNEEIDMSESAGLTNIKATPLDVLIAPRLP  511



>ref|XP_009109920.1| PREDICTED: cytochrome P450 82C4 [Brassica rapa]
Length=525

 Score =   447 bits (1150),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 225/486 (46%), Positives = 314/486 (65%), Gaps = 19/486 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PE  GAWP IGHLHLL G+  +  RTLG MA++YGP   LRLGS+ A VVSS EV KEC
Sbjct  32    APEPSGAWPIIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSNEAFVVSSFEVAKEC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HVR
Sbjct  92    FTVNDKALASRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATVELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF----------S  652
              SE+   + DLYS+  + G      V+L  W E +TLN+ +R++ GKR+          +
Sbjct  152   VSEISMGVKDLYSLWVKKGGSEPIIVDLKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDT  211

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
               A+  ++ +++  +L G+F  SD  P+L W D+ G+ K +K+   E+D I+  W++ H 
Sbjct  212   EEARQCQKAITKFFHLIGIFTMSDAFPTLGWFDLQGHEKEMKKTGSELDVILERWIENHR  271

Query  833   RNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLIW  1003
             + RK   + ++D   + ++ SL E   +S  + D      +  L L   GS++TA TL W
Sbjct  272   QQRKVSGNKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTW  331

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               +LLLNN   +K AQDE+D+ VG DR VE+SDI+NL Y QAIIKE LRLYP GPL GPR
Sbjct  332   AIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPR  391

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EAMEDC +  YH+  GTRLI+N+ K+ RDP+VW EP EF+PER+   E       G++FE
Sbjct  392   EAMEDCTVAGYHVACGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDVRGQNFE  451

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
              +PF  GRR CPG + ++QV+ L LAR L  F++ T + + VDMSE  G+ +PK TP++V
Sbjct  452   LIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEV  511

Query  1544  LLTPRL  1561
             +++PRL
Sbjct  512   MISPRL  517



>ref|XP_007017414.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14639.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=755

 Score =   454 bits (1167),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 248/512 (48%), Positives = 330/512 (64%), Gaps = 17/512 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+A  +WP IGHLHLL G  P    LG MADKYGP+F +++G++ A+VVS+ E  KEC 
Sbjct  43    APQAGSSWPVIGHLHLLGGPQPPHIVLGDMADKYGPIFTIKMGAYRALVVSNWETAKECL  102

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND  FASRP      +L Y+ A+F  A YG YWR +RK+ TLEL++  RL  L+HVR 
Sbjct  103   TTNDKAFASRPKTHAIDFLTYDHAMFGFASYGPYWRQMRKVATLELLSNYRLDMLKHVRQ  162

Query  521   SEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF-----SRIAKH  667
             SE++  + +LY    EN        +++  WF  VTLN+ LR++VGKR          + 
Sbjct  163   SEIKTSLKELYQHWSENKGSSDKVLLDMKAWFRDVTLNVMLRMIVGKRIPSSGSDAEGER  222

Query  668   LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKE  847
              K+ +     L G FV SD +P L W+D+GG  K +K+V KE+DE+   WLQ+H +    
Sbjct  223   WKDALQDFFDLSGKFVISDALPFLRWLDVGGDEKFMKKVRKELDEVAEGWLQDHKQKTAS  282

Query  848   -ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLN  1024
              + +   DFMDVM S L  DA    H  +TI KA  L LIL G ++T  TL W  SLLLN
Sbjct  283   GNQESDQDFMDVMFSILSTDA--GKHDAETINKANCLNLILGGFDTTTVTLTWALSLLLN  340

Query  1025  NPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCK  1204
             N  A+K AQ+E+D+HVG+D+LVEESD+K L Y QAI+KE LRLYP GPLS P E+ EDC 
Sbjct  341   NRDALKKAQEELDIHVGRDKLVEESDVKKLIYLQAIVKETLRLYPAGPLSVPHESTEDCT  400

Query  1205  IGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGG  1384
             +  YHIP GTRL++NL K+HRDPRVWS+P EF+PER F   +      G++FE +PF  G
Sbjct  401   VSGYHIPAGTRLLINLYKIHRDPRVWSDPCEFQPER-FLTTYKDFDVRGQNFELIPFGSG  459

Query  1385  RRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             RRMCPG++F+LQV++LTLA LLQGF + TP+   VDMSE +G+   K +P++VL+TPRLP
Sbjct  460   RRMCPGVSFALQVLELTLANLLQGFELGTPLDELVDMSEAIGMTNLKASPLEVLITPRLP  519

Query  1565  NL--FPTMLNKN**HFDCNPNLKCCPFVLFQL  1654
                 F +ML K    +   P  + C    F++
Sbjct  520   AAQNFSSMLTKIHRDYKFQPQSEDCGLEWFEM  551


 Score = 95.5 bits (236),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +2

Query  155  LRVPEAPGAWPFIGHLH-LLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVK  331
            ++  E  GA P +GH+H LL G  P   TLG + DKYGP+F ++LG  PA+V+S+ E+ K
Sbjct  659  VKALEVSGARPLLGHIHNLLEGPKPAHITLGDLVDKYGPIFTIKLGMKPALVISNSELAK  718

Query  332  ECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRY  442
            EC TTN+  F +R      ++ GYN A+   +PYG Y
Sbjct  719  ECLTTNNEAFVNRLKSLAAEFFGYNYAMLRFSPYGSY  755



>ref|XP_004154898.1| PREDICTED: cytochrome P450 82A3-like [Cucumis sativus]
Length=501

 Score =   445 bits (1144),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 233/473 (49%), Positives = 314/473 (66%), Gaps = 18/473 (4%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE PG WP IGHLHLL+   P   TL   AD YGP+F L+LG + A+VVSS E+ KECFT
Sbjct  43    PELPGRWPVIGHLHLLNATEPAHITLAKFADTYGPIFTLKLGMNKALVVSSWEIAKECFT  102

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND +FASRP +   K LGYN  +  L+PYG YWR +RK+ TLEL+T  RL +L+H+R  
Sbjct  103   TNDRIFASRPKLVASKLLGYNYTMLGLSPYGSYWRHIRKLATLELLTNRRLHQLQHIREF  162

Query  524   EVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVVSRALY  697
             EV+  I  LY +C  N +  V ++ WF  +TLN   R++VGKRFS             + 
Sbjct  163   EVQTSIKKLYELCIRNKKSLVEMNTWFGDITLNTIFRMVVGKRFS-------------MA  209

Query  698   LGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmd  877
             + G+FVPSD  P L+W D+GG+ K +K+ +K +DE+   WLQEH R R++ ++ ++DFMD
Sbjct  210   MDGMFVPSDSFPFLKWFDLGGHEKAMKKTAKILDEVFDKWLQEH-RLRRKFEESENDFMD  268

Query  878   VMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDE  1057
             V+LS++ +    S +  DT+IK++ L LIL G ++T  T+IWT SLLLNNP A+K AQ E
Sbjct  269   VLLSNVKDAEQFSNYDADTVIKSSCLALILAGFDTTTVTMIWTLSLLLNNPEALKRAQLE  328

Query  1058  MDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTR  1237
             +D  +G+ + V+ESDI+ LKY +AI+KE LRLYPPGPL  P E+ +DCKI  YHIP GTR
Sbjct  329   LDEQIGRHKQVKESDIEKLKYLEAIVKEALRLYPPGPLGVPHESTDDCKIAGYHIPAGTR  388

Query  1238  LILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSL  1417
             L++N+ KL RDP VW +P EF+PER F   H      GK    +PF  GRRMCP  +F+L
Sbjct  389   LMVNIQKLQRDPCVWEDPCEFRPER-FLTSHKDFDVRGKCPMLIPFGTGRRMCPASSFAL  447

Query  1418  QVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL-PNLF  1573
             Q++ L LA LL GF I  P    +DM E  G+   K  P++V+++PRL P L+
Sbjct  448   QIMHLALANLLHGFEIERPSQDLIDMEESAGMVSIKKEPLRVIISPRLQPQLY  500



>gb|KGN59915.1| Cytochrome P450 [Cucumis sativus]
Length=521

 Score =   446 bits (1146),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 238/480 (50%), Positives = 319/480 (66%), Gaps = 12/480 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE PG WP IGHLHLL+   P   TL   AD YGP+F L+LG + A+VVSS E+ KECFT
Sbjct  43    PELPGRWPVIGHLHLLNATEPAHITLAKFADTYGPIFTLKLGMNKALVVSSWEIAKECFT  102

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND +FASRP +   K LGYN  +F L+PYG YWR +RK+ TLEL+T  RL +L+H+R  
Sbjct  103   TNDRIFASRPKLVASKLLGYNYTMFGLSPYGSYWRHIRKLATLELLTNRRLHQLQHIREF  162

Query  524   EVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFSRI---AKHLKEVVSR  688
             EV+  I  LY +C  N +  V ++ WF  +TLN   R++VGKRFS     + +  +V   
Sbjct  163   EVQTSIKKLYELCIRNKKSLVEMNTWFGDITLNTIFRMVVGKRFSMAMDGSANGNDVYRM  222

Query  689   ALY----LGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddd  856
             AL       GVFVPSD  P L+W D+GG+ K +K+ +K +DE+   WLQEH R R++ ++
Sbjct  223   ALRDFFEWFGVFVPSDSFPFLKWFDLGGHEKAMKKTAKILDEVFDKWLQEH-RLRRKFEE  281

Query  857   dqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHA  1036
              ++DFMDV+LS++ +    S +  DT+IK++ L LIL G ++T  T+IWT SLLLNNP A
Sbjct  282   SENDFMDVLLSNVKDAEQFSNYDADTVIKSSCLALILAGFDTTTVTMIWTLSLLLNNPEA  341

Query  1037  IKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKY  1216
             +K AQ E+D  +G+ + V+ESDI+ LKY +AI+KE LRLYPPGPL  P E+ +DCKI  Y
Sbjct  342   LKRAQLELDEQIGRHKQVKESDIEKLKYLEAIVKEALRLYPPGPLGVPHESTDDCKIAGY  401

Query  1217  HIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMC  1396
             HIP GTRL++N+ KL RDP VW +P EF+PER F   H      GK    +PF  GRRMC
Sbjct  402   HIPAGTRLMVNIQKLQRDPCVWEDPCEFRPER-FLTSHKDFDVRGKCPMLIPFGTGRRMC  460

Query  1397  PGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL-PNLF  1573
             P  +F+LQ++ L LA LL GF I  P    +DM E  G+   K  P++V+++PRL P L+
Sbjct  461   PASSFALQIMHLALANLLHGFEIERPSQDLIDMEESAGMVSIKKEPLRVIISPRLQPQLY  520



>ref|XP_002282118.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   446 bits (1146),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 247/487 (51%), Positives = 322/487 (66%), Gaps = 22/487 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHG--RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
              PEA GAWP IGHLHLL G   LP    LG MADKYG VF +RLG   A+VVSS ++ KE
Sbjct  38    APEAAGAWPIIGHLHLLGGSKNLP-HLLLGTMADKYGAVFSVRLGLERAVVVSSWQMAKE  96

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFTT+DL  ASRP + + K LGYN+A+FA +P+G YWR+VRK+ TLEL++  RL+ L++V
Sbjct  97    CFTTHDLALASRPQLVISKQLGYNDAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNV  156

Query  515   RTSEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF--------S  652
             R SEVE C+ +LY +  E         V++ +WF  +TLN+ L ++ GKR+         
Sbjct  157   RISEVETCMKELYKLWAEKKNEAGVVLVDMKQWFGDLTLNVILMMVAGKRYFGYTAESQE  216

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
             +  +  ++ +     L G+FV SD +P L W+D+GG++K  K+ +KEMD I   WL+EH 
Sbjct  217   KETQRCQKSIREFFRLLGLFVVSDALPFLGWLDVGGHLKATKKTAKEMDGIAQEWLEEH-  275

Query  833   RNRKEd--dddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWT  1006
             R RK+    +   D MDVMLS L      +G+  DTI KAT+LILI  GS++T+ TL W 
Sbjct  276   RQRKDSGEANGNQDLMDVMLSILA-GTDPTGYDADTINKATSLILIAGGSDTTSVTLTWA  334

Query  1007  TSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPRE  1186
              SLLLNNP  ++ AQ+E+D HVGK RLV E D+  L Y QAI+KE LRLYP  PLSGPR+
Sbjct  335   ISLLLNNPCMLRKAQEELDTHVGKGRLVNEVDLSKLVYLQAIVKETLRLYPAFPLSGPRQ  394

Query  1187  AMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEY  1366
               +D  +G Y IPKGTRL+LNL K+ RDP +W  P EF+PER F   H  I    K+FE+
Sbjct  395   FNQDSILGGYRIPKGTRLVLNLTKIQRDPSIWLNPTEFQPER-FLTTHKDIDMRVKNFEF  453

Query  1367  LPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVL  1546
              PF GGRR+CPG  F+LQV+ LTLA  L  F +STP    VDMSE LGI   K TP++VL
Sbjct  454   TPFGGGRRICPGATFALQVLHLTLANFLHKFQLSTPSDATVDMSESLGITNIKSTPLEVL  513

Query  1547  LTPRLPN  1567
             ++PRL +
Sbjct  514   ISPRLSS  520



>ref|XP_010466938.1| PREDICTED: cytochrome P450 82G1-like [Camelina sativa]
Length=534

 Score =   446 bits (1146),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 242/493 (49%), Positives = 326/493 (66%), Gaps = 11/493 (2%)
 Frame = +2

Query  116   YKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSH  295
             + R   +  ++  L +PE  GA P  GH+HLL G+  +   L  M+DK GP+F L+LG +
Sbjct  43    FCRKKSSKCEVNSLTIPEPLGALPLFGHIHLLRGKELICMKLAAMSDKLGPIFSLKLGFY  102

Query  296   PAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLE  475
               +V S  + VK+CFTTNDL  A+RP++A G+Y+GYN A+ ALAPYG YWR++RK+ T+ 
Sbjct  103   KLVVASDPKTVKDCFTTNDLALATRPNIAFGRYVGYNNAIMALAPYGEYWRELRKIATVH  162

Query  476   LMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKR--F  649
             L +   ++ L HVR+SEV   I  LY        V +    E +T NI LR +VGKR  F
Sbjct  163   LFSNQSIEMLGHVRSSEVNTFIKHLYKKSGSTSTVKIDMLCEFLTFNIILRKMVGKRIGF  222

Query  650   SRIAKH---LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWL  820
               +       KE + R+ YL  V +  DVIP L W+D    I  +K   K++D +I  WL
Sbjct  223   GEVKSEEWRYKEAMKRSEYLAVVPMIGDVIPWLGWLDFAK-ISQMKTTFKDIDVVITKWL  281

Query  821   QEHIRNR-KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETL  997
             QEH++ R + + D +   MD++L  LPED VI GH RD I+KATTL+L LTGS+ST+ TL
Sbjct  282   QEHLKKRSRNEKDGERTIMDLLLDILPEDVVICGHVRDVIVKATTLVLTLTGSDSTSITL  341

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
              W  SLLLNNP  +K AQ+E+D  VGK R VEESDI NLKY QAI+KE  RLYPP PL+G
Sbjct  342   TWAISLLLNNPATLKAAQEEIDNCVGKGRWVEESDIPNLKYLQAIVKETHRLYPPAPLTG  401

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
              REA EDC +G Y + KGTRL++N+ KLHRDP++W +P+ FKPER F +E +  G     
Sbjct  402   IREASEDCFVGGYPVKKGTRLLVNIWKLHRDPKIWPDPKIFKPER-FMEEKSQCG--KSD  458

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FEY+PFS GRR CPG+N  L+VV + LA+L+QGF +    G P+DM+EG G+ALPK+ P+
Sbjct  459   FEYIPFSSGRRSCPGINLGLRVVHIVLAKLIQGFELRKASGEPLDMAEGPGLALPKIKPV  518

Query  1538  QVLLTPRL-PNLF  1573
             +V++ PRL P L+
Sbjct  519   EVVVMPRLNPELY  531



>ref|XP_006339196.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=524

 Score =   445 bits (1144),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 226/485 (47%), Positives = 330/485 (68%), Gaps = 16/485 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHG--RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             PE PG+WP IGHL        +P+ART G ++D+YGP+F ++LG +   V+++ E  K+C
Sbjct  38    PEIPGSWPIIGHLRGFGDGKNVPLARTFGKLSDQYGPIFTIKLGMYRYCVINNWEAAKDC  97

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   A+RP     ++ GYN A F+ A YG Y+  VRK+V   +++ +RL+K++HVR
Sbjct  98    FTINDKELAARPISLAAEHYGYNYARFSFANYGPYYCQVRKLVLQNVLSSTRLEKVKHVR  157

Query  518   TSEVEHCIGDLYSMC---HENGEVNLSEWFEHVTLNITLRLLVGKRFSRI-----AKHLK  673
             TSEVE  I +LY++C     +  +N+S+WFE +TLNI ++++ GKR+  +     A+  +
Sbjct  158   TSEVEISIKELYNLCGKGDNSNTINISKWFEKLTLNIIVKMIAGKRYISLEKDEEAQCFR  217

Query  674   EVVSRALYLGGVFVPSDVIPS--LEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKE  847
             +  ++ +YL G F+  D IP    +++D  G+IK +K++ K++D+I+ +W+ EH+  +K 
Sbjct  218   KAFAKIMYLAGEFILYDAIPFKIFKYVDFQGHIKTMKQIYKDLDDILQSWVNEHMEKKKI  277

Query  848   ddddqsdfmdV--MLSSLP-EDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
             + D+ ++   +  MLS    ED    G+ RDT+IKAT L +IL GS++TA  L W  SLL
Sbjct  278   EGDNNNEQDCIDSMLSVTKLEDFKAYGYTRDTVIKATVLSMILDGSDTTAVHLTWLMSLL  337

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNNPH +   Q E+D  VGKDR VEESDIK+L Y QAI+KE LRLYPP PL  P EA+ED
Sbjct  338   LNNPHVMSHVQKEIDNKVGKDRWVEESDIKDLVYLQAIVKEALRLYPPAPLLVPHEAVED  397

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C +  Y+IPKGTRL  N  K+ RDPRV+SEP++F PER F +EH+++   G+ FE++PF 
Sbjct  398   CTVAGYNIPKGTRLFPNAWKIQRDPRVYSEPDKFMPER-FLNEHSNVDARGQHFEFIPFG  456

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CPG+NF+ QV  LT+ RL+QGFN  TP  +PVDM+EG GI +PK  P++V++TPR
Sbjct  457   SGRRSCPGINFATQVAHLTIGRLIQGFNFGTPSNLPVDMTEGQGITMPKAKPVEVVITPR  516

Query  1559  LPNLF  1573
             L ++ 
Sbjct  517   LNSML  521



>ref|XP_002869304.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45563.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   445 bits (1144),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 229/506 (45%), Positives = 319/506 (63%), Gaps = 24/506 (5%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGL  280
              I  +K+  K N     ++ P   GAWP IGHLHLL G+  +  RTLG MAD YGP   L
Sbjct  17    FIALFKKSKKPNH----VKAPAPSGAWPIIGHLHLLGGKEHLLYRTLGKMADHYGPAMSL  72

Query  281   RLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRK  460
             RLGS  A VVSS EV K+CFT ND   ASRP  A  K++GYN AVF  APY  +WR++RK
Sbjct  73    RLGSSEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRK  132

Query  461   MVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITL  625
             + T+EL++  RL+ L+HVR SE+   + DLYS+  + G      V+L  W E +TLN+ +
Sbjct  133   IATIELLSNRRLQMLKHVRVSEISMGVKDLYSLWVKKGGTEPVMVDLKSWLEDMTLNMIV  192

Query  626   RLLVGKRF-----------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKG  772
             R++ GKR+           +  A   K+ +++  +L G+F  SD  P L W D+ G+ K 
Sbjct  193   RMVAGKRYFGGGGSQSSEDTEEAMQCKKAIAKFFHLIGIFTVSDAFPRLGWFDLQGHEKE  252

Query  773   LKEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikat  949
             +K+   E+D I+  W++ H + R+     ++D   + ++ SL E   +S  + D      
Sbjct  253   MKQTGSELDVILERWIENHRQQRQVSGTKENDSDFIDVMLSLAEQGKLSHLQYDANTSIK  312

Query  950   tlililt--GSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYF  1123
             +  L L   GS+++A TL W  SLLLNN   +K AQDE+D+HVG D+ VE+SDI+NL Y 
Sbjct  313   STCLALILGGSDTSASTLTWAISLLLNNKEMLKKAQDEIDLHVGTDKNVEDSDIENLVYL  372

Query  1124  QAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFK  1303
             QAIIKE LRLYP GPL GPREAMEDC++  Y++P GTRLI+N+ K+ RDP+V++EP EF+
Sbjct  373   QAIIKETLRLYPAGPLLGPREAMEDCRVAGYNVPCGTRLIVNVWKIQRDPKVYTEPNEFR  432

Query  1304  PERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGM  1483
             PER+   E       G++FE +PF  GRR CPG + ++QV+ L LAR L  F   T + +
Sbjct  433   PERFITGEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEAKTVLDL  492

Query  1484  PVDMSEGLGIALPKLTPIQVLLTPRL  1561
             PVDMSE  G+ +PK TP++VL++PRL
Sbjct  493   PVDMSESPGLTIPKATPLEVLISPRL  518



>ref|XP_007017416.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
 gb|EOY14641.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
Length=798

 Score =   454 bits (1167),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 240/492 (49%), Positives = 323/492 (66%), Gaps = 18/492 (4%)
 Frame = +2

Query  140   GKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSC  319
             G  +  + PEA GA PF+GHLHLL G  P    LG +AD YGP+F +RLG    +VVS+ 
Sbjct  304   GSGMKRKAPEASGARPFLGHLHLLGGSKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNW  363

Query  320   EVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLK  499
             E+ KECFTTND  FA+RP     + LGYN A+F  +PYG YWR +RK+VTLE+++  RL+
Sbjct  364   EIAKECFTTNDKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLE  423

Query  500   KLRHVRTSEVEHCIGDLYSMCHE------NGEV--NLSEWFEHVTLNITLRLLVGKRFSR  655
             KL+H+R SEV   I +LY +  E      +G+V   +  WF  + +N+  +++VGKR+S 
Sbjct  424   KLKHIRESEVRTSIKELYKLGVEGVSNSSSGKVLVEMKRWFWTLNINMVFKMVVGKRYSE  483

Query  656   I-AKHLKEVVSRA-------LYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIG  811
                 H K+   R          L G F   D +P L W+D+GG+ K +K+ +KE+D I+ 
Sbjct  484   AETSHGKDENDRRRKALRDFFELTGTFTVGDSLPFLRWLDLGGHEKAMKKTAKELDHILE  543

Query  812   TWLQEHIRNRKEddddqsdfmdVMLSSLPEDAV-ISGHKRDtiikattlililtGSESTA  988
              WL+EH + R   + +       M+ SL  DA  +  +  DTI KAT L LIL  S++T 
Sbjct  544   EWLEEHKQKRNSGNAESEHDFMGMMLSLLNDAAELPSYDADTINKATCLSLILAASDTTM  603

Query  989   ETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGP  1168
              TL W  SLLLNN +A+K AQ+E+D+HVG+D+LVEESDIK L Y QAIIKE LRLYP  P
Sbjct  604   VTLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIKETLRLYPAAP  663

Query  1169  LSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYV  1348
             LS P E+MEDC +  YHIP GTRL++NL K+HRDP  WS+P EF+PER F   +      
Sbjct  664   LSVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPER-FLTTYKDFDVR  722

Query  1349  GKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKL  1528
             G++FE +PF  GRRMCPG++ +LQV++LTLA LLQGF + TP+  PVDM E +GI   K+
Sbjct  723   GQNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMGEAIGITNLKV  782

Query  1529  TPIQVLLTPRLP  1564
             +P++VL+TPRLP
Sbjct  783   SPLEVLITPRLP  794


 Score = 98.2 bits (243),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 96/229 (42%), Gaps = 65/229 (28%)
 Frame = +2

Query  158  RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
            + PE  GA PF+GHL LL G  P    LG +AD YGP+F +RLG    +VVS+ E+ KEC
Sbjct  4    KAPEVSGARPFLGHLQLLGGSKPAQVVLGDLADTYGPIFTIRLGMQSTLVVSNWEMAKEC  63

Query  338  FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
            FTTN   F +RP     + LGYN A+  +                              R
Sbjct  64   FTTNHKAFVNRPRTLAAELLGYNYAMMVIGK----------------------------R  95

Query  518  TSEVEHCIG-DLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVVSRAL  694
             SEVE   G D    C  N   N  E     T+  +L  L                 R L
Sbjct  96   YSEVEASHGKDDNDRCR-NAVRNFLELTGTFTVGDSLPFL-----------------RWL  137

Query  695  YLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
             LG                  G+ K +K+ +KE+D+I+  WL+EH + R
Sbjct  138  DLG------------------GHEKAMKKTAKELDQILEKWLEEHKQKR  168


 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 71/124 (57%), Gaps = 10/124 (8%)
 Frame = +2

Query  98   NQIILKYKRDNK---NNGKLLPLRV-------PEAPGAWPFIGHLHLLHGRLPVARTLGH  247
            +QI+ K+  ++K   N+G +  +++       PEA  +WP IGHLHLL G  P    LG 
Sbjct  154  DQILEKWLEEHKQKRNSGNVESVKIRDKKRAAPEAGSSWPVIGHLHLLGGPQPPHIVLGD  213

Query  248  MADKYGPVFGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALA  427
            MA+KYG +F +++G + A+VV++ E  KEC TTND  FASRP     ++L +   +    
Sbjct  214  MAEKYGSIFTIKMGVYRALVVNNWETAKECLTTNDKAFASRPKTLAMEFLSFEHTMVGFT  273

Query  428  PYGR  439
               R
Sbjct  274  LMDR  277



>gb|KFK29809.1| hypothetical protein AALP_AA7G181800 [Arabis alpina]
Length=524

 Score =   444 bits (1143),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 234/488 (48%), Positives = 317/488 (65%), Gaps = 22/488 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PE  GAWP IGHLHLL G+  +  RTLG MAD YGP   LRLGS  A VVSS EV K+C
Sbjct  32    APEPSGAWPIIGHLHLLGGKDQLLYRTLGEMADHYGPAMSLRLGSSEAFVVSSFEVAKDC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTTND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HVR
Sbjct  92    FTTNDKALASRPMTAAAKHMGYNFAVFGFAPYSSFWREMRKIATVELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF----------S  652
              SE+   + DLYS+  + G      V+L  W E +TLN+ +R++ GKR+          +
Sbjct  152   VSEIAMGVQDLYSLWVKKGGSEPVMVDLKTWLEDMTLNMIVRMVAGKRYFGCGSVSSEDT  211

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
               A+  K+ +++  +L G+F  SD  P+L W D+ G+ K +K    E+D I+  W++ H 
Sbjct  212   DEARQCKKAIAKFFHLIGIFTVSDAFPTLTWFDLQGHEKKMKRTGSELDVILERWIENHK  271

Query  833   RNRKEddddqsdfmd---VMLSSLPEDAVIS--GHKRDtiikattlililtGSESTAETL  997
             + R +    +++  D   VMLS L E   +S   +  DT IK+T L LIL GS++TA TL
Sbjct  272   QQRNDSGTKENNDSDFIDVMLS-LAEQGKLSHLQYDADTSIKSTCLALILGGSDTTASTL  330

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
              W  +LLLNN   +K AQDE+D+ VG DR VE+SDI+NL Y QAIIKE LRLYP GPL G
Sbjct  331   TWAIALLLNNKEMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLG  390

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             PREA+E+C +  Y++ +G RLI+N+ K+ RDP+V+ EP EF+PER+   E       GK+
Sbjct  391   PREALENCTVAGYNVSRGKRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVRGKN  450

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FE +PF  GRR CPG + +LQV+ L LAR L  F + T + +PVDMSE  G+ +PK TP 
Sbjct  451   FELIPFGSGRRSCPGSSLALQVLHLGLARFLHSFEVKTILDLPVDMSESPGLTIPKATPF  510

Query  1538  QVLLTPRL  1561
             +VL++PRL
Sbjct  511   EVLISPRL  518



>ref|XP_002281431.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   443 bits (1140),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 232/490 (47%), Positives = 324/490 (66%), Gaps = 13/490 (3%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             + NKN G+      PE  GAWP +GHLHLL    P+ RT G MAD+YGP+F +RLG   A
Sbjct  28    KGNKNKGR----SPPEPSGAWPVMGHLHLLGADKPLHRTFGAMADEYGPIFSIRLGLRTA  83

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +VVSS EV KEC+TT D   A+RP     K +GY  A+FA   +G YWRDVR++  +EL+
Sbjct  84    LVVSSSEVAKECYTTKDKALANRPRSLAVKLMGYEHAMFAFERHGPYWRDVRRLAMVELL  143

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF  649
             +  + + L+HVR SEV   I +LY    +NG     V++ + FEH+  N+ +R + GKR 
Sbjct  144   SNRQHEMLKHVRDSEVTFFIQELYGQWVDNGGSPVLVDMKKKFEHLVANLVMRTVAGKRC  203

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEIIGTWLQE  826
                     + +   + L G F+ SD +P L W+D + GY   +K  ++++D++IG W++E
Sbjct  204   GNGESRWCQALGDFMNLMGQFMVSDAVPFLGWLDTVRGYTAKMKGTARQLDQVIGRWVEE  263

Query  827   HIRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRD--tiikattlililtGSESTAETL  997
             H + R     ++++   +  + S+ +DA  SGH  D  T+IKAT L ++L  +++ A TL
Sbjct  264   HRQKRLSGSINEAEQDFIHAMLSVIDDAQFSGHDHDHDTVIKATCLTVMLASNDTIAITL  323

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
              W  SLL+NNPHA+K AQ+E+D HVG+++ V ESDIK L Y QAIIKE LRLYP GPL+ 
Sbjct  324   TWALSLLMNNPHALKKAQEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLAL  383

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             P EAMEDC I  +HI  GTRL++NL KLHRDP +WS+P EF+PER F  +H  +   G+ 
Sbjct  384   PHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTIWSDPLEFQPER-FLTKHVGLDVRGQH  442

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FE LPF  GRRMCPG++F+L+++QLTLARLL GF +      P+DM+EG+G+ALPK TP+
Sbjct  443   FELLPFGSGRRMCPGISFALEILQLTLARLLHGFELGVVADSPLDMTEGVGLALPKATPL  502

Query  1538  QVLLTPRLPN  1567
             +V L PRLP+
Sbjct  503   EVTLVPRLPS  512



>ref|XP_002282085.3| PREDICTED: cytochrome P450 82A1-like [Vitis vinifera]
Length=1053

 Score =   460 bits (1183),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 239/484 (49%), Positives = 322/484 (67%), Gaps = 16/484 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTL-GHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PEA GAWP IGHLHLL G   +   L G MADKYGPVF +RLG   A+VVSS E+ KEC
Sbjct  566   APEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKEC  625

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTT+DL  ASRP +   KYLGYN A+FA +P+G YWR+VRK+ TLEL++  RL+ L++VR
Sbjct  626   FTTHDLALASRPELVAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVR  685

Query  518   TSEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF--------SR  655
              SEVE C+ +LY +  E         V++ +WF H++LN+ L+++VGKR+         +
Sbjct  686   ISEVETCMKELYKLWAEKKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEK  745

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A+  ++ +     L G+FV SD +P L W+D+GG++K +K+ +KE+D I   WL+EH R
Sbjct  746   EAQQCQKAIREFFRLLGLFVVSDALPFLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRR  805

Query  836   NRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
              +   + D       ++ S+      +G+  DTI KAT+LILI  G+++T+ TL W  SL
Sbjct  806   RKDSGEADGDQDFMDVMLSILGATDPNGYDADTINKATSLILIAGGTDTTSVTLTWAISL  865

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             LLNNPH ++ AQ+E+D HVGK+RLV E DI  L Y QAI+KE LRLYP  PLSG R+ ++
Sbjct  866   LLNNPHVLRKAQEELDTHVGKERLVNEMDISKLVYLQAIVKETLRLYPAAPLSGQRQFIQ  925

Query  1196  DCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPF  1375
             D  +G YHIPKGTRL+LNL K+ RDPRVW  P +F+P R F   +  +   GK F   PF
Sbjct  926   DSVLGGYHIPKGTRLLLNLTKIQRDPRVWLNPTKFQPSR-FLTTYKDVDVKGKHFVLTPF  984

Query  1376  SGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTP  1555
              GGRR+CPG  F+LQV+ LTLA  L  F +STP   P+DMSE  GI   K TP++VL++P
Sbjct  985   GGGRRICPGAAFALQVLPLTLANFLHKFQLSTPSNSPIDMSESFGITNIKSTPLEVLISP  1044

Query  1556  RLPN  1567
             RL +
Sbjct  1045  RLAS  1048


 Score =   442 bits (1137),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 238/499 (48%), Positives = 319/499 (64%), Gaps = 23/499 (5%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHG---RLPVARTLGHMADKYGPVFGLRLGS  292
             R    N K+     PEA  AWP IGHLHLL G   +LP   TLG+MADKYGPVF +R+G 
Sbjct  29    RSRAGNKKI----APEAAAAWPIIGHLHLLAGGSHQLPHI-TLGNMADKYGPVFTIRIGL  83

Query  293   HPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTL  472
             H A+VVSS E+ KEC T ND V +SRP +   K LGYN A+F  +PYG YWR++RK+++L
Sbjct  84    HRAVVVSSWEMAKECSTANDQVSSSRPELLASKLLGYNYAMFGFSPYGSYWREMRKIISL  143

Query  473   ELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG------EVNLSEWFEHVTLNITLRLL  634
             EL++ SRL+ L+ VR SEV   I +LY +  E         V + +WF  +TLN+ LR++
Sbjct  144   ELLSNSRLELLKDVRASEVVTSIKELYKLWAEKKNESGLVSVEMKQWFGDLTLNVILRMV  203

Query  635   VGKRF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSK  790
              GKR+        ++ A+  + V     +L G+FV +D IP L W+D G + K LK+ + 
Sbjct  204   AGKRYFSASDASENKQAQRCRRVFREFFHLSGLFVVADAIPFLGWLDWGRHEKTLKKTAI  263

Query  791   EMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililt  970
             EMD I   WL+EH R +   DD+ +     ++ S+ +   + G+  DTI KAT L LI  
Sbjct  264   EMDSIAQEWLEEHRRRKDSGDDNSTQDFMDVMQSVLDGKNLGGYDADTINKATCLTLISG  323

Query  971   GSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLR  1150
             GS++T  +L W  SL+LNN   +K AQ+E+D+ VGK+RLV E DI  L Y QAI+KE LR
Sbjct  324   GSDTTVVSLTWALSLVLNNRDTLKKAQEELDIQVGKERLVNEQDISKLVYLQAIVKETLR  383

Query  1151  LYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEH  1330
             LYPPGPL G R+  EDC +G YH+ KGTRLI+NL K+ +DPR+WS+P EF+PER F   H
Sbjct  384   LYPPGPLGGLRQFTEDCTLGGYHVSKGTRLIMNLSKIQKDPRIWSDPTEFQPER-FLTTH  442

Query  1331  ASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLG  1510
               +   GK FE++PF  GRR CPG+ F LQV+ LTLA  L  F  STP    V+M E LG
Sbjct  443   KDVDPRGKHFEFIPFGAGRRACPGITFGLQVLHLTLASFLHAFEFSTPSNEQVNMRESLG  502

Query  1511  IALPKLTPIQVLLTPRLPN  1567
             +   K TP++VL++PRL +
Sbjct  503   LTNMKSTPLEVLISPRLSS  521



>ref|XP_003634362.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   443 bits (1140),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 238/484 (49%), Positives = 321/484 (66%), Gaps = 16/484 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTL-GHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PEA GAWP IGHLHLL G   +   L G MADKYGPVF +RLG   A+VVSS E+ KEC
Sbjct  38    APEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKEC  97

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTT+DL  ASRP +   KYLGYN ++FA +P+G YWR+VRK+ TLEL++  RL+ L++VR
Sbjct  98    FTTHDLALASRPQLVAAKYLGYNYSMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVR  157

Query  518   TSEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF--------SR  655
              SEVE C+ +LY +  E         V++ +WF H++LN+ L+++VGKR+         +
Sbjct  158   ISEVETCMKELYKLWAETKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEK  217

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A+  ++ +     L G+FV SD +P L W+D+GG++K +K+ +KE+D I   WL+EH R
Sbjct  218   GAQQCQKAIREFFRLMGLFVVSDALPFLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRR  277

Query  836   NRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
              +   + D       ++ S+      + +  DTI KAT LILI  G+++T+ TL W  SL
Sbjct  278   RKDSGEADGDQDFMDVMLSILGGRDTTDYDADTINKATALILIGGGTDTTSGTLTWAISL  337

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             LLNNPH ++ AQ+E+D HVGK+R+V E DI  L Y QAI+KE LRL P  PLSGPR+ ++
Sbjct  338   LLNNPHILRKAQEELDAHVGKERIVNEMDISKLVYLQAIVKETLRLNPTAPLSGPRQFIQ  397

Query  1196  DCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPF  1375
             D  +G Y+I KGTRLILNL K+ RDPRVW  P EF+P+R F   H  +   GK FE  PF
Sbjct  398   DSILGGYYISKGTRLILNLTKIQRDPRVWLNPMEFQPDR-FLTTHKDVDVRGKHFELTPF  456

Query  1376  SGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTP  1555
              GGRR+CPG  F+LQV+ LTLA  L  F +STP   PVDMSE  G+   K TP++VL++P
Sbjct  457   GGGRRICPGAIFALQVLHLTLANFLHRFQLSTPSDAPVDMSESFGLTNIKSTPLEVLISP  516

Query  1556  RLPN  1567
             RL +
Sbjct  517   RLAS  520



>ref|XP_010447469.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=527

 Score =   443 bits (1140),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 224/487 (46%), Positives = 311/487 (64%), Gaps = 21/487 (4%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             P+  GAWP IGHLHLL G+  +  RTLG +AD+YGP   LRLGS  A VVSS EV K+CF
Sbjct  35    PKPSGAWPIIGHLHLLVGKEQLLYRTLGRLADRYGPTMSLRLGSSEAFVVSSFEVAKDCF  94

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HV  
Sbjct  95    TVNDKALASRPMTAAAKHMGYNYAVFGFAPYNAFWREMRKIATIELLSNRRLQMLKHVSV  154

Query  521   SEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRF------------  649
             SE+   + DLYS+  +NG      V+L  W +++TLN+ +R++ GKR+            
Sbjct  155   SEISMGVKDLYSLWVKNGGSEPVMVDLRRWLDNMTLNMIVRMVAGKRYFGGVVGSESSED  214

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
             +   +  K  +S+  +L G+F  SD  PSL W D  G+ K +K+   E+D I+  W+  H
Sbjct  215   TEEGRQCKTAISKFFHLIGIFTVSDAFPSLRWFDFQGHEKEMKQTGSELDVILEKWIDNH  274

Query  830   IRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLI  1000
              + RK    ++ D   + ++ SL E   +S  + D  I   +  L L   GSE+T+ TL 
Sbjct  275   RQERKVSGTEEIDSDFIHVMLSLAEQGKLSHLQYDANISIKSTCLALILGGSETTSSTLT  334

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  +LLLNN   +K AQDE+D+HVG+DR VE SDI NL Y QA++KE LRLYP GPL GP
Sbjct  335   WAIALLLNNKEMLKKAQDEIDLHVGRDRNVEVSDINNLVYLQAVVKETLRLYPAGPLLGP  394

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
             REAMEDC +  Y++ +GTRLI+N+ K+ RDP+V+ EP EF+PER+   E       G++F
Sbjct  395   REAMEDCTVAGYNVTRGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVRGQNF  454

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PF  GRR CPG + ++QV+ L LAR L  F + T + MPVDM+E  G+ +PK TP++
Sbjct  455   ELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKATPLE  514

Query  1541  VLLTPRL  1561
             VL++PRL
Sbjct  515   VLISPRL  521



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   442 bits (1138),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 230/500 (46%), Positives = 315/500 (63%), Gaps = 20/500 (4%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             R   + GKL P   PEA GAWP +GHL LL G  P   TLG MADKYGP++ +RLG +P+
Sbjct  29    RAANHKGKLSP---PEAKGAWPILGHLPLLGGSTPPHITLGAMADKYGPLYTIRLGVYPS  85

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +V+SS E+ KECFTTNDL   SRP MAV  ++GYN A+F  AP G YWR++RK+ TLEL+
Sbjct  86    LVISSSEIAKECFTTNDLSVNSRPKMAVVDHIGYNYAMFGFAPSGPYWREIRKITTLELL  145

Query  482   TVSRLKKLRHVRTSEVEHCIGDL---YSMCHENGE-----VNLSEWFEHVTLNITLRLLV  637
             +  R++ L+H+R SEV   + +L   +S   + G      V L +WF  +TLN+ +R++ 
Sbjct  146   SNRRVELLKHIRVSEVTTFLKELHKTWSTRQKEGSNDGVVVELKQWFGDMTLNVIVRMVA  205

Query  638   GKRFSRIAKH--------LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKE  793
             GKR+S  A          ++  +       G+F+  D +P L W+D+GG+ K +K+ +K+
Sbjct  206   GKRYSVAADEDEKKEALRVQNALREFFNFVGMFLVGDAVPYLRWLDLGGHEKAMKKTAKD  265

Query  794   MDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtG  973
             +D ++G W++EH + R +            + S+ + A + G   DTI KAT+L +I  G
Sbjct  266   LDAMVGEWVEEHKQRRAKGGAKGEQDFIDAMLSVLDGADLGGFDADTINKATSLNMIAGG  325

Query  974   SESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRL  1153
             S++T  TL W  SLL+NNPH +K A +E+D  +G+ R+V E DI NL Y QAI+KE LRL
Sbjct  326   SDTTMVTLTWAISLLVNNPHVLKRALNELDTKIGRQRVVSEEDISNLVYIQAIVKETLRL  385

Query  1154  YPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHA  1333
             YP  PLSGPRE  EDC I   HI KGTRLI+NL KL  DP++W +P EFKPER F   H 
Sbjct  386   YPAAPLSGPREFTEDCTIAGCHIRKGTRLIMNLWKLQTDPKIWPDPLEFKPER-FLTTHK  444

Query  1334  SIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGI  1513
              +   G  FE +PF  GRR CPG+ F+LQ+VQ TLA  L  F IS P   P+DM+E  G+
Sbjct  445   DVDVKGHHFELIPFGSGRRACPGLAFALQMVQFTLASFLHAFEISNPSSAPIDMTESFGL  504

Query  1514  ALPKLTPIQVLLTPRLPNLF  1573
                K+TP++VL+ PRL   F
Sbjct  505   TNMKVTPLKVLIKPRLSFEF  524



>ref|XP_010432796.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   442 bits (1138),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 224/489 (46%), Positives = 309/489 (63%), Gaps = 20/489 (4%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVK  331
             ++ P+  GAWP IGHLHLL G+  +  RTLG MAD YG    L+LGS  A VVSS EV K
Sbjct  30    VKAPKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAK  89

Query  332   ECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRH  511
              CFT ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+H
Sbjct  90    NCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKH  149

Query  512   VRTSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF---------  649
             VR SE+   + DLYS+  +NG      V+L  W E +T N+ +R++ GKR+         
Sbjct  150   VRVSEISMGVKDLYSLWVKNGGSEPVIVDLKRWSEDMTQNVIVRMVAGKRYLGGAVSESS  209

Query  650   --SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQ  823
               +  A+  K  +S+  +L G+F  SD  P+L W D  G+ K +K+   E+D I+  W +
Sbjct  210   EDAAEARQCKRAISKFFHLIGIFTVSDAFPALRWFDFQGHEKEMKQTGSELDVILERWTE  269

Query  824   EHIRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAET  994
              H + RK     ++D   + ++ SL E   +S  + D      +  L L   GS++T+ T
Sbjct  270   NHRQERKVSGTKENDSDFIDVMLSLEEQGKLSHLQYDANTSIKSTCLSLILGGSDTTSST  329

Query  995   LIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLS  1174
             L W  +LLLNN   +K AQDE+D+HVG+DR VE+SDI NL Y QAIIKE LRLYP GPL 
Sbjct  330   LTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGPLL  389

Query  1175  GPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGK  1354
             GPREAMEDC +  Y++  GTRLI+N+ K+ RDP+V+ EP EF+PER+   E       G+
Sbjct  390   GPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVRGQ  449

Query  1355  SFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTP  1534
             +FE +PF  GRR CPG + ++QV+ L LAR L  F + T + MPVDM+E  G+ +PK TP
Sbjct  450   NFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKATP  509

Query  1535  IQVLLTPRL  1561
             ++VL++PRL
Sbjct  510   LEVLISPRL  518



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   442 bits (1137),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 228/491 (46%), Positives = 315/491 (64%), Gaps = 21/491 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA GAWP IGHLHLL G  P     G+MADKYGP+F +++G HP +V S+ E+ KECF
Sbjct  38    APEAGGAWPLIGHLHLLRGPQPSHIVFGNMADKYGPIFTIKMGVHPTLVASNWEMAKECF  97

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND  FA+RP++     LGY  ++FA +PYG YWR +RK+ TLEL++  RL+   HVR 
Sbjct  98    TTNDKAFANRPNILAMDLLGYGRSMFAFSPYGNYWRQIRKISTLELLSNHRLQMFNHVRE  157

Query  521   SEVEHCIGDLYSMCHENGEVN--------LSEWFEHVTLNITLRLLVGKRF--------S  652
             SEV   + +LY +  +N   N        +  WF  +TLNI LR++VGK           
Sbjct  158   SEVGTALKELYKLWEKNKTTNSNNKVLVEMKRWFGDITLNIILRIIVGKFIGYETADEGK  217

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
                +  K+ +    +L G F+ +D +P L W+DIGG+ K +K  + ++D ++  WL EH 
Sbjct  218   ESNEGWKQALRDFFHLSGRFIAADAVPFLRWLDIGGHEKTMKHTANKLDIVVTEWLNEHK  277

Query  833   RNRKE--ddddqsdfmdVMLSSLPEDAVIS-GHKRDtiikattlililtGSESTAETLIW  1003
               +        + DFMD++L  + ++A  +     DTI KAT L L L  S++T+ TLIW
Sbjct  278   EKKASGCVKKGEEDFMDLILDIMDDEAEATLSRDSDTINKATCLALTLAASDTTSVTLIW  337

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               SLL+NNP  +K AQDE+D+ VG++R V ESD+ NL + +AI+KE LRLYP GPLS P 
Sbjct  338   ALSLLVNNPDVLKKAQDELDVQVGRERQVHESDVNNLIFLKAIVKETLRLYPAGPLSVPH  397

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             E+M+DC +  YHIP GTRL+ NL K+HRDPRVWS P E++ ER F   H      GK+FE
Sbjct  398   ESMKDCTVAGYHIPAGTRLVTNLSKIHRDPRVWSNPSEYQQER-FLTSHQDFDVRGKTFE  456

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
             ++PF  GRRMCPG++F+LQV+ +TLA LL GFN  TP G P+DM+E  G+   + TP++V
Sbjct  457   FIPFGSGRRMCPGVSFALQVLHITLATLLHGFNFGTPTGEPLDMTENFGLTNLRATPLEV  516

Query  1544  LLTPRL-PNLF  1573
              + PRL P+L+
Sbjct  517   AINPRLGPHLY  527



>emb|CAN65652.1| hypothetical protein VITISV_016780 [Vitis vinifera]
Length=473

 Score =   440 bits (1131),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 309/474 (65%), Gaps = 50/474 (11%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE  GAWPF+GHLHLLHG++PV RTLG MADK GPVF +RLG +  +VVS+ E  KECFT
Sbjct  39    PEPSGAWPFVGHLHLLHGKVPVFRTLGAMADKVGPVFVIRLGMYRTLVVSNREAAKECFT  98

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND +FASRP+ +  K LGYN A FA AP+G YWR++RK   LE+++  RL         
Sbjct  99    TNDKIFASRPNSSAAKILGYNYAAFAFAPHGPYWREMRKXSMLEILSTRRL---------  149

Query  524   EVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE-------VV  682
                                              LR++ GKR+     H  E        +
Sbjct  150   --------------------------------VLRMVAGKRYFNNVVHGGEEARSAIAAI  177

Query  683   SRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddddq  862
              + L L G  V SDVIP LEW+D+ G++  +K V+KEMD +I +W++EH      +    
Sbjct  178   KKLLLLVGASVASDVIPFLEWVDLQGHLSSMKLVAKEMDSLIESWVKEHTGRLNSEASSS  237

Query  863   sdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIK  1042
              DF+D+ML+ L +D++  G+ R+TIIKAT L +I+ GS++T+ T  W  S LLNN H +K
Sbjct  238   QDFIDIMLTKLKDDSLF-GYSRETIIKATVLTMIVAGSDTTSLTSTWLLSALLNNKHVMK  296

Query  1043  MAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHI  1222
              AQ+E+D+ VG+DR VE+SDI+NL Y +AI+KE LRLY   PL  P EAMEDC +G YHI
Sbjct  297   HAQEELDLKVGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHI  356

Query  1223  PKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPG  1402
              KGTRL++N  KLHRDP VWS PEEF+PER F   HA++   G+ FE +PF  GRR CPG
Sbjct  357   SKGTRLLVNAWKLHRDPAVWSNPEEFQPER-FLTSHANVDVFGQHFELIPFGSGRRSCPG  415

Query  1403  MNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             +N  LQ++ LT+ARLLQGF+++ P   PVDM+EG+ +AL KLTP++V+LTPRLP
Sbjct  416   LNMGLQMLHLTIARLLQGFDMTKPSNSPVDMTEGISVALSKLTPLEVMLTPRLP  469



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   441 bits (1135),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 233/477 (49%), Positives = 316/477 (66%), Gaps = 10/477 (2%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             R PEA GAWP  GHLHLL G  P  R LG MADK GP+F +++G + A+VVS+ E+ KEC
Sbjct  44    RAPEAGGAWPVTGHLHLLGGPEPPHRVLGAMADKCGPIFTIKMGINRALVVSNWEMAKEC  103

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
              TT+D VFASRP     +  GYN ++F  +PYG YWR+ RK+ T+EL++  RL+KL+HVR
Sbjct  104   LTTHDKVFASRPKTLAMEIFGYNFSMFGFSPYGSYWRETRKIATVELLSNHRLEKLKHVR  163

Query  518   TSEVEHCIGDLYSMCHENGEVN------LSEWFEHVTLNITLRLLVGKRFSRI-AKHLKE  676
               EV+ C+ +LY +  +N   N      L  WF     N+ LR++VGK  + +  +   E
Sbjct  164   DYEVKTCLKELYELWDKNKSTNEMLLVELKRWFADTIRNVVLRMIVGKGCNSVDGEEWME  223

Query  677   VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH--IRNRKEd  850
             +++R+  + G FV SD +P L W+DIGG  + +K +++E+D ++  WL++H   RN +E 
Sbjct  224   LLTRSFEMSGKFVVSDALPFLRWLDIGGDERSMKNIAEELDNLLQGWLEKHKRKRNSQEI  283

Query  851   dddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNP  1030
              +++ DFM VML  L +    SG   DT+ KAT L LIL  +++TA TL W  SLLLN+ 
Sbjct  284   KEEELDFMSVMLLILGDKEQYSGRDVDTVNKATCLGLILAATDTTAVTLTWVISLLLNHR  343

Query  1031  HAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIG  1210
               +  AQ+E+D+ VG  R V ESDIKNL Y QAI+KE +RLYP  PL  P E+ME+C + 
Sbjct  344   DILNKAQNELDIQVGSKRQVNESDIKNLVYLQAILKETMRLYPAVPLLVPHESMEECIVN  403

Query  1211  KYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRR  1390
              YHIP GT+L +N  KL RDPRVW EP +F P+R F   H  I   G++FE LPFS GRR
Sbjct  404   GYHIPAGTQLFINAWKLQRDPRVWEEPYKFHPKR-FLTRHKDIDVKGQNFELLPFSSGRR  462

Query  1391  MCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             MCPG++F+LQV+Q TLA LL GF+ +TP   PVDM EGLG+ + K TP+ VL+ PRL
Sbjct  463   MCPGVSFALQVMQFTLASLLHGFDFATPSNEPVDMGEGLGLTMEKSTPLVVLVAPRL  519



>emb|CDP16080.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   441 bits (1135),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 249/505 (49%), Positives = 328/505 (65%), Gaps = 29/505 (6%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVAR---TLGHMADKYGPVFGLRLG  289
             K+D K +G L+P   PEA GAWP IGHLHLL GR P      TL  +ADKYGP F +RLG
Sbjct  29    KKDAKKHG-LVP---PEAGGAWPIIGHLHLL-GRAPEKLPHITLAALADKYGPAFTIRLG  83

Query  290   SHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVT  469
              H  +++S+ E+ KE FTT+DL  A RP+   GK L Y+ A    APYG YWR++RK+  
Sbjct  84    VHKTLIISNRELAKEIFTTHDLAAAGRPNYLAGKLLNYDNAALGFAPYGAYWREIRKLTA  143

Query  470   LELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLL  634
              EL++  RL+ LRH+R SE E    +LY++ + +       V + +WF  +TLN+ LR++
Sbjct  144   TELLSTKRLELLRHLRVSETEISTRNLYNLWNSSSGSGPVLVEMKQWFADLTLNVILRMV  203

Query  635   VGKRF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSK  790
             VGKRF           A+  + V+    +L G+FV +D +P L W+D GGY K ++  ++
Sbjct  204   VGKRFFGAVDVSKEEEARLCQNVMREFFHLTGLFVLADSVPYLRWLDWGGYEKKMRVNAQ  263

Query  791   EMDEIIGTWLQEHIRNRK--EddddqsdfmdVMLSSLPEDAVIS---GHKRDtiikattl  955
             EMD++   WL+EH + ++  E   D  DFMDVMLS L E A I+   G+  DTI KAT  
Sbjct  264   EMDQLANRWLKEHRQKKQSGEATSDHRDFMDVMLS-LKEAAAIAAVGGYDADTITKATCT  322

Query  956   ililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAII  1135
             ILI  GS++T   LIWT SL++NNP  +K AQ+E+D+ VGK R V ESDI NL Y QAII
Sbjct  323   ILISGGSDTTLVALIWTLSLIMNNPQVLKKAQEELDLQVGKGRRVSESDISNLVYLQAII  382

Query  1136  KEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVW-SEPEEFKPER  1312
             KE LRLYPP PL G RE  EDC +G YHIPKGTR+ILN+ K+ RDP VW  +P EF+PER
Sbjct  383   KEALRLYPPEPLGGARELREDCIVGGYHIPKGTRVILNIRKIQRDPNVWHDDPLEFRPER  442

Query  1313  WFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVD  1492
              F   H  I   G +FE +PF GGRR+CPG+NF LQ++ L L  LL  F +STP   PVD
Sbjct  443   -FLTTHKHIDAKGYNFELIPFGGGRRICPGINFGLQILHLVLPNLLHAFELSTPSNEPVD  501

Query  1493  MSEGLGIALPKLTPIQVLLTPRLPN  1567
             M+E  G++  K TP+Q+L+ PRLP+
Sbjct  502   MTESAGLSNMKATPLQLLVAPRLPH  526



>ref|XP_010918630.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=493

 Score =   440 bits (1131),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 238/491 (48%), Positives = 320/491 (65%), Gaps = 14/491 (3%)
 Frame = +2

Query  140   GKLLPLRVPEAP-GAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSS  316
             GK   ++ P  P G+WP IGHLHLL  + P+A   G MADKYGPVF L LG    +VV+S
Sbjct  2     GKKTKIKEPPKPSGSWPIIGHLHLLRSQKPLAHLFGEMADKYGPVFMLHLGMRRTLVVNS  61

Query  317   CEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRL  496
              E  KEC  TND VFA+RP  A GK+LGYN A+   APYG YWR VRK++ +EL++ +RL
Sbjct  62    WEAAKECLATNDKVFATRPGNAAGKHLGYNYAMVGFAPYGSYWRSVRKIIMVELLSNARL  121

Query  497   KKLRHVRTSEVEHCIGDLYSMCHENG----EVNLSEWFEHVTLNITLRLLVGKRF-----  649
             + L+HVR+ E++ CI +LY +   N     +V +  W   +  NI +R++ GKR+     
Sbjct  122   ETLKHVRSMEMDTCIRELYELWLRNNRRPVKVEMKRWLGGLAYNIVVRVVAGKRYFGSGT  181

Query  650   -SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQE  826
              S  A   ++ +SR   L   FV SD+ P L+WMD  G+   +K  ++E+D I+   L+E
Sbjct  182   GSDEAWRFRKAISRLFGLLDAFVASDMFPCLKWMDWRGHESAMKNTAQEVDSIMAGLLEE  241

Query  827   HIRNR--KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLI  1000
             H + R   +      DFMDVMLS + EDA  SG   D +IKAT+L LI+ G+++T  +L 
Sbjct  242   HRQRRLSGKATGGPQDFMDVMLS-IVEDAEFSGMDVDAVIKATSLALIMGGTDTTTTSLA  300

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             WT +LL+ NP  +K AQDE+D  VGKDR VEESD+KNL Y QAI+KE LRLYP   L   
Sbjct  301   WTLALLVKNPQVLKKAQDEIDAVVGKDRHVEESDVKNLLYLQAIVKEVLRLYPAAKLLVQ  360

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
              EAM DC+IG Y +  GTRL +N+ KL RDP VWSEP EF+PER+    HA +   G+ F
Sbjct  361   HEAMADCRIGGYDVAAGTRLHVNVWKLQRDPLVWSEPNEFRPERFLSAPHAGVDVRGQHF  420

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PF  GRR CPG++F+LQV+ LTLARL+QGF + TP G P +M++ LG+  P  TP++
Sbjct  421   ELIPFGSGRRSCPGISFALQVMHLTLARLIQGFELETPGGGPSEMADDLGLPYPNTTPLE  480

Query  1541  VLLTPRLPNLF  1573
             VLL+PRL ++ 
Sbjct  481   VLLSPRLADML  491



>ref|XP_002885694.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61953.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata]
Length=515

 Score =   440 bits (1132),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 235/481 (49%), Positives = 320/481 (67%), Gaps = 11/481 (2%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P  GHLHLL G+  + + L  M++K+GP+F L+LG +  +V S  + VK+CF
Sbjct  39    IPEPLGALPLFGHLHLLRGKELICKKLAAMSEKHGPIFSLKLGFYRLVVASDPKTVKDCF  98

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTNDL  A+RP++A G+Y+GYN A+ ALAPYG YWR++RK+VT+ L +   ++ L H+R+
Sbjct  99    TTNDLALATRPNIAFGRYVGYNNAILALAPYGDYWRELRKIVTVHLFSNQSIEMLGHIRS  158

Query  521   SEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKR--FSRIAKH---LKEVVS  685
             SEV   I  LY        V +   FE +T NI LR +VGKR  F  +       KE + 
Sbjct  159   SEVNALIKHLYKGGGGTSMVKIDMLFEFLTFNIILRKMVGKRIGFGEVKSEEWRYKEALK  218

Query  686   RALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK-Eddddq  862
              ++YL  V +  DV+P L W+D    I  +K + KE+D +I  WL+EH++ R   + D +
Sbjct  219   HSVYLAAVPMIGDVLPWLGWLDFAK-ISQMKRLFKELDSVITKWLKEHLKKRSINEKDQE  277

Query  863   sdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIK  1042
                MD++L    E  VI GH RD I+KAT L+L LTGS+ST+ TL W  SLLLNNP A+K
Sbjct  278   KTIMDLLLDIFSEGIVICGHVRDVIVKATILVLTLTGSDSTSITLTWAVSLLLNNPAALK  337

Query  1043  MAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHI  1222
              AQ+E+D  VGK R VEESDI+NLKY QAI+KE  RLYPP PL+G REA EDC +G Y +
Sbjct  338   AAQEEIDNCVGKGRWVEESDIQNLKYLQAIVKETHRLYPPAPLTGIREAREDCFVGGYRV  397

Query  1223  PKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPG  1402
              KGTRL++N+ KLHRDP++W +P+ FKPER+  ++          FEY+PFS GRR CPG
Sbjct  398   EKGTRLLVNIWKLHRDPKIWPDPKAFKPERFMEEKSQC---EKSDFEYIPFSSGRRSCPG  454

Query  1403  MNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL-PNLFPT  1579
             +N  L+VV   LARLLQGF +    G P+DM+EG G+ LPK+ P++V++TPRL P L+  
Sbjct  455   INLGLRVVHFVLARLLQGFELRKVSGEPLDMAEGPGLDLPKIKPVEVVVTPRLHPELYSL  514

Query  1580  M  1582
             +
Sbjct  515   L  515



>gb|KDO42181.1| hypothetical protein CISIN_1g009844mg [Citrus sinensis]
Length=524

 Score =   440 bits (1132),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 233/479 (49%), Positives = 316/479 (66%), Gaps = 9/479 (2%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA GAWP IGHLHLL G  P  R    MADKYGP+F +R+G +PA++VS+ E+ KEC 
Sbjct  45    APEAGGAWPVIGHLHLLRGPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEIAKECL  104

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT+D VFA+RP     + LGYN ++F  +PYG YWR+ RK+ TL L++  RL+KL+HVR 
Sbjct  105   TTHDKVFANRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKLKHVRE  164

Query  521   SEVEHCIGDLYSMCHENGEVN------LSEWFEHVTLNITLRLLVGKRFSRI-AKHLKEV  679
              EV+ C+ +LY + H+N   N      + +WF     N+ LR++VGK  + + ++  KE+
Sbjct  165   YEVKTCLKELYELWHKNKSTNKILLVEMKKWFGDTLRNVVLRMVVGKGCNSVDSEEWKEL  224

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR-KEddd  856
             ++R   + G FV SD +P + W+DIGG  + +K+++KE+D I   WL+EH R R  ++  
Sbjct  225   LTRFFEMSGKFVVSDALPFMRWLDIGGDERSMKKIAKELDVIAQGWLEEHKRKRDSQEIK  284

Query  857   dqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHA  1036
              + DFM VMLS L +     G   DTI KA  L LIL  +++T  TL    SLLLN+   
Sbjct  285   KEEDFMYVMLSILGDTEQYLGRDVDTINKAICLALILGAADTTTVTLTLVMSLLLNHRDI  344

Query  1037  IKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKY  1216
             +  AQ+E+D+ VG  R V ESDIKNL Y QAI+KE +RLYP GPL  P E++E+C +  Y
Sbjct  345   LNKAQNELDIQVGAKRQVNESDIKNLVYLQAILKEAMRLYPAGPLLVPHESIEECTVNGY  404

Query  1217  HIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMC  1396
             H+P  T+L +N  K+ RDP VW EP +F+PER F   H  I   G++FE LPFS GRRMC
Sbjct  405   HVPASTQLFINAWKIQRDPSVWEEPSKFQPER-FLTRHKDIDVKGQNFELLPFSSGRRMC  463

Query  1397  PGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLPNLF  1573
             PG++F+LQV+Q TLA LLQGFN +TP   PVDM EGLG+ + K  P +VL+TPRL   F
Sbjct  464   PGVSFALQVMQFTLASLLQGFNFATPSNEPVDMGEGLGLTMEKSQPFEVLVTPRLSAAF  522



>ref|XP_010249368.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=556

 Score =   441 bits (1135),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 237/523 (45%), Positives = 330/523 (63%), Gaps = 28/523 (5%)
 Frame = +2

Query  98    NQIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFG  277
             N ++  YK   K   +  P R PE PGAWP  GHL  L G  P+ RTLG MAD+ GPVF 
Sbjct  37    NGVVGNYK---KKRDQARP-RPPEPPGAWPIFGHLAQLGGPKPLFRTLGDMADRNGPVFM  92

Query  278   LRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVR  457
             LR G +P +VVS  +V +ECFTTND   ASRP+   GKYL Y  A+   APYG YWR++R
Sbjct  93    LRFGMYPTLVVSRWDVARECFTTNDRALASRPTSVAGKYLSYGGAIIGFAPYGAYWREIR  152

Query  458   KMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITL  625
             K+ TLEL++  R++ L+H++ +EV  CI +LY +          V +++WF  +T+N+ +
Sbjct  153   KIATLELLSNRRIESLKHIQFAEVGKCIRELYELWVRKQRRPFTVEMNQWFGDLTMNVIV  212

Query  626   RLLVGKRF---------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLK  778
             ++++GKR+          + A+  +  +     L GV V SD IP LEWMD+ G+   +K
Sbjct  213   KMVIGKRYFNTTDPSDEDKEARQFRRAIIEFSKLAGVSVASDAIPFLEWMDLQGHKSAMK  272

Query  779   EVSKEMDEIIGTWLQEHIRNRKEddddqsdf-----mdVMLSSLPEDAVISGHKRDtiik  943
             + SKEMD I   WL EH   R+ + +          MDV+LS L ED  +S + RDT++K
Sbjct  273   KASKEMDSIAVGWLDEHRDRRRGNRNRDDQQQDDDFMDVLLSILEEDTHLSTYDRDTVVK  332

Query  944   attlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYF  1123
             AT L LIL  SE+TA TL W  SLLLNN H ++  +DE++  VGKDR V+  DIKNL Y 
Sbjct  333   ATALALILAASETTAITLSWALSLLLNNRHVLRKVRDELEKCVGKDREVKADDIKNLVYL  392

Query  1124  QAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFK  1303
             QA++KE LRLYPPGPLS P EA+EDC +  + +P GTR+++NL K+ RDP + S+P +F+
Sbjct  393   QAVVKETLRLYPPGPLSVPHEAIEDCCVHGFRVPAGTRVLVNLWKIQRDPTLSSDPSQFR  452

Query  1304  PERWF------RDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNI  1465
             PER+          H ++   G+ FE +PF  GRR+CPG++F+L  + +TLARL+  F +
Sbjct  453   PERFLTVTGAGSTTHINVDVRGQHFELIPFGSGRRICPGISFALHTIHMTLARLIHEFEL  512

Query  1466  STPMGMPVDMSEGLGIALPKLTPIQVLLTPRLPNLFPTMLNKN  1594
              TP   PVDM+EG G+ +P++TP+QV+ TPRLP L     N N
Sbjct  513   GTPSQAPVDMTEGSGLTMPRITPLQVIFTPRLPFLQVQYNNTN  555



>ref|XP_004489343.1| PREDICTED: cytochrome P450 82A3-like [Cicer arietinum]
Length=531

 Score =   440 bits (1132),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 232/505 (46%), Positives = 321/505 (64%), Gaps = 26/505 (5%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
              +L   +D+KN         P A GAWP +GHL +  G+ P  R LG +ADKYGP+F ++
Sbjct  26    FLLSLSKDSKNK------EAPIAKGAWPILGHLSIFSGKQPPHRVLGTLADKYGPIFTIK  79

Query  284   LGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKM  463
             LGS  AIV+++ E+ KECFT ND++ +SRP++   ++L Y  A+FA  PY  YWR++RK+
Sbjct  80    LGSKHAIVLNNWELAKECFTKNDMIVSSRPNLDSTEHLAYKGAMFAFGPYNPYWREIRKI  139

Query  464   VTLELMTVSRLKKLRHVRTSEVEHCIGDLYSM--------CHENGE-VNLSEWFEHVTLN  616
              TLE+++  R+++ +HVR SEV+  I +L+ +        C  N   V+L +WF H+T N
Sbjct  140   ATLEILSNRRVEQQQHVRVSEVQTSIKELFDVWSSKKNESCSSNYVLVDLKQWFTHLTFN  199

Query  617   ITLRLLVGKRFSRIAKHLKE--------VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKG  772
             + LR++VGKR+      ++E         +   ++L G+    DVIP L+W D  G++K 
Sbjct  200   MVLRIIVGKRYFGTTSIVEEEEAQRSVKAMEEMMHLLGIITIGDVIPWLKWFDFNGHVKA  259

Query  773   LKEVSKEMDEIIGTWLQE--HIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiika  946
             +KE SK++D+I+G WL+E  H RN  E  D+ +  +  +L SL +   I G   DTIIKA
Sbjct  260   MKETSKKLDKIVGEWLKECRHKRNLGEKVDEHNQNIMEVLLSLLDGTTIEGFDSDTIIKA  319

Query  947   ttlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQ  1126
             T L++   GSE+++ TL W   +LL NP  ++ A++E+D  VGK+R V ESDI NL Y Q
Sbjct  320   TILVIFGGGSETSSVTLTWVACMLLKNPIVMEKAKEELDSQVGKERCVRESDISNLVYLQ  379

Query  1127  AIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKP  1306
             AI+KE LRLYPPGPLSG RE  E+C +G Y I KGTRLI NL K+H DP VWS+P EFKP
Sbjct  380   AIVKETLRLYPPGPLSGSREFSENCTLGGYKISKGTRLITNLWKIHTDPNVWSDPLEFKP  439

Query  1307  ERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMP  1486
             ER F   H  +   G  FE LPF  GRRMCPG++F LQ+V  TLAR L  F IS P    
Sbjct  440   ER-FLTTHKDVDVRGNHFELLPFGSGRRMCPGISFGLQMVLFTLARFLHSFEISNPTPNL  498

Query  1487  VDMSEGLGIALPKLTPIQVLLTPRL  1561
             VDMSE  G+   K TP+++L+ PRL
Sbjct  499   VDMSESFGLTNTKTTPLEILIKPRL  523



>ref|XP_011039260.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=528

 Score =   440 bits (1131),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 245/491 (50%), Positives = 319/491 (65%), Gaps = 24/491 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+A GAWP IGH+HL  G+    + LG MADKYGPVF ++LGSH  +VV+S E+ ++CF
Sbjct  41    APQAGGAWPIIGHMHLFGGKQLTHKILGAMADKYGPVFTIKLGSHRVLVVNSWEMARDCF  100

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T +D  F+SRPS+A  K LGY+ A+F  APYG YWR++RK+ T+EL++  R+  LRH+R 
Sbjct  101   TVHDRAFSSRPSIAASKLLGYDLAMFGFAPYGPYWREMRKITTIELLSSHRIDMLRHIRA  160

Query  521   SEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF--------SRI  658
             SEVE  I DL+ M    G       V++ +WF  +TLNI LR++ GKR+           
Sbjct  161   SEVETAIRDLHKMWVSKGSAESGVTVDMKQWFGELTLNIVLRMVGGKRYFGPSADGEEAE  220

Query  659   AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
             A+  ++V+   + L GVFV SD IP L W+D  GY K +K  +KE+D + G WL+EH + 
Sbjct  221   ARRNQKVMRDFVRLFGVFVLSDAIPFLGWLDFNGYEKAMKRTAKELDILAGGWLEEHKQR  280

Query  839   R----KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWT  1006
             R    KE    + DFMDVML+ L E A I G   DTI KAT L +IL GS++T  TL W 
Sbjct  281   RLLGGKE--KQEQDFMDVMLNIL-EKANIGGFDADTINKATCLNVILAGSDTTMVTLTWA  337

Query  1007  TSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPRE  1186
              SLLLNNP  +K A+DE+D+HVGKDRLV+ESDI NL Y QAIIKE LRLYPP PL   R 
Sbjct  338   LSLLLNNPQVLKKAKDELDIHVGKDRLVDESDINNLVYLQAIIKETLRLYPPSPLIAHRS  397

Query  1187  AMEDCKIG-KYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             A EDC +   YH+P GTRL+ N  K+ RD RVW  P+EF PER F      I   G++FE
Sbjct  398   AKEDCTLSVGYHVPSGTRLMANAWKIQRDERVWPNPDEFHPER-FLTSQKEIDLKGQNFE  456

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
              +PF  GRR CPG+  +L++V  TLARLL  F ++ P    VDM+E  G+   K TP+++
Sbjct  457   LIPFGSGRRSCPGIALALRIVHFTLARLLHSFEVTKPSREDVDMTESHGLTNLKATPLEI  516

Query  1544  LLTPRL-PNLF  1573
             LL PRL P L+
Sbjct  517   LLIPRLNPRLY  527



>ref|XP_009364178.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   439 bits (1130),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 223/482 (46%), Positives = 309/482 (64%), Gaps = 17/482 (4%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PEA GAWP +GHL LL G  P   TLG MADKYGP+F +R+G +P++V+SS E+ KECFT
Sbjct  38    PEAKGAWPILGHLSLLGGSTPPHITLGAMADKYGPIFTIRIGVYPSLVISSSEIAKECFT  97

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TNDL   SRP MA  +++GYN A+F   P G YWR++RK+VTLEL+++ +++ L+H+R  
Sbjct  98    TNDLSLNSRPKMAAVEHIGYNYAMFGFGPSGPYWREIRKIVTLELLSIRKVELLKHIRVL  157

Query  524   EVEHCIGDL---YSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRFS--------R  655
             EV   + +L   +S   + G      V L +WF  +TLN+ +R++ GKR+S        +
Sbjct  158   EVTTFLEELHKTWSTRQKEGSNDGVVVELKQWFGDMTLNVLVRMVNGKRYSVAADEDEKK  217

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A+ ++  +    +  G+F+  D +P L W+D+GG+ K +K+++KE+D I+G W++EH +
Sbjct  218   EARRVQNALREFFHYAGLFLVGDAVPYLRWLDLGGHEKAIKKIAKELDTIVGEWVEEHKQ  277

Query  836   NRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
              R + D          + S+ + A + G   DTI KAT+L +I  GS++   TL W  SL
Sbjct  278   RRAKGDAKGEQDFIDAMLSVLDGAELGGFDADTINKATSLNMIAAGSDTIMVTLTWAISL  337

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             LLNN H ++ A +E+D  +G+ R+V E DI NL Y QAIIKE LRLYPP PLSGPRE  E
Sbjct  338   LLNNSHVLERALNELDTKIGRQRVVSEQDISNLVYIQAIIKETLRLYPPAPLSGPREFTE  397

Query  1196  DCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPF  1375
             DC I  YHI KGTRL +NL KL  DP+ W +P EFKPER F   H  +   G+ FE +PF
Sbjct  398   DCTIAGYHIRKGTRLTMNLWKLQTDPKNWPKPFEFKPER-FLTTHKKVDVKGQHFELIPF  456

Query  1376  SGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTP  1555
               GRR CPG+ F LQ+VQ TLA  L  F I  P   P+DM+E  G+   K TP++VL+ P
Sbjct  457   GSGRRACPGLAFGLQMVQFTLASFLHAFEILNPSSTPIDMTESFGLTNNKRTPLKVLIKP  516

Query  1556  RL  1561
             RL
Sbjct  517   RL  518



>ref|XP_002869302.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45561.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   439 bits (1130),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 223/487 (46%), Positives = 310/487 (64%), Gaps = 20/487 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              P   GAWP IGHLHLL G+  +  RTLG MAD YGP   LRLGS    VVSS EV KEC
Sbjct  32    APAPSGAWPIIGHLHLLSGKEQLLYRTLGKMADHYGPAMSLRLGSSETFVVSSFEVAKEC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP  A  K++GYN AVF  APYG +WR++RK+ T+EL++  RL+ L+HVR
Sbjct  92    FTVNDKALASRPMSAAAKHMGYNFAVFGFAPYGAFWREMRKIATIELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF-----------  649
              SE+   + DLYS+  + G      V+L  W E ++LN+ +R++ GKR+           
Sbjct  152   VSEIAMGVKDLYSLWVKKGGAEPVMVDLQSWLEDISLNMMVRMVAGKRYFGGGGSLSSED  211

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
             +  A+  ++ V+   +L G+F  SD  P L W D+ G+ K +K+  +E+D I+  W++ H
Sbjct  212   TEEARQCRKGVANFFHLVGIFTVSDAFPKLGWFDLQGHEKEMKQTGRELDVILERWIENH  271

Query  830   IRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLI  1000
              + RK      +D   + ++ SL E   +S  + D      +  L +   G+E++  TL 
Sbjct  272   RQQRKVSGTKHNDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLAMILGGTETSPATLT  331

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  SLLLNN   +K AQ+E+D+HVG+DR VE+SDI+NL Y QAIIKE LRLYP GPL G 
Sbjct  332   WAISLLLNNKEMLKKAQEEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGH  391

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
             REAMEDC +  Y++P GTR+++N+ K+ RDP+V+ EP+EF+PER+   E       G++F
Sbjct  392   REAMEDCTVAGYNVPCGTRMLVNVWKIQRDPKVYMEPDEFRPERFITGEAKEFDVRGQNF  451

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PF  GRR CPG + ++QV+ L LAR L  F + T M MPVDMSE  G+ +PK TP++
Sbjct  452   ELMPFGSGRRSCPGASLAMQVLHLGLARFLHSFEVKTVMDMPVDMSESPGLTIPKGTPLE  511

Query  1541  VLLTPRL  1561
             VL++PRL
Sbjct  512   VLISPRL  518



>gb|KDP38438.1| hypothetical protein JCGZ_04363 [Jatropha curcas]
Length=526

 Score =   439 bits (1129),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 227/483 (47%), Positives = 307/483 (64%), Gaps = 15/483 (3%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             +VPEA GAWP IGHLHL  G  P+   LG MADK GP+F ++LG HP +VVS+ E+ K+C
Sbjct  40    KVPEAGGAWPLIGHLHLFRGSKPLHIILGKMADKMGPIFKIKLGMHPTLVVSNWEMAKQC  99

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
              TTND VFA+RP       +GYN A+   +PYG YWR +RK+  LEL++  R++    VR
Sbjct  100   LTTNDQVFATRPKTLASVLVGYNRAMLPFSPYGPYWRQMRKIAILELLSNQRIQTQSRVR  159

Query  518   TSEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRFSRI-------  658
              SEV   + +LY    +N        V +  WF  +TLN+   ++VGK    +       
Sbjct  160   ESEVRTFLKELYKFWDKNKNSQNKVLVEMVRWFGDMTLNLICEIIVGKSVGYVTTEGGGE  219

Query  659   AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
             +K  K+ +     L G FV +D IP L W DIGG+ K + + +KE+D +   WL+EH + 
Sbjct  220   SKIWKQGLRDLFDLIGKFVAADAIPFLRWFDIGGFEKAMIKTAKELDLVAEGWLKEHKKK  279

Query  839   RKEddddqsdfmd-VMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
             R        +    +ML+ L    V  G   D I KA +L LIL  S++TA TL W  SL
Sbjct  280   RASGFKQGEEHFMGLMLNILDHTQVAQGPHSDPINKAVSLSLILVASDTTAVTLNWALSL  339

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             L+NNP+A+K AQDE+DMHVG++R ++ESDIKNL+Y QAI+KE LRLYP GPLS P E+ E
Sbjct  340   LVNNPNALKKAQDELDMHVGRERQIQESDIKNLEYLQAILKETLRLYPAGPLSLPHESTE  399

Query  1196  DCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPF  1375
             DC +G Y IP GT+L++N+ K+H DPRVW  P EF+PER F   H      G++FE++PF
Sbjct  400   DCTVGGYDIPAGTKLVINIWKIHHDPRVWENPFEFRPER-FLTSHKDFDVRGQNFEFIPF  458

Query  1376  SGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTP  1555
               GRR CPG++F LQV+QLTLA LL  F+I TP   PVDM+E +G+   + TP+++L+ P
Sbjct  459   GSGRRRCPGISFGLQVMQLTLANLLHSFDIETPSNEPVDMTENIGLTNLRATPLEILMHP  518

Query  1556  RLP  1564
             RLP
Sbjct  519   RLP  521



>ref|XP_010647827.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=516

 Score =   439 bits (1128),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 230/490 (47%), Positives = 324/490 (66%), Gaps = 13/490 (3%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             + NKN G+      PE  GAWP +GHLHLL    P+ RT G MAD+YGP+F +R+G   A
Sbjct  28    KGNKNKGR----SPPEPSGAWPVMGHLHLLGADKPLHRTFGAMADEYGPIFSIRVGLRTA  83

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +VVSS EV KEC+TT D   A+RP     K +GY+ A+FA   +G YWRDVR++  + L+
Sbjct  84    LVVSSSEVAKECYTTKDKALATRPRSLAVKLMGYDHAMFAFERHGPYWRDVRRLAMVNLL  143

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF  649
             +  + + L+HVR SEV+  I +LY    ENG     V++ + FEH+  N+T+R + GKR 
Sbjct  144   SNRQHEMLKHVRDSEVKFFIQELYGQWVENGGSPVLVDMKKKFEHLVANLTMRTVAGKRC  203

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEIIGTWLQE  826
                     + +   + L G F+ SD +P L W+D + GY   +K  ++++D +IG W++E
Sbjct  204   ENGESRWCQSLGDFMNLMGQFMVSDALPFLGWLDTVRGYTAKMKGTARQLDRVIGRWVEE  263

Query  827   HIRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRD--tiikattlililtGSESTAETL  997
             H + R     + ++   +  + S+ +DA +SGH  D  T+IKAT L ++L G+++ A TL
Sbjct  264   HRQKRLSGSINDAEQDFIHAMLSVIDDAQLSGHDHDHDTVIKATCLTVMLAGNDTIAVTL  323

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
              W  SLL+NNP A+K AQ+E+D HVG+++ V ESDIK L Y QAIIKE LRLYP GPL+ 
Sbjct  324   TWALSLLMNNPRALKKAQEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLAL  383

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             P EAMEDC I  +HI  GTRL++NL KLHRDP +WS+P EF+PER F  +H  +   G+ 
Sbjct  384   PHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTIWSDPLEFQPER-FLTKHVGLDVGGQH  442

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FE LPF  GRRMCPG++ +L+++QLTLARLL GF +      P+DM+EG+G+A+PK TP+
Sbjct  443   FELLPFGSGRRMCPGISLALEILQLTLARLLHGFELGVVSDSPLDMTEGVGLAMPKATPL  502

Query  1538  QVLLTPRLPN  1567
             +V L PRLP+
Sbjct  503   EVTLVPRLPS  512



>emb|CAN64371.1| hypothetical protein VITISV_016844 [Vitis vinifera]
Length=527

 Score =   439 bits (1129),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 240/493 (49%), Positives = 324/493 (66%), Gaps = 17/493 (3%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             + NK  GK    R PE  G WP IGHLHLL     + RTLG MADKYGP+F +RLG    
Sbjct  31    KGNKKXGK----RPPEPSGRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKT  86

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +VVSS EV KEC+TT+D VFA+RP     K +GY+   F  APYG YWRDVRK+  +EL+
Sbjct  87    LVVSSWEVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELL  146

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF  649
             +  +L+  +HV+ SEV+  I +LY     N +    V + E F ++ LN+ +R + GKR+
Sbjct  147   SNRQLEMHKHVQDSEVKILIKELYGQWASNKDGPALVEMKERFGNLALNVVVRAIAGKRY  206

Query  650   ------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEII  808
                       K  K+     + L G+F+ SDVIP L W+D + G+   +K V+KE+D ++
Sbjct  207   FGTHACGDEPKRXKKAFEDFIILLGLFMVSDVIPFLGWLDTMKGFTAEMKRVAKEVDYVL  266

Query  809   GTWLQEHIRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililtGSEST  985
             G+W++EH +NR   +D+ ++   +  + S+ +D   SG   DTIIK T   LIL G+++T
Sbjct  267   GSWVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFSGRDPDTIIKGTCSNLILAGNDTT  326

Query  986   AETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPG  1165
             + TL W  SLLLNN HA+K AQ E+++HVGK R V+ SDIKNL Y QAI+KE LRLYPPG
Sbjct  327   SITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPG  386

Query  1166  PLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGY  1345
             PLS P EAMEDC +  +HI  GTRL++NL KLHRDPRVW +P EF+PER F  +HA +  
Sbjct  387   PLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPER-FLTKHAGLDV  445

Query  1346  VGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPK  1525
              GK++E LPF  GRR+CPG++F+L++  LTLARLL GF +      PVDM+E  G+  PK
Sbjct  446   RGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPK  505

Query  1526  LTPIQVLLTPRLP  1564
              TP++V + PRLP
Sbjct  506   ATPLEVTIVPRLP  518



>ref|XP_008358513.1| PREDICTED: cytochrome P450 82G1-like [Malus domestica]
Length=709

 Score =   445 bits (1145),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 257/524 (49%), Positives = 335/524 (64%), Gaps = 45/524 (9%)
 Frame = +2

Query  98    NQIILKYKRDNK--NNGKLLPL---RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKY  262
             N++  K K+ +   NN K   +   +VP+   AWPFIGHLHLLHG+ PVA  LG MADK 
Sbjct  184   NKVYTKQKKKSNITNNTKTETMSLTKVPQPSEAWPFIGHLHLLHGKDPVALILGAMADKL  243

Query  263   GPVFGLRLGSHPAIVV-SSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGR  439
             GP++ LRLG    +VV S+ E VKE FT ND+VFA+RPS A GK+LGYN A+FALAPYG 
Sbjct  244   GPIYSLRLGPRQVVVVLSAWEQVKERFTKNDIVFATRPSTAAGKHLGYNNAIFALAPYGS  303

Query  440   YWRDVRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG----------EVNLS  589
             YWRD+RK+ T E ++  +++ L HVR  EV+  I  L+ +   +G           V LS
Sbjct  304   YWRDIRKLATQEFLSAQKVEMLSHVRAEEVDSFIKKLFDVAGSSGLTITPATSPVAVRLS  363

Query  590   EWFEHVTLNITLRLLVGKRFS------------RIAKHLKEVVSRALYLGGVFVPSDVIP  733
             E  EH+  NI++RL+ GKRFS            R  K +++ + R     G FV SD IP
Sbjct  364   ELVEHLMFNISVRLIAGKRFSDREYNEKGSEAWRFEKAMQDTMHRL----GNFVWSDAIP  419

Query  734   SLEWMD-IGGYIKGLKEVSKEMDEIIGTWLQEH------IRNRKEddddqsdfmdVMLSS  892
              LEW+D + G +  +K   KE+D ++ +WL EH      I N        SD MD M+S+
Sbjct  420   FLEWLDSLFGPVSSMKHTFKELDSVLSSWLNEHRSPGGKIGNSSR---VASDLMDAMISN  476

Query  893   LPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHV  1072
               E AVISGH  D +IKAT+LILI+ G++ T+  + W  SLLLN+P A+K AQ E+D+ V
Sbjct  477   FGEKAVISGHSCDNVIKATSLILIIGGTDGTSIAVTWALSLLLNHPSALKSAQQELDISV  536

Query  1073  GKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNL  1252
             G+DR V+ESD+ NLKY QAI+KE LRLYP  P++   E MED  +  Y +PKGTR+++NL
Sbjct  537   GRDRWVQESDLPNLKYLQAIVKETLRLYPSIPIT-VNEGMEDTHLSGYLVPKGTRIVVNL  595

Query  1253  LKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQL  1432
              KLHRDPRVW+ P EF PER F  +HA + Y  K FEY+PFS GRR+CPG    L VVQL
Sbjct  596   WKLHRDPRVWANPCEFHPER-FMTDHADVDYF-KGFEYIPFSSGRRLCPGATLGLHVVQL  653

Query  1433  TLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
              LARL+QGF++S     PVDM E +G+AL K  P+   L PRLP
Sbjct  654   VLARLVQGFDMSRVGDEPVDMRERVGLALMKENPLDAFLAPRLP  697



>ref|XP_002281361.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   438 bits (1126),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 228/490 (47%), Positives = 324/490 (66%), Gaps = 13/490 (3%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             + NKN G+      PE  GAWP +GHLHLL     + RT G MAD+YGP+F +RLG   A
Sbjct  28    KGNKNKGR----SPPEPSGAWPVMGHLHLLGADKQIHRTFGAMADEYGPIFSIRLGLRTA  83

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +VVSS EV KEC+TT D   A+RP     K +GY+ A+FA   +G YWRDVR++  + L+
Sbjct  84    LVVSSSEVAKECYTTKDKALATRPRSLAVKLMGYDHAMFAFERHGPYWRDVRRLAMVNLL  143

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF  649
             +  + + L+HVR SEV+  I +LY    ENG     V++ + FEH+  N+T+R + GKR 
Sbjct  144   SNRQHEMLKHVRDSEVKFFIQELYGQWVENGGSPVLVDMKKKFEHLVANLTMRTVAGKRC  203

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEIIGTWLQE  826
                     + +   + L G F+ SD +P L W+D + GY   +K  ++++D+++G W++E
Sbjct  204   ENGESRWCQALGDFMNLMGQFMVSDAVPFLGWLDTVRGYTAKMKGTARQLDQVLGRWVEE  263

Query  827   HIRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRD--tiikattlililtGSESTAETL  997
             H + R     ++++   +  + S+ +DA +S H  D  T+IKAT L ++L G+++ A TL
Sbjct  264   HRQKRLSGSINEAEQDFIHAMLSVIDDAQLSAHDHDHDTVIKATCLTVMLAGNDTIAITL  323

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
              W  SLL+NNP A+K AQ+E+D HVG+++ V ESDIK L Y QAIIKE LRLYP GPL+ 
Sbjct  324   TWALSLLMNNPRALKKAQEELDFHVGRNQQVYESDIKKLVYLQAIIKETLRLYPAGPLAL  383

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             P EAMEDC I  +HI  GTRL++NL KLHRDP +WS+P EF+PER F  +H  +   G+ 
Sbjct  384   PHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTIWSDPLEFQPER-FLTKHVGLDVRGQH  442

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FE LPF  GRRMCPG++ +L+++QLTLARLL GF +      P+DM+EG+G+A+PK TP+
Sbjct  443   FELLPFGSGRRMCPGISLALEILQLTLARLLHGFELGVVADSPLDMTEGVGLAMPKATPL  502

Query  1538  QVLLTPRLPN  1567
             +V L PRLP+
Sbjct  503   EVTLVPRLPS  512



>ref|XP_010253830.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   438 bits (1127),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 320/487 (66%), Gaps = 19/487 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             + P+  GAWP IGHLHL      +   LG MADKYGP F LRLG   A+VVSS +  K+C
Sbjct  36    QAPQPSGAWPIIGHLHLFRASELLHPKLGAMADKYGPAFMLRLGMRRALVVSSWDAAKQC  95

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTTND VF++RP     K++GYN A+   APYG YWR++RK+ T+EL++  RL   +H+R
Sbjct  96    FTTNDKVFSTRPRTVAIKHMGYNYALPGFAPYGPYWREMRKISTVELLSHRRLDMFKHIR  155

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRFSRIAKH-----  667
             TSE++  + DLY+   +NG      V + +WF  +T+NI  R++ GKR+   A +     
Sbjct  156   TSEIDLSMKDLYTRWVKNGHGSPVLVEMKQWFSDLTMNIVTRMIAGKRYFGAANYTDFSE  215

Query  668   -----LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH-  829
                   K+ ++  ++L G+FV SD +P L W+D+ G+ + +K  +K++D ++ +WL+EH 
Sbjct  216   EEVQKCKKAITEFMHLVGIFVVSDALPFLGWLDLQGHERAMKRTAKQLDHMLESWLKEHR  275

Query  830   IRNRKEddddqsdfmdVM--LSSLPEDAVISGHKRDtiikattlililtGSESTAETLIW  1003
              + R  +    +D  D M  L S+ +D    G+  DT++KAT L LIL GS++T+ TL W
Sbjct  276   CKKRASEGIATADERDFMDVLLSILDDHQCIGYGTDTVVKATCLGLILGGSDTTSVTLTW  335

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               SLLLNN  A+K AQDE+D  VG+D LVEESDI+NL Y QAI+KE LRLYP   +S PR
Sbjct  336   ALSLLLNNRQALKKAQDELDTKVGRDGLVEESDIRNLVYLQAIVKETLRLYPAAAVSAPR  395

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EAMEDC +  +HIP GT+L++N+ KL RDP +W  P EF PER+     A I   G+ FE
Sbjct  396   EAMEDCTVAGFHIPAGTQLLVNIWKLQRDPSIWPHPCEFSPERFLTSHAADIDVRGQHFE  455

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTP-MGMPVDMSEGLGIALPKLTPIQ  1540
              LPF  GRR CPG++F++QV+ LTLARL+QGF++ TP     VDM++G+G+   K TP+ 
Sbjct  456   LLPFGSGRRACPGISFAIQVLHLTLARLIQGFDLGTPCCDAMVDMTQGIGLTNHKKTPLD  515

Query  1541  VLLTPRL  1561
             VLLTPRL
Sbjct  516   VLLTPRL  522



>ref|XP_006342717.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=527

 Score =   438 bits (1126),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 243/513 (47%), Positives = 329/513 (64%), Gaps = 35/513 (7%)
 Frame = +2

Query  116   YKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGS  292
             +K  N +  K    +VPE  GAWP IGHLHLL G   +  RTLG MAD YGP F LRLG+
Sbjct  21    FKNKNYSTSK----QVPEPAGAWPIIGHLHLLGGTEQLLYRTLGAMADNYGPAFNLRLGT  76

Query  293   HPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTL  472
               A VVSS E+ KECFT ND   ASRP+    K++GY  AVF  APY  +WR++RK+   
Sbjct  77    RRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSPFWREMRKIAMF  136

Query  473   ELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLV  637
             EL++  RL  L++V+ SEV+  I +LY +  +N       V L  WFE +TLN+ +R++ 
Sbjct  137   ELLSNRRLDALKYVQVSEVDIGIQELYKLWVDNNSDRPILVELKRWFEDLTLNVIVRMVA  196

Query  638   GKRF---------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSK  790
             GKR+            A+  ++ +++  +L G+FVPSD  P L W DI G+ K +K+ +K
Sbjct  197   GKRYFGAGATCDNDDEARRCQKAINQFFHLIGIFVPSDAFPILGWFDINGHEKAMKKTAK  256

Query  791   EMDEIIGTWLQEHIRNRK--------EddddqsdfmdVMLSSLPEDAVISG--HKRDtii  940
             E+D I+  WL+EH   RK          D    DF+DVMLS L E+  +S   +  DT I
Sbjct  257   ELDFILEGWLKEHREKRKCTSIEVKSTTDSAVQDFIDVMLS-LEEEGRLSNFPYDADTSI  315

Query  941   kattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKY  1120
             K+T L LIL GS++TA TL W  SLLLNNP  +  AQ+E+D+HVGK+R ++ESDI NL Y
Sbjct  316   KSTCLALILGGSDTTAGTLTWAISLLLNNPKILTKAQEEIDLHVGKNRQIDESDINNLIY  375

Query  1121  FQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEF  1300
              QAIIKE LRLYP GPL GPREAM++C+I  Y I  GTRLI+N+ K+ RDPR+W +P+ F
Sbjct  376   IQAIIKETLRLYPAGPLLGPREAMDNCEISGYKITPGTRLIVNVWKIQRDPRIWEDPDCF  435

Query  1301  KPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPM-  1477
              P+R+     +++   GK FE +PF  GRR CPG + +LQV+ LTLAR+L  F  + P+ 
Sbjct  436   NPDRFL---MSNVDVKGKDFELIPFGSGRRSCPGASLALQVLHLTLARILHAFEFTKPID  492

Query  1478  GMPVDMSEGLGIALPKLTPIQVLLTPRL-PNLF  1573
             G P+D++E  G+ +PK TP+ VL+ PRL  NL+
Sbjct  493   GQPIDLTESPGLTIPKATPLDVLIAPRLSANLY  525



>ref|NP_194925.1| cytochrome P450, family 82, subfamily C, polypeptide 2 [Arabidopsis 
thaliana]
 sp|O49394.2|C82C2_ARATH RecName: Full=Cytochrome P450 82C2 [Arabidopsis thaliana]
 emb|CAA16592.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79915.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85984.1| cytochrome P450, family 82, subfamily C, polypeptide 2 [Arabidopsis 
thaliana]
Length=523

 Score =   437 bits (1125),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 224/486 (46%), Positives = 310/486 (64%), Gaps = 19/486 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              P   GAWP IGHLHLL G+  +  RTLG MAD+YGP   LRLGS    VVSS EV K+C
Sbjct  32    APAPSGAWPIIGHLHLLSGKEQLLYRTLGKMADQYGPAMSLRLGSSETFVVSSFEVAKDC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP  A  K++GY+ AVF  APY  +WR++RK+ TLEL++  RL+ L+HVR
Sbjct  92    FTVNDKALASRPITAAAKHMGYDCAVFGFAPYSAFWREMRKIATLELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF----------S  652
              SE+   + DLYS+  + G      V+L  W E ++LN+ +R++ GKR+          +
Sbjct  152   VSEISMVMQDLYSLWVKKGGSEPVMVDLKSWLEDMSLNMMVRMVAGKRYFGGGSLSPEDA  211

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
               A+  ++ V+   +L G+F  SD  P L W D  G+ K +K+  +E+D I+  W++ H 
Sbjct  212   EEARQCRKGVANFFHLVGIFTVSDAFPKLGWFDFQGHEKEMKQTGRELDVILERWIENHR  271

Query  833   RNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLIW  1003
             + RK      +D   V ++ SL E    S  + D I    +  L L   GSE++  TL W
Sbjct  272   QQRKVSGTKHNDSDFVDVMLSLAEQGKFSHLQHDAITSIKSTCLALILGGSETSPSTLTW  331

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               SLLLNN   +K AQDE+D+HVG+DR VE+SDI+NL Y QAIIKE LRLYP GPL G R
Sbjct  332   AISLLLNNKDMLKKAQDEIDIHVGRDRNVEDSDIENLVYIQAIIKETLRLYPAGPLLGHR  391

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EA+EDC +  Y++ +GTR+++N+ K+ RDPRV+ EP EF+PER+   E       G++FE
Sbjct  392   EAIEDCTVAGYNVRRGTRMLVNVWKIQRDPRVYMEPNEFRPERFITGEAKEFDVRGQNFE  451

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
              +PF  GRR CPG + ++QV+ L LAR LQ F++ T M MPVDM+E  G+ +PK TP+++
Sbjct  452   LMPFGSGRRSCPGSSLAMQVLHLGLARFLQSFDVKTVMDMPVDMTESPGLTIPKATPLEI  511

Query  1544  LLTPRL  1561
             L++PRL
Sbjct  512   LISPRL  517



>gb|AGO03797.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=518

 Score =   437 bits (1124),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 235/482 (49%), Positives = 314/482 (65%), Gaps = 20/482 (4%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             P A GAWP IGHLHL+ G  P    LG  ADKYGP+F ++LG H A+VVSS E+ KECFT
Sbjct  34    PRAKGAWPIIGHLHLVAGSRPRQHVLGDWADKYGPIFTIKLGFHQALVVSSTEIAKECFT  93

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND VFASRP     + +GYN A+F LAPYG YWR  RK++TLE+++  R++ L HVR S
Sbjct  94    TNDKVFASRPKAKAVEIMGYNYAMFGLAPYGDYWRQERKIITLEVLSPRRVEMLGHVRES  153

Query  524   EVEHCIGDLYSMCHENGE--------VNLSEWFEHVTLNITLRLLVGKRF---SRIAKHL  670
             E+   + D++     N E        V++ +WF  + LNI +R++ GKRF        H 
Sbjct  154   EIRASLKDIHVAWENNKENEGSNMVKVDMKQWFGTLVLNIVVRVISGKRFPANDEEGVHF  213

Query  671   KEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK--  844
             + V+ + + L G FV SD IP ++  D+GGY K +K V KE+D+I+  WLQE  R  +  
Sbjct  214   QNVLRKNVVLMGAFVASDYIPYIDRFDLGGYQKEMKLVWKELDDIMEGWLQERRREMESG  273

Query  845   EddddqsdfmdVMLSSL----PEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
             +  +    FMDV++SSL     ED   S    DT+IKA+ L LI  G ++T+ TL W   
Sbjct  274   QQLERNQAFMDVLISSLQGAPKED--FSDFDHDTVIKASCLELITAGLDTTSVTLTWVLC  331

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLNNP A++  Q+E+D HVG+DR VEESD+KNL Y  A+IKE +RLYP  PL+ P E+ 
Sbjct  332   LLLNNPKALRTVQEEIDEHVGRDRPVEESDMKNLLYLGAVIKETMRLYPAAPLAVPHEST  391

Query  1193  EDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLP  1372
             EDC +  Y++PKGTRL++NL KLHRDP +WS+PEEFKPER F   +  I   G+ ++ LP
Sbjct  392   EDCVVSGYNVPKGTRLLINLWKLHRDPNIWSDPEEFKPER-FMTTNKDIDVKGRHYDLLP  450

Query  1373  FSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLT  1552
             F  GRRMCPG+ F+LQ + LTLA L+Q F +  P    +DMSE  G+   K TP++VLL+
Sbjct  451   FGSGRRMCPGIYFALQAMHLTLATLIQQFELVKPTDEQIDMSERSGLTTSKATPLEVLLS  510

Query  1553  PR  1558
             PR
Sbjct  511   PR  512



>ref|XP_010028533.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW55288.1| hypothetical protein EUGRSUZ_I01215 [Eucalyptus grandis]
Length=524

 Score =   437 bits (1124),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 240/499 (48%), Positives = 319/499 (64%), Gaps = 21/499 (4%)
 Frame = +2

Query  113   KYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGS  292
             + KR NK    L     PEA GAWP  GHLHLL     + R L  MA++YGP F +RLG 
Sbjct  28    RSKRSNKRGQTL-----PEAAGAWPLFGHLHLLGPNKLLHRILAAMANQYGPAFSIRLGI  82

Query  293   HPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTL  472
             H  +VVS+ EV KECFT+ND VF +RP     K +GY+ A+F  APYG YWR +RK+  +
Sbjct  83    HQVLVVSNWEVAKECFTSNDRVFPTRPRSLSVKLMGYDHAMFGFAPYGPYWRGMRKLAVV  142

Query  473   ELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVG  640
             EL++  RL  L+HVR +E    +  LY     NGE    V + + F HV +NIT+R++ G
Sbjct  143   ELLSNHRLDLLKHVRDAETNLFVKGLYEKWLSNGENPVTVEMEKNFGHVAMNITVRMVAG  202

Query  641   KRFSRIAKHLKEVVSRA-------LYLGGVFVPSDVIPSLEWMDI-GGYIKGLKEVSKEM  796
             KR+    +  +E  SR         +L G F+ SD IP L W+D+  G +  +K  +KE+
Sbjct  203   KRYLSGNEGDEEESSRCRKALGDFFHLVGEFMVSDAIPFLGWLDVLRGRVAEMKRTAKEL  262

Query  797   DEIIGTWLQEHIRNRKEddddqsdfmdV--MLSSLP-EDAVISGHKRDtiikattlilil  967
             D ++G W++EH + R     +  +   +  MLS+   E+   S  + DTI+KAT L +IL
Sbjct  263   DWVLGRWVEEHRKRRAVAKVEDDEQDFIHFMLSATELEEGKYSVQEADTIVKATCLSVIL  322

Query  968   tGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGL  1147
              G+++T  TL W  SLLLNNPH+++ AQDE+D+ VGK R VEESDIKNL Y QA++KE L
Sbjct  323   GGNDTTVLTLTWALSLLLNNPHSLERAQDELDVQVGKHRQVEESDIKNLTYLQAVVKETL  382

Query  1148  RLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDE  1327
             RLYP  PLS  REAMEDC +  +H+P GTRL++NL KL RDPRVWS   EF+PER+  D 
Sbjct  383   RLYPVLPLSVQREAMEDCIVAGFHVPAGTRLMVNLWKLQRDPRVWSRASEFQPERFLTD-  441

Query  1328  HASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGL  1507
             H  +   G+SFEY+PF  GRRMCPG++F LQVVQL LARLL  F +    G  VDMSE  
Sbjct  442   HVHVDVRGQSFEYIPFGTGRRMCPGVSFGLQVVQLILARLLHAFKLERVSGAEVDMSESP  501

Query  1508  GIALPKLTPIQVLLTPRLP  1564
             G+ +P+ TP++ +LTPRLP
Sbjct  502   GLTMPRATPLEAVLTPRLP  520



>gb|ABK28662.1| unknown [Arabidopsis thaliana]
Length=524

 Score =   437 bits (1124),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 224/486 (46%), Positives = 310/486 (64%), Gaps = 19/486 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              P   GAWP IGHLHLL G+  +  RTLG MAD+YGP   LRLGS    VVSS EV K+C
Sbjct  32    APAPSGAWPIIGHLHLLSGKEQLLYRTLGKMADQYGPAMSLRLGSSETFVVSSFEVAKDC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP  A  K++GY+ AVF  APY  +WR++RK+ TLEL++  RL+ L+HVR
Sbjct  92    FTVNDKALASRPITAAAKHMGYDCAVFGFAPYSAFWREMRKIATLELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF----------S  652
              SE+   + DLYS+  + G      V+L  W E ++LN+ +R++ GKR+          +
Sbjct  152   VSEISMVMQDLYSLWVKKGGSEPVMVDLKSWLEDMSLNMMVRMVAGKRYFGGGSLSPEDA  211

Query  653   RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
               A+  ++ V+   +L G+F  SD  P L W D  G+ K +K+  +E+D I+  W++ H 
Sbjct  212   EEARQCRKGVANFFHLVGIFTVSDAFPKLGWFDFQGHEKEMKQTGRELDVILERWIENHR  271

Query  833   RNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLIW  1003
             + RK      +D   V ++ SL E    S  + D I    +  L L   GSE++  TL W
Sbjct  272   QQRKVSGTKHNDSDFVDVMLSLAEQGKFSHLQHDAITSIKSTCLALILGGSETSPSTLTW  331

Query  1004  TTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPR  1183
               SLLLNN   +K AQDE+D+HVG+DR VE+SDI+NL Y QAIIKE LRLYP GPL G R
Sbjct  332   AISLLLNNKDMLKKAQDEIDIHVGRDRNVEDSDIENLVYIQAIIKETLRLYPAGPLLGHR  391

Query  1184  EAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFE  1363
             EA+EDC +  Y++ +GTR+++N+ K+ RDPRV+ EP EF+PER+   E       G++FE
Sbjct  392   EAIEDCTVAGYNVRRGTRMLVNVWKIQRDPRVYMEPNEFRPERFITGEAKEFDVRGQNFE  451

Query  1364  YLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQV  1543
              +PF  GRR CPG + ++QV+ L LAR LQ F++ T M MPVDM+E  G+ +PK TP+++
Sbjct  452   LMPFGSGRRSCPGSSLAMQVLHLGLARFLQSFDVKTVMDMPVDMTESPGLTIPKATPLEI  511

Query  1544  LLTPRL  1561
             L++PRL
Sbjct  512   LISPRL  517



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   437 bits (1124),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 240/482 (50%), Positives = 321/482 (67%), Gaps = 15/482 (3%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             R  E  G WP IGHLHLL       RTLG MADKYGP+F + LG   A+VVSS EV KEC
Sbjct  39    RPQEPSGRWPIIGHLHLLGADKLPHRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKEC  98

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             +TTND VFA+RP     K +GY+ A+   APYG YWRDVRK+  +EL++  +L+ L+HV+
Sbjct  99    YTTNDKVFATRPRSLAVKLMGYDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLKHVQ  158

Query  518   TSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF------SRIAKH  667
              SEVE  I +LY     N +    V + E F ++ +N+ +R + GKR+          K 
Sbjct  159   DSEVEFLIKELYGQWARNKDSPALVEMKERFGNLVMNVMVRAIAGKRYFGTHACDDEPKR  218

Query  668   LKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEIIGTWLQEHIRNR-  841
              K+ +   + L G+F+ SD IP L W+D + GY   +K+++KE+D ++G W++EH + R 
Sbjct  219   GKKALDDFMLLVGLFMVSDAIPFLGWLDTVKGYTTDMKKIAKELDYLLGRWVEEHRQQRL  278

Query  842   -KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
                ++  + DF+ VMLS + +D   SG   DT+IKAT L LIL G ++T+ TL W  SLL
Sbjct  279   SANNNRAEVDFLHVMLSVI-DDGQFSGRDPDTVIKATCLNLILAGYDTTSITLTWALSLL  337

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN HA+K AQ E+++HVGK R V+ SDIKNL Y QAI+KE LRLYPPGPLS P EAMED
Sbjct  338   LNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLSVPHEAMED  397

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C +  +HI  GTRL++NL KLHRDPRVW +P EF+PER F   HA +   GK++E LPF 
Sbjct  398   CTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPER-FLTNHAGLDVRGKNYELLPFG  456

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR+CPG++F+L++  L LARLL GF +      PVDM+EG G++ PK TP++V + PR
Sbjct  457   SGRRVCPGISFALELTHLALARLLHGFELGVVADSPVDMTEGPGLSAPKATPLEVTIVPR  516

Query  1559  LP  1564
             LP
Sbjct  517   LP  518



>gb|ABB20912.1| P450 mono-oxygenase [Stevia rebaudiana]
Length=528

 Score =   437 bits (1124),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 235/500 (47%), Positives = 317/500 (63%), Gaps = 19/500 (4%)
 Frame = +2

Query  107   ILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRL  286
             I K K+ +    KLLP   P+A GAWP IGHL LL       R LG +ADKYGP+F ++L
Sbjct  24    ISKRKKVDTTKNKLLP---PKAKGAWPLIGHLPLLGKNRIAHRVLGDLADKYGPIFTIKL  80

Query  287   GSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMV  466
             G +  +VVSS + VK+CFTT+D  FASRP     + +GYN A+F LAPYG YWR VRK+ 
Sbjct  81    GVYQVLVVSSADAVKDCFTTSDKAFASRPKSTAVEIMGYNYAMFGLAPYGEYWRQVRKIA  140

Query  467   TLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE--------VNLSEWFEHVTLNIT  622
              LE+++  R+  L   R SEV     ++Y     N E        V++ +WF ++ LN+ 
Sbjct  141   VLEILSQKRVDMLEWARVSEVRTSTNEVYDAWRVNKENEGSDMVLVDMKQWFTNLILNVL  200

Query  623   LRLLVGKRF---SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKE  793
             +R++ GKRF   S      +++  +   L G FV SD+IPS++  DIGGY K +K  ++E
Sbjct  201   VRIISGKRFPFKSVEGIRFQKMEKKLFELLGAFVVSDLIPSMKRFDIGGYQKQMKMAAEE  260

Query  794   MDEIIGTWLQEHIRNRK--EddddqsdfmdVMLSSLPE--DAVISGHKRDtiikattlil  961
             +++I+  WL      ++  E  +    FMDV++S L +  DA   G+  DT+IKAT + L
Sbjct  261   INDIMEGWLNNRKTQKESGEQKEGDQYFMDVLISVLKDASDADFPGYDHDTVIKATCMAL  320

Query  962   iltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKE  1141
             +  GS++T+ T+IW  +LLLN+P  +K+AQDE+D HVG+DRLVEESD+KNL Y  AIIKE
Sbjct  321   LAAGSDTTSVTIIWALALLLNHPEKMKIAQDEIDKHVGRDRLVEESDLKNLVYINAIIKE  380

Query  1142  GLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFR  1321
              +RLYP  PLS P EAMEDC +G YHIPKGTRL+ N  K+  DP +W EP EFKPER F 
Sbjct  381   TMRLYPAAPLSVPHEAMEDCVVGGYHIPKGTRLLPNFWKIQHDPNIWPEPYEFKPER-FL  439

Query  1322  DEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSE  1501
               H  +   GK FE LPF  GRRMCP + F LQ++ LTLA L+Q F I  P   P+DM+E
Sbjct  440   STHKDVDVKGKHFELLPFGTGRRMCPAITFVLQILPLTLANLIQQFEIRKPSNDPIDMTE  499

Query  1502  GLGIALPKLTPIQVLLTPRL  1561
               G+   + TP+ VL+ PRL
Sbjct  500   SAGLTTKRATPLDVLIAPRL  519



>ref|XP_008796321.1| PREDICTED: cytochrome P450 CYP82D47-like [Phoenix dactylifera]
Length=527

 Score =   437 bits (1123),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 230/509 (45%), Positives = 323/509 (63%), Gaps = 23/509 (5%)
 Frame = +2

Query  98    NQIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFG  277
             NQ + K  +  K   K      P+  GAWP +GHLHLL     + R+L  +AD  GPVF 
Sbjct  24    NQWLAKKSKSAKRRNK-----APQPGGAWPVLGHLHLLGSHNNIGRSLKAVADAVGPVFA  78

Query  278   LRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVR  457
             LRLG+HPA+VVS+ E  KECFT ND   A RP     K + YN A+   +PYG YWR VR
Sbjct  79    LRLGAHPALVVSTWEAAKECFTANDKALAGRPPSTASKLMCYNNAMVGFSPYGSYWRQVR  138

Query  458   KMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHE----NGEVNLSEWFEHVTLNITL  625
             +++TLEL++ +RL  L HVR SEV      L+ +C +       V +++WF+ +T N+ +
Sbjct  139   RILTLELLSHARLASLAHVRASEVGAFAKSLFGVCRKVEGGAARVEMNKWFQELTFNVVV  198

Query  626   RLLVGKRF----------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGL  775
             R++ GKR           SR A+     + R + L G FV SDV+P L WMD+GGY + +
Sbjct  199   RMVAGKRCFGCGAVDDGGSREARRFTGAMHRMMELLGAFVVSDVVPFLRWMDLGGYERAM  258

Query  776   KEVSKEMDEIIGTWLQEHIRNRKEddddqsdf-mdVMLSSL-PEDAVISGHKRDtiikat  949
             +  + EMD IIG WL+EH   R E   +  +  MDVMLS++  E  + S H  DT+IKA 
Sbjct  259   RRTAAEMDGIIGGWLREHRERRSEGRGEGKEDFMDVMLSTIEKEGELFSDHDPDTVIKAN  318

Query  950   tlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQA  1129
             +L LI+ G+++T+ T+ W  +LLLN+P+ ++ A++E+D  VGK+R V+ESD++ L Y QA
Sbjct  319   SLALIIGGTDTTSVTMTWVLALLLNHPNVLRKAREELDSRVGKERNVDESDVEKLVYLQA  378

Query  1130  IIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPE  1309
             I+KE LRLYPPGP+  P +AME+C++  + +P GTR+++N   +  DP VW +P  F+PE
Sbjct  379   IVKETLRLYPPGPVLIPHQAMEECQVRGFDVPAGTRVLVNAWAIQHDPEVWPDPSAFRPE  438

Query  1310  RWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPV  1489
             R F   H  +   G+ FE LPF  GRR CPG +F+LQV+ LTLAR++ GF++ TP G PV
Sbjct  439   R-FLTSHKDVDIRGRHFELLPFGSGRRACPGASFALQVLHLTLARVIHGFHMRTPGGGPV  497

Query  1490  DMSEGLGIALPKLTPIQVLLTPRL-PNLF  1573
             DM+EG G  LPK TP+ VL+ PRL P L+
Sbjct  498   DMTEGKGATLPKATPLHVLVAPRLSPELY  526



>ref|XP_010527272.1| PREDICTED: cytochrome P450 82G1-like isoform X4 [Tarenaya hassleriana]
Length=484

 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 235/485 (48%), Positives = 321/485 (66%), Gaps = 18/485 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P IGHLHLL G+  V +    ++DK GP+F L++G++  +VVS  E V++CF
Sbjct  1     MPEPSGALPLIGHLHLLRGKDLVFKKFAAISDKLGPIFSLKIGAYRLVVVSDPETVRDCF  60

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
              TND+V A+RP++++G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +  R++ L H+R 
Sbjct  61    ATNDVVLATRPNISIGRYVGYNNAILALAPYGDYWRELRKITTIYLFSNHRIEMLGHIRL  120

Query  521   SEVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFSRIAK-----HLKEV  679
             +EV   I  LY+   + G   V +    E +T NI LR + GKR             K+ 
Sbjct  121   NEVNVFIKHLYTTTVDRGSSLVRMDTLLEFMTFNIILRTVAGKRIEYGEMGCEEWRYKKA  180

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR------  841
             + +  YL GVF+  D IP LEWMD    +  +K+ +KE+D +I  WL+EH+  R      
Sbjct  181   IQQTEYLWGVFMVGDAIPWLEWMDFAK-VSLMKKTAKELDGVISKWLEEHLEKRLRNGND  239

Query  842   KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
             +E  D +   MD++L  LPED ++SGH RD I+K+T LIL LTGS+S   TLIWT SLLL
Sbjct  240   EESLDQEKTIMDLLLDVLPEDVLMSGHTRDIIVKSTALILTLTGSDSAYITLIWTVSLLL  299

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NNP  +K AQDE+D+ VGK R VEESDI+NLK+ QAI+KE  RLYPP PL+G REA EDC
Sbjct  300   NNPSVLKAAQDEIDVIVGKGRWVEESDIRNLKFLQAIVKETHRLYPPAPLTGIREASEDC  359

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +G Y + KGTRL++N+ KLHRDP++W EPE F+PER F +E       G  + Y+PF  
Sbjct  360   YVGGYRVTKGTRLLVNIWKLHRDPKIWPEPETFRPER-FMEEKPKCEQSG--YGYMPFGL  416

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPGMN  L+VV L LARLLQGF +      P+ M+EG G+AL K+ P+++ + PRL
Sbjct  417   GRRSCPGMNLGLRVVYLVLARLLQGFEVRRDSVEPLGMAEGPGLALTKVEPVEISVMPRL  476

Query  1562  -PNLF  1573
              P L+
Sbjct  477   EPELY  481



>ref|XP_009136105.1| PREDICTED: cytochrome P450 82G1 [Brassica rapa]
Length=513

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 239/482 (50%), Positives = 327/482 (68%), Gaps = 13/482 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P +GHLHLL G+  V + L  M+DK GP+F L+LG +  +V S  E++K+CF
Sbjct  37    IPEPLGALPLLGHLHLLRGKELVCKKLAAMSDKLGPIFSLKLGFYRLVVTSDPEILKDCF  96

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTNDLV A+RP++A G+Y+GYN A  ALAPYG YWR++RK+ T+ L +   ++ L H+R 
Sbjct  97    TTNDLVLATRPNIAFGRYVGYNNAALALAPYGDYWRELRKITTVHLFSNQSVEMLGHIRY  156

Query  521   SEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKR--FSRIAKH---LKEVVS  685
             +EV   +  LY        V +   FE +T NI LR +VGKR  F ++       KE + 
Sbjct  157   AEVNEFLKHLYEGSDGTSTVKIDMSFEFLTFNIILRKMVGKRIGFGKVKSEEWRYKEALK  216

Query  686   RALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI--RNRKEdddd  859
             R+ YL  VF+  DVIP L W+D    I  +K   KE+D +I  WL+EH+  R+RKE++ +
Sbjct  217   RSEYLAAVFMIGDVIPWLGWLDFTK-IAQMKSTFKELDSVITKWLEEHLEKRSRKEENQE  275

Query  860   qsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAI  1039
             ++    ++L  LPED VI GH RD I+KAT L+L LTGS+ST+ TL W  SLLLNNP  +
Sbjct  276   KTIMD-LLLDILPEDVVICGHVRDVIVKATILVLTLTGSDSTSITLTWAVSLLLNNPSTL  334

Query  1040  KMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYH  1219
             K AQ+E+D  VGK R VEESDI+NLKY QAI+KE  RLYPP PL+G REA EDC +G+YH
Sbjct  335   KAAQEEIDNSVGKGRWVEESDIRNLKYLQAIVKETHRLYPPAPLTGIREAREDCLLGEYH  394

Query  1220  IPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCP  1399
             + +G+RL++N+ KLHRDP++W +PE FKPER+  ++          FE++PFS GRR CP
Sbjct  395   VKRGSRLLVNIWKLHRDPKIWHDPETFKPERFMEEKSLC---EKSDFEFIPFSSGRRSCP  451

Query  1400  GMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL-PNLFP  1576
             GMN  L+VV L LARL+QGF +      P+DM+EG G+ALPK+ P++V+  PRL P L+ 
Sbjct  452   GMNLGLRVVHLVLARLIQGFELHKASDEPLDMAEGPGLALPKINPVEVVAMPRLEPELYH  511

Query  1577  TM  1582
             ++
Sbjct  512   SL  513



>ref|XP_007047111.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91268.1| Cytochrome P450 [Theobroma cacao]
Length=529

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 236/484 (49%), Positives = 323/484 (67%), Gaps = 20/484 (4%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             P+A GA P IGH+HLL G+    +TLG MADKYGPVF +RLGSH  +V++S E+ KECFT
Sbjct  41    PQAGGALPVIGHMHLLGGQQLTHKTLGAMADKYGPVFSIRLGSHRVLVLNSWEMAKECFT  100

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
              +D VF++RPS+A  K+LGY+ A+F  APYG YWR++RK+ T+EL++  R+  L+H+R S
Sbjct  101   VHDKVFSTRPSIAASKHLGYDFAMFGFAPYGSYWREMRKIATIELLSSHRIDMLKHIRAS  160

Query  524   EVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRF--------SRIA  661
             EV+  I +LY      G       V++ +WF  +T NI LR++ G+R+           A
Sbjct  161   EVKTAIRELYKSWLSKGSAETEVFVDMKQWFGDLTHNIALRMVGGRRYFGPNADCEEADA  220

Query  662   KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
             +  ++V+   +YL GVFV SD IP L W+D  GY K +K  +K++D ++  WL+EH + R
Sbjct  221   RRCQKVMRDFVYLFGVFVLSDAIPFLGWLDFQGYEKSMKRTAKQLDSLVERWLEEHKQKR  280

Query  842   KE--ddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
                    ++ DFMDVML+ L ED  I+G   DTI KAT L LIL GS++T  TL W  SL
Sbjct  281   LSGGGVIEEQDFMDVMLNIL-EDGKITGFDADTINKATCLNLILAGSDTTMVTLTWALSL  339

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             LLNNP  +K AQDE+DMHVGKDR +EESDI NL Y Q+I+KE LRLYPP P+ G R A+E
Sbjct  340   LLNNPRVLKRAQDELDMHVGKDRPLEESDISNLVYLQSIVKETLRLYPPSPIIGLRAALE  399

Query  1196  DCKIGK-YHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLP  1372
             DC +   YHIP GTRL++N  K+ RD RVW +P +F+PER F   H  + + G++FE +P
Sbjct  400   DCTLSTGYHIPSGTRLMVNAWKIQRDERVWPDPHDFQPER-FLTSHKDMDFRGQTFELIP  458

Query  1373  FSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGM-PVDMSEGLGIALPKLTPIQVLL  1549
             F  GRR CPG + +L++V   L R L  F+++ P  +  VDM+E  G+   K TP++VL+
Sbjct  459   FGSGRRSCPGTSLALKMVHFILGRFLHSFDVAKPSKLEDVDMTESAGLTNLKATPLEVLV  518

Query  1550  TPRL  1561
             TPRL
Sbjct  519   TPRL  522



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 229/476 (48%), Positives = 318/476 (67%), Gaps = 10/476 (2%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA GAWP IGHLHLL G  P  R LG MADKYGP+F +++G + A+VVS+ E+ KEC 
Sbjct  45    APEAGGAWPVIGHLHLLGGPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECL  104

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT+D VFASRP     + LGYN ++F  +PYG YWR+ RK+ TLEL++  RL+KL+ VR 
Sbjct  105   TTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLKQVRE  164

Query  521   SEVEHCIGDLYSMCHENGEVN------LSEWFEHVTLNITLRLLVGKRFSRI-AKHLKEV  679
              E++ C+ +LY +   N   N      +  W      N+ LR++VGK  + + ++  KE+
Sbjct  165   YELKTCLKELYQLWDNNKSTNKMLLVEMKRWLADSIRNVVLRMIVGKGCNSMDSEEWKEL  224

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH--IRNRKEdd  853
             ++R   + G FV SD +P L W+DIGG  + +K+++KE+D ++  WL+EH   R+ +E +
Sbjct  225   LTRFFEMSGKFVVSDALPFLRWLDIGGDERSMKKIAKELDVVVQGWLEEHKMKRDSQEMN  284

Query  854   ddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPH  1033
              ++ DFM VMLS L +     G   DTI KA  L LIL  +++TA TL W  SLLLN+  
Sbjct  285   QEEEDFMYVMLSILGDTDQYYGRDVDTINKAICLGLILAATDTTAVTLTWIISLLLNHHD  344

Query  1034  AIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGK  1213
              +  A++E+D+ VG  R V ESDIKNL Y QAI+KE +RLYP  PL  P E++E+C +  
Sbjct  345   ILNKARNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHESIEECTVSG  404

Query  1214  YHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRM  1393
             Y++P GT+L +N+ KL RDP VW EP +F+PER F   H      G++FE LPFS GRRM
Sbjct  405   YNVPSGTQLFINVWKLQRDPHVWEEPCKFQPER-FLTRHKDTDVRGQNFELLPFSSGRRM  463

Query  1394  CPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             CPG++F+LQV+Q TLA LL GF+I+TP   P+DM EGLG+ + K TP++VL+ PRL
Sbjct  464   CPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGLGLTVEKSTPLEVLVAPRL  519



>gb|KDO39483.1| hypothetical protein CISIN_1g009723mg [Citrus sinensis]
Length=527

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 237/502 (47%), Positives = 318/502 (63%), Gaps = 27/502 (5%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHP  298
             K  NK  G       PEA G WP IGHLHLL    P+ + LG +ADKYGP+  +++G H 
Sbjct  24    KAGNKKRG------APEAGGGWPVIGHLHLLGRPEPLHKVLGKIADKYGPILTIKIGVHR  77

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
              +VVS+ E+ KEC TT+D VFA+RP    G  L Y+ ++    PYG YWR +RK+ TLEL
Sbjct  78    TLVVSNWEIAKECLTTSDKVFATRPKTVAGHILCYDSSLLGFVPYGHYWRQIRKIATLEL  137

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGK  643
             ++  RL+ L++VR SEV  C+ +LY++     +     V++ +W E+VTLN+ LR++VGK
Sbjct  138   LSSYRLESLKYVRESEVRTCLKELYNLWDAGLDKAPVLVDMKKWCEYVTLNVILRMVVGK  197

Query  644   RF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMD  799
             R         +   +  K+ +SR     G  V SD +P L W+DIGG  + +K+ ++E+D
Sbjct  198   RCNISISQKGTSSDQGWKDELSRFFEFMGKLVVSDALPFLRWLDIGGDERLMKKTARELD  257

Query  800   EIIGTWLQEHIRNRK----EddddqsdfmdVMLSSLPEDAV--ISGHKRDtiikattlil  961
              I+  WL EH R       +    + +FM  MLS L +       G   DTI KAT L L
Sbjct  258   LIMQRWLDEHRRKGDSGDYQIKGREENFMGAMLSILDDIGAQEFPGRDADTINKATCLAL  317

Query  962   iltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKE  1141
             IL GS++T+ TL W  SLLLNN HA+K AQ+E+D  VGK+R V+ESD +NL Y QAIIKE
Sbjct  318   ILGGSDTTSGTLTWAISLLLNNRHALKKAQEELDQQVGKERAVDESDTENLVYLQAIIKE  377

Query  1142  GLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWF-  1318
              LRLYP GPL  PREAMEDC +  YH+P GTRL++N  K+ RDPRVW  P  F+PER+  
Sbjct  378   TLRLYPAGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPRVWENPSAFQPERFLP  437

Query  1319  -RDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDM  1495
                 HA +   G+ FE +PF  GRR CPG + +LQV+ LTLARLL  F ++TP+  PVDM
Sbjct  438   GHGAHADVDVRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHAFELATPLDQPVDM  497

Query  1496  SEGLGIALPKLTPIQVLLTPRL  1561
             SE  G+ +PK TP++VLL+PRL
Sbjct  498   SESPGLTIPKATPLKVLLSPRL  519



>ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52485.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 226/482 (47%), Positives = 321/482 (67%), Gaps = 16/482 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              PE  G+WP IGHLHLL G   +  RTLG +ADKYGP F +R+GSH A+VV+S E+ KEC
Sbjct  38    APEPAGSWPIIGHLHLLGGADKLLHRTLGSLADKYGPAFNIRIGSHRALVVASKELAKEC  97

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASR + A  K++ Y+ AVF  APY  +WR++RK+V LEL++  RL+ ++HV+
Sbjct  98    FTINDKTLASRSTTAATKHMCYDHAVFGFAPYSSHWREMRKIVMLELLSNRRLEMVKHVQ  157

Query  518   TSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRFS-----RIAKHL  670
              SEV+  I  LY++  +N      V L ++FE +TL++ +R++ GKR++       A+  
Sbjct  158   ASEVDLGIRKLYNLWAQNRCLPVIVELKQFFEDLTLDVIVRVVAGKRYTGSSDDDEARQY  217

Query  671   KEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR--K  844
             ++ +S+  +L G+FV SD +P L W+D+ G+ K +K+ +K++D ++  WL EH R R   
Sbjct  218   QKAISQFFHLMGIFVVSDALPFLRWLDLEGHEKAMKKTAKDLDAVLAGWLDEHRRRRVSG  277

Query  845   EddddqsdfmdVMLSSLPEDAVISG--HKRDtiikattlililtGSESTAETLIWTTSLL  1018
             E   +       ++ SL E   +SG  +  DT IK+T L LI   S++T  TL+W  SLL
Sbjct  278   EVKSEGDQDFIDVMLSLEEKGHLSGFQYDADTSIKSTCLALIAGASDTTTTTLVWAISLL  337

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN  A+K A++E++ H+G +R V+ESD+KNL Y QA+IKE LRLYP  PL  PRE +ED
Sbjct  338   LNNQLALKNAKEELEKHIGTERQVDESDLKNLVYLQAVIKETLRLYPVAPLI-PREFVED  396

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C++G YH+P GTRL++N+ K+ RDP +W++   F+PER F   HA I   G  FE LPF 
Sbjct  397   CRVGGYHVPAGTRLLVNVWKIQRDPMLWTKASAFQPER-FLTSHADIDVRGHHFELLPFG  455

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CPG +F+L  + LTLAR L  F+++TPM  PVDM+E  G  LPK TP++VLL+PR
Sbjct  456   SGRRSCPGASFALHALHLTLARFLHAFDVATPMDQPVDMTERSGTTLPKATPLEVLLSPR  515

Query  1559  LP  1564
             LP
Sbjct  516   LP  517



>emb|CBI32510.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   439 bits (1128),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 240/493 (49%), Positives = 324/493 (66%), Gaps = 17/493 (3%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             + NK  GK    R PE  G WP IGHLHLL     + RTLG MADKYGP+F +RLG    
Sbjct  99    KGNKKRGK----RPPEPSGRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKT  154

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +VVSS EV KEC+TT+D VFA+RP     K +GY+   F  APYG YWRDVRK+  +EL+
Sbjct  155   LVVSSWEVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELL  214

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF  649
             +  +L+  +HV+ SEV+  I +LY     N +    V + E F ++ LN+ +R + GKR+
Sbjct  215   SNRQLEMHKHVQDSEVKILIKELYGQWASNKDGPALVEMKERFGNLALNVVVRAIAGKRY  274

Query  650   SRI------AKHLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEII  808
                       K  K+     + L G+F+ SDVIP L W+D + G+   +K V+KE+D ++
Sbjct  275   FGTHACGDEPKRAKKAFEDFIILLGLFMVSDVIPFLGWLDTMKGFTAEMKRVAKEVDYVL  334

Query  809   GTWLQEHIRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililtGSEST  985
             G+W++EH +NR   +D+ ++   +  + S+ +D   SG   DTIIK T   LIL G+++T
Sbjct  335   GSWVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFSGRDPDTIIKGTCSNLILAGNDTT  394

Query  986   AETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPG  1165
             + TL W  SLLLNN HA+K AQ E+++HVGK R V+ SDIKNL Y QAI+KE LRLYPPG
Sbjct  395   SITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPG  454

Query  1166  PLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGY  1345
             PLS P EAMEDC +  +HI  GTRL++NL KLHRDPRVW +P EF+PER F  +HA +  
Sbjct  455   PLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPER-FLTKHAGLDV  513

Query  1346  VGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPK  1525
              GK++E LPF  GRR+CPG++F+L++  LTLARLL GF +      PVDM+E  G+  PK
Sbjct  514   RGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPK  573

Query  1526  LTPIQVLLTPRLP  1564
              TP++V + PRLP
Sbjct  574   ATPLEVTIVPRLP  586



>gb|KDP29948.1| hypothetical protein JCGZ_18517 [Jatropha curcas]
Length=525

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 234/497 (47%), Positives = 314/497 (63%), Gaps = 24/497 (5%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHP  298
             ++ + NN K LP   PEA G WP +GHL LL        TLG +ADK GP+F +RLG H 
Sbjct  32    RKRSANNKKRLP---PEAAGGWPIVGHLPLLSLSKAPYITLGKIADKLGPLFTIRLGVHR  88

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
             A++VSS E+ KEC++TND  FASRP       +GYN A+    PYG YWR +RK+ TL+L
Sbjct  89    ALIVSSWEMAKECYSTNDEAFASRPKALFFDVMGYNYAMIGATPYGEYWRQIRKISTLKL  148

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVG  640
             ++  RL  LRHVR +EV+  +G LY    +N        V +  WF  + LN+ L+++VG
Sbjct  149   LSNYRLDLLRHVRETEVKEAVGGLYKKWMKNKSSSGKLVVEMKNWFWDLNLNVILKMVVG  208

Query  641   KRF----------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSK  790
             KR+          +  +   +  V     L G F  SD +P L W+D+GG  K +K+   
Sbjct  209   KRYVEYINGEDESNEESDTWQNTVRDFFELAGKFAVSDALPFLRWLDVGGVEKAMKKTMT  268

Query  791   EMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililt  970
             +MDEI+  WLQEH   +K+   ++ D MDV++S+L ++  +      TI KAT L LIL 
Sbjct  269   DMDEIMDRWLQEH--KQKKAKPEEEDLMDVLMSALDDENTLFTQDAGTINKATCLSLILA  326

Query  971   GSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLR  1150
              S+     L WT SL+LNNP+ +K A+ E+  H+G+DR V++SD+KNL Y QAI+KE LR
Sbjct  327   ASDIVRAALTWTLSLILNNPNVLKKAKQELYTHIGQDRQVQDSDVKNLVYLQAIVKEALR  386

Query  1151  LYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEH  1330
             LYPPGP+S PRE ++DC +G YHIP GTRLI+N+ ++HRDPRVWS P EF+PER+     
Sbjct  387   LYPPGPVSVPRECIKDCSVGGYHIPAGTRLIVNISRIHRDPRVWSNPSEFEPERFL---S  443

Query  1331  ASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLG  1510
              +I   GK+ E +PF  GRRMCPG  F+LQ++ LTLA  L  F I TP G PVDMSEG G
Sbjct  444   MNIDVKGKNPELIPFGSGRRMCPGATFALQILNLTLASFLHAFEIETPSGKPVDMSEGTG  503

Query  1511  IALPKLTPIQVLLTPRL  1561
             I   K TP++V LTPRL
Sbjct  504   IINLKATPLEVALTPRL  520



>ref|XP_006366470.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=511

 Score =   435 bits (1119),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 230/480 (48%), Positives = 310/480 (65%), Gaps = 16/480 (3%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHG----RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEV  325
             RV EA GAWP IGHLHLL G    +LP  + +G MADKYGP+FG++LG H  +VVS  ++
Sbjct  30    RVAEAGGAWPIIGHLHLLGGSDTDQLP-HKIMGRMADKYGPIFGMKLGVHQVVVVSDHKL  88

Query  326   VKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKL  505
              KECFTTNDL  A RP +   + +GY +A F L  YG YWR+ +K+ T+EL +  R++ L
Sbjct  89    AKECFTTNDLALAGRPKLMSSEIMGYKQAFFGLCSYGPYWRETKKIATIELFSTRRIEML  148

Query  506   RHVRTSEVEHCIGDLYSMCHENGEVN------LSEWFEHVTLNITLRLLVGKRFSRIAKH  667
             +H+R  EV+  I ++++   +N  +N      + EW   + +N   ++L G        +
Sbjct  149   KHIRQFEVKSGIKEIHNNWAKNMNLNGVVKMEMKEWIGDIVMNTIQKMLFGSSNEEEGIN  208

Query  668   LK--EVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
              K  + + R   L G FV +D +P L W+DIGGY K +KEVSKEMD ++  WL EH + +
Sbjct  209   YKAHKAIRRYFELAGAFVVADYLPYLRWLDIGGYEKAMKEVSKEMDSVVEEWLAEH-KTK  267

Query  842   KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
             K    +  DFMDVMLS + E+  +     DT IKAT + ++  G+++T  TL W   LLL
Sbjct  268   KIKSGEVEDFMDVMLS-ICENKHLPAFDSDTAIKATCMGILSAGTDTTIVTLTWILCLLL  326

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NN  A++ AQDE+D HVGK+  V+ESDIKNL Y QAI+KE LRLYP GPLS P E+MEDC
Sbjct  327   NNYEALQKAQDEIDAHVGKNTWVQESDIKNLVYLQAIVKEALRLYPAGPLSVPHESMEDC  386

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              IG Y IPKGTRL++NL K+H DP +W  P EFKPER F   H  +   G  FE +PF  
Sbjct  387   VIGGYDIPKGTRLLVNLWKIHHDPNIWKNPHEFKPER-FLTTHKDVDVRGNHFELIPFGS  445

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRRMCPG++  LQVV   +A LLQGF++  P   P+DMSE  G+++ K +P++VLL PRL
Sbjct  446   GRRMCPGISLVLQVVPFVIAMLLQGFDMKRPSDEPIDMSESFGLSVLKASPLEVLLAPRL  505



>ref|XP_010527271.1| PREDICTED: cytochrome P450 82G1-like isoform X3 [Tarenaya hassleriana]
Length=497

 Score =   435 bits (1118),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 235/485 (48%), Positives = 321/485 (66%), Gaps = 18/485 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P IGHLHLL G+  V +    ++DK GP+F L++G++  +VVS  E V++CF
Sbjct  14    MPEPSGALPLIGHLHLLRGKDLVFKKFAAISDKLGPIFSLKIGAYRLVVVSDPETVRDCF  73

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
              TND+V A+RP++++G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +  R++ L H+R 
Sbjct  74    ATNDVVLATRPNISIGRYVGYNNAILALAPYGDYWRELRKITTIYLFSNHRIEMLGHIRL  133

Query  521   SEVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFSRIAK-----HLKEV  679
             +EV   I  LY+   + G   V +    E +T NI LR + GKR             K+ 
Sbjct  134   NEVNVFIKHLYTTTVDRGSSLVRMDTLLEFMTFNIILRTVAGKRIEYGEMGCEEWRYKKA  193

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR------  841
             + +  YL GVF+  D IP LEWMD    +  +K+ +KE+D +I  WL+EH+  R      
Sbjct  194   IQQTEYLWGVFMVGDAIPWLEWMDFAK-VSLMKKTAKELDGVISKWLEEHLEKRLRNGND  252

Query  842   KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
             +E  D +   MD++L  LPED ++SGH RD I+K+T LIL LTGS+S   TLIWT SLLL
Sbjct  253   EESLDQEKTIMDLLLDVLPEDVLMSGHTRDIIVKSTALILTLTGSDSAYITLIWTVSLLL  312

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NNP  +K AQDE+D+ VGK R VEESDI+NLK+ QAI+KE  RLYPP PL+G REA EDC
Sbjct  313   NNPSVLKAAQDEIDVIVGKGRWVEESDIRNLKFLQAIVKETHRLYPPAPLTGIREASEDC  372

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +G Y + KGTRL++N+ KLHRDP++W EPE F+PER F +E       G  + Y+PF  
Sbjct  373   YVGGYRVTKGTRLLVNIWKLHRDPKIWPEPETFRPER-FMEEKPKCEQSG--YGYMPFGL  429

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPGMN  L+VV L LARLLQGF +      P+ M+EG G+AL K+ P+++ + PRL
Sbjct  430   GRRSCPGMNLGLRVVYLVLARLLQGFEVRRDSVEPLGMAEGPGLALTKVEPVEISVMPRL  489

Query  1562  -PNLF  1573
              P L+
Sbjct  490   EPELY  494



>ref|XP_002284810.3| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=610

 Score =   439 bits (1128),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 240/493 (49%), Positives = 324/493 (66%), Gaps = 17/493 (3%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             + NK  GK    R PE  G WP IGHLHLL     + RTLG MADKYGP+F +RLG    
Sbjct  114   KGNKKRGK----RPPEPSGRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKT  169

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +VVSS EV KEC+TT+D VFA+RP     K +GY+   F  APYG YWRDVRK+  +EL+
Sbjct  170   LVVSSWEVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELL  229

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE----VNLSEWFEHVTLNITLRLLVGKRF  649
             +  +L+  +HV+ SEV+  I +LY     N +    V + E F ++ LN+ +R + GKR+
Sbjct  230   SNRQLEMHKHVQDSEVKILIKELYGQWASNKDGPALVEMKERFGNLALNVVVRAIAGKRY  289

Query  650   SRI------AKHLKEVVSRALYLGGVFVPSDVIPSLEWMD-IGGYIKGLKEVSKEMDEII  808
                       K  K+     + L G+F+ SDVIP L W+D + G+   +K V+KE+D ++
Sbjct  290   FGTHACGDEPKRAKKAFEDFIILLGLFMVSDVIPFLGWLDTMKGFTAEMKRVAKEVDYVL  349

Query  809   GTWLQEHIRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililtGSEST  985
             G+W++EH +NR   +D+ ++   +  + S+ +D   SG   DTIIK T   LIL G+++T
Sbjct  350   GSWVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFSGRDPDTIIKGTCSNLILAGNDTT  409

Query  986   AETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPG  1165
             + TL W  SLLLNN HA+K AQ E+++HVGK R V+ SDIKNL Y QAI+KE LRLYPPG
Sbjct  410   SITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPG  469

Query  1166  PLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGY  1345
             PLS P EAMEDC +  +HI  GTRL++NL KLHRDPRVW +P EF+PER F  +HA +  
Sbjct  470   PLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPER-FLTKHAGLDV  528

Query  1346  VGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPK  1525
              GK++E LPF  GRR+CPG++F+L++  LTLARLL GF +      PVDM+E  G+  PK
Sbjct  529   RGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLTAPK  588

Query  1526  LTPIQVLLTPRLP  1564
              TP++V + PRLP
Sbjct  589   ATPLEVTIVPRLP  601



>ref|XP_009795251.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   435 bits (1119),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 226/487 (46%), Positives = 311/487 (64%), Gaps = 16/487 (3%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             +VP+A GAWP IGHLHLL+G     +  GHMA+KYGP+F ++LG +  +VVS  ++ KEC
Sbjct  33    KVPKAAGAWPIIGHLHLLNGSQMPHKIFGHMAEKYGPIFRIKLGVNQVVVVSDAKIAKEC  92

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTTND+ FA+RP     + +GYN A+F L PYG YWR++RK+ T+E ++  +++   H+R
Sbjct  93    FTTNDMAFANRPKSIASEIIGYNYAMFGLGPYGPYWREIRKIATIEFLSTRQVEISSHIR  152

Query  518   TSEVEHCIGDLY--------SMCHENGEVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLK  673
               EV+  I ++Y        S  +   ++ + EWF ++ +N  +++L G R++   +  +
Sbjct  153   ELEVKSAIKEIYEYWLKSKSSSLNVAVKIEMKEWFGNLIMNTMVKMLFGVRYTGKEEEER  212

Query  674   ----EVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
                 + + R   L GV   +D +P L W+DIGG+ K +KE + EMD ++  WL EH R R
Sbjct  213   GRAHKAIRRFFELMGVSAVADFLPYLRWLDIGGHEKAMKETANEMDSLVEEWLAEHRRQR  272

Query  842   KEddddqsdfmdVM--LSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
             +       D  D+M  + S+ ED  + G   DTIIKAT L L   G+++T  TL WT SL
Sbjct  273   ELRGIKYGDEEDLMDVMLSICEDRDLPGFDADTIIKATCLALQSAGTDTTIVTLTWTLSL  332

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             +LNN   +K AQDE+D HVGK R V+ESDIKNL Y QAI+KE LRLYP  PL  P E +E
Sbjct  333   ILNNYQILKKAQDELDAHVGKHRWVQESDIKNLVYLQAIVKEALRLYPAAPLLLPHECIE  392

Query  1196  DCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPF  1375
             DC I  Y IPKGTRL++N+ K+H DP +W  PEEFKPER F   H  +   G  FE +PF
Sbjct  393   DCDISGYDIPKGTRLLVNIWKIHYDPDLWPNPEEFKPER-FLTTHKDVDVRGNHFELIPF  451

Query  1376  SGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTP  1555
               GRRMCPG++  LQVVQ  LA LLQGF I  P   P+DMSE  G+ + K +P+++LL P
Sbjct  452   GSGRRMCPGISMGLQVVQYVLAVLLQGFEIKRPSDEPIDMSESFGLTILKASPLEILLAP  511

Query  1556  RL-PNLF  1573
             RL PNL+
Sbjct  512   RLAPNLY  518



>ref|XP_004238201.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=520

 Score =   435 bits (1119),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 229/486 (47%), Positives = 314/486 (65%), Gaps = 16/486 (3%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHG----RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEV  325
             +VPEA GAWP IGHLHLL G     LP  + LG +ADKYGP+FG++LG H  +VVS  ++
Sbjct  36    KVPEAGGAWPIIGHLHLLGGSESDHLP-HKMLGRLADKYGPIFGMKLGVHQVVVVSDHKL  94

Query  326   VKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKL  505
              KECFTTNDL  A RP     + +GY  A+F L  YG YWR+ RK+ T+EL +  R++ L
Sbjct  95    AKECFTTNDLALAGRPKSMASEIIGYKHAMFGLCSYGPYWRETRKIATIELFSARRIEML  154

Query  506   RHVRTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGK-RFSRIAKH  667
             +H+R  EV+  I ++Y+   +N      ++ + EW   + +N   ++L GK R S   + 
Sbjct  155   KHIREFEVKSGIKEIYNNWEKNNLNGVVKMEMKEWIGDLFMNTMGKILFGKGRRSNEDEG  214

Query  668   LKEV---VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
             + +    + R   L GVFV +D +P L W+DIGG+ K +KEVSKEMD ++  WL EH   
Sbjct  215   INKAHKAIRRFFELLGVFVVADFLPYLRWLDIGGHEKAMKEVSKEMDSVVEEWLTEHKTK  274

Query  839   RKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
             R      + +    ++ S+ ED  + G   DT IKAT + L+  G+++T  TL W  SLL
Sbjct  275   RGIIKSGEEEDFMDVMLSVCEDRDLPGVDADTAIKATCMALLSAGTDTTMVTLTWILSLL  334

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN  +++ AQDE+D HVGK+R V+ESDIKNL YFQAI+KE LRLYP GPLS P E+MED
Sbjct  335   LNNYQSLQKAQDELDAHVGKNRWVQESDIKNLVYFQAIVKEALRLYPAGPLSLPHESMED  394

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C I  Y IPKGTRL++N+ K+ RDP +W  P EFKPER F   H  +   G  FE +PF 
Sbjct  395   CTISGYDIPKGTRLLVNIWKIQRDPNIWPNPHEFKPER-FLSTHKDVDVKGNHFELMPFG  453

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRRMCPG++ +LQV+   +A LLQGF++   +  P+DMSE  G+ + K +P++VLL PR
Sbjct  454   SGRRMCPGISLALQVLPFVIAMLLQGFDMKRLLDEPIDMSESFGLTVLKASPLEVLLAPR  513

Query  1559  L-PNLF  1573
             L P+L+
Sbjct  514   LAPDLY  519



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   433 bits (1114),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 228/474 (48%), Positives = 310/474 (65%), Gaps = 19/474 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA GAWP IGHLH+L G  P+ R LG MADKYGP+F +++G + A+VVSS E+ KEC 
Sbjct  6     APEAGGAWPVIGHLHILGGPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMAKECL  65

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND +FASRP     + LGYN ++F  +PYG YWR+ RK+ TLEL++  RL+KLRHVR 
Sbjct  66    TTNDKIFASRPKTLAMEILGYNFSMFGSSPYGSYWRETRKIATLELLSKHRLEKLRHVRD  125

Query  521   SEVEHCIGDLYSMCHENGEVN-----LSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVVS  685
              EV+ C+ +LY +  ++   N     +  WFE    N+ LR++VGK  + + K       
Sbjct  126   YEVKTCLKELYELWDKSKSTNKMLVEMKRWFEDTICNVILRMIVGKGCNSVDK-------  178

Query  686   RALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR--KEdddd  859
                 + G FV SD +P L W+DIGG  + +K+ +KE+D ++   L+EH R R  +E   +
Sbjct  179   ----MSGKFVVSDALPFLRWLDIGGDERSMKKTAKELDIVVQGCLEEHKRKRDSREMKGE  234

Query  860   qsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAI  1039
             + DFM VMLS L +    SG   DTI KA  L LI+ G ++T  TL W  SLLLN+   +
Sbjct  235   ELDFMSVMLSILGDTEKYSGRDVDTINKAVCLGLIIAGLDTTTVTLTWVISLLLNHRDIL  294

Query  1040  KMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYH  1219
                Q+E+D+ VG  R V ESD+KNL Y QA +KE +RLYP  PL  P EA+E+C +  YH
Sbjct  295   DKVQNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRLYPAVPLLIPHEAIEECTVNGYH  354

Query  1220  IPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCP  1399
             +P GT+L++N+ KL RDPRVW EP +F+PER F  +H  I   G+  E LPF  GRRMCP
Sbjct  355   VPAGTQLLINVWKLQRDPRVWEEPCKFQPER-FLTKHKDIDVRGQHLELLPFGSGRRMCP  413

Query  1400  GMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             G++F+LQV+Q T+A LLQGF+ +TP   P+DM EG G+ + K  P++VL+ PRL
Sbjct  414   GVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLTMEKSRPLEVLIAPRL  467



>ref|XP_007049686.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOX93843.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
Length=590

 Score =   437 bits (1124),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 230/475 (48%), Positives = 326/475 (69%), Gaps = 17/475 (4%)
 Frame = +2

Query  188   FIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFTTNDLVFAS  367
             F+G L L +  + +ARTL  MADKYGPVF +R+G +  ++VS+ E VKECFTTND + A+
Sbjct  113   FLGLLILYNLTVTLARTLAAMADKYGPVFTIRIGIYRTLIVSNHEAVKECFTTNDKILAN  172

Query  368   RPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTSEVEHCIGD  547
             RP    G YL Y+ A F  APYG YWR +RK+  LEL++V RL  L HVR SEV+  I +
Sbjct  173   RPRSNAGTYLAYDHAGFGFAPYGTYWRQMRKLAVLELLSVHRLATLTHVRVSEVDAFIKN  232

Query  548   LYSMCHE-----NGEVNLSEWFEHVTLNITLRLLVGKRF--------SRIAKHLKEVVSR  688
             L   C +     N ++++S+  E + LN+ LR + G R+         + A+   +++  
Sbjct  233   LCFFCKKSEQSPNQKISISQRLEVLNLNMMLRTIAGTRYFSDADGENDKEAQRAMKLIKE  292

Query  689   ALYLGGVFVPSDVIPSLEWMDIGGY-IKGLKEVSKEMDEIIGTWLQEH-IRNRKEddddq  862
               YL GV   S+V+P L+W+D  G+ +K +K +SKEMD +I +W+ EH +R  K    + 
Sbjct  293   FSYLLGVTALSEVVPFLKWIDFWGHQVKSMKRISKEMDSLIESWVDEHKLRRFKIGAKNN  352

Query  863   sdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIK  1042
              DF+DV+LS++ +D++  GH R+TIIKAT  +LI  GS+ST+ TL W  S L+NN +A+K
Sbjct  353   QDFIDVLLSAIEDDSMF-GHTRETIIKATVTVLISAGSDSTSRTLTWILSNLMNNRNAMK  411

Query  1043  MAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHI  1222
              AQ+E+D+ +G+DR VE+ DI+ L Y QAIIKE  RLYP  PLS P +AME C+I  YHI
Sbjct  412   RAQEELDLKIGRDRWVEDCDIEKLVYLQAIIKETFRLYPAAPLSVPHQAMEYCRISGYHI  471

Query  1223  PKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPG  1402
             PKGTRL +N+ KL RDPR+WS PEEF+PER F   + ++  +G+ FE +PF  GRR CPG
Sbjct  472   PKGTRLFVNVWKLQRDPRIWSNPEEFEPER-FLTSYQNVDILGQHFELIPFGSGRRSCPG  530

Query  1403  MNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLPN  1567
             M+++LQV++LT+ARLLQGF+++TP+  PVDM+E  G  + K TP+Q++LTPRLP+
Sbjct  531   MSWALQVIRLTIARLLQGFDLATPLNAPVDMTEEPGGTMSKATPLQLVLTPRLPD  585



>ref|XP_010106082.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07352.1| Cytochrome P450 82A3 [Morus notabilis]
Length=532

 Score =   435 bits (1118),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 235/499 (47%), Positives = 327/499 (66%), Gaps = 26/499 (5%)
 Frame = +2

Query  131   KNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVV  310
             +N+ ++ P   PEA G WP IGHLHLL G      TL ++ADK+GP+F +R+GS+  +VV
Sbjct  34    RNDSRISP---PEAAGRWPIIGHLHLLGGSQLPHITLANLADKWGPIFTIRIGSYRGLVV  90

Query  311   SSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVS  490
             SS E+ KECFT NDL  ASRP++   K+LGY  A+F LAP+G +WR++RK+ T++L++  
Sbjct  91    SSSEMAKECFTINDLASASRPNLLAAKHLGYKYAMFGLAPHGPFWREIRKIATVQLLSNR  150

Query  491   RLKKLRHVRTSEVEHCIGDLY----SMCHEN-----GEVNLSEWFEHVTLNITLRLLVGK  643
             RL+ L+H+R SEV   + +LY    +  ++N       V + + F  +TLN+ LR++ GK
Sbjct  151   RLELLKHIRISEVASFVKELYEHWTTKWNDNDHSGQASVEMKQRFSDLTLNVILRMVAGK  210

Query  644   RFS---------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEM  796
             R+S         + A+ +++ +   L   G+FVP D IP L W+D+GG  K +K+ +K +
Sbjct  211   RYSIDANDGGDVKEARLVQKEIKEFLKHLGLFVPGDAIPYLGWLDLGGCEKAMKKTAKAL  270

Query  797   DEIIGTWLQEHIRNRKEddddqsdfm---dVMLSSLPEDAVISGHKRDtiikattlilil  967
             D I+G WL+EH +NR E ++++       DVMLS L   +   G   DTIIKAT L +I 
Sbjct  271   DGIVGEWLEEHKQNRAEMNNEEKKEQDFMDVMLSVL-HGSDFGGFDADTIIKATILNMIA  329

Query  968   tGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGL  1147
              GS++TA TL W  SLLLNN H +K AQ+E++ +VGK+R V ESDI  L Y  AI+KE L
Sbjct  330   GGSDTTALTLTWAVSLLLNNHHVLKKAQEELENNVGKNRTVNESDIGKLTYIFAIVKETL  389

Query  1148  RLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDE  1327
             RLYP  PLS PR  +EDC IG YH+ KGTRLI N+ K+  DP +W +P EFKPER F   
Sbjct  390   RLYPVAPLSAPRVFLEDCTIGGYHVAKGTRLITNIWKIQTDPILWPDPFEFKPER-FLTT  448

Query  1328  HASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGL  1507
             +  +   G+ FE +PF  GRR CPG +F+LQ+VQ TLA  LQ F+ISTP+   VDM+E  
Sbjct  449   NKDVDVRGQHFELIPFGSGRRACPGTSFALQMVQFTLASFLQAFDISTPLNALVDMTESF  508

Query  1508  GIALPKLTPIQVLLTPRLP  1564
             G+   K TP++VL+TPRLP
Sbjct  509   GLTNTKATPLEVLITPRLP  527



>ref|XP_009801176.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=517

 Score =   434 bits (1117),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 221/481 (46%), Positives = 322/481 (67%), Gaps = 14/481 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHG---RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             PE PGAWP IGHL  L G    +P  R LG +ADKYGPVF LR+G +P ++V++ E  K+
Sbjct  33    PEIPGAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKD  92

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             C TT+D   A+RP+   G+ +GY  A F  A +G Y+  VRK+   ++++ ++L+K++H+
Sbjct  93    CLTTHDKDLAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQQVLSSTKLEKMKHI  152

Query  515   RTSEVEHCIGDLYSMC---HENGEVNLSEWFEHVTLNITLRLLVGKRFSRI-----AKHL  670
             R SE+E  I +LYS+    +   +VN+S+WFE +TLNI ++ + GKR+S I     A+  
Sbjct  153   RVSEMETSIKELYSLALVKNNIQKVNISKWFEQLTLNIIVKTICGKRYSNIEEDEEAQRF  212

Query  671   KEVVSRALYLGGVFVPSDVIPS--LEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK  844
             ++     +Y+ G  V  D IP    ++ D  G+IK +K++ K++D I+  WL +H+  + 
Sbjct  213   RKAFKGIMYVVGQIVLYDAIPFPLFKYFDFQGHIKLMKKIYKDLDYILQGWLDDHMMKKD  272

Query  845   EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLN  1024
              +++DQ     ++  +   +    G  + T+IK+T L LIL G+++TA  LIW  SLLLN
Sbjct  273   VNNEDQDAMDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLN  332

Query  1025  NPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCK  1204
             NPH +K AQ+E+DM VGK+R VE++DIKNL Y QAI+KE LRLYPP P   P EA++DCK
Sbjct  333   NPHVMKQAQEEIDMKVGKERWVEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCK  392

Query  1205  IGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGG  1384
             +  YHIPKGTRL +N  K+HRDP +WSEPE F PER F    A++   G++FE++PF  G
Sbjct  393   VAGYHIPKGTRLHINAWKVHRDPEIWSEPERFMPER-FLTSKANVDARGQNFEFIPFGSG  451

Query  1385  RRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             RR CPG+NF+  V  LT  RLLQGF+ STP   P+DM+EG+G+ LPK+  ++VL++PRLP
Sbjct  452   RRSCPGINFATLVTHLTFGRLLQGFDFSTPSNTPIDMTEGVGVTLPKVNQVEVLISPRLP  511

Query  1565  N  1567
             +
Sbjct  512   S  512



>gb|KEH25406.1| cytochrome P450 family protein [Medicago truncatula]
Length=516

 Score =   434 bits (1117),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 235/489 (48%), Positives = 319/489 (65%), Gaps = 16/489 (3%)
 Frame = +2

Query  131   KNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVV  310
             K + K   ++ PE   A P IGHLHLL  ++P+AR     +DKYGPVF +RLG++PA+++
Sbjct  28    KPSNKFKGMKPPEPLFALPLIGHLHLLGKQIPLARIFASFSDKYGPVFQIRLGAYPALII  87

Query  311   SSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVS  490
             S+ E +KECFTTND + ASRP  + G +LGYN A F+ AP G Y+  ++K+  +EL++  
Sbjct  88    SNKEAIKECFTTNDKILASRPKSSHGIHLGYNYAGFSFAPSGPYFSKLKKITMVELLSSR  147

Query  491   RLKKLRHVRTSEVEHCIGDL--YSMCHENGEVNLSEWFEHVTLNITLRLLVGKRF-----  649
             RL+ LRHV  SE+   I DL  Y   + N +V +SEW + ++ N   +++ GKR+     
Sbjct  148   RLESLRHVYESEIHTWIKDLSFYVKGNNNVKVVISEWLKRLSFNTITKMIGGKRYFENLN  207

Query  650   -SRIAKH--LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYI-KGLKEVSKEMDEIIGTW  817
                +  H  +  ++   + + G FVP D+IP + W    G + K +K V K+++ ++G+W
Sbjct  208   VEDVEAHGNIVNLIREFMLIAGDFVPKDLIPIIGWFGFEGQVLKSMKRVGKDLETLVGSW  267

Query  818   LQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETL  997
             ++EHI N   +  D  D   VMLS + ED  + GH RDTIIKA    L+L GS+ST+ TL
Sbjct  268   IEEHIVNNSNEKHDFID---VMLSVI-EDDRVYGHNRDTIIKANITDLMLAGSDSTSTTL  323

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
              W  +LLLNN + +K AQ+E+D H+GK R VE SDIKNL Y QAI+KE LRLYP  PL  
Sbjct  324   TWIVALLLNNRNVLKRAQEEIDHHIGKGRRVESSDIKNLVYLQAILKETLRLYPAAPLLA  383

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             P EA EDC I  Y++PKGTR+  N+ KLHRDP +WSEPE+F PER F +E+  I +    
Sbjct  384   PHEATEDCNIQGYYVPKGTRVFFNVWKLHRDPSIWSEPEKFLPER-FINENGEIDHESHH  442

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FEYLPF  GRR CPG  F+ Q   +TLA LL GF++  PM   VDM EGLGI LPKLTP+
Sbjct  443   FEYLPFGLGRRACPGSLFATQNSLITLACLLHGFDLEVPMDEVVDMREGLGITLPKLTPL  502

Query  1538  QVLLTPRLP  1564
             QV+LTPRLP
Sbjct  503   QVVLTPRLP  511



>ref|XP_010919967.1| PREDICTED: cytochrome P450 CYP82D47-like [Elaeis guineensis]
Length=518

 Score =   434 bits (1117),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 227/484 (47%), Positives = 314/484 (65%), Gaps = 20/484 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+  GAWP +GHLHLL     + R L  +AD  GPVF LRLG+ PA+VVS+ E  +ECF
Sbjct  34    APQPAGAWPVLGHLHLLGSHNNIGRALKAVADAVGPVFALRLGARPALVVSTWEAARECF  93

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND   A RP+    K + YN A+   +PYG YWR VRK+ T+EL++ +RL    HVR 
Sbjct  94    TTNDKALAGRPTSTASKLMCYNNAMVGFSPYGPYWRQVRKIFTVELLSHARLCSHAHVRA  153

Query  521   SEVEHCIGDLYSMCHE----NGEVNLSEWFEHVTLNITLRLLVGKRF----------SRI  658
             SEV+     LY +C +       V +S+WF+ +T N+  R++ GKR           +R 
Sbjct  154   SEVDAFAKTLYGLCRKVDGGPARVEMSKWFQELTFNVVARMVAGKRCFVYGAVDDGGNRE  213

Query  659   AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
             A+     + R + L G F+ SDV+P L W+D+GGY + +K  + EMD IIG WL+EH   
Sbjct  214   ARRFTGAMHRMMELLGAFMVSDVVPFLRWLDLGGYQRAMKRTAAEMDGIIGGWLREHRDR  273

Query  839   RKE-ddddqsdfmdVMLSSL-PEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
             R E   + + DFMDVMLS++  E  + S H  DT+IKA +L LI+ G+++T+ T+IW  +
Sbjct  274   RSEGRAEGKEDFMDVMLSTMEKEGELFSDHDPDTVIKANSLALIIAGTDTTSVTMIWALA  333

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLN+P+ ++ AQ+E+D HVGKDR V+ESD++ L Y QAI+KE LRLYPPGP   P + M
Sbjct  334   LLLNHPNVLRTAQEELDSHVGKDRNVKESDVEKLVYLQAIVKETLRLYPPGPTLIPHQTM  393

Query  1193  EDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLP  1372
             EDC++  + +P GT++++N   +  DP VW +P  F+PER F   H  +   G+ FE LP
Sbjct  394   EDCQVSGFDVPAGTQVLVNAWAIQHDPEVWPDPSAFRPER-FLTSHKDVDIRGRHFELLP  452

Query  1373  FSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLT  1552
             F  GRR CPG +F+LQVV L LAR++ GF+++   G PVDM+EG G  LPK TP+QVL+T
Sbjct  453   FGSGRRACPGASFALQVVHLALARIIHGFDMA---GGPVDMTEGKGATLPKATPLQVLVT  509

Query  1553  PRLP  1564
             PRLP
Sbjct  510   PRLP  513



>ref|XP_006465163.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=527

 Score =   435 bits (1118),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 236/502 (47%), Positives = 317/502 (63%), Gaps = 27/502 (5%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHP  298
             K  NK  G       PEA G WP IGHLHLL    P+ + LG +ADKYGP+  +++G H 
Sbjct  24    KAGNKKRG------APEAGGGWPVIGHLHLLGRPEPLHKVLGKIADKYGPILTIKIGVHR  77

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
              +VVS+ E+ KEC TT+D VFA+RP    G  L Y+ ++    PYG YWR +RK+ TLEL
Sbjct  78    TLVVSNWEIAKECLTTSDKVFATRPKTVAGDILCYDSSLLGFVPYGHYWRQIRKIATLEL  137

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGK  643
             ++  RL+ L++VR SEV  C+ +LY++     +     V++ +W E+VTLN+ LR++VGK
Sbjct  138   LSSYRLESLKYVRESEVRTCLKELYNLWDAGLDKVPVLVDMKKWCEYVTLNVILRMVVGK  197

Query  644   RF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMD  799
             R         +   +  K+ +SR     G  V SD +P L W+DIGG  + +K+ ++E+D
Sbjct  198   RCNISISQKGASSDQGWKDELSRFFEFMGKLVVSDALPFLRWLDIGGDERLMKKTARELD  257

Query  800   EIIGTWLQEHIRN----RKEddddqsdfmdVMLSSLPEDAV--ISGHKRDtiikattlil  961
              I+  WL EH R       +    + +FM  MLS L +       G   DTI KAT L L
Sbjct  258   LIMQRWLDEHRRKGDSGDDQIKGREGNFMGAMLSILDDIGAQEFPGRDADTINKATCLAL  317

Query  962   iltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKE  1141
             IL GS++T+ TL W  SLLLNN HA+K A +E+D  VGK+R V+ESD +NL Y QAIIKE
Sbjct  318   ILGGSDTTSGTLTWAISLLLNNRHALKRAHEELDQQVGKERAVDESDTQNLVYLQAIIKE  377

Query  1142  GLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWF-  1318
              LRLYP GPL  PREAMEDC +  YH+P GTRL++N  K+ RDPRVW  P  F+PER+  
Sbjct  378   TLRLYPAGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPRVWENPSAFQPERFLP  437

Query  1319  -RDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDM  1495
                 HA +   G+ FE +PF  GRR CPG + +LQV+ LTLARLL  F ++TP+  PVDM
Sbjct  438   GHGAHADVDVRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHAFELATPLDQPVDM  497

Query  1496  SEGLGIALPKLTPIQVLLTPRL  1561
             SE  G+ +PK TP++VLL+PRL
Sbjct  498   SESPGLTIPKATPLKVLLSPRL  519



>ref|XP_010104162.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXB99094.1| Cytochrome P450 82C4 [Morus notabilis]
Length=482

 Score =   433 bits (1113),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 232/481 (48%), Positives = 307/481 (64%), Gaps = 44/481 (9%)
 Frame = +2

Query  239   LGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAV-----------  385
             +  +ADKYGP+F  RLG +P +V+S+ E VKECFTTND+ FASRPS              
Sbjct  1     MADIADKYGPIFLFRLGMNPVLVISNYEAVKECFTTNDITFASRPSFCAKPSTIRAGAPC  60

Query  386   ----------------GKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
                             G +LGY+ A F  APYG YWR +RK+V +EL++  RL+ LRHV+
Sbjct  61    GPVQPTPAFMRSWSTHGTHLGYDFAAFGFAPYGPYWRTMRKLVMIELLSNRRLETLRHVQ  120

Query  518   TSEVEHCIGDLYSMCHENG----EVNLSEWFEHVTLNITLRLLVGKRFSRI--------A  661
              SEVE  +  LY  C +NG    EV +SEW EH TLNI   ++ GKR+           A
Sbjct  121   VSEVETLVNGLYGQCKKNGFGPTEVVISEWIEHFTLNIITEMIAGKRYFDSSGKVVGGEA  180

Query  662   KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
             + + +V+   + + G F+ SD+IP  +W+D  G +K +K + +E+D +I +W++EH R+ 
Sbjct  181   ERIGKVIKEYMCISGAFIVSDLIPVPKWVDFNGNLKAMKRIGREIDVLIQSWVEEHKRSE  240

Query  842   KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
               D  D  D   +MLS + E+  + G+ RDTIIK T   LI+ GS++TA  L W  +LLL
Sbjct  241   ASDKQDFID---IMLSLIEENHEL-GYARDTIIKGTVSTLIIAGSDTTAINLTWILALLL  296

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NN  A+  AQ+E+D+ VGK+R VE SDIKNL Y QAI+KE LRLYPPGPL+ P +A EDC
Sbjct  297   NNRRALNRAQEELDLIVGKERWVEGSDIKNLVYLQAIVKETLRLYPPGPLAVPHQAREDC  356

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +  +H+ KGTRL +NL KLHRDP  W +PE F PER F   HA I  +G+ FE +PF  
Sbjct  357   TVCGFHVRKGTRLFVNLWKLHRDPNTWPDPEAFSPER-FLTSHAGIDVLGQHFELIPFGS  415

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPGM F+LQV  L LARLLQGF  +T +  PVDMSEGLGI LP+ TP++ +LTPRL
Sbjct  416   GRRSCPGMAFALQVTHLALARLLQGFVFATKLDEPVDMSEGLGITLPRATPVEAVLTPRL  475

Query  1562  P  1564
             P
Sbjct  476   P  476



>ref|XP_010106080.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07350.1| Cytochrome P450 82A3 [Morus notabilis]
Length=641

 Score =   438 bits (1127),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 245/493 (50%), Positives = 320/493 (65%), Gaps = 24/493 (5%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PEA GAWP +GHLHLL G     RTLGHMADKYGP+F +++G H A+VVSS E+ KE  T
Sbjct  89    PEAGGAWPIVGHLHLLAGSQAPHRTLGHMADKYGPIFSIKVGVHRALVVSSWEMAKEFLT  148

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND VFA+R      + L YN A+F  +PYG YWR VRK+ TLEL++ +RL+ L HVR S
Sbjct  149   TNDKVFANRSKGIASEILAYNYAMFGFSPYGSYWRQVRKIATLELLSNNRLEILSHVRES  208

Query  524   EVEHCIGDLYSM--------CHENGEVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEV  679
             EV+  I  +  +         +   E+ + +WF  +TLN+T R++VGKR+   A  L E+
Sbjct  209   EVKTAIKGICELWVNNINNGNNNGVELEMKKWFGDITLNVTFRMIVGKRYLE-ATSLSEL  267

Query  680   VS--------RALY-LGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
              S        R  + L   FV SD +P L W+D+GG  K +K+ SKE+D++   WL+EH 
Sbjct  268   GSDDRCRKTLRDFFDLAATFVVSDALPYLRWLDLGGCEKAMKKASKELDQLAQRWLEEHK  327

Query  833   RNR--KEddddqsdfmdVMLSSL--PEDAVISGHKRDtiikattlililtGSESTAETLI  1000
               R   E   D  DFMDVMLS L   + + I+ +  DTI KA +L LIL G+++T  T+I
Sbjct  328   LKRVSGEVTKDDQDFMDVMLSILDGADQSGIASYDVDTITKAISLALILAGTDTTTATMI  387

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  +LLLNN  A+K AQ E+D HVGK+R V+ESD+KNL Y QAI+KE LRL+P  PLS P
Sbjct  388   WAIALLLNNREALKKAQQELDQHVGKERQVKESDLKNLDYLQAILKETLRLFPAAPLSVP  447

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
              E+ EDC +  YH+P  TRLILNL KLH DP VW EP EF+PER F   H ++   G++F
Sbjct  448   HESTEDCTVAGYHVPARTRLILNLSKLHLDPTVWHEPSEFRPER-FLTTHQNVDVRGQNF  506

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PF  GRRMCPG++F+LQV+QLTLA LL GF I+T    PVDM E +G+   K +P+ 
Sbjct  507   ELIPFGSGRRMCPGVSFALQVLQLTLATLLHGFEIATTSDEPVDMRETVGLTSIKTSPLD  566

Query  1541  VLLTPRLPNLFPT  1579
              L    L  +FPT
Sbjct  567   -LNGVYLAAIFPT  578



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   434 bits (1116),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 228/476 (48%), Positives = 317/476 (67%), Gaps = 10/476 (2%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA GAWP IGHLHLL G  P  R LG MADKYGP+F +++G + A+VVS+ E+ KEC 
Sbjct  45    APEAGGAWPVIGHLHLLGGPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECL  104

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT+D VFASRP     + LGYN ++F  +PYG YWR+ RK+ TLEL++  RL+KL+ VR 
Sbjct  105   TTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLKQVRE  164

Query  521   SEVEHCIGDLYSMCHENGEVN------LSEWFEHVTLNITLRLLVGKRFSRI-AKHLKEV  679
              E++ C+ +LY +   N   N      +  W      N+ LR++VGK  + + ++  KE+
Sbjct  165   YELKTCLKELYQLWDNNKSTNKMLLVEMKRWLADSIRNVVLRIIVGKGCNSMDSEEWKEL  224

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH--IRNRKEdd  853
             ++R   + G FV SD +P L W+DIGG  + +K+++KE+D ++  WL+EH   R+ +E +
Sbjct  225   LTRFFEMSGKFVVSDALPFLRWLDIGGDERSMKKIAKELDVVVQGWLEEHKMKRDSQEMN  284

Query  854   ddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPH  1033
              ++ DFM VMLS L +     G   DTI KA  L LIL  +++TA TL W  SLLLN+  
Sbjct  285   QEEEDFMYVMLSILGDTEQYYGRDVDTINKAICLGLILAATDTTAVTLTWIISLLLNHHD  344

Query  1034  AIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGK  1213
              +  A++E+D+ VG  R V ESDIK L Y QAI+KE +RLYP  PL  P E++E+C +  
Sbjct  345   ILNKARNELDIQVGTKRQVNESDIKKLVYLQAILKEAMRLYPAAPLLIPHESIEECTVSG  404

Query  1214  YHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRM  1393
             Y++P GT+L +N+ KL RDP VW EP +F+PER F   H      G++FE LPFS GRRM
Sbjct  405   YNVPSGTQLFINVWKLQRDPHVWEEPCKFQPER-FLTRHKDTDVRGQNFELLPFSSGRRM  463

Query  1394  CPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             CPG++F+LQV+Q TLA LL GF+I+TP   P+DM EGLG+ + K TP++VL+ PRL
Sbjct  464   CPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGLGLTVEKSTPLEVLVAPRL  519



>ref|XP_006427755.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
 gb|ESR40995.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
Length=527

 Score =   434 bits (1116),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 236/502 (47%), Positives = 317/502 (63%), Gaps = 27/502 (5%)
 Frame = +2

Query  119   KRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHP  298
             K  NK  G       PEA G WP IGHLHLL G  P+ + LG +ADKYGP+  +++G   
Sbjct  24    KAGNKKRG------APEAGGGWPVIGHLHLLGGPEPLHKVLGKIADKYGPILTIKIGVRR  77

Query  299   AIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLEL  478
              +VVS+ E+ KEC TT+D VFA+RP    G  L Y+ ++    PYG YWR +RK+ TLEL
Sbjct  78    TLVVSNWEIAKECLTTSDKVFATRPKTVAGHILCYDSSLLGFVPYGHYWRQIRKIATLEL  137

Query  479   MTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGK  643
             ++  RL+ L++VR SEV  C+ +LY++     +     V++ +W E+VTLN+ LR++VGK
Sbjct  138   LSSYRLESLKYVRESEVRTCLKELYNLWDAGLDKAPVLVDMKKWCEYVTLNVILRMVVGK  197

Query  644   RF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMD  799
             R         +   +  K+ +SR     G  V SD +P L W+DIGG  + +K+ ++E+D
Sbjct  198   RCNISISQKGTSSDQGWKDELSRFFEFMGKLVVSDALPFLRWLDIGGDERLMKKTARELD  257

Query  800   EIIGTWLQEHIRNRK----EddddqsdfmdVMLSSLPEDAV--ISGHKRDtiikattlil  961
              I+  WL EH R       +    + +FM  MLS L +       G   DTI KAT L L
Sbjct  258   LIMQRWLDEHRRKGDSGDYQIKGREENFMGAMLSILDDIGAQEFPGRDADTINKATCLAL  317

Query  962   iltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKE  1141
             IL GS++T+ TL W  SLLLNN HA+K AQ+E+D  VGK+R V+ESD +NL Y QAIIKE
Sbjct  318   ILGGSDTTSGTLTWAISLLLNNRHALKKAQEELDQQVGKERAVDESDTENLVYLQAIIKE  377

Query  1142  GLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWF-  1318
              LRLYP GPL  PREAMEDC +  YH+P GTRL++N  K+ RDP VW  P  F+PER+  
Sbjct  378   TLRLYPAGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPSVWENPSAFQPERFLP  437

Query  1319  -RDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDM  1495
                 HA +   G+ FE +PF  GRR CPG + +LQV+ LTLARLL  F ++TP+  PVDM
Sbjct  438   GHGAHADVDVRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHSFELATPLDQPVDM  497

Query  1496  SEGLGIALPKLTPIQVLLTPRL  1561
             SE  G+ +PK TP++VLL+PRL
Sbjct  498   SESPGLTIPKATPLKVLLSPRL  519



>ref|XP_010527270.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   434 bits (1117),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 235/485 (48%), Positives = 321/485 (66%), Gaps = 18/485 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P IGHLHLL G+  V +    ++DK GP+F L++G++  +VVS  E V++CF
Sbjct  49    MPEPSGALPLIGHLHLLRGKDLVFKKFAAISDKLGPIFSLKIGAYRLVVVSDPETVRDCF  108

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
              TND+V A+RP++++G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +  R++ L H+R 
Sbjct  109   ATNDVVLATRPNISIGRYVGYNNAILALAPYGDYWRELRKITTIYLFSNHRIEMLGHIRL  168

Query  521   SEVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFSRIAK-----HLKEV  679
             +EV   I  LY+   + G   V +    E +T NI LR + GKR             K+ 
Sbjct  169   NEVNVFIKHLYTTTVDRGSSLVRMDTLLEFMTFNIILRTVAGKRIEYGEMGCEEWRYKKA  228

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR------  841
             + +  YL GVF+  D IP LEWMD    +  +K+ +KE+D +I  WL+EH+  R      
Sbjct  229   IQQTEYLWGVFMVGDAIPWLEWMDFAK-VSLMKKTAKELDGVISKWLEEHLEKRLRNGND  287

Query  842   KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
             +E  D +   MD++L  LPED ++SGH RD I+K+T LIL LTGS+S   TLIWT SLLL
Sbjct  288   EESLDQEKTIMDLLLDVLPEDVLMSGHTRDIIVKSTALILTLTGSDSAYITLIWTVSLLL  347

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NNP  +K AQDE+D+ VGK R VEESDI+NLK+ QAI+KE  RLYPP PL+G REA EDC
Sbjct  348   NNPSVLKAAQDEIDVIVGKGRWVEESDIRNLKFLQAIVKETHRLYPPAPLTGIREASEDC  407

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +G Y + KGTRL++N+ KLHRDP++W EPE F+PER F +E       G  + Y+PF  
Sbjct  408   YVGGYRVTKGTRLLVNIWKLHRDPKIWPEPETFRPER-FMEEKPKCEQSG--YGYMPFGL  464

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPGMN  L+VV L LARLLQGF +      P+ M+EG G+AL K+ P+++ + PRL
Sbjct  465   GRRSCPGMNLGLRVVYLVLARLLQGFEVRRDSVEPLGMAEGPGLALTKVEPVEISVMPRL  524

Query  1562  -PNLF  1573
              P L+
Sbjct  525   EPELY  529



>ref|NP_001236179.1| cytochrome P450 CYP82C1 [Glycine max]
 gb|AAB94590.1| CYP82C1p [Glycine max]
Length=532

 Score =   434 bits (1117),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 241/505 (48%), Positives = 333/505 (66%), Gaps = 23/505 (5%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLR  283
             +I   KR +  +GK+     P+A GAWP IGHLHL  G     +TLG MA+K+GP+F ++
Sbjct  25    LIYGLKRTHSGHGKICS--APQAGGAWPIIGHLHLFGGHQHTHKTLGIMAEKHGPIFTIK  82

Query  284   LGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKM  463
             LGS+  +V+SS E+ KECFT +D  F++RP +A  K +GYN A+F   PYG YWR++RK+
Sbjct  83    LGSYKVLVLSSWEMAKECFTVHDKAFSTRPCVAASKLMGYNYAMFGFTPYGPYWREIRKL  142

Query  464   VTLELMTVSRLKKLRHVRTSEVEHCIGDLYSM-----CHENGE-VNLSEWFEHVTLNITL  625
              T++L++  RL+ L++ RTSE E  I +LY +     C + G  V++ +WF  +T NI L
Sbjct  143   TTIQLLSNHRLELLKNTRTSESEVAIRELYKLWSREGCPKGGVLVDMKQWFGDLTHNIVL  202

Query  626   RLLVGKRF---------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLK  778
             R++ GK +            A+  K+V+   + L GVFV SD IP L W+DI GY K +K
Sbjct  203   RMVRGKPYYDGASDDYAEGEARRYKKVMGECVSLFGVFVLSDAIPFLGWLDINGYEKAMK  262

Query  779   EVSKEMDEIIGTWLQEHIRNRK---EddddqsdfmdVMLSSLPEDAVISGHKRDtiikat  949
               + E+D ++  WL+EH R R    +  ++Q +FMDVML+ L +DA ISG+  DTIIKAT
Sbjct  263   RTASELDPLVEGWLEEHKRKRAFNMDAKEEQDNFMDVMLNVL-KDAEISGYDSDTIIKAT  321

Query  950   tlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQA  1129
              L LIL GS++T  +L W  SLLLN+   +K  QDE+D ++GKDR VEESDI  L Y QA
Sbjct  322   CLNLILAGSDTTMISLTWVLSLLLNHQMELKKVQDELDTYIGKDRKVEESDITKLVYLQA  381

Query  1130  IIKEGLRLYPPGPLSGPREAMEDCKI-GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKP  1306
             I+KE +RLYPP PL   R AMEDC   G YHIP GTRL++N  K+HRD RVWS+P +FKP
Sbjct  382   IVKETMRLYPPSPLITLRAAMEDCTFSGGYHIPAGTRLMVNAWKIHRDGRVWSDPHDFKP  441

Query  1307  ERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMP  1486
              R F   H  +   G+++E +PF  GRR CPG + +L+VV LT+ARLL  FN+++P    
Sbjct  442   GR-FLTSHKDVDVKGQNYELVPFGSGRRACPGASLALRVVHLTMARLLHSFNVASPSNQV  500

Query  1487  VDMSEGLGIALPKLTPIQVLLTPRL  1561
             VDM+E +G+   K TP+++LLTPRL
Sbjct  501   VDMTESIGLTNLKATPLEILLTPRL  525



>ref|XP_011030967.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   434 bits (1117),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 237/490 (48%), Positives = 317/490 (65%), Gaps = 22/490 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+A GAWP IGHLHLL G  P  + LG MA+KYGP+F +++G H A+VVS+ E  KECF
Sbjct  45    APKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECF  104

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT+D  F+ RP     + L Y+ A+   +PYG YWR VRK+ T+EL++  RL+KL+ VR 
Sbjct  105   TTHDKAFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRE  164

Query  521   SEVEHCIGDLYSMCHENGE-----------VNLSEWFEHVTLNITLRLLVGKRFSRIA--  661
             SEV   + +LY +  +N             V +  WF  +TLNI LR +VGK    I   
Sbjct  165   SEVRAFLKELYKLWDDNRGGASKSKGSMVLVEMERWFGDLTLNIVLRTIVGKTVGYITNV  224

Query  662   ------KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQ  823
                   K  K+ +    +  GVF  SD +P L ++D+GG+ + +K+ +KE+D ++  WL+
Sbjct  225   EDEESVKGWKKGLKDFFHWTGVFPVSDALPFLRFLDLGGHGEAMKKTAKELDLVVEDWLE  284

Query  824   EHIRNRKEdddd-qsdfmdVMLSSLPEDA-VISGHKRDtiikattlililtGSESTAETL  997
             EH R R       + DFMD+ML     DA  + G   DTI KAT+L LIL  S++TA TL
Sbjct  285   EHKRKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTINKATSLTLILAASDTTAVTL  344

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
             IW  SLL+NNP+A+K AQ E+D HV K+R VEESD++NL Y +A++KE LRLYPPGPL  
Sbjct  345   IWALSLLVNNPNALKKAQLELDTHVSKERQVEESDVQNLVYLKAVLKETLRLYPPGPLLI  404

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             P EA+EDC I  YH+P+GTRL++N+ K+HRD RVWS P EF PER F   H      GK+
Sbjct  405   PHEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPER-FLTTHRGFDVRGKN  463

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FE+LPF  GRRMCPG++F+L  + L LA LL GF+ +TP G PVDM E  G+   + TP+
Sbjct  464   FEFLPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPVDMHENSGLTNLRATPL  523

Query  1538  QVLLTPRLPN  1567
             +VLL PRLP+
Sbjct  524   EVLLCPRLPS  533



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   434 bits (1115),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 230/505 (46%), Positives = 318/505 (63%), Gaps = 25/505 (5%)
 Frame = +2

Query  101   QIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGL  280
             ++    K+ +KN        VPEA GAWP IGHLHLL+G     +  G MA+KYGP+F L
Sbjct  22    KLFFSAKKQSKN--------VPEAAGAWPIIGHLHLLNGPQMPHKIFGQMAEKYGPIFRL  73

Query  281   RLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRK  460
             +LG +  ++VS  ++ KECFTTND  FA+RP     + LGYN A+F L PYG YWR++RK
Sbjct  74    KLGVNDVVIVSDHKIAKECFTTNDKAFANRPKSIASEILGYNYAMFGLGPYGPYWREIRK  133

Query  461   MVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITL  625
             +VT E ++  R++ L+HVR  EV+  + + Y    +N      ++ + EWF ++ +N  +
Sbjct  134   IVTTEFLSARRIEMLKHVREFEVKSAVKETYEYWLKNNLNGAVKIEMKEWFGNLIMNTMV  193

Query  626   RLLVGKRFS------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVS  787
             +LL G +++      R   H  + + R L L G FV +D +P L W+DIGG+ K +K  +
Sbjct  194   KLLFGVQYTGNEDEERSKAH--KAIQRLLELLGAFVVADFLPYLRWLDIGGHEKIMKSTA  251

Query  788   KEMDEIIGTWLQEHIRNRKEddddqsdfmdVM--LSSLPEDAVISGHKRDtiikattlil  961
             KE+D I+  WL EH R RK   ++  D  D M  + S+ ED  + G   D IIKAT + L
Sbjct  252   KEIDFIVEDWLAEHRRKRKLRGNNCGDEEDFMDVMLSICEDKNLHGFDTDAIIKATCMAL  311

Query  962   iltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKE  1141
                G+++T  TLIW  SLLLNN  A+K AQDE+D H+GK+R V+ESDIKNL Y QAI+KE
Sbjct  312   QTAGTDTTIVTLIWILSLLLNNYEALKKAQDELDTHIGKNRWVQESDIKNLVYLQAIVKE  371

Query  1142  GLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFR  1321
               RLYP  PL  P E++EDC +  Y IPKGTRL++N+ KL  DP +W  P EFKPER F 
Sbjct  372   SFRLYPAAPLMLPHESIEDCVVSGYDIPKGTRLLVNVWKLQYDPEIWPNPHEFKPER-FL  430

Query  1322  DEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSE  1501
               H  +   G  FE +PF  GRRMCPG++ +LQV+Q  ++ LLQGF+I  P    +DMSE
Sbjct  431   TTHKDVDVRGNHFELIPFGSGRRMCPGVSLALQVLQYVVSVLLQGFDIKRPSDEAIDMSE  490

Query  1502  GLGIALPKLTPIQVLLTPRL-PNLF  1573
               G+ + K +P++V LTPRL  NL+
Sbjct  491   SFGLTILKASPLEVQLTPRLDSNLY  515



>ref|XP_010527269.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Tarenaya hassleriana]
Length=540

 Score =   434 bits (1117),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 235/485 (48%), Positives = 321/485 (66%), Gaps = 18/485 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P IGHLHLL G+  V +    ++DK GP+F L++G++  +VVS  E V++CF
Sbjct  57    MPEPSGALPLIGHLHLLRGKDLVFKKFAAISDKLGPIFSLKIGAYRLVVVSDPETVRDCF  116

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
              TND+V A+RP++++G+Y+GYN A+ ALAPYG YWR++RK+ T+ L +  R++ L H+R 
Sbjct  117   ATNDVVLATRPNISIGRYVGYNNAILALAPYGDYWRELRKITTIYLFSNHRIEMLGHIRL  176

Query  521   SEVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFSRIAK-----HLKEV  679
             +EV   I  LY+   + G   V +    E +T NI LR + GKR             K+ 
Sbjct  177   NEVNVFIKHLYTTTVDRGSSLVRMDTLLEFMTFNIILRTVAGKRIEYGEMGCEEWRYKKA  236

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR------  841
             + +  YL GVF+  D IP LEWMD    +  +K+ +KE+D +I  WL+EH+  R      
Sbjct  237   IQQTEYLWGVFMVGDAIPWLEWMDFAK-VSLMKKTAKELDGVISKWLEEHLEKRLRNGND  295

Query  842   KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
             +E  D +   MD++L  LPED ++SGH RD I+K+T LIL LTGS+S   TLIWT SLLL
Sbjct  296   EESLDQEKTIMDLLLDVLPEDVLMSGHTRDIIVKSTALILTLTGSDSAYITLIWTVSLLL  355

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NNP  +K AQDE+D+ VGK R VEESDI+NLK+ QAI+KE  RLYPP PL+G REA EDC
Sbjct  356   NNPSVLKAAQDEIDVIVGKGRWVEESDIRNLKFLQAIVKETHRLYPPAPLTGIREASEDC  415

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
              +G Y + KGTRL++N+ KLHRDP++W EPE F+PER F +E       G  + Y+PF  
Sbjct  416   YVGGYRVTKGTRLLVNIWKLHRDPKIWPEPETFRPER-FMEEKPKCEQSG--YGYMPFGL  472

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPGMN  L+VV L LARLLQGF +      P+ M+EG G+AL K+ P+++ + PRL
Sbjct  473   GRRSCPGMNLGLRVVYLVLARLLQGFEVRRDSVEPLGMAEGPGLALTKVEPVEISVMPRL  532

Query  1562  -PNLF  1573
              P L+
Sbjct  533   EPELY  537



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   434 bits (1116),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 226/475 (48%), Positives = 313/475 (66%), Gaps = 9/475 (2%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA GAWP IGHLH+L G  P+ R LG MADKYGP+F +++G + A+VVSS E+ KEC 
Sbjct  52    APEAGGAWPVIGHLHILGGPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMAKECL  111

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND +FASRP     + LGYN ++F  +PYG YW + RK+ TLEL++  RL+KLRHVR 
Sbjct  112   TTNDKIFASRPKTLAMEILGYNFSMFGFSPYGSYWCETRKIATLELLSNHRLEKLRHVRD  171

Query  521   SEVEHCIGDLYSMCHENGEVN-----LSEWFEHVTLNITLRLLVGKRFSRI-AKHLKEVV  682
              EV+ C+ +LY +  ++   N     +  WF     N+ LR++VGK  + + ++   E++
Sbjct  172   YEVKTCLKELYELWDKSKSTNKMLVEMKRWFADTIRNVILRMIVGKGCNSVDSEEWMELL  231

Query  683   SRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR--KEddd  856
             +R L + G FV SD +P L W+DIGG  + +K+ +KE+D ++  W +EH R R  +E   
Sbjct  232   TRFLEMSGKFVVSDALPFLRWLDIGGDERSMKKTAKELDIVVQGWFEEHKRKRDSREVKG  291

Query  857   dqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHA  1036
             ++ DFM VM S L +    SG   DTI KA  L LI+ G ++T  TL W  SLLLN+   
Sbjct  292   EELDFMSVMPSILGDTEQYSGRDVDTINKAVCLGLIIAGLDTTTVTLTWVISLLLNHRDI  351

Query  1037  IKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKY  1216
             +   Q+E+D+ VG  R V ESD+KNL Y QA +KE +RLYP  PL  P EA+E+C +  Y
Sbjct  352   LDKVQNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRLYPAVPLLIPHEAIEECTVNGY  411

Query  1217  HIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMC  1396
             H+P  T+L++N+ KL RDPRVW EP +F+PER F  +H  I   G+  E LPF  GRRMC
Sbjct  412   HVPARTQLLINVWKLQRDPRVWEEPCKFQPER-FLTKHKDIDVRGQHLELLPFGSGRRMC  470

Query  1397  PGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             PG++F+LQV+Q T+A LLQGF+ +TP   P+DM EG G+ + K  P++VL+ PRL
Sbjct  471   PGVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLTMEKSRPLEVLIAPRL  525



>ref|XP_006283535.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
 gb|EOA16433.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
Length=524

 Score =   434 bits (1115),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 222/487 (46%), Positives = 313/487 (64%), Gaps = 20/487 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
              P+  GAWP IGHLHL+ G+  +  RTLG MAD YG    L+LGS  A VVSS EV K+C
Sbjct  32    APKPSGAWPIIGHLHLISGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKDC  91

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   ASRP  A  K++GYN AVF  APY  +WR++RK+ T+EL++  RL+ L+HVR
Sbjct  92    FTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVR  151

Query  518   TSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRLLVGKRF-----------  649
              SE+   +  LYS+  + G      V+L  W + +TLN+ +R++ GKR+           
Sbjct  152   VSEISMGVNYLYSLWVKKGGSEPVMVDLKSWLDDMTLNMVVRMVAGKRYFGGAGSESSKD  211

Query  650   SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
             +  A+  K+ +++  +L G+F  SD  P+L W D+ G+ K +K+   E+D I+  W++ H
Sbjct  212   TEEARQCKKAIAKFFHLIGIFTVSDAFPTLGWFDLQGHEKEMKQTGIELDVILERWVENH  271

Query  830   IRNRKEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililt--GSESTAETLI  1000
              + RK     ++D   + ++ SL E   +S  + D  I   +  L L   GSE+T+ TL 
Sbjct  272   RQQRKVSGPKENDSDFIDVMLSLAEQGKLSHLQYDANISIKSTCLALILGGSETTSSTLT  331

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  +LLLNN   +K AQDE+D+HVG +R VE+SDI+NL Y QAIIKE LRLYP GPL GP
Sbjct  332   WAIALLLNNKEMLKKAQDEIDLHVGTERNVEDSDIENLVYVQAIIKETLRLYPAGPLLGP  391

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
             REAMEDC +  +++ +GTRLI+N+ K+ RDPRV+ EP EF+PER+   E       G++F
Sbjct  392   REAMEDCTVAGHNVSRGTRLIVNVWKIQRDPRVYMEPNEFRPERFVTGEAKKFDVRGQNF  451

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PF  GRR CPG + ++QV+ L LAR+LQ F++ T   M VDMSE  G+ +PK TP++
Sbjct  452   ELMPFGSGRRSCPGSSLAMQVLHLGLARILQSFDVKTVSDMAVDMSESPGLTIPKATPLE  511

Query  1541  VLLTPRL  1561
             VL++PRL
Sbjct  512   VLISPRL  518



>ref|XP_006375031.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
 gb|ERP52828.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
Length=538

 Score =   434 bits (1115),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 236/490 (48%), Positives = 317/490 (65%), Gaps = 22/490 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+A GAWP IGHLHLL G  P  + LG+MA+KYGP+F +++G H A+VVS+ E  KECF
Sbjct  45    APKAGGAWPVIGHLHLLGGAEPPHKVLGNMAEKYGPIFTIKMGVHRALVVSNWETAKECF  104

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT+D  F+ RP     + L Y+ A+   +PYG YWR VRK+ T+EL++  RL+KL+ VR 
Sbjct  105   TTHDKAFSGRPRTLASELLTYDGAMVGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRE  164

Query  521   SEVEHCIGDLYSMCHEN-----------GEVNLSEWFEHVTLNITLRLLVGKRFSRIA--  661
             SEV   + +LY +  EN             V +  WF  +TLNI LR +VGK    I   
Sbjct  165   SEVRAFLKELYKLWDENRGSASKSKSNLALVEMKRWFGDLTLNIVLRTIVGKTVGYITNV  224

Query  662   ------KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQ  823
                   +  K+ +    +  GVF  SD +P L ++D+GG+ + +K+ +KE+D ++  WL+
Sbjct  225   EDEESVEGWKKGLKDFFHWTGVFSVSDALPFLRFLDLGGHGEAMKKTAKELDLVVEDWLK  284

Query  824   EHIRNRKEdddd-qsdfmdVMLSSLPEDA-VISGHKRDtiikattlililtGSESTAETL  997
             EH R R       + DFMDVML     DA  + G   DT IKAT+L LIL  S++TA TL
Sbjct  285   EHKRKRAAGIVKGKEDFMDVMLDVFDNDAEAVQGGDSDTTIKATSLALILAASDTTAVTL  344

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
             IW  SLL+NNP+ +K AQ E+D HVGK+R VEESD++NL Y +A++KE LRLYP GPL  
Sbjct  345   IWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRLYPAGPLLV  404

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             P EA+EDC I  YH+P+GTRL++N+ K+HRD RVWS P EF PER F   H      GK+
Sbjct  405   PHEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPER-FLTTHRGFDVRGKN  463

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FE+ PF  GRRMCPG++F+L V+ L LA LL G + +TP G PVDM E  G+   + TP+
Sbjct  464   FEFFPFGSGRRMCPGVSFALHVMDLALATLLHGLDFATPSGEPVDMHESSGLTNLRATPL  523

Query  1538  QVLLTPRLPN  1567
             +VLL+PRLP+
Sbjct  524   EVLLSPRLPS  533



>ref|XP_008464765.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=523

 Score =   433 bits (1114),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 226/477 (47%), Positives = 312/477 (65%), Gaps = 11/477 (2%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE  GA P IGHLHLL    P  +T   MAD YGP+F LRLG +  ++VS+ E+ +ECFT
Sbjct  43    PEVGGALPLIGHLHLLAKNEPAHKTFAKMADAYGPIFTLRLGLYTNLIVSNWEIARECFT  102

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND +FASRP +   K LGY+ A+F L+PYG +WR VRK+  LEL++  RL+KL+H+R S
Sbjct  103   TNDKIFASRPKLVASKLLGYDYAMFGLSPYGPHWRHVRKLAMLELLSNYRLEKLQHIRVS  162

Query  524   EVEHCIGDLYSMC---HENGEVNLSEWFEHVTLNITLRLLVGKRFSRIA-------KHLK  673
             EV+  + +LY +C    +N  V +  WF  +TLN   R++VGK+FS          +  +
Sbjct  163   EVQTSMKNLYELCLKNKKNALVEMKTWFGDITLNTISRIVVGKKFSTAVDASNNENEEYR  222

Query  674   EVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEdd  853
             + +       GVFVPSD  P L+W+D+GG+ K +K+ +K +DE+   W+Q+H  N  E  
Sbjct  223   KALRDFFEWFGVFVPSDSFPFLKWLDLGGHEKAMKKTAKVLDEVFDKWIQDHKNNLGEVK  282

Query  854   ddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPH  1033
              ++ DFMDVMLS++ +D  +S +   T+ KAT L LIL GS++T  T+IW  SLLLNN  
Sbjct  283   MEEHDFMDVMLSNVRDDGQLSKYDAHTVTKATCLSLILAGSDTTTVTMIWALSLLLNNQE  342

Query  1034  AIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGK  1213
              +K AQ E+D  VG+ R V+ESD+KNL Y QAI+KE LRLYP  P+  P E+++DC +  
Sbjct  343   VLKRAQLELDERVGRQRQVKESDVKNLLYLQAIVKETLRLYPAAPILVPHESVDDCVVAG  402

Query  1214  YHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRM  1393
             YHIP GTRLI+N+ KL RDP++W +P EF+PER F          G++   +PF  GRRM
Sbjct  403   YHIPVGTRLIVNVQKLQRDPQIWEDPCEFRPER-FLTSAKDFDVRGQNPRLIPFGSGRRM  461

Query  1394  CPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             CPG++F+LQV+ L LA LL GF IS P    +DM E  G+   +  P++V+LTPRLP
Sbjct  462   CPGISFALQVMHLALANLLHGFEISRPSKEFLDMEESAGMTSIRKNPLEVVLTPRLP  518



>ref|XP_010092357.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXB51033.1| Cytochrome P450 82A3 [Morus notabilis]
Length=534

 Score =   434 bits (1115),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 235/507 (46%), Positives = 328/507 (65%), Gaps = 28/507 (6%)
 Frame = +2

Query  113   KYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGS  292
             +  R  +N+ +  P   PEA G WP IGHLHLL G      TL ++ADK GP+F +R+GS
Sbjct  28    RSSRLRRNDSRKSP---PEAAGRWPIIGHLHLLGGSQLPHITLANLADKCGPIFTVRIGS  84

Query  293   HPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTL  472
             HP +VVSS E+ KECFT NDL  ASRP++   K++GYN A+F LAP+G +WR++RK+ T+
Sbjct  85    HPGLVVSSSEMAKECFTINDLALASRPNLLAAKHMGYNYAMFGLAPHGPFWREIRKIATV  144

Query  473   ELMTVSRLKKLRHVRTSEVEHCIGDLYSMC--------HENGE--VNLSEWFEHVTLNIT  622
             +L++  RL+ L+H+R SEV   + +LY           H +G+  V + + F  ++LN+ 
Sbjct  145   QLLSNRRLELLKHIRISEVASFVKELYEHWTTKWNDNDHHSGQASVEMKQRFLDLSLNVI  204

Query  623   LRLLVGKRFS---------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGL  775
             LR++ GKR+S         + A+ +++ +     L G+FVP D IP L W+D+GG  K +
Sbjct  205   LRMVAGKRYSVDANDGGDVKEARLVQKEIKEFFKLLGLFVPGDAIPYLGWLDLGGCEKAM  264

Query  776   KEVSKEMDEIIGTWLQEHIRNRKEddddqsdfm----dVMLSSLPEDAVISGHKRDtiik  943
             K+ +K +D I+G WL+EH +NR E ++D+        DVMLS L   +   G   DTIIK
Sbjct  265   KKTAKALDGIVGEWLEEHKQNRAEMNNDEKKEQDDFMDVMLSVL-HGSDFGGFDADTIIK  323

Query  944   attlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYF  1123
             AT L +I  GS++   TL W  SLLLNN H +K AQ+E++ +VGK+R+V ESDI  L Y 
Sbjct  324   ATILNMIAGGSDTIPATLTWAVSLLLNNHHVLKKAQEELENNVGKNRVVSESDIGKLTYI  383

Query  1124  QAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFK  1303
              AI+KE LRLYP  PLS P   ++DC IG YH+ KGTRLI N+ K+  +P +W +P EFK
Sbjct  384   FAIVKETLRLYPVAPLSVPHVFLKDCTIGGYHVAKGTRLITNIWKIQTNPILWPDPFEFK  443

Query  1304  PERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGM  1483
             PER F   +  +   G+ FE +PF  GRR CPG +F+LQ+VQ TLA  LQ F+ISTP+  
Sbjct  444   PER-FLTTNKDVDIRGQHFELIPFGSGRRACPGTSFALQMVQFTLASFLQAFDISTPLNA  502

Query  1484  PVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             PVDM+E  G+   K TP++VL+TPRLP
Sbjct  503   PVDMTESFGLTNTKATPLEVLITPRLP  529



>ref|XP_004238199.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=539

 Score =   434 bits (1115),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 229/485 (47%), Positives = 308/485 (64%), Gaps = 15/485 (3%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHG----RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEV  325
             RVP A GAWP IGHLHLL G    +LP  + +G MADKYGP+FG++LG H  +VVS  ++
Sbjct  55    RVPGAGGAWPIIGHLHLLSGSETEQLP-HKIMGRMADKYGPIFGMKLGVHQVVVVSDPKL  113

Query  326   VKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKL  505
              KECFTTNDL  A RP     + +GY  A+FAL+ YG YWR+ RK+ T+EL +  R++ L
Sbjct  114   AKECFTTNDLALAGRPKSMASEIVGYKHAMFALSAYGPYWRETRKIATIELFSARRIEML  173

Query  506   RHVRTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGK-RFSRIAKH  667
             +H+R  EV+  I ++YS   +N      ++ + EW   + +N   ++L GK R S   + 
Sbjct  174   KHIREFEVKSGIKEIYSDWGKNNLNGVVKMEMKEWIGDLVMNTMGKILFGKGRRSNEDEG  233

Query  668   LKEV---VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
             + +    + R   L G FV +D +P L W+DIGG+ K +KEVSKEMD ++  WL EH   
Sbjct  234   INKAHKAIRRFFELLGAFVVADFLPYLRWLDIGGHEKAMKEVSKEMDSVVEEWLTEHKTK  293

Query  839   RKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
             R      + +    ++ S+ ED  + G   DT IKA  + L+  G+++T  TL W   LL
Sbjct  294   RGIIKSGEEEDFMDVMLSICEDRDLPGFDADTAIKANCMGLLSAGTDTTIVTLTWALCLL  353

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN  A+K AQDE+D HVG +R V+ESDIKNL Y QAI+KE LRLYP GPLS P E+MED
Sbjct  354   LNNYEALKKAQDELDAHVGNNRWVQESDIKNLVYLQAIVKEVLRLYPAGPLSVPHESMED  413

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C IG Y IPKGTRL++NL K+  DP +W  P EFKPER F   H  +   G  FE +PF 
Sbjct  414   CVIGGYDIPKGTRLLVNLWKIQHDPNIWPNPHEFKPER-FLSTHKDVDVKGNHFELMPFG  472

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRRMCPG++ +LQVV   +A LLQGF++  P    +DMSE  G+ + K +P+QVLL PR
Sbjct  473   SGRRMCPGISLALQVVPFVIAVLLQGFDMKRPSDEAIDMSESFGLTVLKASPLQVLLAPR  532

Query  1559  LPNLF  1573
             L ++ 
Sbjct  533   LASVL  537



>ref|XP_004291927.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   433 bits (1113),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 232/483 (48%), Positives = 315/483 (65%), Gaps = 17/483 (4%)
 Frame = +2

Query  155   LRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKE  334
             L  P+A GAWP +GHL LL G  P    LG MADKYGP+F +RLG +P +VVSS EV KE
Sbjct  38    LPAPQAKGAWPILGHLPLLGGSTPPQIILGAMADKYGPLFTVRLGVYPTLVVSSSEVAKE  97

Query  335   CFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHV  514
             CFT +D+  +SRP MA  + +GYN A+F + P G YWR+VRK+ TL+L++  +++ L+ +
Sbjct  98    CFTIHDMAASSRPKMAAVELIGYNYAMFGMGPSGPYWREVRKLATLKLLSNRQMQLLKDI  157

Query  515   RTSEVEHCIGDLYSMCHENGEVNLSE---WFEHVTLNITLRLLVGKRFSRI---------  658
             R SEV   + +L+  C ++  V+L E   WF  +TLN+TLR++ GKR+S I         
Sbjct  158   RVSEVATFLKELFK-CTDHNHVDLVELKQWFGDLTLNVTLRMVAGKRYSFISDSASEDEK  216

Query  659   --AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHI  832
               A+ +++ V +  Y  GVF+  D++P L W+D+GG+ K +K+ +KE+D II  WLQEH 
Sbjct  217   KEARRVQDAVRKFFYFAGVFMVGDLVPYLRWLDLGGHEKAMKKTAKEIDAIIEEWLQEHK  276

Query  833   RNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
             + R+  D  + DFMD ML+ L + A + G++ DT+ KAT L +IL GS++T  TLIW  S
Sbjct  277   QRRRAGDTGEHDFMDAMLTEL-QGADLGGYEADTVNKATCLNMILGGSDTTMVTLIWAIS  335

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLNN H +K AQDE+D  VG++R V ESD   L Y QAI+KE LRLYP  PLS   E  
Sbjct  336   LLLNNRHVLKQAQDELDAEVGRERFVTESDTGKLVYIQAIVKETLRLYPAVPLSAQHEFT  395

Query  1193  EDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLP  1372
             ED  +  YH+ KGTRLI NL K+  +P++W +P EFKPER F   H +I   G  FE +P
Sbjct  396   EDSTVNGYHVQKGTRLITNLWKIQTNPQMWPDPLEFKPER-FLTTHKNIDVRGHHFELIP  454

Query  1373  FSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLT  1552
             F  GRR CPG++F+LQ+V   LA  L  F +STP    VDMSE  G+   K TP+ VL+ 
Sbjct  455   FGSGRRSCPGISFALQMVSFALASFLHAFEVSTPSNELVDMSESFGLTNVKATPLNVLIK  514

Query  1553  PRL  1561
             PRL
Sbjct  515   PRL  517



>ref|XP_007222623.1| hypothetical protein PRUPE_ppa004179mg [Prunus persica]
 gb|EMJ23822.1| hypothetical protein PRUPE_ppa004179mg [Prunus persica]
Length=525

 Score =   433 bits (1113),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 235/510 (46%), Positives = 313/510 (61%), Gaps = 23/510 (5%)
 Frame = +2

Query  95    YNQIILKYKRDNK-NNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPV  271
             +  II+ Y    +    KL P    EA GAWP  GHL LL G  P   TL  MAD+YGP+
Sbjct  16    FTIIIISYYFSRRWRPAKLAPT---EAKGAWPIFGHLPLLGGSTPPHITLAAMADQYGPL  72

Query  272   FGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRD  451
             F +RLG HP++V+SS E+ KECFTTNDLV  SRP +AV  ++GYN A+FA AP G +WR+
Sbjct  73    FTIRLGVHPSLVISSSEIAKECFTTNDLVLNSRPKLAVVDHIGYNGAMFAFAPSGPFWRE  132

Query  452   VRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSM--CHENGEVN--------LSEWFE  601
             +RK+ TLEL++  RL+ LR +R SEV   + +LY      E  E N        L +WF 
Sbjct  133   MRKITTLELLSNRRLELLRRIRVSEVTTFLQELYKTWSTEEKRESNNSDGVLVELKQWFG  192

Query  602   HVTLNITLRLLVGKRF--------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIG  757
              +TLN+ LR++ GKR+         + A  ++  +    +  G+FV  D +P L W+D+G
Sbjct  193   DMTLNVILRMVAGKRYLVAADEDEKKEASRVQTALREFFHYWGLFVVGDAVPYLRWLDLG  252

Query  758   GYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDti  937
             G+ K +K++ KE+D I+G W++ H + R              + S+ + A + G   DT+
Sbjct  253   GHEKAMKKIGKELDAIVGEWVEGHKQRRASGYAKGEQDFIDAMLSVLDGADLGGFDADTV  312

Query  938   ikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLK  1117
              KAT L +I   S++T  TL W  SLLLNNPH +K AQ+E+D  +G+ R+V ESDI  L 
Sbjct  313   NKATILTMISGASDTTMVTLTWAISLLLNNPHVLKRAQNELDTEIGRQRVVSESDISKLV  372

Query  1118  YFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEE  1297
             Y QAI+KE LRLYP  PLSGPRE  EDC IG YH+ KGTRLI NL K+  DPR+W +P E
Sbjct  373   YIQAIVKETLRLYPAAPLSGPREFTEDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLE  432

Query  1298  FKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPM  1477
             FKPER F   H  +   G  FE +PF  GRR CPG+ F LQ+VQ TLA  +  F IS P 
Sbjct  433   FKPER-FLTSHRDVDVKGLHFELIPFGSGRRACPGLAFGLQMVQFTLASFVHAFEISNPS  491

Query  1478  GMPVDMSEGLGIALPKLTPIQVLLTPRLPN  1567
               P+DM+E  G+   K TP+QVL+ PRLP+
Sbjct  492   SAPIDMTESFGLTNVKATPLQVLINPRLPS  521



>emb|CDY61596.1| BnaC03g74240D [Brassica napus]
Length=448

 Score =   430 bits (1105),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 225/453 (50%), Positives = 307/453 (68%), Gaps = 13/453 (3%)
 Frame = +2

Query  248   MADKYGPVFGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALA  427
             M+DK GP+F L+LG +  +V S  E++K+CFTTNDLV A+RP++A G+Y+GYN A  ALA
Sbjct  1     MSDKLGPIFSLKLGFYRLVVTSDPEILKDCFTTNDLVLATRPNIAFGRYVGYNNAALALA  60

Query  428   PYGRYWRDVRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHV  607
             PYG YWR++RK+ T+ L +   ++ L H+R SEV   +  LY        V +   FE +
Sbjct  61    PYGDYWRELRKITTVHLFSNQSVEMLGHIRYSEVNEFLKHLYEGSDGTSTVKIDMLFEFL  120

Query  608   TLNITLRLLVGKR--FSRIAKH---LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKG  772
             T NI LR +VGKR  F ++       KE + R+ YL  VF+  DVIP L W+D    I  
Sbjct  121   TFNIILRKMVGKRIGFGKVKSEEWRYKEALKRSEYLAAVFMIGDVIPWLGWLDFAK-IAQ  179

Query  773   LKEVSKEMDEIIGTWLQEHI--RNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiika  946
             +K   KE+D +I  WL EH+  R+RKE + +++    ++L  LPED VI GH RD I+KA
Sbjct  180   MKSTFKELDSVITKWLAEHLEKRSRKEKNQEKTIMD-LLLDILPEDVVICGHVRDVIVKA  238

Query  947   ttlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQ  1126
             T L++ LTGS+ST+ TL W  SLLLNNP  +K AQ+E+D  VGK R VEESDI+NLKY Q
Sbjct  239   TILVVTLTGSDSTSITLTWAISLLLNNPSTLKAAQEEIDNSVGKGRWVEESDIRNLKYLQ  298

Query  1127  AIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKP  1306
             AI+KE  RLYPP PL+G REA EDC +G+YH+ +G+RL++N+ KLHRDP++W +PE FKP
Sbjct  299   AIVKETHRLYPPAPLTGIREAREDCLLGEYHVKRGSRLLVNIWKLHRDPKIWHDPETFKP  358

Query  1307  ERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMP  1486
             ER+  ++          FE++PFS GRR CPGMN  L+VV L LARL+QGF +      P
Sbjct  359   ERFMEEKSLC---EKSDFEFIPFSSGRRSCPGMNLGLRVVHLVLARLIQGFELHKASDEP  415

Query  1487  VDMSEGLGIALPKLTPIQVLLTPRL-PNLFPTM  1582
             +DM+EG G+ALPK+ P++V+  PRL P L+ ++
Sbjct  416   LDMAEGPGLALPKINPVEVMAMPRLEPELYHSL  448



>emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera]
Length=528

 Score =   432 bits (1112),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 240/484 (50%), Positives = 312/484 (64%), Gaps = 19/484 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P A GAWP IGHLHL   +    +TLG MADKYGPVF +RLG +  +V+SS E+ +ECF
Sbjct  40    APRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECF  99

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT+D VF++RPS+   K LGY+ A+F  APYG YWR++RK+VT+EL++  RL  L+H+R 
Sbjct  100   TTHDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRA  159

Query  521   SEVEHCIGDLYSM-CHENGE-----VNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE--  676
             SEV   I +LY M   E G      V++  WF  +TLN+ +RL+ GKR+       KE  
Sbjct  160   SEVGTSIRELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLVGGKRYFGAGADTKEGE  219

Query  677   ------VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
                   V+    +L GVFV SD IP L W+D+ GY K +K  +KE+D + G WLQEH   
Sbjct  220   GRTCQKVIRDFAHLFGVFVLSDAIPFLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHKEK  279

Query  839   R--KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
             R    +  D  DFMDVML+ L ED   SG   DT+ KAT L LIL GS++T  TL W  S
Sbjct  280   RLLGGEGKDDQDFMDVMLTVL-EDVNFSGFDADTVNKATCLNLILAGSDTTKVTLTWALS  338

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLN+PH +K AQ E+D+ VGKDR V+ESD+KNL Y QAIIKE LRLYP  P+     AM
Sbjct  339   LLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITLHAAM  398

Query  1193  EDCKIGK-YHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
             EDC +   Y+I  GT++++N  K+HRD RVW  P+EF+PER F   H      G+ FE +
Sbjct  399   EDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPER-FMTSHKDTDVRGQHFELI  457

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PF  GRR CPG++ +LQVV   LA LL  + ++ P    VDM+E LG+   K TP++VLL
Sbjct  458   PFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLEVLL  517

Query  1550  TPRL  1561
             +PRL
Sbjct  518   SPRL  521



>ref|XP_008378426.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=523

 Score =   432 bits (1110),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 233/503 (46%), Positives = 319/503 (63%), Gaps = 21/503 (4%)
 Frame = +2

Query  104   IILKYKRDNKNNGKLLPL-RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGL  280
             ++L Y   N+ +     L + P+  G WP +GH+HLL G       LG + DKYGPVF +
Sbjct  19    LVLSYLIINRKSRAAASLPKAPKVVGGWPLLGHIHLLAGPELPHIVLGGLVDKYGPVFSI  78

Query  281   RLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRK  460
              +G + A+VV+  E  KECFTTNDL  +SRP +   ++L YN A+ A +PYG YWR++RK
Sbjct  79    NVGLNSALVVNCWEAAKECFTTNDLAVSSRPKIVGVEHLSYNGALVAYSPYGPYWREIRK  138

Query  461   MVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHE----NGE--VNLSEWFEHVTLNIT  622
             + T EL++ SRL+ L+HVR SEVE  + +LY +  +    +GE  V + EWF  +TLN+ 
Sbjct  139   ITTHELLSNSRLELLKHVRVSEVEMSLKELYKLWIKRKGGSGEILVEMKEWFGDLTLNVV  198

Query  623   LRLLVGKRFSRI----------AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKG  772
              R++ GKRF  +          A+  + V+    +  G+FV  D +P L W+DIGG+ K 
Sbjct  199   FRMVAGKRFFNVMNGSLSDEKKARRCQNVIRDMFHYIGLFVLGDAVPWLRWLDIGGHEKA  258

Query  773   LKEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikatt  952
             ++  +KE+D I+  WL+EH + R +  +       VMLS L   A + G   DT+ KAT 
Sbjct  259   MRRTAKELDSIVMEWLEEHKQRRTQGQEQDFMD--VMLSVL-NGADVVGFDADTVNKATC  315

Query  953   lililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAI  1132
             L +I  GS++   T+ W  SLLLNN H +  AQ+E+D HVG+ RLV ESDI NL+Y QAI
Sbjct  316   LAVIAGGSDTPMVTMTWALSLLLNNRHTLVKAQEELDKHVGRGRLVNESDISNLEYLQAI  375

Query  1133  IKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPER  1312
              KE LR+YPP PLSG R+  EDC IG YH+PK T L++NL K+H DPRVW +P EFKPER
Sbjct  376   FKETLRMYPPAPLSGIRKFSEDCTIGGYHVPKDTWLMMNLWKIHSDPRVWVDPMEFKPER  435

Query  1313  WFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVD  1492
              F   H  I   G +FE +PF GGRR+CPGM F+LQV+QLTLA  L  ++ISTP    VD
Sbjct  436   -FLTTHKDIDVKGHNFELIPFGGGRRICPGMGFALQVIQLTLASFLHAYDISTPENAAVD  494

Query  1493  MSEGLGIALPKLTPIQVLLTPRL  1561
             M+  LG++  K TP++VL+ PRL
Sbjct  495   MTGSLGLSNVKSTPLRVLVKPRL  517



>gb|KDP38427.1| hypothetical protein JCGZ_04352 [Jatropha curcas]
Length=520

 Score =   431 bits (1109),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 228/479 (48%), Positives = 313/479 (65%), Gaps = 11/479 (2%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             R P+A GAWP IGHL LL G   +  T G +AD+YGP+F +++G H A+VVSS E+ KE 
Sbjct  39    RAPKAGGAWPIIGHLPLLAGSKLLHITFGSLADRYGPIFTMQIGIHQAVVVSSGELAKEL  98

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTTND+  + RP+    KYLGY+  +FA APYG YWR++RK+++L+L++  +++ L+HVR
Sbjct  99    FTTNDMAVSERPNFTAFKYLGYDGVMFAFAPYGDYWREMRKIISLKLLSNHQIELLKHVR  158

Query  518   TSEVEHCIGDLYSMCHE--NGE----VNLSEWFEHVTLNITLRLLVGKRFS--RIAKHLK  673
              SE+E  + +LY +  E  NG     V+L++WF  + LN+ LR++VGKR S    A+H +
Sbjct  159   LSEIETLLKELYKLWTEKKNGSGHVLVDLNKWFGELGLNVILRMVVGKRCSGGGEAEHFR  218

Query  674   EVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEdd  853
             + +    +  G+FV  D IP L W+D GG+ KG+K  +KEM+ ++   L+EH R R    
Sbjct  219   KTMREFFHYLGMFVLRDAIPFLGWLDAGGHEKGMKTTAKEMNCLVSELLEEHRRKRGSAG  278

Query  854   ddqsdfmdVMLS--SLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
                +   D M S  S+ E+   +G+  D IIK+  L LI  GS+++  TL WT SLLLNN
Sbjct  279   KVATKEQDFMDSMLSVLEEKDFAGYDSDMIIKSACLNLIAGGSDTSTVTLTWTISLLLNN  338

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
               A++ AQ+E+D  VG++R V E DI  L Y QAIIKE LRLYPP PLS PR   E+C I
Sbjct  339   KQALEKAQEELDRLVGRERQVNEFDISKLIYLQAIIKESLRLYPPAPLSAPRVTRENCTI  398

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
             G  HI KGTRLI+N+ K+HRDP+ W +P +F PER F   H  I   G++FE +PF  GR
Sbjct  399   GGCHIKKGTRLIINVWKIHRDPKNWPDPLQFTPER-FLTSHKDIDVRGQNFELIPFGSGR  457

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             R CPG  F LQ+V + LAR LQ F IS P   P+DM+E  G+   K TP++VLL+PRLP
Sbjct  458   RACPGTAFGLQMVHIALARFLQAFQISNPTTEPIDMTESPGLTNLKATPLEVLLSPRLP  516



>gb|KEH18125.1| cytochrome P450 family protein [Medicago truncatula]
Length=506

 Score =   431 bits (1107),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 231/484 (48%), Positives = 320/484 (66%), Gaps = 13/484 (3%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             R  K + K   ++ PE   A P IGHLHLL  ++P+AR     +DKYGP+F +  G++PA
Sbjct  25    RVKKPSNKFKGMKPPEPSYALPLIGHLHLLGNQIPLARIFASFSDKYGPIFQIHFGAYPA  84

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +++S+ E +KECFTTND + ASRP  + G +LGYN A F  APYG YW  +RK+  LEL+
Sbjct  85    LIISNKEAIKECFTTNDKILASRPKSSHGIHLGYNYAGFGFAPYGPYWTKLRKLTMLELL  144

Query  482   TVSRLKKLRHVRTSEVEHCIGDL-YSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFSRI  658
             +  RL+ LRHV  SE++  I DL   +     +V +SEW E     +       K    +
Sbjct  145   SSRRLESLRHVYESEIDTLIKDLSLYVKVGKVKVVISEWLERYFEYL-------KDVDDV  197

Query  659   AKH--LKEVVSRALYLGGVFVPSDVIPSLEWMDI-GGYIKGLKEVSKEMDEIIGTWLQEH  829
               H  + +++   +++ G FVP D+IP L W    G  +K +K +++++D ++G+W++EH
Sbjct  198   EAHGNIVKLIKEFMHISGEFVPKDLIPILGWFGFEGKVLKSMKRIARDLDAVVGSWVEEH  257

Query  830   IRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTT  1009
                 +   +++ DF+DVMLS + ED   SGH RDTIIKA  + L+L GS++T+ T+ W  
Sbjct  258   DVEIESKSNEKYDFIDVMLSVI-EDDPTSGHNRDTIIKANVMNLMLAGSDTTSTTMTWIL  316

Query  1010  SLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREA  1189
             ++L+NN +A+K AQ+E+D H+G+DR VE SDIKNL Y QAI+KE LRLYPPGPL  P E 
Sbjct  317   AILMNNMNALKHAQEEIDHHIGRDRRVESSDIKNLVYLQAIVKETLRLYPPGPLLVPHEV  376

Query  1190  MEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
              EDC I  Y++PKGTR+  N+ KLHRDP +W EPE+F PER F +E+  I +    FEYL
Sbjct  377   TEDCYIQDYYVPKGTRVFANVWKLHRDPSIWLEPEKFLPER-FINENGEIDHESHHFEYL  435

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLL  1549
             PF  GRR CPG  F+ QV+ +TLARLL GF++  PM   VDM EGLGI LPKLTP+QV+L
Sbjct  436   PFGLGRRACPGSLFATQVILITLARLLHGFDLEVPMDEVVDMREGLGITLPKLTPLQVVL  495

Query  1550  TPRL  1561
             TPRL
Sbjct  496   TPRL  499



>ref|XP_010106083.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07353.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   431 bits (1109),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 313/487 (64%), Gaps = 23/487 (5%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PEA G WP  GHL LL G  P    LG MAD  GP+F +R+GSH  +VVSS E+ +ECFT
Sbjct  42    PEALGGWPLFGHLSLLKGPKPSHINLGAMADICGPIFTIRIGSHRGLVVSSSEMARECFT  101

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TNDL  ASRP++   K++GYN A+FA AP+G +WR++RK+ T+EL++  RL+ L+H+R S
Sbjct  102   TNDLALASRPNLLAAKHIGYNYAMFAFAPHGPFWREIRKIATVELLSNRRLELLKHIRIS  161

Query  524   EVEHCIGDLY----SMCHEN-----GEVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE  676
             EV   + +LY    +  ++N       V + + F  +TLN+ LR++ GKR+S  A    +
Sbjct  162   EVAAFVKELYQHWTTKWNDNDHSGQASVEMKQRFSDLTLNVILRMVAGKRYSVDANDGGD  221

Query  677   V---------VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
             V         +     L G+FVP D IP L W+D+GGY K +K+ +K +D I+G WL+EH
Sbjct  222   VKEGRLVQKEIKEFFNLVGLFVPGDAIPYLGWLDLGGYEKAMKKTAKALDGIVGEWLEEH  281

Query  830   IRNRKEddddqsdfm---dVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLI  1000
              +NR E  +++       DVMLS L  D+ + G   DTI KAT L LI  GS++TA TL 
Sbjct  282   KQNRAERSNEEKKEQDFMDVMLSVL-HDSELGGFDADTINKATILNLIAGGSDTTAVTLT  340

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  SLLLNN H +K AQDE+D  VGK+R V E D+  L Y QAI+KE LRLYP  PLSGP
Sbjct  341   WAVSLLLNNRHVLKKAQDELDSQVGKNRAVNEFDMHKLTYIQAIVKETLRLYPAAPLSGP  400

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
                ++DC IG YHI KGTRL+ NL K+  DP +W +P +FKPER F   +  +   G+ F
Sbjct  401   HVFLKDCTIGGYHIHKGTRLLTNLWKIQTDPNLWPDPLDFKPER-FLTTNKDVDVRGQHF  459

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PF  GRR CPG++F+LQ+VQ T+A  LQ F I+TP+   VDM+E  G+   + TP++
Sbjct  460   ELIPFGTGRRACPGISFALQMVQFTVASFLQAFEIATPLDASVDMTESFGLTNIRATPLE  519

Query  1541  VLLTPRL  1561
             +L+T  L
Sbjct  520   LLITAEL  526



>emb|CBI40977.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   432 bits (1111),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 238/476 (50%), Positives = 310/476 (65%), Gaps = 17/476 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P A GAWP IGHLHL   +    +TLG MADKYGPVF +RLG +  +V+SS E+ +ECF
Sbjct  69    APRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECF  128

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT+D VF++RPS+   K LGY+ A+F  APYG YWR++RK+VT+EL++  RL  L+H+R 
Sbjct  129   TTHDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRA  188

Query  521   SEVEHCIGDLYSM-CHENGE-----VNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVV  682
             SEV   I +LY M   E G      V++  WF  +TLN+ +RL+ GKR+         V+
Sbjct  189   SEVGTSIRELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLVGGKRY------FGAVI  242

Query  683   SRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR--KEddd  856
                 +L GVFV SD IP L W+D+ GY K +K  +KE+D + G WLQEH   R    +  
Sbjct  243   RDFAHLFGVFVLSDAIPFLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHKEKRLLGGEGK  302

Query  857   dqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHA  1036
             D  DFMDVML+ L ED   SG   DT+ KAT L LIL GS++T  TL W  SLLLN+PH 
Sbjct  303   DDQDFMDVMLTVL-EDVNFSGFDADTVNKATCLNLILAGSDTTKVTLTWALSLLLNHPHV  361

Query  1037  IKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGK-  1213
             +K AQ E+D+ VGKDR V+ESD+KNL Y QAIIKE LRLYP  P+     AMEDC +   
Sbjct  362   LKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITLHAAMEDCTLAAG  421

Query  1214  YHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRM  1393
             Y+I  GT++++N  K+HRD RVW  P+EF+PER F   H      G+ FE +PF  GRR 
Sbjct  422   YNISAGTQIMVNAWKIHRDERVWCNPKEFQPER-FMTSHKDTDVRGQHFELIPFGSGRRS  480

Query  1394  CPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             CPG++ +LQVV   LA LL  + ++ P    VDM+E LG+   K TP++VLL+PRL
Sbjct  481   CPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLEVLLSPRL  536



>ref|NP_189154.1| cytochrome P450, family 82, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
 sp|Q9LSF8.1|C82G1_ARATH RecName: Full=Cytochrome P450 82G1 [Arabidopsis thaliana]
 dbj|BAB02077.1| cytochrome p450 [Arabidopsis thaliana]
 gb|AEE76989.1| cytochrome P450, family 82, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
Length=515

 Score =   431 bits (1108),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 233/478 (49%), Positives = 315/478 (66%), Gaps = 11/478 (2%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             +PE  GA P  GHLHLL G+  + + L  M+ K+GP+F L+LG +  +V S  + VK+CF
Sbjct  39    IPEPLGALPLFGHLHLLRGKKLLCKKLAAMSQKHGPIFSLKLGFYRLVVASDPKTVKDCF  98

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTNDL  A+RP++A G+Y+GYN A   LAPYG YWR++RK+VT+ L +   ++ L H+R+
Sbjct  99    TTNDLATATRPNIAFGRYVGYNNASLTLAPYGDYWRELRKIVTVHLFSNHSIEMLGHIRS  158

Query  521   SEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKR--FSRIAK---HLKEVVS  685
             SEV   I  LY        V +   FE +T NI LR +VGKR  F  +       KE + 
Sbjct  159   SEVNTLIKHLYKGNGGTSIVKIDMLFEFLTFNIILRKMVGKRIGFGEVNSDEWRYKEALK  218

Query  686   RALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR-KEddddq  862
                YL  + +  DVIP L W+D     + +K + KE+D +   WL EH++ R + + D +
Sbjct  219   HCEYLAVIPMIGDVIPWLGWLDFAKNSQ-MKRLFKELDSVNTKWLHEHLKKRSRNEKDQE  277

Query  863   sdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAIK  1042
                MD++L  LPED VISGH RD I+KAT L L LTGS+ST+ TL W  SLLLNNP A++
Sbjct  278   RTIMDLLLDILPEDIVISGHVRDVIVKATILALTLTGSDSTSITLTWAVSLLLNNPAALE  337

Query  1043  MAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHI  1222
              AQ+E+D  VGK R +EESDI+NLKY QAI+KE  RLYPP PL+G REA EDC +G Y +
Sbjct  338   AAQEEIDNSVGKGRWIEESDIQNLKYLQAIVKETHRLYPPAPLTGIREAREDCFVGGYRV  397

Query  1223  PKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPG  1402
              KGTRL++N+ KLHRDP++W +P+ FKPER+  D+         +FEY+PF  GRR CPG
Sbjct  398   EKGTRLLVNIWKLHRDPKIWPDPKTFKPERFMEDKSQC---EKSNFEYIPFGSGRRSCPG  454

Query  1403  MNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL-PNLF  1573
             +N  L+VV   LARLLQGF +      P+DM+EG G+ALPK+ P++V++ PRL P L+
Sbjct  455   VNLGLRVVHFVLARLLQGFELHKVSDEPLDMAEGPGLALPKINPVEVVVMPRLDPKLY  512



>ref|XP_006375032.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
 gb|ERP52829.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
Length=538

 Score =   432 bits (1110),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 236/490 (48%), Positives = 316/490 (64%), Gaps = 22/490 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+A GAWP IGHLHLL G  P  + LG MA+KYGP+F +++G H A+VVS+ E  KECF
Sbjct  45    APKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAKECF  104

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT+D  F+ RP     + L Y+ A+   +PYG YWR VRK+ T+EL++  RL+KL+ VR 
Sbjct  105   TTHDKAFSGRPRTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKDVRE  164

Query  521   SEVEHCIGDLYSMCHENG-----------EVNLSEWFEHVTLNITLRLLVGKRFSRIA--  661
             SEV   + +LY +  EN             V +  WF  +TLNI LR +VGK    I+  
Sbjct  165   SEVRAFLKELYKLWDENRCSASKSKSSLVLVEMKRWFGDLTLNIVLRTIVGKTVGYISNV  224

Query  662   ------KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQ  823
                   +  K+ +    +  GVF  SD +P L ++D+GG+ + +K+ +KE+D ++  WLQ
Sbjct  225   EDEESVEGWKKGLKDFFHWTGVFSVSDALPFLRFLDLGGHGEAMKKTAKELDLVVEDWLQ  284

Query  824   EHIRNRKEdddd-qsdfmdVMLSSLPEDA-VISGHKRDtiikattlililtGSESTAETL  997
             EH R R       + DFMD+ML     DA  + G   DT IKAT+L LIL  S +TA TL
Sbjct  285   EHKRKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTTIKATSLALILAASNTTAVTL  344

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
             IW  SLL+NNP+ +K AQ E+D HVGK+R VEESD++NL Y +A++KE LRLYP GPL  
Sbjct  345   IWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRLYPAGPLLV  404

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             P EA+EDC I  YH+P+GTRL++N+ K+HRD RVWS P EF PER F   H      GK+
Sbjct  405   PHEAIEDCTIDGYHVPRGTRLLINVPKIHRDERVWSNPNEFDPER-FLTTHRGFDVRGKN  463

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FE+ PF  GRR CPG++F+L V+ L LA LL GF+ +TP G PVDM E  G+   + TP+
Sbjct  464   FEFFPFGSGRRKCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSGLTNLRATPL  523

Query  1538  QVLLTPRLPN  1567
             +VLL+PRLP+
Sbjct  524   EVLLSPRLPS  533



>ref|XP_008220885.1| PREDICTED: cytochrome P450 82A3-like [Prunus mume]
Length=1017

 Score =   446 bits (1147),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 234/510 (46%), Positives = 317/510 (62%), Gaps = 23/510 (5%)
 Frame = +2

Query  95    YNQIILKYKRDNK-NNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPV  271
             +  II+ Y    +    KL P    EA GAWP  GHL LL G  P    L  MADKYGP+
Sbjct  508   FTIIIVSYYFSRRWRPAKLAP---TEAKGAWPIFGHLPLLGGSTPPHIKLAAMADKYGPL  564

Query  272   FGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRD  451
             F +RLG +P++V+SS E+ KECFTTNDL  +SRP + V +++GYN A+F  AP G +WR+
Sbjct  565   FTIRLGVYPSLVISSSEIAKECFTTNDLASSSRPKLVVVEHVGYNHAMFGFAPSGPFWRE  624

Query  452   VRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSM--CHENGEVN--------LSEWFE  601
             +RK+ TL+L++  RL+ LRH+R SEV   + +LY      E  E N        L +WF 
Sbjct  625   MRKITTLKLLSNRRLELLRHIRVSEVTTFLQELYKTWSTAEKRESNNRDGVLVELKQWFG  684

Query  602   HVTLNITLRLLVGKRFSRIA--------KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIG  757
              +TLN+ LR++ GKR+S  A        + ++  +    Y  G+FV  D +P L W+D+G
Sbjct  685   DMTLNVILRMVAGKRYSVAADEDEKTEARRVQSALKLFFYYVGLFVLGDAVPYLRWLDLG  744

Query  758   GYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDti  937
             G+ K +K+++KE+D I+G W++EH R R   D          + S+ + A + G   DT+
Sbjct  745   GHEKAMKKIAKELDAIVGGWVEEHKRRRARGDAKGEPDFIDAMLSVLDGADLGGFDADTV  804

Query  938   ikattlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLK  1117
              KAT+L +I   S++T  TL W  SLLLNNPH +K AQ E+D  +G+ R+V ESDI  L 
Sbjct  805   NKATSLNMIAGASDTTMVTLTWAISLLLNNPHMLKRAQTELDTEIGRQRVVSESDISKLV  864

Query  1118  YFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEE  1297
             Y QAI+KE LRLYP  PLSGPRE  +DC IG YH+ KGTRLI NL K+  DPR+W +P E
Sbjct  865   YIQAIVKETLRLYPAAPLSGPREFTKDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLE  924

Query  1298  FKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPM  1477
             FKPER F      +   G  FE +PF  GRR CPG+ F+LQ+VQ TLA  +  F IS P+
Sbjct  925   FKPER-FLTTQKDVDVKGLHFELIPFGSGRRACPGLAFALQMVQFTLASFVHAFEISNPL  983

Query  1478  GMPVDMSEGLGIALPKLTPIQVLLTPRLPN  1567
               P+DM+E  G+   K TP+QVL+ PRLP+
Sbjct  984   SAPIDMTESFGLTNVKATPLQVLIKPRLPS  1013


 Score =   372 bits (955),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 209/453 (46%), Positives = 289/453 (64%), Gaps = 18/453 (4%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             ++P+  G WP +GHL L  G       L  + DKYGP F + +G H A+V+S+ EV K+C
Sbjct  50    KLPKVAGGWPLLGHLGLFGGSQLPHIALASLVDKYGPAFTINIGIHSALVISTWEVAKDC  109

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTTND+V +SRP+    K+LGYN A+F  +PYG YWR++RK+ +LEL++  RL+ L+ VR
Sbjct  110   FTTNDMVVSSRPATLGAKHLGYNFAMFGFSPYGPYWREMRKLTSLELLSNRRLELLKKVR  169

Query  518   TSEVEHCIGDLYSMC----HENGE--VNLSEWFEHVTLNITLRLLVGKRF--------SR  655
              SEVE  + +LY++       +GE  V +  WF  +TLN+  R++ GKR          +
Sbjct  170   VSEVEMSLKELYTLWIKRKESSGERLVEMKRWFGDLTLNVIFRMVAGKRCFMNGNLSEEK  229

Query  656   IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIR  835
              A+  ++ +    +L G+FV  D +P L W+D+GG  K +K+ +KE+D I+  WL+EH  
Sbjct  230   EARRWQKAMREFFHLAGLFVLGDAVPWLSWLDLGGQQKAMKKNAKELDSIVAEWLEEH--  287

Query  836   NRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
              +K  +    DFMDVMLS++     ++G   DT+IKAT LILI  GS++T  TL W  SL
Sbjct  288   KQKITEGKDQDFMDVMLSAI-NGTDVAGFDADTVIKATCLILIAGGSDTTMVTLTWALSL  346

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             LLNN   +K   +E+D +VGK RL+EESDI NL Y QA +KE +RL P GPLSG RE  E
Sbjct  347   LLNNRQVLKKIYEELDQYVGKGRLLEESDINNLVYLQATVKEAMRLCPAGPLSGQREFTE  406

Query  1196  DCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPF  1375
             DC IG YH+PKGT L++NL K+  DPRVW++P EFKPER F   H  +   G+ FE +PF
Sbjct  407   DCTIGGYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPER-FLTTHKDVDVRGQQFELMPF  465

Query  1376  SGGRRMCPGMNFSLQVVQLTLARLLQGFNISTP  1474
               GRR CPG++F LQ+  LTLA  L   + S P
Sbjct  466   GSGRRACPGISFGLQMTLLTLASFLFSMDYSLP  498



>ref|XP_003548652.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
Length=521

 Score =   431 bits (1107),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 237/500 (47%), Positives = 336/500 (67%), Gaps = 17/500 (3%)
 Frame = +2

Query  116   YKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSH  295
             +++ +    K+  L+ PE   A P IGHLHLL  + P+AR    +ADKYGP+F + LG++
Sbjct  23    WRKKSSTIHKIKGLQPPEPSFALPLIGHLHLLGAKTPLARIFASLADKYGPIFQIHLGAY  82

Query  296   PAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLE  475
             PA+V+ + E +KECFTTND V ASRP  + G +L YN A F  APYG YW  +RK+  LE
Sbjct  83    PALVICNQEAIKECFTTNDKVLASRPKSSHGVHLSYNFAGFGFAPYGSYWIKLRKLTMLE  142

Query  476   LMTVSRLKKLRHVRTSEVEHCIGDL--YSMCHENGEVNLSEWFEHVTLNITLRLLVGKRF  649
             L++  RL+ LR V  SE++  I DL  Y     + +V +SEW E +T N+  +++ GKR+
Sbjct  143   LLSARRLEFLRPVYESEIDTLIRDLWMYLGGKSDVKVTISEWLERLTFNMITKMIAGKRY  202

Query  650   SRIAKHLKEV--------VSRALYLGGVFVPSDVIPSLEWMDIGGYI-KGLKEVSKEMDE  802
                 + + +V        +   +++ G FV SD+IP L W+ + G + K +K ++K++D 
Sbjct  203   FSYLQDVDDVEAHGIVKLIKEFMHISGEFVLSDLIPLLGWLGVHGTVLKNMKRIAKDLDT  262

Query  803   IIGTWLQEHIRNR--KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGS  976
             ++G W++EH+++        ++ DF+DVMLS + +D+V SGH RDTIIKA  + L+L GS
Sbjct  263   LVGGWVEEHMKSDTLTNKSWEKHDFIDVMLSVIEDDSV-SGHTRDTIIKANVMNLMLAGS  321

Query  977   ESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKD-RLVEESDIKNLKYFQAIIKEGLRL  1153
             ++T+ T+ WT ++L+ NPHA+K AQ+E+D  VG++ R VE  DIK+L Y QAI+KE LRL
Sbjct  322   DTTSTTMTWTLAMLMKNPHALKRAQEEIDHQVGRERRRVEARDIKDLIYLQAIVKETLRL  381

Query  1154  YPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHA  1333
             YPPGP+  P EA EDC I  YH+PKGTR+  N+ KLHRDP +WSEPE+F PER F  E+ 
Sbjct  382   YPPGPVLVPHEAREDCNIQGYHVPKGTRVFANVWKLHRDPSLWSEPEKFSPER-FISENG  440

Query  1334  SIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGI  1513
              +  V   FEYLPF  GRR CPG  F+ QV  LTL+RLLQGF++  PM  PVD+ EGLGI
Sbjct  441   ELDEV-HHFEYLPFGSGRRACPGSTFATQVCLLTLSRLLQGFDLHVPMDEPVDLEEGLGI  499

Query  1514  ALPKLTPIQVLLTPRLPNLF  1573
              LPK+ P+Q++L+PRLP+ F
Sbjct  500   TLPKMNPLQIVLSPRLPSEF  519



>emb|CDY52276.1| BnaA03g57690D [Brassica napus]
Length=448

 Score =   428 bits (1100),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 225/453 (50%), Positives = 309/453 (68%), Gaps = 13/453 (3%)
 Frame = +2

Query  248   MADKYGPVFGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALA  427
             M+DK GP+F L+LG +  +V S  E++K+CFTTNDLV A+RP++A G+Y+GYN A  ALA
Sbjct  1     MSDKLGPIFSLKLGFYRLVVTSDPEILKDCFTTNDLVLATRPNIAFGRYVGYNNAALALA  60

Query  428   PYGRYWRDVRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLSEWFEHV  607
             PYG YWR++RK+ T+ L +   ++ L H+R +EV   +  LY        V +   FE +
Sbjct  61    PYGDYWRELRKITTVHLFSNQSVEMLGHIRYAEVNEFLKHLYEGSDGTSTVKIDMSFEFL  120

Query  608   TLNITLRLLVGKR--FSRIAKH---LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKG  772
             T NI LR +VGKR  F ++       KE + R+ YL  VF+  DVIP L W+D    I  
Sbjct  121   TFNIILRKMVGKRIGFGKVKSEEWRYKEALKRSEYLAAVFMIGDVIPWLGWLDFTK-IAQ  179

Query  773   LKEVSKEMDEIIGTWLQEHI--RNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiika  946
             +K   KE+D +I  WL+EH+  R+RKE++ +++    ++L  LPED VI GH RD I+KA
Sbjct  180   MKSTFKELDSVITKWLEEHLEKRSRKEENQEKTIMD-LLLDILPEDVVICGHVRDVIVKA  238

Query  947   ttlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQ  1126
             T L+L LTGS+ST+ TL W  SLLLNNP  +K AQ+E+D  VGK R VEESDI+NLKY Q
Sbjct  239   TILVLTLTGSDSTSITLTWAVSLLLNNPSTLKAAQEEIDNSVGKGRWVEESDIRNLKYLQ  298

Query  1127  AIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKP  1306
             AI+KE  RLYPP PL+G REA EDC +G+YH+ +G+RL++N+ KLHRDP++W +PE FKP
Sbjct  299   AIVKETHRLYPPAPLTGIREAREDCLLGEYHVKRGSRLLVNIWKLHRDPKIWHDPETFKP  358

Query  1307  ERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMP  1486
             ER+  ++          FE++PFS GRR CPGMN  L+VV L LARL+QGF +      P
Sbjct  359   ERFMEEKSLC---EKSDFEFIPFSSGRRSCPGMNLGLRVVHLVLARLIQGFELHKASDEP  415

Query  1487  VDMSEGLGIALPKLTPIQVLLTPRL-PNLFPTM  1582
             +DM+EG G+ALPK+ P++V+  PRL P L+ ++
Sbjct  416   LDMAEGPGLALPKINPVEVVAMPRLEPELYHSL  448



>ref|XP_008464766.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=521

 Score =   431 bits (1107),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 231/476 (49%), Positives = 310/476 (65%), Gaps = 11/476 (2%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE  G WP IGHLHLL    P   TL  +AD YGP+F L+LG   A+VVSS E+ KECFT
Sbjct  43    PEPAGHWPVIGHLHLLSATEPAHITLAKLADTYGPIFTLKLGMSKALVVSSWEIAKECFT  102

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND +FASRP +   K LGYN  +  L+PYG YWR +RK+ TLEL+T  RL + +H+R  
Sbjct  103   TNDRIFASRPKLVASKLLGYNYNMLGLSPYGPYWRHIRKLATLELLTNRRLHQFQHIREF  162

Query  524   EVEHCIGDLYSMCHENGE--VNLSEWFEHVTLNITLRLLVGKRFSRI---AKHLKEVVSR  688
             EV+  I  LY  C  N +  V ++ WF  +TLN   R++VGK+FS     +    EV   
Sbjct  163   EVQTSIKKLYESCIRNKKALVEMNTWFGDITLNTIFRIVVGKKFSIAMDGSADRNEVYRT  222

Query  689   ALY----LGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddd  856
             AL       GVFVPSD  P L+W D+GG+ K +K+ +K +DE+   WLQEH R R++ ++
Sbjct  223   ALREFFEWFGVFVPSDSFPFLKWFDLGGHEKAMKKTAKILDEVFDKWLQEH-RQRRKFEE  281

Query  857   dqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHA  1036
              ++DFMDV+LS++ +      +  DT+IK++ L LIL G ++T  T+IW  SLLLNN  A
Sbjct  282   SENDFMDVLLSNVKDAEQFPNYDADTVIKSSCLGLILAGFDTTTVTMIWALSLLLNNEEA  341

Query  1037  IKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKY  1216
             +K AQ E+D  +G+ + V+ESDI NLKY +AI+KE LRLYP GPL  P E+ EDCKI  Y
Sbjct  342   LKRAQLELDEQIGRHKQVKESDIVNLKYLRAIVKETLRLYPAGPLGVPHESTEDCKIAGY  401

Query  1217  HIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMC  1396
             HIP GTRL++N+ KL RDPR W +P EF+PER+   E       GK+ + +PF  GRRMC
Sbjct  402   HIPAGTRLMVNIQKLQRDPREWKDPCEFRPERFLTSE-KDFDVGGKNPKLIPFGTGRRMC  460

Query  1397  PGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             P ++F+LQ++ LTLA  L GF I  P    +DM E  G+   K  P++V+++PRLP
Sbjct  461   PAVSFALQIMHLTLANFLHGFEIERPSQDLIDMEESAGMTSIKKEPLRVIISPRLP  516



>ref|XP_006464300.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   431 bits (1107),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 223/478 (47%), Positives = 305/478 (64%), Gaps = 9/478 (2%)
 Frame = +2

Query  152   PLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVK  331
             P + P A GAWP IGHLHL  G+ P  R LG +ADKYGP+F +++G + A+VVS+ E+ K
Sbjct  40    PHQAPVAAGAWPLIGHLHLFGGQEPTHRLLGDVADKYGPIFTMKMGLNRALVVSNWEIAK  99

Query  332   ECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRH  511
             ECFT ND  FA+RP       LGYN    A +PYG YWR+ RKM T+EL++ ++L+KL+H
Sbjct  100   ECFTINDKPFANRPRSMAMDLLGYNFLAIAASPYGNYWRESRKMATIELLSNNQLQKLKH  159

Query  512   VRTSEVEHCIGDLYSMCHENG----EVNLSEWFEHVTLNITLRLLVGKRF-SRIAKHLKE  676
             VR SEV+  I  L+  C  +      V +  W E + L+I +R++ GKR+ S+ +   +E
Sbjct  160   VRESEVKASIKGLFENCKRSSSHKVSVEMKHWIEGIVLDIIMRIIAGKRYTSQDSSDFQE  219

Query  677   VVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEddd  856
               +    L G FV SD +P L W+DIGGY K +K+ +KE D +   WL EH   R   + 
Sbjct  220   HATNFFDLCGKFVVSDALPFLRWLDIGGYEKLMKKTAKEFDLVFQGWLDEHKSKRGSSEV  279

Query  857   dqsdfmdVMLSSLPED---AVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNN  1027
                +    ++ SL +D    +  G   DT+IKA  L LIL  S++TA TL W  +LLLNN
Sbjct  280   KGDEDFMYVMLSLFDDKAKQLPDGDDTDTVIKAICLSLILAASDTTAVTLTWAIALLLNN  339

Query  1028  PHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKI  1207
                +K AQ+E+D  VG +R V ESD+KNL Y Q I+KE LRLYP GPL  P E++EDC I
Sbjct  340   RDVLKKAQNELDAQVGTNRQVNESDMKNLAYLQVILKETLRLYPAGPLLVPHESIEDCTI  399

Query  1208  GKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGR  1387
               YH+P GT+LI+N  K+ RDP VW EP +F PER+ + ++  +   G++FE++PF  GR
Sbjct  400   RGYHVPAGTQLIVNAWKVQRDPGVWEEPCKFLPERFLK-KYKDVDLKGQNFEFIPFGSGR  458

Query  1388  RMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             RMCPG++F+ QV+ L LA LL GF+ +TP   PVDM E   +   K TP++VLLTPRL
Sbjct  459   RMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKATPLEVLLTPRL  516



>ref|XP_009336967.1| PREDICTED: cytochrome P450 82A4-like [Pyrus x bretschneideri]
Length=526

 Score =   431 bits (1107),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 229/502 (46%), Positives = 304/502 (61%), Gaps = 28/502 (6%)
 Frame = +2

Query  122   RDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPA  301
             R   + GKL P   PEA G WP  GHLHLL G  P   TLG MADKYGP+F +RLG  P+
Sbjct  29    RAANHKGKLSP---PEAKGGWPIFGHLHLLGGSTPPHITLGAMADKYGPIFTIRLGVQPS  85

Query  302   IVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELM  481
             +V+SS E+ KEC+TTNDL   SRP M V  ++ Y+ A+FA  P G YWR++RK+VTLEL+
Sbjct  86    LVISSSEIAKECYTTNDLSILSRPKMVVVDHVSYDYAMFAFGPPGPYWREIRKIVTLELL  145

Query  482   TVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE--------VNLSEWFEHVTLNITLRLLV  637
             +V +++ L+HVR SEV   + +L+ +     +        V L +WF  + LN+ L  + 
Sbjct  146   SVRKVELLKHVRVSEVATFLKELHELWSTKKKEGSKDGVVVELKQWFADMMLNVILTTVA  205

Query  638   GKRFS------------RIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKE  781
             GKR+S            R+   L+E+     YL G+F+  D +P L W+D GG+ K +K+
Sbjct  206   GKRYSVAAAGDEKKEARRVQTALRELFD---YL-GMFLLGDAVPYLRWLDWGGHEKAMKK  261

Query  782   VSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlil  961
              + EMD II  W++EH + R + D      +   L S  +   + G   DTI KAT++ +
Sbjct  262   SATEMDAIIAEWVEEHKQRRAKGDAKGKQDLMDALLSALDGEDLGGFDADTITKATSVAI  321

Query  962   iltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKE  1141
             I  G ++T   + W  SLLLNNPH +K A +E+D  +GK R+V E DI NL Y QAI+KE
Sbjct  322   IAGGGDTTMVAVTWAISLLLNNPHVMKKALNELDTKIGKQRVVSEEDITNLVYIQAIVKE  381

Query  1142  GLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFR  1321
              LRLYP GPL+GPR   EDC I  YHIPKGTR I N  K+  DP+ W EP EFKPER F 
Sbjct  382   TLRLYPGGPLAGPRIFTEDCTIAGYHIPKGTRFIPNFWKIQTDPKYWPEPFEFKPER-FL  440

Query  1322  DEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSE  1501
               H  +   G  F+++PFS GRR CPG+ F LQVVQ TLA  L  F IS P   P+DM+E
Sbjct  441   TTHKDVDLKGHHFQFIPFSSGRRSCPGLAFGLQVVQFTLASFLHAFEISNPSSAPIDMTE  500

Query  1502  GLGIALPKLTPIQVLLTPRLPN  1567
               G+   K  P+ VL+ PRL +
Sbjct  501   SFGMTNVKAAPLNVLIKPRLSS  522



>ref|XP_003618363.1| Cytochrome P450 [Medicago truncatula]
 gb|AES74581.1| cytochrome P450 family 82 protein [Medicago truncatula]
Length=531

 Score =   430 bits (1106),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 229/488 (47%), Positives = 309/488 (63%), Gaps = 26/488 (5%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P A GAWP +GHL +  G+ P  R LG +ADKYGP+F ++LGS  A+++++ E+ KECF
Sbjct  41    APIAKGAWPILGHLPIFSGKQPPHRVLGPLADKYGPIFTIKLGSKHALILNNWEIAKECF  100

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT+D+V +SRP +   ++L Y  AVF   PYG YWR++RK+VTLE++T  R+ + +HVR 
Sbjct  101   TTHDMVVSSRPKLISTEHLAYGGAVFGFGPYGPYWRELRKIVTLEILTNRRIIQQQHVRV  160

Query  521   SEVEHCIGDLYSMCHENGE---------VNLSEWFEHVTLNITLRLLVGKRF--------  649
             SEV+  I +L+ + +   +         V+L +WF H+T N+ LR+ VGKR+        
Sbjct  161   SEVQTSIKELFDVWYSKKKESYPSNYMLVDLKQWFTHLTFNMVLRMAVGKRYFGAKTIVE  220

Query  650   --SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQ  823
                R  K LKE+    + L GV    DVIP L+W D GG++K + E S EMDEI+G WL+
Sbjct  221   EAQRSVKALKEI----MRLFGVITVGDVIPCLKWFDFGGHMKAMDETSTEMDEILGEWLK  276

Query  824   EHIRNRKEddddqsdfmdVM--LSSLPEDAVISGHKRDtiikattlililtGSESTAETL  997
             EH   R   +       D+M  L SL +   + G   DTIIKAT L L + GS++++ TL
Sbjct  277   EHRHKRTLTEKADDQDQDIMDVLISLLDGKTMEGFDCDTIIKATILTLFIGGSDTSSVTL  336

Query  998   IWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSG  1177
              W   LLL NP  +K A++E+D HVGK+RLV ESDI  L Y QAI+KE LRL+PPGPL+ 
Sbjct  337   TWAICLLLKNPLVLKKAKEELDTHVGKERLVNESDIGKLVYLQAIVKETLRLHPPGPLAA  396

Query  1178  PREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKS  1357
             PRE  E+C IG YH+ KGTRL+LNL K+  DP VWS+P EFKPER F   H  +   G  
Sbjct  397   PREFSENCTIGGYHVRKGTRLMLNLWKIQTDPSVWSDPLEFKPER-FLTTHKVVDVRGNH  455

Query  1358  FEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPI  1537
             FE LPF  GRR CP ++F LQ+V  TLA  L  F+I  P    VDM+E  G+A  K TP+
Sbjct  456   FELLPFGSGRRKCPAISFGLQIVHFTLASFLHSFDILNPTPGLVDMTEEFGLANTKATPL  515

Query  1538  QVLLTPRL  1561
             ++L+ P L
Sbjct  516   EILIKPHL  523



>ref|XP_010106079.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07349.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   430 bits (1106),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 250/487 (51%), Positives = 330/487 (68%), Gaps = 23/487 (5%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PEA GAWP IGHLHLL G  P   TL HMADKYGP+F +++G H A+VVSS E+ KEC T
Sbjct  38    PEAGGAWPIIGHLHLLAGPQPPHITLAHMADKYGPIFTIKMGVHRALVVSSWEMAKECLT  97

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
             TND +FA+RP  A  +++ YN A+F  +PYG YWR VRK+ TLEL++  RL+ L HVR S
Sbjct  98    TNDKIFANRPKAAAPEHMTYNYAMFGFSPYGPYWRQVRKIATLELLSNHRLEMLSHVRVS  157

Query  524   EVEHCIGDLYSM---------CHENGEVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE  676
             EV   I + Y +          +    V + +WF  +TLN+  R++VGKR+   A  L E
Sbjct  158   EVNTAIKEKYELWVKNNNSGNNNNGVGVEMKKWFGDITLNVIFRMVVGKRYLE-ATSLSE  216

Query  677   VVS-----RALY----LGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH  829
             + S     +AL     L G FV SD +P L+W+D GGY K +K+ SKE+D++   WL+EH
Sbjct  217   IGSDDRCRKALRDFFELTGTFVVSDALPYLKWLDFGGYEKSMKKTSKELDQLAQRWLEEH  276

Query  830   IRNR-KEddddqsdfmdVMLSSL--PEDAVISGHKRDtiikattlililtGSESTAETLI  1000
              R R   + +   DFMDVMLS L   E  + S +  DTI KAT+L LIL G+++T  T+ 
Sbjct  277   KRKRVSGEVNGDQDFMDVMLSILDGAELGISSTYDADTINKATSLALILAGTDTTTVTMT  336

Query  1001  WTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGP  1180
             W  +LLLNN  A+K A+ E+D++VGK+R V+ESD+KNL Y QAI+KE +RLYP GPLS P
Sbjct  337   WALALLLNNREALKKAEQELDLYVGKERQVKESDLKNLVYLQAILKETMRLYPAGPLSLP  396

Query  1181  REAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSF  1360
              E+ EDC +G YH+P GTRL+LNL KLH DP+VW +P EF+PER F   H ++   G++F
Sbjct  397   HESTEDCTVGGYHVPAGTRLLLNLSKLHLDPKVWDQPSEFRPER-FLTAHKNVDVRGQNF  455

Query  1361  EYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQ  1540
             E +PFS GRRMCPG++F+LQV+QLTLA LL GF I+T    PVDM E +G+   K TP+ 
Sbjct  456   ELIPFSSGRRMCPGVSFALQVMQLTLAALLHGFKIATRSDEPVDMRETVGLTNLKATPLD  515

Query  1541  VLLTPRL  1561
             V++TPRL
Sbjct  516   VIITPRL  522



>gb|AJD25201.1| cytochrome P450 CYP82D71 [Salvia miltiorrhiza]
Length=516

 Score =   429 bits (1104),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 232/482 (48%), Positives = 316/482 (66%), Gaps = 11/482 (2%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGR----LPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVK  331
             PEA GAWPF+GHLHL+ G     LP    LG +ADK+GP+F +R+G H A VVSS E+ K
Sbjct  36    PEAGGAWPFLGHLHLISGGPSSGLPHV-NLGALADKHGPIFTIRIGVHRAAVVSSWELAK  94

Query  332   ECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRH  511
             + FT ND   +SRPS+  GK+LGY  A+   A +G +WR +RK+ + EL +  RL++ R 
Sbjct  95    QAFTANDAAVSSRPSVKAGKHLGYGYAMLGFAEHGAHWRQLRKLASAELFSARRLEQQRR  154

Query  512   VRTSEVEHCIGDLYSMCHE--NGEVNLSEWFEHVTLNITLRLLVGK--RFSRIAKHLKEV  679
             VR +E    +G+L+++        V++ E    + LN+ LRL+ GK  R    A+  + V
Sbjct  155   VRVAETLIFVGELHALWQRERGAAVDVKERLGELNLNVMLRLVAGKELRGGEEARRCRRV  214

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEdddd  859
             +    ++ G+FVPSD  P LEW+DIGG+ + +K  ++EMDEI+G WL EH R     +D 
Sbjct  215   MRDFFHMAGLFVPSDAFPYLEWLDIGGHERRMKRAAEEMDEIVGEWLAEHRRKEYSGEDK  274

Query  860   qsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAI  1039
               DFMDVMLS +  +   S +  DTIIKAT   LI  G+++T+   IW  +LLLNN   +
Sbjct  275   AQDFMDVMLSVVKGEDFGSEYDVDTIIKATCGTLIAGGTDTTSVVFIWAIALLLNNRRVL  334

Query  1040  KMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYH  1219
             + AQ+E+D HVGK+R VEESDI NL Y QAI+KE LRLYPPGPL G R   +DC IG Y+
Sbjct  335   EKAQEELDKHVGKERRVEESDIANLVYLQAIVKETLRLYPPGPLGGARRVTQDCSIGGYN  394

Query  1220  IPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCP  1399
             IPKGT LI+NL KLHRDPRVW +P EF+PER+   E ++    G+ FE +PF  GRR+CP
Sbjct  395   IPKGTWLIVNLWKLHRDPRVWQDPSEFRPERFLNGE-SNADVKGQDFELIPFGAGRRICP  453

Query  1400  GMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL-PNLFP  1576
             G+NF +Q++ L LA LLQ F+++T     VDMSE  G+   K TP+ V++ PRL PNL+ 
Sbjct  454   GINFGVQMLHLVLASLLQAFDLNTVSDEGVDMSESAGLTNIKATPLDVVIAPRLPPNLYE  513

Query  1577  TM  1582
             + 
Sbjct  514   SF  515



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   429 bits (1104),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 231/484 (48%), Positives = 313/484 (65%), Gaps = 18/484 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              PEA GAWP IGHLHLL G     +TLG MADKYGPVF ++LG    +++S+ E+ KECF
Sbjct  50    APEAAGAWPVIGHLHLLGGPELPHKTLGAMADKYGPVFLIKLGVQRVLMLSNWEMAKECF  109

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TTND VFA+RP     + LGYN A+F   PYG YWR VRK+VT  L++  RL+ ++HV  
Sbjct  110   TTNDKVFANRPKSIAVEVLGYNYAMFGFGPYGSYWRQVRKIVTTGLLSNRRLEIVKHVWI  169

Query  521   SEVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRFS-----RIAKH  667
             SEV+  I +LY +            V + +WF  ++LN+ LR+L G R S     R+  H
Sbjct  170   SEVKASIRELYELWINKRSDSNMVLVEMKDWFGDLSLNMVLRMLSGGRDSSSKEERMRCH  229

Query  668   LKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRK-  844
               ++V       G F+ SD +P L W D GGY K +++ +K++D ++ +WLQ+H   R  
Sbjct  230   --KLVRDFFQSMGTFLVSDALPLLRWFDFGGYEKAMRKTAKDLDHLLESWLQQHKSKRSS  287

Query  845   EddddqsdfmdVMLSSLPE---DAVISGHKRDtiikattlililtGSESTAETLIWTTSL  1015
             E  D   DFMDVMLS L +   D  + G   DTI KAT L ++  G+++   +LIW  SL
Sbjct  288   EQADGNQDFMDVMLSMLDDMATDEDLKGFDADTINKATCLTILAGGTDTVTVSLIWALSL  347

Query  1016  LLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAME  1195
             LLN P  +K A++E+D HVG++R VEE D+KNL Y  AI+KE LRLYP GPL+ P E+ E
Sbjct  348   LLNKPQVLKTAREELDSHVGRERQVEERDMKNLAYLNAIVKETLRLYPAGPLTAPHESTE  407

Query  1196  DCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPF  1375
             DC +G YHIP GTRL+ NL K+HRDP +WS+P+EF+PER F   H  +   G+ FE +PF
Sbjct  408   DCLLGGYHIPAGTRLLANLWKIHRDPSIWSDPDEFRPER-FLTTHKDVDVKGQHFELIPF  466

Query  1376  SGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTP  1555
               GRR+CPG++F LQ +Q TLA L+QGF  +T    PVDM+E +G+   K TP++VL+ P
Sbjct  467   GSGRRICPGISFGLQFMQFTLASLIQGFEFATMSDEPVDMTESIGLTNLKATPLEVLVAP  526

Query  1556  RLPN  1567
             RL +
Sbjct  527   RLSS  530



>ref|XP_009606708.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=523

 Score =   429 bits (1103),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 243/511 (48%), Positives = 324/511 (63%), Gaps = 27/511 (5%)
 Frame = +2

Query  95    YNQIILKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHG----RLPVARTLGHMADKY  262
             YNQ  L  KR+N         RVPEA GAWP IGHLHLL G    +LP  + L  MA+KY
Sbjct  21    YNQF-LSTKRNNGQRK-----RVPEAAGAWPIIGHLHLLSGSESDQLP-HKVLARMAEKY  73

Query  263   GPVFGLRLGSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRY  442
             GP+FGL+LG + A+VVS  ++ KECFTTNDL  A+RP     + +GYN A+F +APYG Y
Sbjct  74    GPIFGLKLGVYKAVVVSDPKIAKECFTTNDLALANRPKSLASEIIGYNHAMFGVAPYGPY  133

Query  443   WRDVRKMVTLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGEVNLS--------EWF  598
             WR++RK+ T+E ++  R++ L+H+R  EV+  I + Y    +N   +L+        EW 
Sbjct  134   WREIRKIATIEFLSTRRIEVLKHIREFEVKSAIKESYEFWLKNKSSSLNGAVKMEMKEWL  193

Query  599   EHVTLNITLRLLVGKRFSR---IAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIK  769
              +V +N  +++L GK  +    I K  K  + R   L G  V +D +P L W+DIGG+ K
Sbjct  194   GNVIMNTMVKMLFGKECTEGEGINKAHK-AIRRFFELMGATVVADFLPYLRWLDIGGHEK  252

Query  770   GLKEVSKEMDEIIGTWLQEHIRNRKEddddqsdfmdVM--LSSLPEDAVISGHKRDtiik  943
              +KEV+KE+D ++  WL EH R R        +  D M  + S+ E+  + G   DT IK
Sbjct  253   AMKEVAKEIDSVVEEWLGEHKRRRDSKGIKSGEEEDFMDVMLSICENRDLPGFDADTSIK  312

Query  944   attlililtGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYF  1123
             AT + L+  G+++T  TL WT SLLLNN  A+K AQDE+D HVGK+R V++SDIKNL Y 
Sbjct  313   ATCMALLAAGTDTTIVTLTWTLSLLLNNYQALKKAQDELDAHVGKNRCVQDSDIKNLVYL  372

Query  1124  QAIIKEGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFK  1303
             QAI+KE LRLY   PLS P E+MEDC I  Y IPKGTRL++N+ K+H DP +W  P+EFK
Sbjct  373   QAIVKEALRLYSAAPLSVPHESMEDCTISGYDIPKGTRLLVNIWKIHCDPDLWPNPDEFK  432

Query  1304  PERWFRDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGM  1483
             PER F   H  +   G  FE +PF  GRRMCPG++F+LQ V   LA LLQGF +  P   
Sbjct  433   PER-FLTTHKDVDVRGNHFELIPFGSGRRMCPGISFALQAVPFVLAGLLQGFELKRPSDE  491

Query  1484  PVDMSEGLGIALPKLTPIQVLLTPRL-PNLF  1573
             P+DMSE  G+ + K +P+QVLL PRL PNL+
Sbjct  492   PIDMSESFGLTILKASPLQVLLAPRLAPNLY  522



>ref|XP_010547839.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=501

 Score =   428 bits (1101),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 229/501 (46%), Positives = 315/501 (63%), Gaps = 24/501 (5%)
 Frame = +2

Query  110   LKYKRDNKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVA-RTLGHMADKYGPVFGLRL  286
             +K K+ N  N        PE  G+WP IGHLHLL G+  +  RTLG MAD +GP    R+
Sbjct  1     MKTKKPNHRNA-------PEPAGSWPVIGHLHLLGGKEQLLYRTLGAMADDHGPASPRRV  53

Query  287   GSHPAIVVSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMV  466
             GS  A VVSS EV KECFT ND   ASRP     K++GYN AVF  APY  +WR +RK+ 
Sbjct  54    GSRRAFVVSSWEVAKECFTVNDKALASRPMTVASKHMGYNYAVFGFAPYSSFWRKMRKIA  113

Query  467   TLELMTVSRLKKLRHVRTSEVEHCIGDLYSMCHENGE-----VNLSEWFEHVTLNITLRL  631
             T+EL++  RL+ L+HVR SE+   I DL+ +  + G      V+L  W E + LN+ +++
Sbjct  114   TVELLSNRRLQMLKHVRISEISTGIKDLHGLWSKKGGSSPVLVDLKRWLEDMNLNMIVKM  173

Query  632   LVGKRF---------SRIAKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEV  784
             + GKR+         +  A+  +  ++R  +L G+FV SD +P L W D+ G+ K +++ 
Sbjct  174   VAGKRYFGSSAKMEDAEEARQCQRAIARFFHLIGIFVVSDALPFLGWFDLQGHEKEMRKT  233

Query  785   SKEMDEIIGTWLQEHIRNRKEddddqsdfmdVMLSSLPEDAVISGHKRD--tiikattli  958
             + E+D I+  W+ EH R R     +       ++ SL  +  +S  + D  T IK+T L 
Sbjct  234   ASELDGILERWIDEHQRRRVSGQSEGDSDFIDVMLSLEGEGKLSDLQYDPRTSIKSTCLA  293

Query  959   liltGSESTAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIK  1138
             LIL GS++TA TL W  +LLLNN   +K AQ+E+D+HVGK+R VE+SDI+NL Y QAIIK
Sbjct  294   LILGGSDTTAGTLTWAIALLLNNREMLKKAQEEIDIHVGKNRQVEDSDIENLVYLQAIIK  353

Query  1139  EGLRLYPPGPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWF  1318
             E LRLYP GPL GPREAMEDC +  Y +  GTRLI+N+ K+ RDP+VW  PEEF+PER+ 
Sbjct  354   ETLRLYPAGPLLGPREAMEDCTVAGYQVAAGTRLIVNVWKIQRDPKVWRNPEEFRPERFL  413

Query  1319  RDEHASIGYVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMS  1498
               +       G++FE +PF  GRR CPG + +LQV+ L+LAR+L  F++ T     VDM 
Sbjct  414   TGKETEYDVRGQNFELMPFGSGRRSCPGASLALQVLHLSLARVLHSFDLLTVSDSEVDMR  473

Query  1499  EGLGIALPKLTPIQVLLTPRL  1561
             E  G+ +PK TP++VLLTPRL
Sbjct  474   ESPGLTIPKATPLEVLLTPRL  494



>emb|CAN64501.1| hypothetical protein VITISV_020341 [Vitis vinifera]
Length=462

 Score =   427 bits (1097),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 230/475 (48%), Positives = 313/475 (66%), Gaps = 63/475 (13%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PE  GAWPF+GHLHLLHG++PV RTLG MADK GPVF +RLG +  +VVS+ E  KECFT
Sbjct  39    PEPSGAWPFVGHLHLLHGKVPVFRTLGAMADKVGPVFVIRLGMYRXLVVSNXEAAKECFT  98

Query  344   TNDLVFASRPSMAV-GKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TND  FASRP++ + GK   YN            W + +K+V                  
Sbjct  99    TNDKXFASRPNLYILGK--DYN------------WVNPKKVV------------------  126

Query  521   SEVEHCIGDLYSMCHENGEVNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKE-------V  679
                                  +SEWFEH+  N+ LR++ GKR+     H  E       V
Sbjct  127   ---------------------ISEWFEHLNFNVVLRMVAGKRYFNNVVHGGEEAGSATAV  165

Query  680   VSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKEdddd  859
             + + + L G FV SDVIP LEW+D+ G++  +K+V+KEMD ++ +W++EH      +   
Sbjct  166   IKKLVPLAGAFVASDVIPFLEWVDLQGHLSSMKQVAKEMDSVLESWVEEHTGRLNSEASS  225

Query  860   qsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHAI  1039
             + DF+D+ML+ L +DA + G+ R+TIIKAT ++LI+ GS++T+ T  W  S LLNN H +
Sbjct  226   RQDFIDIMLTKL-KDASLFGYSRETIIKATVMMLIVAGSDTTSITSTWLLSALLNNRHVM  284

Query  1040  KMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKYH  1219
             K AQ+E+D+ VG+DR VE+SDI+NL Y +AI+KE LRLYP  PL  P EAMEDC +G YH
Sbjct  285   KHAQEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCHVGGYH  344

Query  1220  IPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMCP  1399
             IPKGTRL++N  KLHRDP VWS PEEF+PER F   HA++  +G++FE +PF  GRR CP
Sbjct  345   IPKGTRLLVNAWKLHRDPAVWSNPEEFQPER-FLTSHATVDVLGQNFELIPFGSGRRSCP  403

Query  1400  GMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRLP  1564
             G+N +LQ++ LT+A+LLQGF+++TP   PVDM+E + I +PKLTP++V+LTPRLP
Sbjct  404   GINMALQMLHLTIAQLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRLP  458



>ref|XP_006464328.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=521

 Score =   429 bits (1102),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 228/475 (48%), Positives = 309/475 (65%), Gaps = 8/475 (2%)
 Frame = +2

Query  158   RVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             + PEA GAWP IGHLHL  G  P  R LG+MA+KYGP+F +++G + A+VVS+ E+ KEC
Sbjct  42    QAPEAGGAWPMIGHLHLFGGPEPTHRILGNMANKYGPIFTMKMGVNRALVVSNSEITKEC  101

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FTTND   ASRP     + LGYN      +PYG YWR+ RK+ T+EL++  RL+KL+HVR
Sbjct  102   FTTNDKALASRPRRMAMEILGYNFLATPSSPYGSYWRETRKIATVELLSNHRLEKLKHVR  161

Query  518   TSEVEHCIGDLYSMCHENG----EVNLSEWFEHVTLNITLRLLVGKRF-SRIAKHLKEVV  682
              SEV   I  L+  C  +      V +  W E  T +I +R++ GKR+ S+    L E  
Sbjct  162   ESEVTASIKGLFKDCQNSATGKVSVEMKHWLEGTTFDIIIRIIEGKRYTSQEGTDLHEHA  221

Query  683   SRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEH-IRNRKEdddd  859
             +    L G FV SD +P L W+DIGG  K +K+ +KE D I+  WL EH I+    + + 
Sbjct  222   ASFFTLFGKFVVSDALPFLRWLDIGGNEKLMKKTAKEFDIILQQWLDEHKIKRGSSEVEG  281

Query  860   qsdfmdVMLSSLPEDA-VISGHKRDtiikattlililtGSESTAETLIWTTSLLLNNPHA  1036
               DF+ VMLS L ++A  +     DT+IKA  L +IL  +++T+ TL W  SLLLNN  A
Sbjct  282   DEDFIYVMLSLLYDNAKQLPDSDADTVIKALCLTVILGAADTTSVTLTWAISLLLNNRDA  341

Query  1037  IKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDCKIGKY  1216
             +K AQDE+++HVG +R V ESDIKNL Y QAI+KE +RLYP  PL  P ++MEDC I  Y
Sbjct  342   LKKAQDELNIHVGANRQVNESDIKNLVYLQAILKETMRLYPAAPLLLPHQSMEDCTISGY  401

Query  1217  HIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSGGRRMC  1396
             H+P GT+L +N  K+H DP+VW EP +F PER F   H  I   G++FE +PF  GRR+C
Sbjct  402   HVPAGTQLFVNAWKVHHDPKVWKEPCKFLPER-FLTTHKDIDLRGQNFELIPFGSGRRIC  460

Query  1397  PGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             PG++F+ QV+ L LA LL GF+++TP+  PVDM E   + + + TP++VLLTPRL
Sbjct  461   PGISFAFQVMPLILASLLHGFDLATPLDEPVDMEEAKSLTITRATPLKVLLTPRL  515



>ref|XP_009616319.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=521

 Score =   429 bits (1102),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 217/482 (45%), Positives = 319/482 (66%), Gaps = 14/482 (3%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHG---RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVK  331
              PE PGAWP IGHL  L G    +P  R LG +ADKYGPVF LR+G +P ++V++ E  K
Sbjct  36    APEIPGAWPIIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAK  95

Query  332   ECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRH  511
             +C TT+D  FA+RP+   G+ +GY  A F  A +G Y+  VRK+    +++ ++L+K++H
Sbjct  96    DCLTTHDKDFAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKH  155

Query  512   VRTSEVEHCIGDLYSMC---HENGEVNLSEWFEHVTLNITLRLLVGKRFSRI-----AKH  667
             +R SE+E  I +LYS+    +   +VN+S+WFE +TLNI ++ + GKR+S I     A+ 
Sbjct  156   IRVSELETSIKELYSLTLGKNNMQKVNISKWFEQLTLNIIVKTICGKRYSNIEEDEEAQR  215

Query  668   LKEVVSRALYLGGVFVPSDVIPS--LEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
              ++     +++ G  V  D IP    ++ D  G+I+ + ++ K++D I+  WL +H+ N+
Sbjct  216   FRKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNK  275

Query  842   KEddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLLL  1021
               ++ DQ     ++  +   +    G  + T+IK+T L LIL G+++TA  LIW  SLLL
Sbjct  276   DVNNKDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLL  335

Query  1022  NNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMEDC  1201
             NNPH +K  Q+E+DM VGK+R +E++DIKNL Y QAI+KE LRLYPP P   P EA++DC
Sbjct  336   NNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDC  395

Query  1202  KIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFSG  1381
             K+  YHIPKGTRL +N  K+HRDP +WSEPE+F P+R F    A+I   G++FE++PF  
Sbjct  396   KVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPDR-FLTSKANIDARGQNFEFIPFGS  454

Query  1382  GRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPRL  1561
             GRR CPG+ F+  V  LT  RLLQGF+ S P   P+DM+EG+G+ LPK+  ++VL+TPRL
Sbjct  455   GRRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRL  514

Query  1562  PN  1567
             P+
Sbjct  515   PS  516



>ref|XP_004249377.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=524

 Score =   429 bits (1102),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 218/484 (45%), Positives = 326/484 (67%), Gaps = 16/484 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHG--RLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKEC  337
             P+ PG+WP IGHL        +P+ART G ++++YGP+F ++LG +   V+++ E  K+C
Sbjct  38    PKIPGSWPIIGHLRGFGDGENVPLARTFGKLSNQYGPIFTIKLGMYRYCVINNWEAAKDC  97

Query  338   FTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVR  517
             FT ND   A+RP     ++ GYN A F+ A YG Y+  VRK+V   +++ +RL+K+++VR
Sbjct  98    FTINDKELAARPISLAAEHYGYNYARFSFANYGPYYCQVRKLVLQNVLSSTRLEKVKNVR  157

Query  518   TSEVEHCIGDLYSMC---HENGEVNLSEWFEHVTLNITLRLLVGKRFSRI-----AKHLK  673
              SEVE  I +LY++      +  +N+S+WFE +TLNI ++++ GKR+  +     A+  +
Sbjct  158   ISEVEISIKELYNIWGKGENSNTINISKWFEKLTLNIIVKMIAGKRYISLEKDQEAQCFR  217

Query  674   EVVSRALYLGGVFVPSDVIPS--LEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNRKE  847
                ++ +YL G F+  D IP    +++D  G+IK +K++ K++D+I+ +W+ EH+  +K 
Sbjct  218   RAFAKIMYLAGEFILYDAIPFKIFKYVDFQGHIKTMKQIYKDLDDILQSWVNEHMEKKKI  277

Query  848   ddddqsdfmdV--MLSSLP-EDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
             + D+ ++   +  MLS    ED    G+ RDT+IKA  L +IL GS++TA  L W  SLL
Sbjct  278   EGDNNNEQDCIDSMLSVTKLEDFKAYGYTRDTVIKAIVLSMILDGSDTTAVHLTWLMSLL  337

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNNP  +  AQ E+D  VGKDR +EESDIK+L Y QAI+KE LRLYPP PL  P EA+ED
Sbjct  338   LNNPRVMNNAQKEIDSKVGKDRWIEESDIKDLVYLQAIVKEALRLYPPAPLLVPHEAVED  397

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C +  Y+IPKGTRL  N  K+ RDPRV+SEP++F PER F +EH+++   G+ FE++PF 
Sbjct  398   CTVAGYNIPKGTRLFANAWKIQRDPRVYSEPDKFIPER-FLNEHSNVDARGQHFEFIPFG  456

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRR CPG+NF+ QV  LT+ RL+QGF+  TP  +PVDM+EG GI +PK  P++V++TPR
Sbjct  457   SGRRSCPGINFATQVAHLTIGRLIQGFSFGTPSNLPVDMTEGQGITMPKAKPVEVVITPR  516

Query  1559  LPNL  1570
             L ++
Sbjct  517   LNSM  520



>gb|AFK79026.1| cytochrome P450 CYP82T1 [Bupleurum chinense]
Length=526

 Score =   429 bits (1102),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 232/494 (47%), Positives = 327/494 (66%), Gaps = 16/494 (3%)
 Frame = +2

Query  128   NKNNGKLLPLRVPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIV  307
              KN+ +    + P+  GAWP IGH+ LL    P  + LG MADKYGPVF ++LG   A+V
Sbjct  27    TKNHDEKKKTQAPKPNGAWPIIGHIPLLASTKPACKILGDMADKYGPVFRIQLGWQNAVV  86

Query  308   VSSCEVVKECFTTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTV  487
             VSS E V + FTTND  F +RP+    KY+GYN A FA APY   +R++RK    E+++ 
Sbjct  87    VSSKEAVMQIFTTNDNNFMTRPTSLTLKYMGYNGAFFAFAPYSTLYREMRKASIFEVLSN  146

Query  488   SRLKKLRHVRTSEVEHCIGDLYSMCHENG-----EVNLSEWFEHVTLNITLRLLVGKRFS  652
             SR++ L+ +R SE+  CI +LYS+C +NG     ++N+ +W + V +N+ L++L  KR+S
Sbjct  147   SRMELLKPLRASEMTTCIKELYSLCCKNGIVVPVKLNIEKWVQQVIINLMLQMLARKRYS  206

Query  653   RIAKHLKEVVSRAL--------YLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEII  808
              I +   +V SR           L G F  SDVIP +EWMD+ G  + +   +KE+D  +
Sbjct  207   SIGEGETQVESRRFKKAFEEFFILAGAFELSDVIPFIEWMDLQGNRRAMIRTAKELDVFM  266

Query  809   GTWLQEHIRNR-KEddddqsdfmdVMLSSLPE-DAVISGHKRDtiikattlililtGSES  982
              +W+ EH ++R ++   +  DF+DVM+S  PE  A + G+K   +IKAT + +I+ GS++
Sbjct  267   SSWIDEHKKSREQDQLKEDRDFIDVMISLFPEPHASVHGYKSTDVIKATVMSVIMGGSDA  326

Query  983   TAETLIWTTSLLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPP  1162
              A TL W  SLLLNN + ++ AQ E+D H+GKDR VEESDI++L Y QAI+KE LRLYP 
Sbjct  327   PAITLTWALSLLLNNNNVLEKAQQELDDHIGKDRWVEESDIRHLVYLQAILKETLRLYPG  386

Query  1163  GPLSGPREAMEDCKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIG  1342
             GPL  PR+A EDC +  YH+PKGT+L +N+ KLHRD   W+ P EF+PER F   HA + 
Sbjct  387   GPLGIPRKAKEDCTVAGYHVPKGTQLWVNIWKLHRDSETWTAPYEFQPER-FLTSHAGVD  445

Query  1343  YVGKSFEYLPFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALP  1522
               G+ FEY+P+S GRR CPG+  S+Q++QLTLARLLQGFN+ +P   PVDM+E  GI++ 
Sbjct  446   VRGQQFEYIPYSSGRRSCPGITASMQMMQLTLARLLQGFNLVSPTNEPVDMTEAAGISMH  505

Query  1523  KLTPIQVLLTPRLP  1564
             +  P +V+LTPRLP
Sbjct  506   RKYPFEVVLTPRLP  519



>ref|XP_011030954.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=528

 Score =   429 bits (1102),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 316/486 (65%), Gaps = 17/486 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECFT  343
             PEA GAWP IGHLHLL G  P   TLG++ADK+GP+F ++LG H A++VS+ E+ KEC  
Sbjct  41    PEAAGAWPLIGHLHLLRGSQPPHITLGNLADKHGPIFTVKLGVHRALIVSNWEMAKECLR  100

Query  344   TNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRTS  523
              ND  FA+RP       LG+N ++   +PYG YWR +RK+VTLE+++  RL+  +HVR  
Sbjct  101   INDKAFATRPKALATDILGFNYSMLGFSPYGTYWRQIRKIVTLEVLSNHRLEMFKHVRED  160

Query  524   EVEHCIGDLYSMCHENGE------VNLSEWFEHVTLNITLRLLVGKRFSRIAKHLKEVVS  685
             EV   +G LY     N        V +  WF  +TLNI L+++V KR+   A H +E  S
Sbjct  161   EVRDAVGALYQQWIGNKSNSQKLLVEMKRWFNDITLNIILKIIVSKRYVDHASHGEEKPS  220

Query  686   --------RALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
                       L L G+FV SD +P L W+D+GG  K +K  +K +D  +  WL+EH + +
Sbjct  221   DEWRDSLREFLELSGMFVVSDALPFLRWLDLGGAEKAMKRTAKNLDHAVEKWLEEHKQRK  280

Query  842   KEdddd-qsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
                    + DFMD+MLS L +   +S    DTI KAT L LIL  S++T+ TL WT SLL
Sbjct  281   ASGTAKGEEDFMDLMLSVLDDAKELSNRSADTINKATCLALILAASDTTSVTLTWTLSLL  340

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN   +K AQDE+D+HVG++R V+ESD+KNL Y QAI KE  RLYP  PLSGP E+ME+
Sbjct  341   LNNREVLKKAQDELDIHVGRERQVKESDMKNLVYLQAIFKESFRLYPAAPLSGPHESMEE  400

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C +G YHIP GTRL  NL K+HRDP+VWS+P+EF+PER F   H    + G+ FE +PF 
Sbjct  401   CTVGGYHIPAGTRLFTNLSKIHRDPQVWSDPDEFQPER-FLTTHKDCDFRGQHFELIPFG  459

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
              GRRMCPG++F+LQV+ L LA LL GF+I +    P+DM+E  GI   K TP++VLLTPR
Sbjct  460   SGRRMCPGVSFALQVLNLALATLLHGFDIESLDDAPIDMTETGGITNVKATPLKVLLTPR  519

Query  1559  L-PNLF  1573
             L P L+
Sbjct  520   LSPGLY  525



>ref|XP_007047112.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91269.1| Cytochrome P450 [Theobroma cacao]
Length=691

 Score =   434 bits (1116),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 238/485 (49%), Positives = 321/485 (66%), Gaps = 21/485 (4%)
 Frame = +2

Query  161   VPEAPGAWPFIGHLHLLHGRLPVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
              P+A GA P IGH+HLL G     +TLG MADKYGPVF +RLGSH A+V++S E+ +ECF
Sbjct  198   APQAGGALPVIGHMHLLGGHQLTHKTLGAMADKYGPVFSIRLGSHSALVLNSWEMARECF  257

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             T +D VF++RP +   K LGYN A+F  APYG YWR++R++ T+EL++  R+  L+H+R 
Sbjct  258   TVHDKVFSTRPVLTASKVLGYNYAMFGFAPYGSYWREIRRIATIELLSSHRIDMLKHIRA  317

Query  521   SEVEHCIGDLYS--MCHENGE----VNLSEWFEHVTLNITLRLLVGKRF--------SRI  658
             SEV+  + +LY   +    GE    V++ +WF  +T NI LR++ GKRF           
Sbjct  318   SEVKTAVRELYKSWLSKGGGETGVLVDMKQWFGDLTHNIALRMVGGKRFFGPNADCEEAE  377

Query  659   AKHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRN  838
             A+  ++V+  + YL GVFV SD +P + W+D  GY K +K  +KE+D ++G WL+EH + 
Sbjct  378   ARRCQKVMRDSAYLFGVFVVSDALPFIGWLDFQGYEKAMKRTAKELDILLGGWLEEHKQK  437

Query  839   RK--EddddqsdfmdVMLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTS  1012
             +        + DFMDVML+ L EDA I+    DTI KAT L L+L GS++T  TL W  S
Sbjct  438   KHLGGGLKKEQDFMDVMLNIL-EDAKITSFDADTINKATCLNLVLAGSDTTMITLTWALS  496

Query  1013  LLLNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAM  1192
             LLLNNP  +K AQDE+DMHVGKDRL+EESDI+NL Y  AI+KE LRLYPP P+   R +M
Sbjct  497   LLLNNPRVLKRAQDELDMHVGKDRLLEESDIRNLVYLHAIVKETLRLYPPSPIIF-RASM  555

Query  1193  EDCKIGK-YHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYL  1369
             EDC +   YHIP GTRL++N  K+ RD RVW +P  FKPER F   H  + + G++FE +
Sbjct  556   EDCTLSTGYHIPAGTRLMVNAWKIQRDERVWPDPHVFKPER-FLTSHKDMEFRGQTFELI  614

Query  1370  PFSGGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGM-PVDMSEGLGIALPKLTPIQVL  1546
             PF  GRR CPG++ +LQVV   LA  LQ F +S P  +  +DM+E  G+   K TP++VL
Sbjct  615   PFGSGRRSCPGVSLALQVVHSALASFLQSFEVSKPSKLEDIDMTESTGLTNLKATPLEVL  674

Query  1547  LTPRL  1561
              TPRL
Sbjct  675   FTPRL  679



>gb|KHN04536.1| Cytochrome P450 82A1, partial [Glycine soja]
Length=490

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 223/483 (46%), Positives = 308/483 (64%), Gaps = 16/483 (3%)
 Frame = +2

Query  164   PEAPGAWPFIGHLHLLHGRL-PVARTLGHMADKYGPVFGLRLGSHPAIVVSSCEVVKECF  340
             P A G WP IGHLHLL G   P   TLG +ADKYGP+F +R+G H A+VVSS E+ KECF
Sbjct  1     PAASGGWPLIGHLHLLGGSTQPPYITLGSLADKYGPIFSMRIGVHHAVVVSSWELAKECF  60

Query  341   TTNDLVFASRPSMAVGKYLGYNEAVFALAPYGRYWRDVRKMVTLELMTVSRLKKLRHVRT  520
             TT D+V +SRP     K LGYN A F   PYG +WR++RK+   EL++ +R + L+ +R 
Sbjct  61    TTLDVVISSRPKFTAAKILGYNYANFGFTPYGDFWREMRKIAASELLSTARFELLQRIRD  120

Query  521   SEVEHCIGDLYSM------CHENGEVNLSEWFEHVTLNITLRLLVGKRFS-------RIA  661
             SE++  + +LY          ++  V + +WF  V LN+ LR++ GKR+S       +  
Sbjct  121   SEMQISLKELYRTWVDKRGVSDDLLVEMKQWFGDVNLNVILRMISGKRYSAKSEDDLQQV  180

Query  662   KHLKEVVSRALYLGGVFVPSDVIPSLEWMDIGGYIKGLKEVSKEMDEIIGTWLQEHIRNR  841
             + ++ V      L G+FV  D IP L W+D+GG +K +K+ + EMD I+  WL+EH +  
Sbjct  181   RRIRRVFREFFRLTGLFVVGDAIPFLGWLDLGGEVKEMKKTAIEMDNIVSEWLEEHKQQI  240

Query  842   KEddddqsdfmdV-MLSSLPEDAVISGHKRDtiikattlililtGSESTAETLIWTTSLL  1018
              +  D +++   + +L  + +   ++G+  DT+IKAT  +LI   +++TA T+ W  SLL
Sbjct  241   TDSGDTKTEQDFIDVLLFVLKGVDLAGYDFDTVIKATCTMLIAGATDTTAVTMTWALSLL  300

Query  1019  LNNPHAIKMAQDEMDMHVGKDRLVEESDIKNLKYFQAIIKEGLRLYPPGPLSGPREAMED  1198
             LNN HA+K  +DE+D HVGK+RLV ESDI  L Y QA++KE LRLYP GP SGPRE  E+
Sbjct  301   LNNHHALKKVKDELDEHVGKERLVNESDINKLVYLQAVVKETLRLYPAGPFSGPREFTEN  360

Query  1199  CKIGKYHIPKGTRLILNLLKLHRDPRVWSEPEEFKPERWFRDEHASIGYVGKSFEYLPFS  1378
             C +G Y I  GTR +LN+ KLHRDPRVWS P EF+PER F + H ++   G+ FE LPF 
Sbjct  361   CTLGGYKIEAGTRFMLNIWKLHRDPRVWSNPLEFQPER-FLNTHKNVDVKGQHFELLPFG  419

Query  1379  GGRRMCPGMNFSLQVVQLTLARLLQGFNISTPMGMPVDMSEGLGIALPKLTPIQVLLTPR  1558
             GGRR CPG++F LQ+  L LA  LQ F I+TP    VDMS   G+   K TP++VL+ P 
Sbjct  420   GGRRSCPGISFGLQMSHLALASFLQAFEITTPSNAQVDMSATFGLTNMKTTPLEVLVRPV  479

Query  1559  LPN  1567
             L +
Sbjct  480   LSH  482



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5439169767108