BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82601_g1_i1 len=642 path=[620:0-641]

Length=642
                                                                      Score     E

sp|A0AT28.1|NLTP1_LENCU  RecName: Full=Non-specific lipid-transfe...  89.0    9e-19   Lens culinaris
ref|XP_004492085.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    8e-18   
ref|XP_006295252.1|  hypothetical protein CARUB_v10024340mg           85.9    1e-17   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  84.3    4e-17   Lens culinaris
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    5e-17   
gb|KFK36745.1|  hypothetical protein AALP_AA4G164400                  84.0    6e-17   
gb|AFK36168.1|  unknown                                               83.2    1e-16   
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    1e-16   
ref|XP_010529176.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    2e-16   
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    2e-16   
ref|XP_009615065.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    3e-16   
ref|XP_010517149.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    4e-16   
ref|XP_009757306.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    4e-16   
ref|XP_010509135.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    1e-15   
ref|XP_002879751.1|  hypothetical protein ARALYDRAFT_482863           80.5    1e-15   
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...  79.7    2e-15   Lens culinaris
ref|XP_003605266.1|  Non-specific lipid-transfer protein              79.7    2e-15   
gb|AFK38461.1|  unknown                                               79.7    2e-15   
gb|KFK36763.1|  lipid transfer protein                                79.3    2e-15   
gb|AAL25839.1|  lipid transfer precursor protein                      79.3    3e-15   Hevea brasiliensis [Para rubber tree]
gb|AFK44274.1|  unknown                                               79.0    3e-15   
ref|XP_010517150.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    3e-15   
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  78.6    4e-15   Lens culinaris
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            79.0    5e-15   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  78.6    5e-15   Lens culinaris
gb|AES87466.2|  Lipid transfer protein                                79.0    5e-15   
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...  78.2    6e-15   Lens culinaris
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    6e-15   
emb|CDP14198.1|  unnamed protein product                              78.2    6e-15   
gb|ABK24295.1|  unknown                                               78.6    7e-15   Picea sitchensis
gb|ABK21641.1|  unknown                                               78.2    8e-15   Picea sitchensis
gb|ABK22438.1|  unknown                                               77.8    9e-15   Picea sitchensis
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    1e-14   
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               77.8    1e-14   
gb|AFK46170.1|  unknown                                               77.8    1e-14   
gb|AFM35695.1|  nonspecific lipid transfer protein                    77.4    1e-14   
gb|AFR43276.1|  lipid transfer protein precursor                      77.4    1e-14   
ref|XP_006295253.1|  hypothetical protein CARUB_v10024341mg           77.4    1e-14   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    1e-14   
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            77.4    1e-14   Gossypium hirsutum [American cotton]
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    2e-14   
ref|NP_181388.1|  non-specific lipid-transfer protein 1               77.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADR66946.1|  non-specific lipid transfer protein                   77.0    2e-14   
gb|AEC04836.1|  lipid transfer protein                                76.6    2e-14   
gb|AGH27863.1|  lipid transfer protein precursor                      77.0    2e-14   
gb|ACJ62381.1|  lipid-transfer protein                                77.0    2e-14   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62387.1|  lipid-transfer protein                                76.6    2e-14   Zea mays subsp. parviglumis [Balsas teosinte]
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  75.9    3e-14   Prunus domestica
ref|XP_010922736.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    3e-14   
gb|ADR66942.1|  non-specific lipid transfer protein                   76.3    3e-14   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  75.9    4e-14   Prunus avium [gean]
gb|AGH27866.1|  lipid transfer protein precursor                      75.9    4e-14   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           75.9    4e-14   
gb|ABK25598.1|  unknown                                               76.3    4e-14   Picea sitchensis
gb|ABG54494.1|  putative allergen Rub i 3                             75.9    4e-14   Rubus idaeus [European raspberry]
gb|ADR66947.1|  non-specific lipid transfer protein                   75.9    4e-14   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           75.9    4e-14   
gb|ADR66943.1|  non-specific lipid transfer protein                   75.9    5e-14   
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  75.9    5e-14   Cicer arietinum [garbanzo]
ref|XP_003605269.1|  Non-specific lipid-transfer protein              77.0    5e-14   
gb|ADR66950.1|  non-specific lipid transfer protein                   75.9    5e-14   
emb|CAA85484.1|  lipid transfer protein precursor                     75.5    6e-14   Hordeum vulgare [barley]
gb|AEN70918.1|  lipid transfer protein                                75.5    6e-14   
gb|ABY21307.1|  pollen allergen Pla o 3                               75.5    6e-14   Platanus orientalis
gb|AAA86694.1|  phospholipid transfer protein precursor               75.5    6e-14   Hordeum vulgare [barley]
prf||2115353B  lipid transfer protein                                 75.5    6e-14
gb|AGN56422.1|  non-specific lipid transfer protein 2                 75.5    7e-14   
gb|AGW21344.1|  lipid transfer protein                                75.5    7e-14   
gb|AGN56421.1|  non-specific lipid transfer protein 1                 75.5    7e-14   
gb|ABK21288.1|  unknown                                               75.5    7e-14   Picea sitchensis
ref|XP_002270970.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    8e-14   Vitis vinifera
sp|Q43871.1|NLTP8_HORVU  RecName: Full=Non-specific lipid-transfe...  75.1    8e-14   Hordeum vulgare [barley]
gb|KEH29195.1|  Lipid transfer protein                                76.3    8e-14   
gb|ABA33867.1|  phospholipid transfer protein 1                       75.1    9e-14   Zea diploperennis [chapule]
ref|NP_001105392.1|  phospholipid transfer protein precursor          75.1    9e-14   Zea mays [maize]
ref|NP_181387.1|  non-specific lipid-transfer protein 2               75.1    9e-14   Arabidopsis thaliana [mouse-ear cress]
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               75.1    9e-14   
gb|ADR66948.1|  non-specific lipid transfer protein                   75.1    9e-14   
gb|ABA33859.1|  phospholipid transfer protein 1                       75.1    9e-14   Zea diploperennis [chapule]
gb|ACJ62361.1|  lipid-transfer protein                                75.1    9e-14   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CBI18043.3|  unnamed protein product                              75.5    1e-13   
gb|AFR31532.1|  lipid transfer protein                                74.7    1e-13   
dbj|BAJ91878.1|  predicted protein                                    74.7    1e-13   
gb|AGW21333.1|  lipid transfer protein                                74.7    1e-13   
gb|AGH27864.1|  lipid transfer protein precursor                      74.7    1e-13   
gb|AEN70916.1|  lipid transfer protein                                74.7    1e-13   
gb|ACJ62320.1|  lipid-transfer protein                                74.7    1e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62316.1|  lipid-transfer protein                                74.7    1e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33849.1|  phospholipid transfer protein 1                       74.7    1e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACG30522.1|  nonspecific lipid-transfer protein 1 precursor        74.7    1e-13   Zea mays [maize]
gb|ABA33850.1|  phospholipid transfer protein 1                       74.7    1e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33847.1|  phospholipid transfer protein 1                       74.7    1e-13   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105311.1|  non-specific lipid-transfer protein precursor    74.7    1e-13   Zea mays [maize]
emb|CAL07989.1|  lipid transfer protein                               74.3    1e-13   Platanus x hispanica [London plane tree]
gb|KHG21711.1|  Non-specific lipid-transfer                           74.7    1e-13   
gb|AGH32497.1|  non-specific lipid transfer protein                   74.3    1e-13   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  74.3    1e-13   Prunus dulcis [sweet almond]
gb|ADR66953.1|  non-specific lipid transfer protein                   74.3    1e-13   
gb|AAV40850.1|  lipid transfer protein 1 precursor                    74.3    1e-13   Prunus persica
gb|ABA33858.1|  phospholipid transfer protein 1                       74.3    1e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAF14232.1|AF109195_1  lipid transfer protein                      74.3    2e-13   Hordeum vulgare [barley]
ref|XP_009372010.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    2e-13   
gb|ABA33860.1|  phospholipid transfer protein 1                       73.9    2e-13   Zea diploperennis [chapule]
ref|XP_010558406.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    2e-13   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  74.3    2e-13   Ricinus communis
gb|ABA33854.1|  phospholipid transfer protein 1                       74.3    2e-13   Zea mays subsp. parviglumis [Balsas teosinte]
dbj|BAC77694.1|  lipid transfer protein                               74.3    2e-13   Atriplex nummularia
gb|ABA33866.1|  phospholipid transfer protein 1                       73.9    2e-13   Zea diploperennis [chapule]
gb|ABA33853.1|  phospholipid transfer protein 1                       73.9    2e-13   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_009135090.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    2e-13   
emb|CDM80997.1|  unnamed protein product                              73.9    2e-13   
gb|AEN70919.1|  lipid transfer protein                                73.9    2e-13   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    73.9    3e-13   Gossypium hirsutum [American cotton]
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    3e-13   
gb|ABA33855.1|  phospholipid transfer protein 1                       73.9    3e-13   Zea mays subsp. parviglumis [Balsas teosinte]
pdb|1FK0|A  Chain A, Structural Basis Of Non-Specific Lipid Bindi...  73.2    3e-13   
gb|ADR66949.1|  non-specific lipid transfer protein                   73.6    3e-13   
ref|XP_004245221.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    3e-13   
gb|AAL27855.1|  lipid transfer protein precursor                      73.6    3e-13   Davidia involucrata
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  72.8    3e-13   
ref|XP_007134674.1|  hypothetical protein PHAVU_010G066400g           73.6    3e-13   
gb|EMS55040.1|  Non-specific lipid-transfer protein 4.1               74.7    4e-13   
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    4e-13   
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  73.2    4e-13   Hordeum vulgare [barley]
gb|AEN70915.1|  lipid transfer protein                                73.2    4e-13   
gb|AAB70539.1|  lipid transfer protein LPT II                         73.2    4e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_009399315.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    5e-13   
gb|KHG30577.1|  Non-specific lipid-transfer                           73.2    5e-13   
gb|ABA33846.1|  phospholipid transfer protein 1                       73.2    5e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT68262.1|  lipid transfer protein                                73.2    5e-13   Nicotiana glauca [glaucous tobacco]
gb|AAT80650.1|  lipid transfer protein precursor                      72.8    5e-13   Malus domestica [apple tree]
ref|XP_009146980.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    5e-13   
ref|XP_006367725.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    5e-13   
emb|CDY32650.1|  BnaA02g07120D                                        72.8    5e-13   
gb|ACJ62339.1|  lipid-transfer protein                                72.8    5e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62323.1|  lipid-transfer protein                                72.8    6e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62315.1|  lipid-transfer protein                                72.8    6e-13   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004492086.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    6e-13   
emb|CDY00655.1|  BnaC03g36390D                                        72.8    6e-13   
ref|XP_002872988.1|  predicted protein                                72.8    6e-13   
gb|ACJ62355.1|  lipid-transfer protein                                72.4    6e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADK60918.1|  lipid transfer protein                                72.8    6e-13   
ref|XP_003605309.1|  Non-specific lipid-transfer protein              77.0    6e-13   
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  72.8    6e-13   
emb|CAB96876.2|  pru p 1                                              72.0    6e-13   Prunus persica
sp|P81651.2|NLTP1_PRUAR  RecName: Full=Non-specific lipid-transfe...  72.0    6e-13   Prunus armeniaca
gb|KDP22770.1|  hypothetical protein JCGZ_00357                       72.4    7e-13   
gb|ABA33848.1|  phospholipid transfer protein 1                       72.4    7e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AEN70933.1|  lipid transfer protein                                72.8    7e-13   
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  72.0    7e-13   
ref|XP_003516421.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    7e-13   
ref|XP_008370253.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    7e-13   
gb|AAT80652.1|  lipid transfer protein precursor                      72.4    7e-13   Malus domestica [apple tree]
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    7e-13   
gb|ACJ62319.1|  lipid-transfer protein                                72.4    7e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62318.1|  lipid-transfer protein                                72.4    7e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACG40474.1|  nonspecific lipid-transfer protein 2 precursor        72.4    8e-13   Zea mays [maize]
gb|AFR43295.1|  lipid transfer protein precursor                      72.4    8e-13   
gb|ACL01093.1|  lipid transfer protein                                72.4    9e-13   Castanea mollissima
gb|ACJ62342.1|  lipid-transfer protein                                72.4    9e-13   Zea mays subsp. parviglumis [Balsas teosinte]
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  71.6    9e-13   Prunus persica
gb|AAY43801.1|  FSLTP3                                                72.0    9e-13   Gossypium hirsutum [American cotton]
gb|ABA33857.1|  phospholipid transfer protein 1                       72.0    9e-13   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CAN70512.1|  hypothetical protein VITISV_005630                   72.0    1e-12   Vitis vinifera
ref|XP_007134675.1|  hypothetical protein PHAVU_010G066500g           72.0    1e-12   
gb|ADY68820.1|  lipid transfer protein 3                              72.0    1e-12   
gb|ACG29829.1|  nonspecific lipid-transfer protein 1 precursor        72.0    1e-12   Zea mays [maize]
gb|ABB90546.1|  lipid transfer protein                                72.0    1e-12   Triticum aestivum [Canadian hard winter wheat]
gb|ABA34092.1|  phospholipid transfer protein 2                       72.0    1e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|EMS57993.1|  Non-specific lipid-transfer protein 4.1               72.0    1e-12   
gb|AFR43294.1|  lipid transfer protein precursor                      72.0    1e-12   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            72.0    1e-12   Gossypium hirsutum [American cotton]
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    1e-12   
ref|XP_009757911.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   
ref|XP_008388344.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    1e-12   
ref|XP_008461223.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   
sp|Q43748.1|NLTP_BETVU  RecName: Full=Non-specific lipid-transfer...  71.6    1e-12   Beta vulgaris [beet]
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   
gb|AAT68264.1|  lipid transfer protein                                71.6    1e-12   Nicotiana glauca [glaucous tobacco]
emb|CDX73941.1|  BnaA03g31060D                                        71.6    1e-12   
sp|Q03461.1|NLTP2_TOBAC  RecName: Full=Non-specific lipid-transfe...  71.6    1e-12   Nicotiana tabacum [American tobacco]
gb|KHN29530.1|  Non-specific lipid-transfer protein 3                 71.6    1e-12   
ref|NP_001067782.1|  Os11g0427800                                     71.6    1e-12   Oryza sativa Japonica Group [Japonica rice]
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  71.6    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABA34089.1|  phospholipid transfer protein 2                       71.6    1e-12   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   
ref|NP_001176316.1|  Os11g0115466                                     71.6    2e-12   
gb|ABA33856.1|  phospholipid transfer protein 1                       71.6    2e-12   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006407743.1|  hypothetical protein EUTSA_v10021759mg           71.2    2e-12   
ref|NP_001065986.1|  Os12g0115000                                     71.2    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002442775.1|  hypothetical protein SORBIDRAFT_08g002680        71.2    2e-12   Sorghum bicolor [broomcorn]
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   71.2    2e-12   
gb|AAB70538.1|  lipid transfer protein                                71.2    2e-12   Oryza sativa [red rice]
gb|ABE11609.1|  lipid-transfer protein precursor                      71.2    2e-12   Solanum chacoense
sp|Q43194.1|NLTP2_SORBI  RecName: Full=Non-specific lipid-transfe...  71.2    2e-12   Sorghum bicolor [broomcorn]
gb|AAA74624.1|  lipid transfer protein precursor                      71.2    2e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_010683516.1|  PREDICTED: non-specific lipid-transfer protein   71.2    2e-12   
emb|CAH04986.1|  type 1 non-specific lipid transfer protein precu...  70.9    2e-12   Triticum aestivum [Canadian hard winter wheat]
gb|AET05730.1|  lipid transfer protein isoform a                      70.5    2e-12   
emb|CDM80964.1|  unnamed protein product                              70.9    2e-12   
gb|ADR66945.1|  non-specific lipid transfer protein                   70.9    2e-12   
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  70.9    2e-12   Pyrus communis
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor   70.9    3e-12   
gb|ACJ62326.1|  lipid-transfer protein                                70.9    3e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AGC08426.1|  lipid transfer protein                                70.9    3e-12   
gb|AAT80665.1|  lipid transfer protein precursor                      70.9    3e-12   Malus domestica [apple tree]
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            70.9    3e-12   Gossypium hirsutum [American cotton]
sp|Q42762.1|NLTP1_GOSHI  RecName: Full=Non-specific lipid-transfe...  70.9    3e-12   Gossypium hirsutum [American cotton]
ref|XP_009764784.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    3e-12   
ref|XP_009346911.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    3e-12   
sp|Q43129.1|NLTP2_GOSHI  RecName: Full=Non-specific lipid-transfe...  70.9    3e-12   Gossypium hirsutum [American cotton]
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   70.9    3e-12   
gb|AAY43800.1|  FSLTP2                                                70.9    3e-12   Gossypium hirsutum [American cotton]
gb|EYU42011.1|  hypothetical protein MIMGU_mgv1a016819mg              70.5    3e-12   
gb|ABF06565.1|  non-specific lipid transfer-like protein              70.5    3e-12   Prosopis juliflora [algorrobo]
gb|KDP21875.1|  hypothetical protein JCGZ_00662                       70.9    3e-12   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           70.5    3e-12   
gb|ACE80968.1|  putative allergen Pru du 3.03                         70.5    3e-12   Prunus dulcis x Prunus persica
ref|XP_009797052.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
ref|XP_002442776.1|  hypothetical protein SORBIDRAFT_08g002690        70.5    3e-12   Sorghum bicolor [broomcorn]
ref|XP_009626829.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    4e-12   
ref|XP_008662435.1|  PREDICTED: non-specific lipid-transfer protein   70.5    4e-12   
gb|AEN70936.1|  lipid transfer protein                                70.5    4e-12   
gb|ABA33862.1|  phospholipid transfer protein 1                       70.1    4e-12   Zea diploperennis [chapule]
gb|KDO49688.1|  hypothetical protein CISIN_1g033151mg                 70.5    4e-12   
sp|Q43875.1|NLT42_HORVU  RecName: Full=Non-specific lipid-transfe...  70.5    4e-12   Hordeum vulgare [barley]
emb|CAC86258.1|  lipid transfer protein                               70.5    4e-12   Fragaria x ananassa
sp|Q42842.1|NLT43_HORVU  RecName: Full=Non-specific lipid-transfe...  70.1    4e-12   Hordeum vulgare [barley]
gb|KHG10481.1|  Non-specific lipid-transfer 3                         70.9    4e-12   
ref|XP_003605349.1|  Non-specific lipid-transfer protein              70.1    4e-12   
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      70.1    4e-12   Nicotiana glauca [glaucous tobacco]
ref|XP_009757912.1|  PREDICTED: uncharacterized protein LOC104210662  72.4    4e-12   
gb|AAM22768.1|  lipid transfer protein                                69.7    5e-12   Prunus persica
gb|KDP21874.1|  hypothetical protein JCGZ_00661                       70.1    5e-12   
ref|XP_010553199.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    5e-12   
gb|EMS48312.1|  Non-specific lipid-transfer protein 4.3               69.7    5e-12   
emb|CBW38504.1|  lipid transfer protein                               69.7    5e-12   
prf||2115353A  lipid transfer protein                                 70.1    5e-12
ref|XP_004506486.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    5e-12   
ref|XP_010486423.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    5e-12   
gb|ACE80969.1|  putative allergen Pru p 3.03                          70.1    5e-12   Prunus dulcis x Prunus persica
gb|KDO49687.1|  hypothetical protein CISIN_1g033151mg                 70.1    5e-12   
gb|AET05731.1|  lipid transfer protein isoform b                      69.3    5e-12   
emb|CAH04987.1|  type 1 non-specific lipid transfer protein precu...  70.1    6e-12   Triticum aestivum [Canadian hard winter wheat]
gb|AFX65219.1|  lipid transfer precursor protein                      70.1    6e-12   
ref|XP_003579021.1|  PREDICTED: probable non-specific lipid-trans...  70.1    6e-12   
gb|EMS62142.1|  Non-specific lipid-transfer protein 4.3               69.3    6e-12   
ref|XP_006367395.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    6e-12   
ref|XP_009112488.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    6e-12   
gb|AAT80649.1|  lipid transfer protein precursor                      69.7    6e-12   Malus domestica [apple tree]
gb|ABA34080.1|  phospholipid transfer protein 2                       69.7    7e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AER92599.1|  putative lipid transfer protein                       69.7    7e-12   
ref|XP_009797053.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    7e-12   
gb|ABA34083.1|  phospholipid transfer protein 2                       69.7    8e-12   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   69.3    8e-12   
gb|AAT80663.1|  lipid transfer protein precursor                      69.3    8e-12   Malus domestica [apple tree]
ref|XP_006355279.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    8e-12   
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein         69.3    8e-12   Retama raetam [retem]
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    69.3    8e-12   
ref|XP_007140137.1|  hypothetical protein PHAVU_008G087100g           70.9    9e-12   
gb|AFR43288.1|  lipid transfer protein precursor                      69.3    9e-12   
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    9e-12   
gb|AAG27707.1|AF302788_1  lipid transfer protein precursor            69.3    9e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010035998.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    9e-12   
gb|AGC08428.1|  lipid transfer protein                                69.3    9e-12   
dbj|BAH03575.1|  nonspecific lipid transfer protein                   69.3    9e-12   Citrus jambhiri [citronelle]
gb|KHG13955.1|  Non-specific lipid-transfer 1                         69.3    1e-11   
pir||S33460  lipid transfer protein - sorghum (fragment)              68.6    1e-11
gb|AAK20395.1|AF334185_1  lipid transfer protein precursor            68.9    1e-11   Triticum aestivum [Canadian hard winter wheat]
gb|ABY54820.1|  lipid transfer protein                                68.9    1e-11   
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            68.9    1e-11   
emb|CDM80995.1|  unnamed protein product                              68.9    1e-11   
ref|XP_010922738.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-11   
gb|ACM78614.1|  lipid transfer protein 2                              68.9    1e-11   Tamarix hispida
gb|ABF14723.1|  non-specific lipid transfer protein 1 precursor       68.9    1e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007206160.1|  hypothetical protein PRUPE_ppa013558mg           68.9    1e-11   
ref|XP_003605294.1|  Non-specific lipid-transfer protein              68.9    1e-11   
ref|XP_003605345.1|  Non-specific lipid-transfer protein              68.9    1e-11   
gb|ABB96481.1|  non-specific lipid transfer protein precursor         68.9    1e-11   
gb|KDO49686.1|  hypothetical protein CISIN_1g033151mg                 68.9    1e-11   
gb|KHN44829.1|  Non-specific lipid-transfer protein 1                 70.1    1e-11   
ref|XP_006367394.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    1e-11   
emb|CDY60288.1|  BnaA09g52860D                                        68.6    1e-11   
ref|XP_010683517.1|  PREDICTED: non-specific lipid-transfer prote...  68.9    1e-11   
gb|EMT31304.1|  Non-specific lipid-transfer protein 3                 68.6    1e-11   
emb|CDY36007.1|  BnaA05g29430D                                        68.6    1e-11   
gb|KDO64078.1|  hypothetical protein CISIN_1g033544mg                 68.6    1e-11   
ref|XP_004514554.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
ref|XP_010690793.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
gb|AAR22488.1|  allergen Mal d 3                                      68.6    2e-11   
gb|AEN70935.1|  lipid transfer protein                                68.6    2e-11   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         68.6    2e-11   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       68.6    2e-11   
ref|XP_006355283.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           68.6    2e-11   
gb|AEI70827.1|  non-specific lipid-transfer protein                   68.6    2e-11   
emb|CDY27974.1|  BnaC05g43760D                                        68.2    2e-11   
gb|AEI70829.1|  non-specific lipid-transfer protein                   68.6    2e-11   
ref|XP_009126703.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
ref|XP_002528683.1|  Nonspecific lipid-transfer protein precursor...  68.2    2e-11   
gb|EMS52738.1|  Non-specific lipid-transfer protein 4.1               68.2    2e-11   
gb|AFI61838.1|  harmalin                                              68.2    2e-11   
gb|ABF74563.1|  lipid transfer protein                                68.2    2e-11   
ref|XP_010035997.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
gb|ACI47547.1|  nonspecific lipid transfer protein                    68.2    2e-11   
ref|XP_010043291.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
emb|CAH69191.1|  type 1 non specific lipid transfer protein precu...  68.2    2e-11   
ref|XP_009126702.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
gb|AFV30232.1|  lipid transfer protein                                68.2    2e-11   
ref|XP_009132019.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
gb|AFR43289.1|  lipid transfer protein precursor                      68.2    2e-11   
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
gb|AAV66924.1|  lipid transfer protein 4                              68.2    2e-11   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           68.2    2e-11   
gb|KEH29225.1|  Lipid transfer protein                                68.2    3e-11   
ref|XP_006429570.1|  hypothetical protein CICLE_v10013139mg           68.2    3e-11   
ref|XP_004506487.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    3e-11   
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  68.2    3e-11   
gb|AII99871.1|  protease inhibitor/seed storage/ltp family            68.2    3e-11   
dbj|BAI94496.1|  lipid transfer protein                               67.8    3e-11   
ref|NP_195807.1|  pathogenesis-related lipid transfer protein         67.8    3e-11   
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           67.8    3e-11   
ref|XP_006842467.1|  hypothetical protein AMTR_s00077p00070120        68.2    3e-11   
gb|AFX66972.1|  non-specific lipid transfer protein 2                 67.8    3e-11   
sp|P85105.1|NLTP5_VITSX  RecName: Full=Non-specific lipid-transfe...  67.0    3e-11   
gb|EMS55912.1|  Non-specific lipid-transfer protein 4.1               67.8    3e-11   
gb|AAC63372.1|  lipid transfer protein                                67.8    3e-11   
ref|XP_003516420.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    3e-11   
emb|CBW38503.1|  lipid transfer protein                               67.4    3e-11   
ref|XP_010464583.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    3e-11   
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  67.8    4e-11   
pir||JH0379  phospholipid transfer protein 6B6 - maize (fragment)     67.0    4e-11
ref|XP_009141745.1|  PREDICTED: non-specific lipid-transfer prote...  67.8    4e-11   
emb|CAH69197.1|  type 1 non specific lipid transfer protein precu...  67.8    4e-11   
gb|ABX56711.1|  LTP isoallergen 1 precursor                           67.4    4e-11   
ref|XP_010464489.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    4e-11   
ref|XP_006407744.1|  hypothetical protein EUTSA_v10021759mg           67.8    4e-11   
gb|AAT68263.1|  lipid transfer protein                                67.4    4e-11   
dbj|BAK05317.1|  predicted protein                                    67.4    4e-11   
ref|NP_001275027.1|  non-specific lipid transfer protein a7 precu...  67.4    4e-11   
ref|NP_568904.1|  non-specific lipid-transfer protein 4               67.4    4e-11   
dbj|BAF46309.1|  lipid transfer protein 3 precursor                   67.4    4e-11   
gb|AAR83849.1|  nonspecific lipid transfer protein 2 precursor        67.4    4e-11   
gb|ACN11576.1|  lipid transfer protein 3 precursor                    67.4    4e-11   
emb|CDX71121.1|  BnaC03g12050D                                        67.4    4e-11   
gb|ABA34098.1|  phospholipid transfer protein 2                       67.4    4e-11   
gb|AES87491.2|  Lipid transfer protein                                67.4    4e-11   
ref|XP_009132605.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    4e-11   
dbj|BAO51648.1|  lipid transfer protein                               67.4    5e-11   
emb|CDY02883.1|  BnaC02g10060D                                        67.0    5e-11   
ref|NP_001236948.1|  uncharacterized protein LOC100306062 precursor   67.4    5e-11   
gb|AEN70917.1|  lipid transfer protein                                67.4    5e-11   
gb|ABA91221.2|  Nonspecific lipid-transfer protein 1 precursor, p...  67.4    5e-11   
emb|CDY32649.1|  BnaA02g07110D                                        67.0    5e-11   
ref|NP_001065583.1|  Os11g0115400                                     67.4    5e-11   
pir||EPRZ  phospholipid transfer protein homolog - rice               66.6    5e-11
ref|XP_010517148.1|  PREDICTED: non-specific lipid-transfer prote...  67.4    5e-11   
ref|XP_007033545.1|  Non-specific lipid-transfer protein isoform 1    67.4    5e-11   
emb|CBW38499.1|  lipid transfer protein                               66.6    5e-11   
sp|P07597.1|NLTP1_HORVU  RecName: Full=Non-specific lipid-transfe...  67.0    5e-11   
ref|XP_008244970.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    5e-11   
ref|XP_002442774.1|  hypothetical protein SORBIDRAFT_08g002670        67.4    5e-11   
gb|ABA34094.1|  phospholipid transfer protein 2                       67.0    6e-11   
ref|XP_007134821.1|  hypothetical protein PHAVU_010G079000g           67.0    6e-11   
ref|NP_001065987.1|  Os12g0115100                                     67.0    6e-11   
emb|CAH69188.1|  type 1 non specific lipid transfer protein precu...  67.0    6e-11   
ref|XP_006362360.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    6e-11   
gb|KCW47519.1|  hypothetical protein EUGRSUZ_K01282                   67.0    6e-11   
emb|CDX72398.1|  BnaC07g44200D                                        67.0    6e-11   
gb|AAB70541.1|  lipid transfer protein LPT IV                         67.0    6e-11   
gb|KHN44830.1|  Non-specific lipid-transfer protein                   67.0    6e-11   
ref|XP_010277659.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    7e-11   
gb|AGH32496.1|  non-specific lipid transfer protein                   66.6    7e-11   
gb|ABA34096.1|  phospholipid transfer protein 2                       66.6    7e-11   
sp|P80273.2|NLTP3_VITSX  RecName: Full=Non-specific lipid-transfe...  66.2    7e-11   
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    7e-11   
gb|KFK34405.1|  non-specific lipid transfer protein                   66.6    8e-11   
gb|AAX20049.1|  putative non-specific lipid transfer protein          66.6    8e-11   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  66.2    8e-11   
emb|CAB96874.1|  mal d 3                                              65.9    8e-11   
ref|XP_009372014.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    8e-11   
gb|AAD09107.1|  nonspecific lipid-transfer protein precursor          66.6    8e-11   
emb|CDM80963.1|  unnamed protein product                              66.6    9e-11   
emb|CDX93316.1|  BnaC04g45800D                                        66.6    9e-11   
ref|XP_011095131.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    9e-11   
gb|AAS13435.1|  lipid-transfer protein                                66.6    9e-11   
ref|XP_006429566.1|  hypothetical protein CICLE_v10013119mg           66.6    9e-11   
gb|ADE77948.1|  unknown                                               67.0    9e-11   
ref|XP_002511596.1|  Nonspecific lipid-transfer protein A, putative   66.2    9e-11   
gb|AEI70828.1|  non-specific lipid-transfer protein                   66.2    9e-11   
ref|XP_002283359.2|  PREDICTED: non-specific lipid-transfer prote...  66.2    9e-11   
ref|XP_004249042.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
emb|CBW38498.1|  lipid transfer protein                               65.9    1e-10   
ref|NP_001234735.1|  non-specific lipid transfer protein precursor    66.2    1e-10   
emb|CDY18379.1|  BnaA04g22080D                                        66.2    1e-10   
gb|AAY83343.1|  non-specific lipid transfer protein precursor         66.2    1e-10   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  66.2    1e-10   
ref|NP_001060928.1|  Os08g0131200                                     66.2    1e-10   
ref|XP_009616321.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
ref|XP_007134822.1|  hypothetical protein PHAVU_010G079000g           66.2    1e-10   
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
gb|KHN29511.1|  Non-specific lipid-transfer protein                   66.2    1e-10   
gb|ABH03042.1|  non-specific lipid transfer protein                   66.2    1e-10   
dbj|BAP11226.1|  hypothetical protein                                 65.9    1e-10   
ref|XP_003522128.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
emb|CDY51220.1|  BnaC09g09750D                                        66.2    1e-10   
ref|XP_007206148.1|  hypothetical protein PRUPE_ppa013428mg           66.2    1e-10   
gb|AAM22767.2|  lipid transfer protein 2 precursor                    66.2    1e-10   
gb|EMS59737.1|  Non-specific lipid-transfer protein 4.1               66.2    1e-10   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
ref|NP_001234074.1|  non-specific lipid-transfer protein 1 precursor  65.9    1e-10   
emb|CBW38501.1|  lipid transfer protein                               65.9    1e-10   
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  66.2    1e-10   
gb|ACB05670.1|  putative non-specific lipid transfer protein          65.9    1e-10   
emb|CDY38865.1|  BnaA03g13140D                                        65.9    1e-10   
gb|AAF23460.1|AF208834_1  non-specific lipid transfer protein pre...  65.9    1e-10   
gb|AEI70830.1|  non-specific lipid-transfer protein                   65.9    1e-10   
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
emb|CDY68127.1|  BnaC03g71570D                                        66.2    1e-10   
gb|AGV40202.1|  nonspecific lipid-transfer protein 1                  66.2    1e-10   
sp|O24418.1|NLTP6_GOSHI  RecName: Full=Non-specific lipid-transfe...  65.9    1e-10   
sp|Q43304.1|NLTPD_BRAOT  RecName: Full=Non-specific lipid-transfe...  65.9    1e-10   
ref|XP_007134820.1|  hypothetical protein PHAVU_010G079000g           66.2    1e-10   
ref|XP_006662672.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|AFR43292.1|  lipid transfer protein precursor                      65.9    1e-10   
sp|Q42641.1|NLTPA_BRAOT  RecName: Full=Non-specific lipid-transfe...  65.9    1e-10   
gb|AGV40203.1|  nonspecific lipid-transfer protein 2                  65.9    2e-10   
ref|XP_010043282.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    2e-10   
ref|XP_010443683.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    2e-10   
gb|AFM39014.1|  lipid transfer protein                                65.9    2e-10   
emb|CBW38497.1|  lipid transfer protein                               65.5    2e-10   
emb|CAA42832.1|  LTP 1                                                66.2    2e-10   
ref|XP_008244911.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    2e-10   
ref|XP_003522131.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    2e-10   
dbj|BAK05751.1|  predicted protein                                    65.9    2e-10   
gb|AAY83345.1|  non-specific lipid transfer protein precursor         65.9    2e-10   
sp|Q84N29.1|NLTP3_WHEAT  RecName: Full=Probable non-specific lipi...  65.9    2e-10   
ref|XP_006429568.1|  hypothetical protein CICLE_v10012953mg           66.6    2e-10   
gb|ABA96286.1|  Nonspecific lipid-transfer protein 3 precursor, p...  65.9    2e-10   
ref|NP_001118321.1|  non-specific lipid-transfer protein 7            65.9    2e-10   
ref|XP_009143379.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
ref|XP_011089414.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
gb|AHB19225.1|  non specific lipid transfer protein 1C                65.5    2e-10   
gb|AGH13363.1|  lipid transfer protein                                65.1    2e-10   
sp|O24038.1|NLTP2_SOLPN  RecName: Full=Non-specific lipid-transfe...  65.5    2e-10   
ref|XP_010043178.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
ref|XP_007134701.1|  hypothetical protein PHAVU_010G069100g           65.5    2e-10   
gb|AFK47623.1|  unknown                                               65.1    2e-10   
dbj|BAB09776.1|  lipid transfer protein-like                          65.1    2e-10   
emb|CAG28937.1|  lipid transfer protein                               65.5    2e-10   
emb|CAA80809.1|  lipid transfer protein                               65.5    2e-10   
ref|XP_002276372.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
gb|AAN75627.1|  lipid transfer protein 1 precursor                    65.1    2e-10   
emb|CAH69196.1|  type 1 non specific lipid transfer protein precu...  65.5    2e-10   
ref|XP_010253092.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-10   
ref|XP_006369490.1|  hypothetical protein POPTR_0001s23920g           65.1    2e-10   
ref|XP_006644921.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
ref|XP_010931360.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
gb|AHB19226.1|  non specific lipid transfer protein 1B                65.1    3e-10   
gb|EMS59740.1|  Non-specific lipid-transfer protein 4.1               65.1    3e-10   
ref|XP_009132002.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
emb|CAN72931.1|  hypothetical protein VITISV_020613                   65.1    3e-10   
emb|CAH69190.1|  type 1 non specific lipid transfer protein precu...  65.1    3e-10   
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  65.1    3e-10   
ref|XP_006346674.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
gb|AET05732.1|  lipid transfer protein isoform c                      64.3    3e-10   
ref|XP_006367397.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-10   
ref|XP_008350568.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
gb|AGC08421.1|  lipid transfer protein                                65.5    3e-10   
gb|KHN40624.1|  Non-specific lipid-transfer protein 3                 68.6    3e-10   
emb|CAH69207.1|  type 1 non specific lipid transfer protein precu...  64.7    3e-10   
gb|ADP37976.1|  lipid transfer protein                                64.7    3e-10   
dbj|BAP11221.1|  hypothetical protein                                 64.7    3e-10   
ref|XP_006298841.1|  hypothetical protein CARUB_v10014953mg           64.7    4e-10   
ref|XP_006362358.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-10   
ref|XP_006411067.1|  hypothetical protein EUTSA_v10017425mg           64.7    4e-10   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  64.7    4e-10   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       64.7    4e-10   
gb|EMT31305.1|  Non-specific lipid-transfer protein                   64.7    4e-10   
ref|XP_010443685.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-10   
gb|ABX75045.1|  LTP isoallergen 2                                     63.9    4e-10   
emb|CDY07725.1|  BnaA03g17860D                                        65.1    4e-10   
ref|XP_010509134.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-10   
gb|ACP43542.1|  lipid transfer protein                                64.7    4e-10   
ref|XP_010253093.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-10   
ref|XP_003564507.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-10   
ref|XP_010483551.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-10   
ref|XP_008388341.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    4e-10   
gb|AAT68265.1|  lipid transfer protein precursor                      64.3    4e-10   
emb|CDY46122.1|  BnaA03g52460D                                        64.7    4e-10   
ref|XP_004970395.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-10   
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              64.3    4e-10   
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   64.7    5e-10   
ref|XP_010529934.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    5e-10   
gb|AHB19227.1|  non specific lipid transfer protein 1A                64.3    5e-10   
gb|ACZ06858.1|  lipid transfer protein                                64.7    5e-10   
sp|Q3YMR2.1|NLTP2_SOLCI  RecName: Full=Non-specific lipid-transfe...  64.3    5e-10   
gb|AGN56423.1|  non-specific lipid transfer protein 3                 63.9    5e-10   



>sp|A0AT28.1|NLTP1_LENCU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Flags: Precursor [Lens culinaris]
 gb|AAX35806.1| lipid transfer protein 1 precursor [Lens culinaris]
Length=118

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            ++  +  L CMVV+    A+ AI C  V   L+PCLTY+ GG  G +P CC GV+ L  A
Sbjct  5    RVSCLVALMCMVVISAPMAEAAISCGTVSGALVPCLTYLKGG-PGPSPQCCGGVKRLNGA  63

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            A T  DRRAAC CLKS+AGSI +G   G  A  L  +C V+LPYTIS STNC+TI 
Sbjct  64   ARTTIDRRAACNCLKSSAGSI-SGLKPGNVA-TLPGKCGVRLPYTISTSTNCNTIR  117



>ref|XP_004492085.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cicer 
arietinum]
Length=120

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 72/116 (62%), Gaps = 4/116 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            I  +A++ CM+++       AI CS+V  ++ PCL Y+ GG+S  +  CCDGV  L + A
Sbjct  7    ITCMAMMICMMLISSPMVVNAISCSEVIEEIEPCLEYLRGGSSAPSRECCDGVNRLNHIA  66

Query  409  ataddrraACQCLKSAAGSIPAGADVGT-AAKNLLRQCNVKLPYTISVSTNCDTIN  245
             T   RR  C+CLKSAA SI   +D+ T  A+ L R+C VKLPY IS ST+C+ I 
Sbjct  67   DTTSARRTTCECLKSAAYSI---SDLNTNHAEELPRRCGVKLPYRISTSTDCNRIR  119



>ref|XP_006295252.1| hypothetical protein CARUB_v10024340mg [Capsella rubella]
 gb|EOA28150.1| hypothetical protein CARUB_v10024340mg [Capsella rubella]
Length=118

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 6/120 (5%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPS-CCDGVR  428
            MA +  +A   LACM+V   + AD A+ C  V S+L PC+ Y+M G  GV P+ CC GVR
Sbjct  1    MAGVMKLACLFLACMIVAGPITADAALSCGAVTSNLAPCIGYVMQG--GVIPAGCCTGVR  58

Query  427  NLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            NL N A T  DR+ AC CL++ A S+ AG + G AA  + + C V +PY IS STNC T+
Sbjct  59   NLNNMARTTPDRQQACTCLQNTARSLGAGLNAGRAA-GIPKACGVNIPYKISTSTNCKTV  117



>ref|XP_010505484.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A   LACM+V   + A+ A+ C  V S+L PC+ Y+M G + + P+CC+GVRN
Sbjct  1    MAGVMKLACLFLACMIVAGPITANAALSCGAVSSNLAPCIGYVMQGGA-IPPACCNGVRN  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L + A T  DR+ AC C++S A ++ +G + G AA  + + C V +PY IS STNC T+
Sbjct  60   LNSMARTTPDRQQACNCIQSVARNLGSGVNAGRAA-GIPKSCGVNIPYKISTSTNCKTV  117



>sp|A0AT29.1|NLTP2_LENCU RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP2; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
7; Short=LTP7; Flags: Precursor [Lens culinaris]
 gb|AAX35807.1| lipid transfer protein 2 precursor [Lens culinaris]
Length=118

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K+  V L+ CMVV+  + A+GAI C  V SDL PCLTY+ GG  G +P CC GV+ L  A
Sbjct  6    KLACVVLVICMVVIAPM-AEGAISCGAVTSDLSPCLTYLTGG-PGPSPQCCGGVKKLLAA  63

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            A T  DR+AAC CLKSAAGSI        AA  L  +C V +PY IS +TNC+T+
Sbjct  64   ANTTPDRQAACNCLKSAAGSITKLNTNNAAA--LPGKCGVNIPYKISTTTNCNTV  116



>ref|XP_010509136.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Camelina sativa]
 ref|XP_010509137.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Camelina sativa]
Length=118

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A   LACM+V   + A+ A+ C  V S+L PC+ Y+M G   + P+CC+GVRN
Sbjct  1    MAGVMKLACLFLACMIVAGPITANAALSCGAVSSNLAPCIGYVMQGGV-IPPACCNGVRN  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L + A T  DR+ AC C++S A ++ +G + G AA  + + C V +PY IS STNC T+
Sbjct  60   LNSMARTTPDRQQACNCIQSVARNLGSGVNAGRAA-GIPKSCGVNIPYKISTSTNCKTV  117



>gb|KFK36745.1| hypothetical protein AALP_AA4G164400 [Arabis alpina]
Length=118

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A  + ACM+V   + ++ A+ C  V S + PC+ YI+ G + VTP CC+G+R 
Sbjct  1    MAGLMKLACLVFACMIVAGPITSNAALGCGQVNSAVAPCIGYILQGGA-VTPGCCNGIRR  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L  AA T  DR+AACQCLK+AA ++  G + G AA  L R C V +P+ IS STNC+ +
Sbjct  60   LNGAARTTPDRKAACQCLKNAAAALGPGLNAGRAA-GLPRACGVSVPFPISTSTNCNNV  117



>gb|AFK36168.1| unknown [Lotus japonicus]
Length=115

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 3/117 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLK  419
            MA ++ V  L  + +++   A+ AI C  + S L+PC  YI GGA G +P CC GVR + 
Sbjct  1    MASVKFVCALVVLSMVVAPMAEAAITCGAIASALIPCTAYIQGGA-GPSPPCCAGVRRVN  59

Query  418  NaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            +AA++  DRRAAC CLKSAAGS P   + G AA +L  +C V +PY IS STNC  I
Sbjct  60   SAASSTADRRAACNCLKSAAGSFPR-FNAGNAA-SLPGKCGVNIPYKISTSTNCANI  114



>ref|XP_010683515.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 4/111 (4%)
 Frame = -3

Query  577  ALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatad  398
            A L CM+V+   HA+ A+ C  V S L+PCL Y+ GGAS  +P+CC G+++L + A+T  
Sbjct  10   ATLMCMLVV-APHAEAAVTCGQVTSSLLPCLGYLQGGAS-PSPACCGGIKSLNSMASTPA  67

Query  397  drraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            DR+ AC CLKSAA S+  G D+ +AA  L  +C+V +PY IS ST+C  +N
Sbjct  68   DRKTACGCLKSAAASV-KGIDM-SAASGLPGKCDVSIPYPISTSTDCSKVN  116



>ref|XP_010529176.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=117

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 77/119 (65%), Gaps = 5/119 (4%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA + ++A  +LACMV+   + AD  I C  V S L PC++Y+  G + V P+CC GVR 
Sbjct  1    MAGVMNLACLVLACMVLAGPMVADAQIGCGSVTSSLAPCISYLTRGGA-VPPACCAGVRR  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L +AA +   R+AAC+CL+SAA +IP G + G AA  L R C V +PY IS STNC+ +
Sbjct  60   LNSAANSTPARQAACRCLQSAARNIP-GLNQG-AASGLPRACGVNVPYPISTSTNCNNV  116



>ref|XP_004516173.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cicer 
arietinum]
Length=118

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (65%), Gaps = 3/116 (3%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            ++  V  L CMVV+    A+ A+ C  + S L+PC++Y+ GG  G + SCC GV+ +  A
Sbjct  5    RVACVVALMCMVVVSAPMAEAAVSCGSITSALVPCISYLKGG-PGPSSSCCGGVKRVNAA  63

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            AAT  DRRAAC CLK+AAGSI +G   G AA  L  +C V +PY  S STNC++IN
Sbjct  64   AATTPDRRAACNCLKNAAGSI-SGLKAGNAAA-LPSKCGVNIPYKFSTSTNCNSIN  117



>ref|XP_009615065.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=125

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 75/121 (62%), Gaps = 4/121 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYV--HADGAIMCSDVQSDLMPCLTYIMGGASGVTPS-CCDGVR  428
            M K+ +   L CMVV+ +   HA+ AI CS V S+L PCL+Y+MG +    P+ CC G++
Sbjct  6    MQKVSACLFLLCMVVISFSSPHAEAAISCSTVYSNLAPCLSYLMGSSKQAAPAGCCSGIQ  65

Query  427  NLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            +L  AA+T  DR++ C CLK+ A S+ +  D   AA  LL +C V +PY IS + +C  +
Sbjct  66   SLYTAASTTADRQSVCSCLKAGAASLGSSIDTNKAA-TLLSKCGVTVPYKISPNIDCSKV  124

Query  247  N  245
            +
Sbjct  125  H  125



>ref|XP_010517149.1| PREDICTED: non-specific lipid-transfer protein 1 [Camelina sativa]
Length=118

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 73/119 (61%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A   LACM+V   + A+ A+ C  V S+L PC+ Y+M G   + P+CC GVRN
Sbjct  1    MAGVMKLACLFLACMIVAGPITANAALSCGAVNSNLGPCIGYVMQGGI-IPPACCTGVRN  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L + A T  DR+ AC C+++AA  +  G + G AA  + + C V +PY IS STNC T+
Sbjct  60   LNSMARTTPDRQQACSCIQNAARGLGGGLNAGRAA-GIPKACGVNIPYKISTSTNCKTV  117



>ref|XP_009757306.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=125

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 75/121 (62%), Gaps = 4/121 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYV--HADGAIMCSDVQSDLMPCLTYIMGGASGVTPS-CCDGVR  428
            M K+ +   L CMVV+ +   HA+ AI CS V S+L PCL+Y++GG+    P+ CC G++
Sbjct  6    MQKVSACLFLLCMVVISFSSPHAEAAISCSTVYSNLAPCLSYLIGGSKQAVPAGCCSGIQ  65

Query  427  NLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            +L  AA+T  DR++ C CLK+ A S+ +  D   AA  LL +C V +PY IS + +C  +
Sbjct  66   SLYTAASTTVDRQSVCSCLKAGAASLGSSIDANKAA-TLLNKCGVTVPYKISPNIDCSKV  124

Query  247  N  245
             
Sbjct  125  Q  125



>ref|XP_010509135.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 72/119 (61%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A   LACM+V   + A+ A+ C  V S+L PC+ Y++ G   + P+CC GVRN
Sbjct  1    MAGVMKLACLFLACMIVAGPITANAALSCGAVNSNLGPCIGYVLQGGV-IPPACCTGVRN  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L N A T  DR+ AC C+++ A  + AG + G  A  + + C V +PY IS STNC T+
Sbjct  60   LNNMARTTPDRQQACNCIQNVARGLGAGLNAGRVA-GIPKACGVNIPYKISTSTNCKTV  117



>ref|XP_002879751.1| hypothetical protein ARALYDRAFT_482863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56010.1| hypothetical protein ARALYDRAFT_482863 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A  +LACM+V   + ++ A+ C  V S+L PC+ Y++ G + +   CC GVRN
Sbjct  1    MAGVMKLACLVLACMIVAGPITSNAALSCGSVNSNLAPCIGYVLQGGT-IPAGCCSGVRN  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L N A T  DR+ AC C++ AA ++ +G + G AA  + + C V +PY IS STNC T+
Sbjct  60   LNNIAKTTPDRQQACNCIQGAARALGSGLNAGRAA-GIPKACGVNIPYKISTSTNCKTV  117



>ref|XP_008244937.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S+L PC+ Y++GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSNLAPCIPYVIGGGA-VPPACCNGIRNVDNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  +GSIP G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   NTTADRQAACNCLKQLSGSIP-GVNPNNAAS-LPGKCGVNIPYNISSSTNCATV  116



>sp|A0AT30.1|NLTP3_LENCU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP3; 
Flags: Precursor [Lens culinaris]
 gb|AAX35808.1| lipid transfer protein 3 precursor [Lens culinaris]
Length=118

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (67%), Gaps = 4/111 (4%)
 Frame = -3

Query  580  VALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaata  401
            VAL+ CMVV+  + A+ A+ C  V  DL PC+ Y+ GGA G T SCC GV+ L  AA T 
Sbjct  10   VALVMCMVVIAPM-AEAAVSCGTVTGDLAPCIPYLTGGA-GPTDSCCAGVKKLLAAAPTT  67

Query  400  ddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             DR+AAC CLK+AAG+I    + G AA  L  +CNV +PY IS +TNC+TI
Sbjct  68   ADRQAACNCLKTAAGNI-NNLNPGNAAA-LPGKCNVNIPYKISTTTNCNTI  116



>ref|XP_003605266.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES87463.1| Lipid transfer protein [Medicago truncatula]
Length=116

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            KI  V L+ CM+V     AD AI C  V S L PC+ Y+ GG  G +P+CC GV+ L  A
Sbjct  5    KIACVVLMMCMIV--APMADAAISCGTVTSALGPCIGYLKGG-PGPSPACCGGVKRLNGA  61

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLR-QCNVKLPYTISVSTNCDTIN  245
            AAT  DR+AAC CLK AAG+I   + + TAA + L  +C V +PY IS STNC TI 
Sbjct  62   AATTPDRQAACNCLKQAAGAI---SGLNTAAASALPGKCGVNIPYKISTSTNCATIR  115



>gb|AFK38461.1| unknown [Lotus japonicus]
Length=115

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 3/117 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLK  419
            MA ++ V  L  + +++   A+ AI C  + S L+PC  YI GGA G +P CC GVR + 
Sbjct  1    MASVKFVCALVVLSMVVAPMAEAAITCGAIVSALIPCTAYIQGGA-GPSPPCCAGVRRVN  59

Query  418  NaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            +AA++  DRRAAC CLKSAAGS  +  + G AA +L  +C V +PY IS STNC  I
Sbjct  60   SAASSTADRRAACNCLKSAAGSF-SRFNAGNAA-SLPGKCGVNIPYKISTSTNCANI  114



>gb|KFK36763.1| lipid transfer protein [Arabis alpina]
Length=119

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 75/117 (64%), Gaps = 4/117 (3%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A  +L CM+V   + ++ A+ C  V + + PC+ YI+ G + +T  CC+GVR 
Sbjct  1    MAGVMKLACLVLTCMIVAGPITSNAALGCGQVNNAVAPCIGYILQGGA-ITSGCCNGVRG  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCD  254
            L NAA T  DR+AACQCLK+AA ++  G + G AA  L R C V +P+ IS STNC+
Sbjct  60   LNNAARTTPDRKAACQCLKNAAAALGPGLNAGRAA-GLPRACGVSVPFPISTSTNCN  115



>gb|AAL25839.1| lipid transfer precursor protein [Hevea brasiliensis]
Length=116

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 8/121 (7%)
 Frame = -3

Query  598  MAKIQSVALLA-CMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTP--SCCDGVR  428
            MA ++ V+ L  CM+V   + A  AI C  VQS L+PCL+Y+    +G TP  +CC+GVR
Sbjct  1    MAALKMVSFLVLCMLVAAPMTAQ-AITCGQVQSALVPCLSYLK--TTGPTPPATCCNGVR  57

Query  427  NLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             + NAA T  DRR ACQCLKSAAGS+  G +  T A  L  +C V +PY IS+STNC T+
Sbjct  58   TINNAAKTTADRRTACQCLKSAAGSV-KGLNPTTVA-GLPGKCGVNIPYKISLSTNCATV  115

Query  247  N  245
             
Sbjct  116  K  116



>gb|AFK44274.1| unknown [Medicago truncatula]
Length=116

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K+  V L+ CM+V     AD AI C  V S L PC+ Y+ GG  G +P+CC GV+ L  A
Sbjct  5    KVACVVLMMCMIV--APMADAAISCGTVTSALGPCIGYLKGG-PGPSPACCGGVKRLNGA  61

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLR-QCNVKLPYTISVSTNCDTIN  245
            AAT  DR+AAC CLK AAG+I   + + TAA + L  +C V +PY IS STNC TI 
Sbjct  62   AATTPDRQAACNCLKQAAGAI---SGLNTAAASALPGKCGVNIPYKISTSTNCATIR  115



>ref|XP_010517150.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 72/119 (61%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A   LACM+V   + AD A+ C  V S+L PC+ Y++ G   + P+CC GVRN
Sbjct  1    MAGVMKLACLFLACMIVAGPITADAALSCGAVNSNLGPCIGYVLQGGV-IPPACCTGVRN  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L + A T  DR+ AC C+++ A  + +G + G  A  + + C V +PY IS STNC T+
Sbjct  60   LNSMARTTPDRQQACNCIQTVARGLGSGLNAGRVA-GIPKACGVNIPYKISTSTNCKTV  117



>sp|A0AT33.1|NLTP4_LENCU RecName: Full=Non-specific lipid-transfer protein 4; Short=LTP4; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
8; Short=LTP8; Flags: Precursor, partial [Lens culinaris]
 gb|AAX35811.1| lipid transfer protein 4 precursor, partial [Lens culinaris subsp. 
culinaris]
Length=110

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            A+GAI C  V SDL PCLTY+ GG  G +P CC GV+ L  AA T  DR+AAC CLKSAA
Sbjct  15   AEGAISCGAVTSDLSPCLTYLTGG-PGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAA  73

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            GSI        AA  L  +C V +PY IS STNC+T+
Sbjct  74   GSITKLNTNNAAA--LPGKCGVNIPYKISTSTNCNTV  108



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 75/122 (61%), Gaps = 5/122 (4%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K+  VAL+ C+V+     A+ AI C  V + L PCL Y+ GG  G +  CC GVRNL +A
Sbjct  5    KVVCVALIMCIVIAPM--AESAITCGRVSAALAPCLGYLQGG-PGPSAQCCGGVRNLNSA  61

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN*ELK  233
            A T  DR+AAC CLKSAAGSI +  +   AA  L  +C V +PY IS STNC T +  LK
Sbjct  62   AVTTPDRQAACNCLKSAAGSI-SRLNANNAAA-LPGKCGVNIPYKISTSTNCATYHQGLK  119

Query  232  WL  227
             L
Sbjct  120  ML  121



>sp|A0AT32.1|NLTP6_LENCU RecName: Full=Non-specific lipid-transfer protein 6; Short=LTP6; 
Flags: Precursor [Lens culinaris]
 gb|AAX35810.1| lipid transfer protein 6 precursor [Lens culinaris subsp. culinaris]
Length=118

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            A+GAI C  V SDL PCLTY+ GG  G +P CC GV+ L  AA T  DR+AAC CLKSAA
Sbjct  23   AEGAISCGAVTSDLSPCLTYLTGG-PGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAA  81

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            GSI        AA  L  +C V +PY IS STNC+T+
Sbjct  82   GSITKLNTNNAAA--LPGKCGVDIPYKISTSTNCNTV  116



>gb|AES87466.2| Lipid transfer protein [Medicago truncatula]
Length=139

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K+  V L+ CM+V     AD AI C  V S L PC+ Y+ GG  G +P+CC GV+ L  A
Sbjct  5    KVACVVLMMCMIVA--PMADAAISCGTVTSALGPCIGYLKGG-PGPSPACCGGVKRLNGA  61

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLR-QCNVKLPYTISVSTNCDTIN  245
            AAT  DR+AAC CLK AAG+I   + + TAA + L  +C V +PY IS STNC T+ 
Sbjct  62   AATTPDRQAACNCLKQAAGAI---SGLNTAAASALPGKCGVNIPYKISTSTNCATVR  115



>sp|A0AT31.1|NLTP5_LENCU RecName: Full=Non-specific lipid-transfer protein 5; Short=LTP5; 
Flags: Precursor [Lens culinaris]
 gb|AAX35809.1| lipid transfer protein 5 precursor [Lens culinaris subsp. culinaris]
Length=116

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 70/115 (61%), Gaps = 5/115 (4%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K+  V L+ CM+V     A+GAI C  V  DL PCLTY+ GG  G +P CC GV+ L  A
Sbjct  6    KLACVVLVMCMIV--APMAEGAISCGAVTGDLSPCLTYLTGG-PGPSPQCCGGVKKLLAA  62

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            A T  DR+AAC C+KSAA SI        AA  L  +C V +PY IS STNC+T+
Sbjct  63   ANTTPDRQAACNCMKSAASSITKLNTNNAAA--LPGKCGVNIPYKISTSTNCNTV  115



>ref|XP_010529189.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=117

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 5/120 (4%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA++  +A  +LACMVV   + A+  I C  V S + PC+ Y+  G   + P+CC GVR+
Sbjct  1    MARVMKLACLVLACMVVAGPMVAEAQISCGTVASRVAPCIAYLTRGGP-LPPACCAGVRS  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            L + A T   R+AAC+CL+SAA SIP G + G AA  L R C V++ Y IS +TNC+ + 
Sbjct  60   LNSLANTTPARQAACRCLQSAARSIP-GLNQG-AASGLPRACGVRISYPISTTTNCNNVK  117



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 70/122 (57%), Gaps = 8/122 (7%)
 Frame = -3

Query  598  MAKIQSVALLA----CMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGV  431
            MAK   +A  A    CM VL+  HA+ AI C  V   + PC+ Y+  G   V PSCC G+
Sbjct  1    MAKHGGLACFALVILCMAVLVVPHAE-AITCGQVSGAVAPCINYVRSGGV-VPPSCCGGI  58

Query  430  RNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDT  251
            R L  AA T  DRR AC CLKSAAG IP G   G AA  L  +C V +P+ IS S NC+T
Sbjct  59   RGLVGAAKTTADRRTACNCLKSAAGRIP-GLKPGLAA-GLPGKCGVSVPFPISTSVNCNT  116

Query  250  IN  245
            + 
Sbjct  117  VT  118



>gb|ABK24295.1| unknown [Picea sitchensis]
Length=126

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 65/125 (52%), Gaps = 8/125 (6%)
 Frame = -3

Query  601  VMAKIQSVALLACMVVLLY------VHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCC  440
            V +K ++V L+A   + L       +HA+ AI C  V SD+ PC+ Y+  G    TP+CC
Sbjct  4    VSSKNKAVGLVAAFAIFLLSMEIMVMHAESAISCGTVTSDMTPCVGYLTSGKGKPTPNCC  63

Query  439  DGVRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTN  260
             GV+ L   A T   RRA C CLK A    P       A   L   C V LP+ IS+ TN
Sbjct  64   GGVKKLAGLANTTPARRAVCGCLKQAYSQFPNANSA--AVSGLPGACGVNLPFKISLQTN  121

Query  259  CDTIN  245
            C+TIN
Sbjct  122  CNTIN  126



>gb|ABK21641.1| unknown [Picea sitchensis]
 gb|ABK23085.1| unknown [Picea sitchensis]
Length=126

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 64/123 (52%), Gaps = 8/123 (7%)
 Frame = -3

Query  595  AKIQSVALLACMVVLLY------VHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDG  434
            +K ++V L+A   + L       +HA+ AI C  V SDL PC+ Y+  G    TP+CC G
Sbjct  6    SKNKAVGLVAAFAIFLLSMEMMVMHAESAISCGTVTSDLTPCVGYLTSGKGKPTPNCCGG  65

Query  433  VRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCD  254
            V+ L   A T   RRA C CLK A    P       A   L   C V LP+ IS+ TNC+
Sbjct  66   VKKLAGLANTTPARRAVCGCLKQAYSQFPNANSA--AVSGLPGACGVNLPFKISLQTNCN  123

Query  253  TIN  245
            TIN
Sbjct  124  TIN  126



>gb|ABK22438.1| unknown [Picea sitchensis]
 gb|ACN41159.1| unknown [Picea sitchensis]
Length=126

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 70/126 (56%), Gaps = 10/126 (8%)
 Frame = -3

Query  601  VMAKIQSVALLACMVVLLY------VHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCC  440
            V +K ++V L+A   + L       +HA+ AI C  V SDL  C+ Y+  G    TPSCC
Sbjct  4    VSSKNKAVVLVAAFAIFLLSMEMMVMHAESAISCGTVTSDLTQCVGYLTSGKGKPTPSCC  63

Query  439  DGVRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAA-KNLLRQCNVKLPYTISVST  263
             GV+ L + A+T   RRA C CLK A    P   +V +AA   L   C V LP+ IS+ T
Sbjct  64   GGVKKLADLASTTPARRAVCGCLKQAYSQFP---NVNSAAVSGLPGACGVNLPFKISLQT  120

Query  262  NCDTIN  245
            NC+TIN
Sbjct  121  NCNTIN  126



>ref|XP_010252072.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 3/101 (3%)
 Frame = -3

Query  547  YVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLK  368
            YVH D AI C  + S L PC+ Y + G   + P+CC GVR L +AA T  DR+A CQCLK
Sbjct  25   YVHVDAAISCGQLASLLSPCVNYFVKGGP-LPPACCSGVRTLNSAAKTTADRQATCQCLK  83

Query  367  SAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            SAA SIP G ++G  A ++  +C V  PY IS ST+C  + 
Sbjct  84   SAAASIP-GLNLGL-ANSIPGKCGVNFPYKISPSTDCSRVR  122



>gb|EMT04675.1| Non-specific lipid-transfer protein 4.3 [Aegilops tauschii]
Length=115

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L V  D AI C  V S L PC++Y  G  +  T +CC GVR+L  AA +  D
Sbjct  11   LVALVAAMLLVATDAAISCGQVSSALSPCISYARGNGANPTAACCSGVRSLAGAARSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + AG   G  +K     C V +PY IS S +C  I 
Sbjct  71   KQAACKCIKSAAGGLTAGKAAGIPSK-----CGVSVPYAISASVDCSKIR  115



>gb|AFK46170.1| unknown [Lotus japonicus]
Length=119

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 70/115 (61%), Gaps = 3/115 (3%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K   + +  CM ++    A+ AI C  V   L PC+ Y+ GG +  +P CC GV+NL  A
Sbjct  6    KFSCMVVAICMALVAAPMAEAAISCGSVIGALTPCMPYLTGGPA-PSPQCCAGVKNLNAA  64

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            A+T  DR+ AC CLK+AAGS+P   + G AA  L  +C V +PY IS STNC+TI
Sbjct  65   ASTTPDRKTACGCLKNAAGSMP-NLNAGNAAA-LPGKCGVNIPYKISTSTNCNTI  117



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 67/110 (61%), Gaps = 3/110 (3%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            ++ CMVV +    + AI C  V S L PCL Y+  G   V P CC G++NL +AA T  D
Sbjct  13   MVICMVVAVPASVEAAITCGQVTSSLSPCLNYLKSGGP-VPPGCCSGIKNLNSAAQTTAD  71

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            R+ AC+CLKS +GSIP G + G A+  L  +C V +PY IS ST+C  + 
Sbjct  72   RQTACKCLKSLSGSIP-GINYGLAS-GLPGKCGVSVPYKISPSTDCSKVT  119



>gb|AFR43276.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43278.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 72/114 (63%), Gaps = 7/114 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V S L PC+ Y+ G GA  + P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T  DR+AAC+C+KSAA  IP G + G A+  L  +C V +PY IS ST+C ++ 
Sbjct  69   TTPDRQAACKCIKSAAAGIP-GINFGLAS-GLPGKCGVNIPYKISPSTDCSSVK  120



>ref|XP_006295253.1| hypothetical protein CARUB_v10024341mg [Capsella rubella]
 gb|EOA28151.1| hypothetical protein CARUB_v10024341mg [Capsella rubella]
Length=118

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 76/120 (63%), Gaps = 6/120 (5%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTP-SCCDGVR  428
            MA +  +A  +LACM+V   + A+ A+ C  V S+L PC+ Y++ G  G+ P  CC+GVR
Sbjct  1    MAGVMKLACLVLACMIVAGPMAANAALSCGAVNSNLAPCIGYLIQG--GIIPVGCCNGVR  58

Query  427  NLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            NL + A T  DR+ AC C+++AA  + +G + G AA  + + C V +PY IS STNC T+
Sbjct  59   NLNSIARTTPDRQQACTCIQNAARGLGSGLNAGRAA-GIPKACGVNIPYKISTSTNCKTV  117



>ref|XP_010683514.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 3/113 (3%)
 Frame = -3

Query  583  SVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaat  404
            S A+  CMVV    HA+ A+ C  V S++ PCL+Y+MG A      CC G++ LKN A+T
Sbjct  10   SCAIFLCMVVAA-PHAEAAMNCGMVASNVAPCLSYLMGSAKQPPSGCCAGIKKLKNMAST  68

Query  403  addrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              DRR AC CLKSAA ++    + G AA  L +QC V +PY IS  T+C  +N
Sbjct  69   PMDRRTACGCLKSAATAM-KNMNYGKAA-GLPKQCGVSIPYAISPKTDCSRVN  119



>gb|AAF35186.1|AF195865_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26698.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43277.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 72/114 (63%), Gaps = 7/114 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V S L PC+ Y+ G GA  + P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T  DR+AAC+C+KSAA  IP G + G A+  L  +C V +PY IS ST+C ++ 
Sbjct  69   TTPDRQAACKCIKSAAAGIP-GINFGLAS-GLPGKCGVNIPYKISPSTDCSSVK  120



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 72/115 (63%), Gaps = 5/115 (4%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K+  VAL+ C+V+     A+ AI C  V + L PCL Y+ GG  G +  CC GVRNL +A
Sbjct  5    KVVCVALIMCIVI--APMAESAITCGRVSAALAPCLGYLQGG-PGPSAQCCGGVRNLNSA  61

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            A T  DR+AAC CLKSAAGSI +  +   AA  L  +C V +PY IS STNC TI
Sbjct  62   AVTTPDRQAACNCLKSAAGSI-SRLNANNAAA-LPGKCGVNIPYKISTSTNCATI  114



>ref|NP_181388.1| non-specific lipid-transfer protein 1 [Arabidopsis thaliana]
 sp|Q42589.1|NLTP1_ARATH RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA86765.1| non-specific lipid transfer protein, partial [Arabidopsis thaliana]
 gb|AAC67364.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 gb|AAF76927.1| lipid transfer protein 1 [Arabidopsis thaliana]
 gb|AAK83638.1| At2g38540/T6A23.26 [Arabidopsis thaliana]
 gb|AAM10276.1| At2g38540/T6A23.26 [Arabidopsis thaliana]
 gb|AEC09547.1| non-specific lipid-transfer protein 1 [Arabidopsis thaliana]
Length=118

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A  LLACM+V   + ++ A+ C  V S+L  C+ Y++ G   + P+CC GV+N
Sbjct  1    MAGVMKLACLLLACMIVAGPITSNAALSCGSVNSNLAACIGYVLQGGV-IPPACCSGVKN  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L + A T  DR+ AC C++ AA ++ +G + G AA  + + C V +PY IS STNC T+
Sbjct  60   LNSIAKTTPDRQQACNCIQGAARALGSGLNAGRAA-GIPKACGVNIPYKISTSTNCKTV  117



>gb|ADR66946.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V + + PC+ Y++GG + V P+CC+G+RN++N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSNSVAPCIPYVIGGGA-VPPACCNGIRNVENLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  +GSIP G +   AA  L  +C V +PY IS+STNC  +
Sbjct  65   KTTADRQAACNCLKQLSGSIP-GVNPNNAAA-LPGKCGVNVPYKISISTNCAAV  116



>gb|AEC04836.1| lipid transfer protein [Dimocarpus longan]
Length=115

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = -3

Query  577  ALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatad  398
            AL+ACM+V+  V A  AI C  V S + PC+ Y+  G S V P CC+G+++L NAA T  
Sbjct  9    ALVACMLVVSPV-AQAAITCGQVTSSVAPCIQYLRSGGS-VPPPCCNGIKSLNNAARTTP  66

Query  397  drraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            DR+ AC+CL++AA +IP G +   AA  L  +C V +PY IS STNC ++
Sbjct  67   DRQQACRCLQNAAKAIP-GINTNLAA-GLPGKCGVNIPYKISTSTNCASV  114



>gb|AGH27863.1| lipid transfer protein precursor [Prunus mira]
 gb|AGW21339.1| lipid transfer protein [Prunus mira]
Length=117

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 71/114 (62%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S+L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSNLAPCIPYVRGGGA-VPPTCCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNPNNAAA-LPGKCGVSIPYKISASTNCATV  116



>gb|ACJ62381.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PCL+Y  G ASG + SCC GVRNL++AA+TA DRRAAC CLK+AA  + 
Sbjct  30   ITCGQVSSAIAPCLSYARGTASGPSTSCCSGVRNLQSAASTAADRRAACNCLKNAARGV-  88

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  89   SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>gb|ACJ62387.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=116

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PCL+Y  G ASG + SCC GVRNL++AA+TA DRRAAC CLK+AA  + 
Sbjct  25   ITCGQVSSAIAPCLSYARGTASGPSTSCCSGVRNLQSAASTAADRRAACNCLKNAARGV-  83

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  84   SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  116



>sp|P82534.1|NLTP1_PRUDO RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru d 3; AltName: Allergen=Pur 
d 3 [Prunus domestica]
Length=91

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 3/93 (3%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S+L PC+ Y+ GG + V P+CC+G+RN+ N A T  DRRAAC CLK  +GSIP
Sbjct  1    ITCGQVSSNLAPCINYVKGGGA-VPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIP  59

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             G +   AA  L  +C V +PY IS STNC T+
Sbjct  60   -GVNPNNAAA-LPGKCGVNVPYKISASTNCATV  90



>ref|XP_010922736.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=120

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 72/122 (59%), Gaps = 3/122 (2%)
 Frame = -3

Query  610  LLPVMAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGV  431
            L+  +    +V+L+  MV+L       AI C  V  DL PC+ Y+  G + V P CC GV
Sbjct  2    LMGAIRGWSAVSLVLAMVLLASPRGTKAITCPQVYGDLNPCIQYLRSGGA-VAPQCCSGV  60

Query  430  RNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDT  251
            R+L  AA T  DRR AC+C+K+AA  + +G D+G  A+ L  +C V +PY IS ST+C  
Sbjct  61   RSLLAAARTVTDRRTACRCIKTAAAGL-SGLDIGR-ARALPGKCGVSIPYKISASTDCSK  118

Query  250  IN  245
            IN
Sbjct  119  IN  120



>gb|ADR66942.1| non-specific lipid transfer protein [Prunus avium]
 gb|ADR66944.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = -3

Query  595  AKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKN  416
            + +  +AL+  + +++ V    A+ C  V S+L PC+ Y+ GG + V P+CC+G+RN+ N
Sbjct  4    SSMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGA-VPPACCNGIRNINN  62

Query  415  aaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             A T  DR+ AC CLK  + S+P G +   AA  L  +C V +PY IS STNC T+
Sbjct  63   LAKTTADRQTACNCLKQLSASVP-GVNANNAAA-LPGKCGVNVPYKISPSTNCATV  116



>sp|Q9M5X8.1|NLTP_PRUAV RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pru av 3; Flags: Precursor [Prunus avium]
 gb|AAF26449.1| lipid transfer protein precursor [Prunus avium]
Length=117

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    A+ C  V S+L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGA-VPPACCNGIRNINNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+ AC CLK  + S+P G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   KTTADRQTACNCLKQLSASVP-GVNANNAAA-LPGKCGVNVPYKISPSTNCATV  116



>gb|AGH27866.1| lipid transfer protein precursor [Prunus kansuensis]
 gb|AGW21340.1| lipid transfer protein [Prunus kansuensis]
Length=117

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSSLAPCIAYVRGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNPNNAAA-LPGKCGVSIPYKISASTNCATV  116



>ref|XP_007206159.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AAV64877.1| non-specific lipid transfer protein [Prunus persica]
 gb|ACE80965.1| putative allergen Pru p 3.01 [Prunus dulcis x Prunus persica]
 gb|ADR66939.1| non-specific lipid transfer protein [Prunus persica]
 gb|ADR66940.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|ADR66941.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|AFN71202.1| non-specific lipid transfer protein LTP1 precursor [Prunus persica]
 gb|EMJ07358.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AGH27867.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27868.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27869.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27870.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27871.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27872.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27873.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27874.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27875.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27876.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27877.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27878.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27879.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27880.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27881.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27882.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27883.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27884.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27885.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27886.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27887.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27888.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27889.1| lipid transfer protein precursor [Prunus persica]
 gb|AGW21334.1| lipid transfer protein [Prunus persica]
 gb|AGW21335.1| lipid transfer protein [Prunus persica]
 gb|AGW21336.1| lipid transfer protein [Prunus persica]
 gb|AGW21337.1| lipid transfer protein [Prunus persica]
 gb|AGW21338.1| lipid transfer protein [Prunus persica]
 gb|AGW21341.1| lipid transfer protein [Prunus persica]
 gb|AGW21342.1| lipid transfer protein [Prunus persica]
 gb|AGW21343.1| lipid transfer protein [Prunus persica]
 gb|AGW21345.1| lipid transfer protein [Prunus persica]
 gb|AGW21346.1| lipid transfer protein [Prunus persica]
 gb|AGW21347.1| lipid transfer protein [Prunus persica]
 gb|AGW21348.1| lipid transfer protein [Prunus persica]
 gb|AGW21349.1| lipid transfer protein [Prunus persica]
 gb|AGW21350.1| lipid transfer protein [Prunus persica]
 gb|AGW21351.1| lipid transfer protein [Prunus persica]
 gb|AGW21352.1| lipid transfer protein [Prunus persica]
 gb|AGW21353.1| lipid transfer protein [Prunus persica]
 gb|AGW21354.1| lipid transfer protein [Prunus persica]
 gb|AGW21355.1| lipid transfer protein [Prunus persica]
 gb|AGW21356.1| lipid transfer protein [Prunus persica]
 gb|AGW21357.1| lipid transfer protein [Prunus persica]
 gb|AGW21358.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSSLAPCIPYVRGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNPNNAAA-LPGKCGVSIPYKISASTNCATV  116



>gb|ABK25598.1| unknown [Picea sitchensis]
Length=126

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 69/126 (55%), Gaps = 10/126 (8%)
 Frame = -3

Query  601  VMAKIQSVALLACMVVLLY------VHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCC  440
            + +K ++V L+A   + L       +HA+ AI C  V SD+ PC+ Y+  G     P+CC
Sbjct  4    ISSKNKAVVLVAAFAIFLLSMEIMVMHAESAISCGTVISDMTPCVGYLTSGKGKPAPNCC  63

Query  439  DGVRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAA-KNLLRQCNVKLPYTISVST  263
             GV+ L   A T   RRA C CLK A   +P   +V +AA   L   C V LP+ IS+ T
Sbjct  64   GGVKKLAGLATTTPTRRAVCGCLKQAYSQVP---NVNSAAVSGLPGACGVNLPFKISLQT  120

Query  262  NCDTIN  245
            NC+TIN
Sbjct  121  NCNTIN  126



>gb|ABG54494.1| putative allergen Rub i 3 [Rubus idaeus]
Length=117

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 69/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+A + +++ V    AI C  V  ++ PC  Y+  G + V  +CC+GVRNL + A
Sbjct  6    VMKLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGA-VPAACCNGVRNLNSQA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+  C CLK+AAGSIP G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   KTTADRQQTCNCLKNAAGSIP-GLNPSLAA-GLPGKCGVSVPYKISTSTNCATV  116



>gb|ADR66947.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSSLAPCIGYVRGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DRR AC CLK  +GSI +G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   RTTPDRRTACNCLKQLSGSI-SGVNPNNAAA-LPGKCGVNIPYKISASTNCATV  116



>ref|XP_007206674.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
 gb|EMJ07873.1| hypothetical protein PRUPE_ppa023110mg [Prunus persica]
Length=118

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 3/111 (3%)
 Frame = -3

Query  580  VALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaata  401
            +AL+  + +++ V    AI C  + S+L PC+ Y+ GG + V P+CC+G+RN+ N A T 
Sbjct  10   LALVVALCMVVSVPIAQAITCGQLFSNLAPCIPYVRGGGA-VPPACCNGIRNVNNLAKTT  68

Query  400  ddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             DR+AAC CLK  + SIP G +   AA  L  +C V +PY IS STNC T+
Sbjct  69   PDRQAACNCLKQLSASIP-GVNPNNAAA-LPGKCGVSIPYKISASTNCKTV  117



>gb|ADR66943.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    A+ C  V S+L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIPYVRGGGA-VPPACCNGIRNINNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+ AC CLK  + S+P G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   KTTADRQTACNCLKQLSASVP-GVNANNAAA-LPGKCGVNVPYKISPSTNCATV  116



>sp|O23758.1|NLTP_CICAR RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Cicer arietinum]
 emb|CAA05771.1| lipid transfer protein [Cicer arietinum]
Length=116

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 72/115 (63%), Gaps = 5/115 (4%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K+  VAL+ C+V+     A+ AI C  V + L PCL Y+ GG  G +  CC GVRNL +A
Sbjct  5    KVVCVALIMCIVI--APMAESAITCGRVDTALAPCLGYLQGG-PGPSAQCCGGVRNLNSA  61

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            A T  DR+AAC CLKSAAGSI +  +   AA  L  +C V +PY IS STNC TI
Sbjct  62   AVTTPDRQAACNCLKSAAGSI-SRLNANNAAA-LPGKCVVNIPYKISTSTNCATI  114



>ref|XP_003605269.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=166

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 71/114 (62%), Gaps = 5/114 (4%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K+  V L+ CM+V     AD AI C  V S L PC+ Y+ GG  G +P+CC GV+ L  A
Sbjct  5    KVACVVLMMCMIVA--PMADAAISCGTVTSALGPCIGYLKGG-PGPSPACCGGVKRLNGA  61

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDT  251
            AAT  DR+AAC CLK AAG+I +G +   AA  L  +C V +PY IS STNC T
Sbjct  62   AATTPDRQAACNCLKQAAGAI-SGLNT-AAASALPGKCGVNIPYKISTSTNCAT  113



>gb|ADR66950.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66951.1| non-specific lipid transfer protein [Prunus sargentii]
 gb|ADR66952.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 71/114 (62%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S+L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSNLAPCIPYVRGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNPNNAAV-LPGKCGVNIPYKISPSTNCATV  116



>emb|CAA85484.1| lipid transfer protein precursor [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L V AD AI C  V S L PC++Y  G    + P+CC GV+ L  AA +  D
Sbjct  11   LVAMVAAMLLVAADAAISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + AG   G     +   C V +PY IS S +C  I 
Sbjct  71   KQAACKCIKSAAGGLNAGKAAG-----IPSMCGVSVPYAISASVDCSKIR  115



>gb|AEN70918.1| lipid transfer protein [Gossypium turneri]
 gb|AEN70931.1| lipid transfer protein [Gossypium armourianum]
 gb|AEN70932.1| lipid transfer protein [Gossypium harknessii]
Length=120

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 72/113 (64%), Gaps = 7/113 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V S L PC+ Y+ G GA  V P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCINYLRGNGAGAVPPGCCGGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            T  DR+AAC+C+KSAA SI +G + G A+  L  +C V +PY IS ST+C+  
Sbjct  69   TTPDRQAACKCIKSAAASI-SGINFGIAS-GLPGKCGVNIPYKISPSTDCNRF  119



>gb|ABY21307.1| pollen allergen Pla o 3 [Platanus orientalis]
Length=118

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            LLACMV     HA+ AI C  V + L PCLTY+  G + V P+CC+GV+ L N A T  D
Sbjct  13   LLACMVAT-APHAEAAITCGTVVTRLTPCLTYLRSGGA-VAPACCNGVKALNNDAKTTPD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            R+AAC CLK+A+ SI +G  +G AA +L  +C V LPY IS + +C  + 
Sbjct  71   RQAACGCLKTASTSI-SGIQLGNAA-SLAGKCGVNLPYKISPTIDCSKVK  118



>gb|AAA86694.1| phospholipid transfer protein precursor [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ91366.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L V AD AI C  V S L PC++Y  G    + P+CC GV+ L  AA +  D
Sbjct  11   LVAMVAAMLLVAADAAISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++A C+C+KSAA  + AG   G  +K     C V +PY+IS S +C  I+
Sbjct  71   KQAVCKCIKSAAAGLNAGKAAGIPSK-----CGVSVPYSISTSVDCSKIH  115



>prf||2115353B lipid transfer protein
Length=115

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 65/110 (59%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L + AD AI C  V S L PC++Y  G  +    +CC GVR+L  AA +  D
Sbjct  11   LVAMVTAMLLIAADAAISCGQVSSALSPCISYARGKGAKPPAACCSGVRSLAGAARSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+K AAG++ AG   G     +  +C V++PY IS S +C  I 
Sbjct  71   KQAACRCIKRAAGALNAGKAAG-----IPNKCGVRVPYAISASVDCSKIR  115



>gb|AGN56422.1| non-specific lipid transfer protein 2, partial [Linum usitatissimum]
Length=116

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 4/108 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            LL C +V   +   G + C  V S +  CLTY+ G A  VTP+CC+G+R L N A T  D
Sbjct  11   LLVCALVAAPITVSG-LTCGQVSSGMAACLTYLTGRAP-VTPACCNGMRGLLNMAKTTAD  68

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDT  251
            RR AC CLK+AAG++P G +   AA  L  +C VK+PY IS STNC+T
Sbjct  69   RRLACTCLKTAAGNVP-GLNPAIAA-GLPGKCGVKIPYKISTSTNCNT  114



>gb|AGW21344.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSSLAPCIPYVRGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNPNNAAV-LPGKCGVSIPYKISASTNCATV  116



>gb|AGN56421.1| non-specific lipid transfer protein 1 [Linum usitatissimum]
Length=116

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 4/108 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            LL C +V   +   G + C  V S +  CLTY+ G A  VTP+CC+G+R L N A T  D
Sbjct  11   LLVCALVAAPITVSG-LTCGQVSSGMAACLTYLTGRAP-VTPACCNGMRGLLNMAKTTAD  68

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDT  251
            RR AC CLK+AAG++P G +   AA  L  +C VK+PY IS STNC+T
Sbjct  69   RRLACTCLKTAAGNVP-GLNPAIAA-GLPGKCGVKIPYKISTSTNCNT  114



>gb|ABK21288.1| unknown [Picea sitchensis]
Length=126

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 69/126 (55%), Gaps = 10/126 (8%)
 Frame = -3

Query  601  VMAKIQSVALLACMVVLLY------VHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCC  440
            + +K ++V L+A   + L       +HA+ A+ C  V SD+ PC+ Y+  G     P+CC
Sbjct  4    ISSKNKAVVLVAAFAIFLLSMEIMVMHAESAVSCGTVISDMTPCVGYLTSGKGKPAPNCC  63

Query  439  DGVRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAA-KNLLRQCNVKLPYTISVST  263
             GV+ L   A T   RRA C CLK A   +P   +V +AA   L   C V LP+ IS+ T
Sbjct  64   GGVKKLAGLATTTPTRRAVCGCLKQAYSQVP---NVNSAAVSGLPGACGVNLPFKISLQT  120

Query  262  NCDTIN  245
            NC+TIN
Sbjct  121  NCNTIN  126



>ref|XP_002270970.1| PREDICTED: non-specific lipid-transfer protein P5 [Vitis vinifera]
Length=118

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 73/110 (66%), Gaps = 4/110 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            +L CM+V   +  +G + C DV + L PC+ Y+   A  + P+CC+GV+NLKN+AAT  D
Sbjct  13   VLMCMLVASPMAVEG-LSCGDVATQLAPCINYLRS-AGPLPPACCNGVKNLKNSAATTQD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            RR AC+CL +A+ SI +G + G AA  L  +C V +PY IS STNCD +N
Sbjct  71   RRTACKCLINASKSI-SGVNFGLAA-GLPGKCGVNIPYKISPSTNCDQVN  118



>sp|Q43871.1|NLTP8_HORVU RecName: Full=Non-specific lipid-transfer protein Cw18; Short=LTP 
Cw-18; AltName: Full=PKG2316; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA48622.1| Cw-18 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
 emb|CAA85483.1| lipid transfer protein precursor [Hordeum vulgare subsp. vulgare]
 dbj|BAK01310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 65/114 (57%), Gaps = 9/114 (8%)
 Frame = -3

Query  580  VALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPS--CCDGVRNLKNaaa  407
            +AL+A +  +L V AD AI C  V S L PC  Y  G  SG +PS  CC GV+ L   A 
Sbjct  9    LALVALVAAMLLVAADAAITCGQVSSALGPCAAYAKG--SGTSPSAGCCSGVKRLAGLAR  66

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +  D++A C+CLKS AG+  AG   G     +  +C V +PYTIS S +C  I+
Sbjct  67   STADKQATCRCLKSVAGAYNAGRAAG-----IPSRCGVSVPYTISASVDCSKIH  115



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 3/119 (3%)
 Frame = -3

Query  601  VMAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            +MA ++   +L  M +++   A+ AI C  V   L PC+ Y+ GG SG + +CC GV+ L
Sbjct  57   IMASMKVACVLLMMCIIVAPMAEAAITCGTVTGSLAPCIGYLKGG-SGPSAACCGGVKRL  115

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             +AA T  DR+AAC CLKSAAG+I +G +   AA  L  +C V +PY IS STNC TI 
Sbjct  116  NSAATTTPDRQAACNCLKSAAGAI-SGLNPNIAA-GLPGKCGVNIPYKISTSTNCATIR  172



>gb|ABA33867.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=118

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  23   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACSCLKNAA  82

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C+V +PYTIS ST+C  +N
Sbjct  83   AGV-SGLNAGNAA-SIPSKCSVSIPYTISTSTDCSRVN  118



>ref|NP_001105392.1| phospholipid transfer protein precursor [Zea mays]
 gb|AAB06443.1| phospholipid transfer protein [Zea mays]
 gb|ACF86016.1| unknown [Zea mays]
 gb|ACJ62344.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 tpg|DAA59231.1| TPA: phospholipid transfer protein-like protein [Zea mays]
Length=121

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  SG + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  32   CGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-SG  90

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  91   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>ref|NP_181387.1| non-specific lipid-transfer protein 2 [Arabidopsis thaliana]
 sp|Q9S7I3.1|NLTP2_ARATH RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; AltName: Full=Protein CELL GROWTH DEFECT FACTOR 3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC24829.1| lipid transfer protein 2 precursor [Arabidopsis thaliana]
 gb|AAC67365.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 gb|AAF76928.1| lipid transfer protein 2 [Arabidopsis thaliana]
 gb|AAL24409.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 gb|AAM10124.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 gb|AAM63016.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 dbj|BAE46870.1| cell growth defect factor -3 [Arabidopsis thaliana]
 gb|AEC09546.1| non-specific lipid-transfer protein 2 [Arabidopsis thaliana]
Length=118

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 73/119 (61%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A  +LACM+V   + A+  + C  V  +L  C+ Y+  GA  +T  CC+GV N
Sbjct  1    MAGVMKLACMVLACMIVAGPITANALMSCGTVNGNLAGCIAYLTRGAP-LTQGCCNGVTN  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            LKN A+T  DR+ AC+CL+SAA ++  G +   AA  L   C V +PY IS STNC+T+
Sbjct  60   LKNMASTTPDRQQACRCLQSAAKAVGPGLNTARAA-GLPSACKVNIPYKISASTNCNTV  117



>gb|EMT30256.1| Non-specific lipid-transfer protein 4.3 [Aegilops tauschii]
Length=115

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L V  D AI C  V S L PC++Y  G  +  T +CC GVR+L  AA +  D
Sbjct  11   LVAMVATMLLVATDAAISCGQVTSALSPCISYARGNGANPTAACCSGVRSLAGAARSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + AG   G  +K     C V +PY IS + +C  I 
Sbjct  71   KQAACKCIKSAAGGLNAGKAAGIPSK-----CGVSVPYAISANVDCSKIR  115



>gb|ADR66948.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSSLAPCIGYVRGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DRR AC CLK  +GSI +G +   AA  L  +C V +PY IS+STNC  +
Sbjct  65   RTTPDRRTACNCLKQLSGSI-SGVNPNNAAA-LPGKCGVNIPYKISISTNCAAV  116



>gb|ABA33859.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33861.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33864.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33865.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=118

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  23   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  82

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C+V +PYTIS ST+C  +N
Sbjct  83   AGV-SGLNAGNAA-SIPSKCSVSIPYTISTSTDCSRVN  118



>gb|ACJ62361.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G ASG + SCC GVRNL++AA+TA DRRAAC CLK+AA  + +G
Sbjct  32   CGQVSSAIAPCLSYARGTASGPSTSCCSGVRNLQSAASTAADRRAACNCLKNAARGV-SG  90

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  91   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>emb|CBI18043.3| unnamed protein product [Vitis vinifera]
Length=139

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 73/110 (66%), Gaps = 4/110 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            +L CM+V   +  +G + C DV + L PC+ Y+   A  + P+CC+GV+NLKN+AAT  D
Sbjct  34   VLMCMLVASPMAVEG-LSCGDVATQLAPCINYLRS-AGPLPPACCNGVKNLKNSAATTQD  91

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            RR AC+CL +A+ SI +G + G AA  L  +C V +PY IS STNCD +N
Sbjct  92   RRTACKCLINASKSI-SGVNFGLAA-GLPGKCGVNIPYKISPSTNCDQVN  139



>gb|AFR31532.1| lipid transfer protein [Betula platyphylla]
Length=120

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIM-GGASGVTPSCCDGVRNLKNaaatad  398
            +L CM+V   + AD A+ C  VQ+ L+PC+TY+   GA  V P+CC G+ ++ NAA T  
Sbjct  13   VLMCMMVYAPL-ADAAVSCGQVQTSLLPCITYVRNNGAGAVPPTCCSGIVSVNNAAKTTP  71

Query  397  drraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            DR+A C CLK AA ++ +G +    A  L  +CNV +PY IS STNC TI
Sbjct  72   DRQAVCDCLKKAASAL-SGVNPNIIA-GLPGKCNVNIPYKISASTNCKTI  119



>dbj|BAJ91878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 65/114 (57%), Gaps = 9/114 (8%)
 Frame = -3

Query  580  VALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPS--CCDGVRNLKNaaa  407
            +AL+A +  +L V AD AI C  V S L PC  Y  G  SG +PS  CC GV+ L   A 
Sbjct  9    LALVALVAAMLLVAADAAITCGQVSSALGPCAAYAKG--SGTSPSAGCCSGVKRLAGLAR  66

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +  D++A C+CLKS AG+  AG   G     +  +C V +PYTIS S +C  I+
Sbjct  67   STADKQATCRCLKSVAGAYNAGRAAG-----IPSRCGVSVPYTISASVDCTKIH  115



>gb|AGW21333.1| lipid transfer protein [Prunus davidiana]
Length=117

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 71/114 (62%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSSLAPCIPYVRGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G ++  AA +L  +C V +PY IS STNC  +
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNLNNAA-SLPGKCGVNIPYQISPSTNCANV  116



>gb|AGH27864.1| lipid transfer protein precursor [Prunus davidiana]
 gb|AGH27865.1| lipid transfer protein precursor [Prunus davidiana]
Length=117

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 71/114 (62%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSSLAPCIPYVRGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G ++  AA +L  +C V +PY IS STNC  +
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNLNNAA-SLPGKCGVNIPYQISPSTNCANV  116



>gb|AEN70916.1| lipid transfer protein [Gossypium laxum]
Length=120

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V + L PC+TY+ G GA+ V P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTTSLAPCITYLRGNGAAAVPPGCCGGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            T  DR+AAC+C+KSAA  I +G + G A+  L  +C V +PY IS ST+C+  
Sbjct  69   TTPDRQAACKCIKSAAAGI-SGINYGIAS-GLPGKCGVNIPYKISPSTDCNRF  119



>gb|ACJ62320.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62321.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62322.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62327.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62334.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62336.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62359.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62360.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62386.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PCL+Y  G  S  + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + 
Sbjct  30   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-  88

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  89   SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>gb|ACJ62316.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62332.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62333.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62337.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62380.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62382.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62383.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62384.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62385.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=116

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PCL+Y  G  S  + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + 
Sbjct  25   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-  83

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  84   SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  116



>gb|ABA33849.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=119

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  24   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  83

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  84   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  119



>gb|ACG30522.1| nonspecific lipid-transfer protein 1 precursor [Zea mays]
Length=121

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (70%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  SG + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  32   CGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGL-SG  90

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  91   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>gb|ABA33850.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  84

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  85   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  120



>gb|ABA33847.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  84

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  85   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  120



>ref|NP_001105311.1| non-specific lipid-transfer protein precursor [Zea mays]
 sp|P19656.1|NLTP_MAIZE RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Allergen=Zea m 14; Flags: Precursor [Zea mays]
 gb|AAA33493.1| phospholipid transfer protein precursor [Zea mays]
 gb|ABA33851.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
 gb|ABA33852.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  84

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  85   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  120



>emb|CAL07989.1| lipid transfer protein [Platanus x acerifolia]
Length=118

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            LLACMV     HA+ AI C  V + L PCLT++  G + V P+CC+GV+ L N A T  D
Sbjct  13   LLACMVAT-APHAEAAITCGTVVTRLTPCLTFLRSGGA-VAPACCNGVKALNNDAKTTPD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            R+AAC CLK+A+ SI +G  +G AA +L  +C V LPY IS + +C  + 
Sbjct  71   RQAACGCLKTASTSI-SGIQLGNAA-SLAGKCGVNLPYKISPTIDCSKVK  118



>gb|KHG21711.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 73/114 (64%), Gaps = 7/114 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V S L PC++Y+ G GA  + P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCISYLRGTGAGAIPPGCCSGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T  DR+AAC+C+KSAA  I  G + G A+  L  +C V +PY IS ST+C+++ 
Sbjct  69   TTPDRQAACKCIKSAATGI-RGINFGLAS-GLPGKCGVNIPYKISPSTDCNSVK  120



>gb|AGH32497.1| non-specific lipid transfer protein [Papaver somniferum]
Length=116

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            +LACMV +    A+GAI C  V S + PCL Y+ GG   +  +CC GV++L  +A T  D
Sbjct  11   VLACMVAVAPYAAEGAISCGMVTSKMAPCLGYLTGGT--LPATCCAGVKSLLASAQTTPD  68

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            R+AAC CLKSA+G I AG + G AA +L  +C V +PY IS ST+C  + 
Sbjct  69   RQAACSCLKSASGGI-AGLNYGNAA-SLPSKCGVNIPYKISPSTDCTKVQ  116



>sp|Q43017.1|NLTP1_PRUDU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Prunus dulcis]
 emb|CAA65475.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80964.1| putative allergen Pru du 3.01 [Prunus dulcis x Prunus persica]
 gb|ACH58427.1| lipid transfer protein [Prunus dulcis]
 gb|ADR66954.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S+L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSNLAPCIPYVRGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G +   AA  L  +C V +PY IS STNC  +
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNPNNAAA-LPGKCGVNIPYQISPSTNCANV  116



>gb|ADR66953.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S+L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSNLAPCIPYVKGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G +   AA  L  +C V +PY IS STNC  +
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNPNNAAA-LPGKCGVNIPYQISPSTNCANV  116



>gb|AAV40850.1| lipid transfer protein 1 precursor [Prunus persica]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C    S L PC+ Y+ GG + V P+CC+G+RN+ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQASSSLAPCIPYVRGGGA-VPPACCNGIRNVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNPNNAAA-LPGKCGVSIPYKISASTNCATV  116



>gb|ABA33858.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=116

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  21   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  80

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  81   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  116



>gb|AAF14232.1|AF109195_1 lipid transfer protein [Hordeum vulgare]
 dbj|BAJ87805.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=121

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            +LA MVV   V    AI CS V S LMPCL Y+  G +     CC G++NL   A  + D
Sbjct  14   VLAAMVVAPPVTVRAAISCSAVYSTLMPCLQYVQQGGTPAR-GCCAGIQNLLAEANNSPD  72

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            RR  C CLK+ A + P G+++ T A  L  +CNV LPY IS S +C++I+
Sbjct  73   RRTICGCLKNVANAAPGGSEI-TRAAALPSKCNVNLPYKISPSVDCNSIH  121



>ref|XP_009372010.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 68/124 (55%), Gaps = 7/124 (6%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYV------HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCD  437
            MA    +  LAC+VV+++        AD A+ C  V SDL PC++Y+  G + + P+CC+
Sbjct  1    MASSGQLLKLACLVVVMFCMVACVPKADAAMTCGQVVSDLTPCISYVRAGGA-LAPACCN  59

Query  436  GVRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNC  257
            GVR L   A T  DR++ C CLK A   IP        A  L  +C V +PY IS ST+C
Sbjct  60   GVRTLFTLAQTTPDRQSVCNCLKQAINGIPYTNTNAGLAAGLPAKCGVNIPYKISPSTDC  119

Query  256  DTIN  245
             ++ 
Sbjct  120  KSVK  123



>gb|ABA33860.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=109

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  14   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  73

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  74   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  109



>ref|XP_010558406.1| PREDICTED: non-specific lipid-transfer protein 1-like [Tarenaya 
hassleriana]
Length=120

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLK  419
            M  +  V  +ACMV +       A+ C+ V SDLMPC++Y+  G  GV  +CC+GVR L 
Sbjct  9    MIAVSMVVAVACMVTVA-----AAVTCNQVVSDLMPCVSYVAQGG-GVPANCCNGVRALN  62

Query  418  NaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              A TA DR+  C+CLK+A   +   A     A +L  +C V+LP+ IS ST+CD+IN
Sbjct  63   GQARTASDRQGVCRCLKAALNGVSYTAFNLNNAASLPSKCGVRLPFAISPSTSCDSIN  120



>ref|XP_002532869.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF29523.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=116

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = -3

Query  565  CMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPS--CCDGVRNLKNaaataddr  392
            CMVV        AI C  V S L PCL Y+ G A G  PS  CC+GVR + +AA T  DR
Sbjct  13   CMVVAPMTTQ--AITCGQVASSLGPCLNYLKG-AGGTAPSAACCNGVRGINSAAKTTADR  69

Query  391  raACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            + ACQCLKSAA  IP        A++L   CNV +PY IS+STNC +I
Sbjct  70   QTACQCLKSAANGIPGLQP--KLAESLPGNCNVNIPYKISLSTNCQSI  115



>gb|ABA33854.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=121

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PC++Y  G  SG +  CC GVR+LKNAA T  DRRAAC CLK+AA  + 
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLKNAARTTADRRAACNCLKNAAAGV-  88

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  89   SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>dbj|BAC77694.1| lipid transfer protein [Atriplex nummularia]
Length=117

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 74/111 (67%), Gaps = 5/111 (5%)
 Frame = -3

Query  577  ALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatad  398
            A+  CM+V    HA+ A+ C  V S + PC++Y+ GG S  TP+CC GV++L + A+T  
Sbjct  12   AVFMCMLVA-APHAE-ALTCGQVTSSMTPCMSYLTGGGS-PTPACCGGVKSLNSMASTPA  68

Query  397  drraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            DR+AAC CLKSAAG++    ++G AA +L  +C + LPY IS ST+C  +N
Sbjct  69   DRKAACGCLKSAAGAM-TNLNMGNAA-SLPGKCGISLPYPISTSTDCSKVN  117



>gb|ABA33866.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=114

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  19   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  78

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  79   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  114



>gb|ABA33853.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=109

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  14   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  73

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  74   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  109



>ref|XP_009135090.1| PREDICTED: non-specific lipid-transfer protein 6-like [Brassica 
rapa]
Length=115

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (64%), Gaps = 0/99 (0%)
 Frame = -3

Query  541  HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSA  362
            H + A+ C++V  DL PCL+Y+M G +  + +CC GVR L + A T  DR++ C+C+K+A
Sbjct  17   HGEAAVTCNNVVGDLYPCLSYVMQGGNSPSTNCCSGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  361  AGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             G     +     A +L  +C V LP++IS STNC++I+
Sbjct  77   IGGASYSSSNLKNALSLPAKCGVNLPFSISPSTNCNSIH  115



>emb|CDM80997.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L V +D AI C  V S L PC++Y  G  +    +CC GVR+L  AA +  D
Sbjct  11   LVAMVAAMLLVASDAAISCGQVTSALSPCISYARGNGANPPAACCSGVRSLAGAARSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + AG   G  +K     C V +PY IS S +C  I 
Sbjct  71   KQAACKCIKSAAGGLNAGKAAGIPSK-----CGVSVPYAISSSVDCSKIR  115



>gb|AEN70919.1| lipid transfer protein [Gossypium mustelinum]
 gb|AEN70920.1| lipid transfer protein [Gossypium mustelinum]
Length=120

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 72/113 (64%), Gaps = 7/113 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V S L PC+ Y+ G GA GV  SCC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCIAYLTGNGAGGVPSSCCGGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            T  DR+AAC+C+KSAA  I +G + G A+  L  +C V +PY IS ST+C+  
Sbjct  69   TTPDRQAACKCIKSAAAGI-SGINYGIAS-GLPGKCGVNIPYKISPSTDCNRF  119



>gb|AAG29777.1| lipid transfer protein 3 precursor [Gossypium hirsutum]
 gb|ACI26697.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43270.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43271.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43272.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 72/114 (63%), Gaps = 7/114 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V + L PC+ Y+ G GA  V P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T  DR+AAC+C+KSAA  I  G + G A+  L  +C V +PY IS ST+C+++ 
Sbjct  69   TTPDRQAACRCIKSAAAGI-TGINFGLAS-GLPGKCGVNIPYKISPSTDCNSVK  120



>ref|XP_008798551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = -3

Query  580  VALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaata  401
            V L   MV+L       AI C  V  DL PC+ Y+  G + V P CC GVR+L  AA T 
Sbjct  10   VGLQLAMVLLASPRGTKAITCPQVYGDLTPCIQYLRSGGA-VAPQCCSGVRSLLAAARTV  68

Query  400  ddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             DRR AC+C+K+AA  + +G D+G A+  L  +C V +PY IS ST+C  IN
Sbjct  69   TDRRTACRCIKTAAAGL-SGLDIGRAS-ALPGKCGVSIPYKISPSTDCSKIN  118



>gb|ABA33855.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=121

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PC++Y  G  SG + SCC GVR+L NAA T  DRRAAC CLK+AA  + 
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSASCCSGVRSLNNAARTTADRRAACNCLKNAAAGV-  88

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  89   SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>pdb|1FK0|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Capric Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK1|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Lauric Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK2|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Myristic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK3|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Palmitoleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK4|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Stearic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK5|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Oleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK6|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Alpha-Linolenic Acid 
Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK7|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Ricinoleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1AFH|A Chain A, Lipid Transfer Protein From Maize Seedlings, Nmr, 15 
Structures
 pdb|1MZL|A Chain A, Maize Nonspecific Lipid Transfer Protein
 pdb|1MZM|A Chain A, Maize Nonspecific Lipid Transfer Protein Complexed With 
Palmitate
Length=93

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA  +
Sbjct  1    AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGV  60

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  61   -SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  93



>gb|ADR66949.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 71/114 (62%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+  + +++ V    AI C  V S+L PC+ Y+ GG + V P+CC+G+R++ N A
Sbjct  6    MTKLALVVALCMVVSVPIAQAITCGQVSSNLAPCIPYVRGGGA-VPPACCNGIRDVNNLA  64

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK  + S+P G +   AA  L  +C V +PY IS STNC T+
Sbjct  65   RTTPDRQAACNCLKQLSASVP-GVNPNNAAV-LPGKCGVNIPYKISPSTNCATV  116



>ref|XP_004245221.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=123

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 69/120 (58%), Gaps = 4/120 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGA--SGVTPSCCDGVRN  425
            M KI +   L C +V++    + AI C+ V S LMPCL+Y+MGG+  +     CC G+++
Sbjct  6    MQKISAFCFLLC-IVIISPQTEAAISCNTVYSKLMPCLSYLMGGSNRAAAPAGCCSGIQS  64

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            L  AA+T  DR+  C CLKS A S+    D   AA  LL +C V +PY IS + +C  + 
Sbjct  65   LYTAASTTTDRQGVCSCLKSGAASLGNSIDTSKAA-TLLSKCGVTVPYKISPNIDCSQVQ  123



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = -3

Query  601  VMAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            V+ K+  VA+L CMVV    HA+ AI C  V   L PCL Y+  G   V P+CC+G+++L
Sbjct  6    VVIKVGIVAVLMCMVVSAP-HAEAAITCGTVTVSLAPCLNYLKKGGP-VPPACCNGIKSL  63

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              AA T  DR+AAC CLK+A+ SI AG ++ + A +L  +C V +PY IS ST+C  + 
Sbjct  64   NAAAKTTADRQAACNCLKTASTSI-AGINL-SYASSLPGKCGVNVPYKISPSTDCSKVQ  120



>pdb|2MAL|A Chain A, Solution Structure Of Lipid Transfer Protein From Lentil 
Lens Culinaris
Length=93

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 60/94 (64%), Gaps = 3/94 (3%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI C  V SDL PCLTY+ GG  G +P CC GV+ L  AA T  DR+AAC CLKSAAGSI
Sbjct  1    AISCGAVTSDLSPCLTYLTGG-PGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSI  59

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
                    AA  L  +C V +PY IS +TNC+T+
Sbjct  60   TKLNTNNAAA--LPGKCGVNIPYKISTTTNCNTV  91



>ref|XP_007134674.1| hypothetical protein PHAVU_010G066400g [Phaseolus vulgaris]
 gb|ESW06668.1| hypothetical protein PHAVU_010G066400g [Phaseolus vulgaris]
Length=118

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI C  V S + PCL+Y+  G +   P CC+GVR L +AA T  DR+A C CLKS AG++
Sbjct  25   AITCGQVASAVTPCLSYLRTGGTPALP-CCNGVRGLNSAAKTTADRQATCNCLKSLAGAL  83

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
              G +   AA +L ++C V++PY IS STNC TI
Sbjct  84   AQGFNAANAA-SLPQKCGVQIPYKISTSTNCATI  116



>gb|EMS55040.1| Non-specific lipid-transfer protein 4.1 [Triticum urartu]
Length=200

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 70/129 (54%), Gaps = 5/129 (4%)
 Frame = -3

Query  631  TG*VLACLLPVMAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVT  452
            +G +L  +    A +  + L+A +  +L +  D AI C  V S L PC++Y  G  +  +
Sbjct  77   SGDLLREIEMARAAVARLVLVALVATMLLITTDAAISCGQVNSALSPCISYARGNGANPS  136

Query  451  PSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTIS  272
             +CC GVR L  A  +  D++  C C+KSAAG + AG      A ++  +C+V +PY IS
Sbjct  137  AACCSGVRRLAGAVRSTTDKKTTCNCIKSAAGGLNAG-----KAADIPSKCSVSIPYAIS  191

Query  271  VSTNCDTIN  245
             S +C TI 
Sbjct  192  PSLDCSTIR  200



>ref|XP_011095133.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
 gb|ABQ53931.1| lipid transfer protein [Sesamum indicum]
Length=119

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 70/121 (58%), Gaps = 5/121 (4%)
 Frame = -3

Query  598  MAKIQSVALLACMVV--LLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTP-SCCDGVR  428
            M K   + L   MVV  L    A+ AI C  V +DL PC+ Y+M G +G  P  CC G++
Sbjct  1    MEKATCLVLAVTMVVVALAPPQAEAAISCGTVANDLSPCINYVMYGGAGTPPVPCCTGIK  60

Query  427  NLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             L N A++  DR+A C CLKS AG   + A +GTAA  L  +C V +PY IS ST+C  +
Sbjct  61   TLYNQASSTADRQAVCGCLKSVAGQA-SPAIIGTAAA-LPGKCGVSIPYEISPSTDCSKV  118

Query  247  N  245
            +
Sbjct  119  H  119



>sp|Q43767.1|NLT41_HORVU RecName: Full=Non-specific lipid-transfer protein 4.1; Short=LTP 
4.1; AltName: Full=CW-21; Short=CW21; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA48621.1| Cw-21 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ92944.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 62/110 (56%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L V AD AI C  V S L PC++Y  G  +    +CC GV+ L  AA +  D
Sbjct  11   LVALVAAMLLVAADAAISCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + AG   G     +   C V +PY IS S +C  I 
Sbjct  71   KQAACKCIKSAAGGLNAGKAAG-----IPSMCGVSVPYAISASVDCSKIR  115



>gb|AEN70915.1| lipid transfer protein [Gossypium thurberi]
 gb|AEN70938.1| lipid transfer protein [Gossypium trilobum]
Length=120

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V S L PC  Y+ G GA  V P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCFAYLTGNGAGSVPPRCCGGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            T  DR+AAC+C+KSAA  I +G + G A+  L  +C V +PY IS ST+C+  
Sbjct  69   TTPDRQAACKCIKSAAAGI-SGINYGIAS-GLPGKCGVNIPYKISPSTDCNRF  119



>gb|AAB70539.1| lipid transfer protein LPT II [Oryza sativa Indica Group]
Length=118

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI C  V S + PCL+Y  GG SG + +CC GVRNL +AA+T  DRR AC CLK+ AGSI
Sbjct  27   AISCGQVNSAVSPCLSYPRGG-SGPSAACCSGVRNLNSAASTTADRRTACNCLKNVAGSI  85

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             +G + G AA  +  +C V +PYTIS S +C ++N
Sbjct  86   -SGLNAGNAAS-IPSKCGVSIPYTISPSIDCSSVN  118



>ref|XP_009399315.1| PREDICTED: non-specific lipid-transfer protein A-like [Musa acuminata 
subsp. malaccensis]
 gb|ABF69976.1| plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor 
(LTP) family protein [Musa acuminata]
Length=114

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 56/106 (53%), Gaps = 2/106 (2%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            LL     L+ V    A  C  V++ L PCLTY+ G     TP+CCDGVR L+N   T  +
Sbjct  9    LLVLAFALVVVEPTRAFTCIQVEACLTPCLTYLTGQQPAPTPACCDGVRRLENMGITPAE  68

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNC  257
            R+ AC C+K AA   P   D   A  +L R C   LP+ IS+  +C
Sbjct  69   RQFACNCVKHAAAHFPNLKD--DAVSDLPRLCATPLPFPISLEFDC  112



>gb|KHG30577.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 72/114 (63%), Gaps = 7/114 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V + L PC+ Y+ G GA  V P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPVCCSGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T  DR+AAC+C+KSAA  I  G + G A+  L  +C V +PY IS ST+C+++ 
Sbjct  69   TTPDRQAACRCIKSAAAGI-TGINFGLAS-GLPGKCGVNIPYKISPSTDCNSVK  120



>gb|ABA33846.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GV++L NAA T  DRRAAC CLK+AA
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAA  84

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  85   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  120



>gb|AAT68262.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 70/120 (58%), Gaps = 5/120 (4%)
 Frame = -3

Query  598  MAKIQ--SVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MAK+    V  +A + V+L  HAD AI C  V S L PC++Y+  G +   P CC+G+ +
Sbjct  1    MAKVALLVVVCMAAVSVMLTPHADAAISCGQVVSSLTPCISYVTKGGAIPAP-CCNGIES  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            L N A +  DR+ AC C+KSAA SI  G +   A  +L  +C V LPY IS S +C T+ 
Sbjct  60   LNNQATSTPDRQTACNCIKSAAASI-KGINFSLAG-SLPGKCGVNLPYKISPSIDCSTVQ  117



>gb|AAT80650.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80651.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80653.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80654.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80655.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80656.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80657.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80658.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80659.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLK  419
            MA    + L   + + + V    AI C  V S+L+PC  Y+  G   V P+CC+G+R + 
Sbjct  1    MASSAVIKLALVVALCMAVSVAHAITCGQVSSNLVPCFDYVRSGGP-VPPACCNGIRTIN  59

Query  418  NaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
              A T  DR+AAC CLKS AGS+ +G + G  A++L  +C V +PY IS STNC T+
Sbjct  60   GLAKTTPDRQAACNCLKSLAGSV-SGVNPGN-AESLPGKCGVNVPYKISTSTNCATV  114



>ref|XP_009146980.1| PREDICTED: non-specific lipid-transfer protein 6 [Brassica rapa]
Length=113

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = -3

Query  541  HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSA  362
              + A+ C+ V  DL PCL+Y++ G + V  +CC+G+R L + A T  DR+  C+C+K+A
Sbjct  16   RGEAAVSCNAVVGDLYPCLSYVVQGGN-VPANCCNGIRTLNSQAQTPVDRQGVCRCIKNA  74

Query  361  AGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             G +   ++    A++L  +C V LPY+IS STNCD+IN
Sbjct  75   IGGVSFSSNNVNNAQSLPAKCGVNLPYSISPSTNCDSIN  113



>ref|XP_006367725.1| PREDICTED: non-specific lipid-transfer protein 4-like [Solanum 
tuberosum]
Length=123

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 68/120 (57%), Gaps = 4/120 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGA--SGVTPSCCDGVRN  425
            M K  +   L C +V++   A+ AI C+ V S LMPCL+Y+MGG+  S     CC G+++
Sbjct  6    MQKNSAFCFLLC-IVIISPQAEAAISCNTVYSKLMPCLSYLMGGSNKSAAPAGCCSGIQS  64

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            L  AA+T  DR+  C CLKS A S+    D   AA  LL +C V +PY IS   +C  + 
Sbjct  65   LYTAASTTTDRQGVCSCLKSGAASLGNSIDTSKAA-TLLSKCGVTVPYKISPDIDCSKVQ  123



>emb|CDY32650.1| BnaA02g07120D [Brassica napus]
Length=113

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 66/114 (58%), Gaps = 7/114 (6%)
 Frame = -3

Query  580  VALLACMVVLLYVHA--DGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaa  407
            +    C+V+ +Y+ A  D A+ C  V S L PC TY+  G + V   CC GV+ L + A 
Sbjct  5    LKFFTCLVLTVYIAASVDAALTCGTVTSSLAPCATYLSKGGAVVPGPCCAGVKKLNDMAQ  64

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T  DR+ AC+CLK+AA SI       + A  L  +C+V +PY IS+STNCD + 
Sbjct  65   TTPDRQQACKCLKAAAKSINP-----SLASGLPGKCSVSIPYPISMSTNCDNVK  113



>gb|ACJ62339.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  S  + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  32   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-SG  90

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  91   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>gb|ACJ62323.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62356.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  S  + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  32   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-SG  90

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  91   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>gb|ACJ62315.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62317.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62335.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62338.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62340.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62341.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62343.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62351.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62358.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62362.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62363.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62365.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62366.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62367.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62368.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62369.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62371.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62372.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62373.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62374.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62376.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  S  + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  32   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-SG  90

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  91   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>ref|XP_004492086.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cicer 
arietinum]
Length=120

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 4/116 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            I  +A++ CM+++       AI CS+V  ++ PCL Y+ G  S  +  CC+GV+NL + A
Sbjct  7    ITCMAMMICMMLISSPMVVNAISCSEVIGEIDPCLEYLNGRYSAPSRECCEGVKNLSHIA  66

Query  409  ataddrraACQCLKSAAGSIPAGADVGT-AAKNLLRQCNVKLPYTISVSTNCDTIN  245
             T   RRA C+CLKSAA SI   +D+    A  L R+C VKL Y +S S +C+ I 
Sbjct  67   HTTSARRATCECLKSAAYSI---SDLNRHHADALARRCGVKLHYRVSTSIDCNRIR  119



>emb|CDY00655.1| BnaC03g36390D [Brassica napus]
Length=113

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -3

Query  541  HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSA  362
            H + A+ C++V  DL PCL+Y+M G +  + +CC+GVR L + A T  DR++ C+C+K+A
Sbjct  17   HGEAAVTCNNVVGDLYPCLSYVMQGGNAPSTNCCNGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  361  AGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCD  254
             G     +     A +L  +C V LP++IS STNC+
Sbjct  77   IGGASYSSSNLNNALSLPAKCGVNLPFSISPSTNCN  112



>ref|XP_002872988.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49247.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ A+ C+ VQ+DL PCL Y++ G + +  SCC G++ LK  A +A DR+A C+C+KSA 
Sbjct  20   SEAAVSCNAVQADLYPCLAYVVQGGN-IPQSCCTGIKMLKQQAKSASDRQAVCRCIKSAV  78

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            G +   +     A  L  +C VKLPY I  STNC++I 
Sbjct  79   GRVSYSSTYLKNAATLPGKCGVKLPYKIDPSTNCNSIK  116



>gb|ACJ62355.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=109

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  S  + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  20   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-SG  78

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  79   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  109



>gb|ADK60918.1| lipid transfer protein [Castanea sativa]
Length=118

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = -3

Query  565  CMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrra  386
            CMV+   V A  AI C  VQS L+ C+ Y+  G S  T +CC+GV++L NAA T  DR+A
Sbjct  16   CMVIGAPV-AQAAISCGQVQSSLVACIPYLRSGGS-PTQACCNGVKSLNNAAKTTADRQA  73

Query  385  ACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            AC+CLK+AAGSI +G     AA +L  +C V +PY IS STNC  +
Sbjct  74   ACECLKTAAGSI-SGLSPANAA-SLPGKCGVNVPYKISTSTNCKNV  117



>ref|XP_003605309.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=545

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 73/122 (60%), Gaps = 5/122 (4%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            KI  V L+ CM+V     AD AI C  V S L PC+ Y+ GG  G +P+CC GV+ L  A
Sbjct  5    KIACVVLMMCMIVAPM--ADAAISCGTVTSALGPCIGYLKGGP-GPSPACCGGVKRLNGA  61

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN*ELK  233
            AAT  DR+AAC CLK AAG+I +G +   AA  L  +C V +PY IS STNC      + 
Sbjct  62   AATTPDRQAACNCLKQAAGAI-SGLNT-AAASALPGKCGVNIPYKISTSTNCHQGMKMMM  119

Query  232  WL  227
            WL
Sbjct  120  WL  121


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 3/119 (3%)
 Frame = -3

Query  601  VMAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            +MA ++   +L  M +++   A+ AI C  V   L PC+ Y+ GG SG + +CC GV+ L
Sbjct  429  IMASMKVACVLLMMCIIVAPMAEAAITCGTVTGSLAPCIGYLKGG-SGPSAACCGGVKRL  487

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             +AA T  DR+AAC CLKSAAG+I +G +   AA  L  +C V +PY IS STNC TI 
Sbjct  488  NSAATTTPDRQAACNCLKSAAGAI-SGLNPNIAA-GLPGKCGVNIPYKISTSTNCATIR  544



>gb|AFR54362.1| nonspecific lipid transfer protein 5 [Triticum aestivum]
 emb|CDM80962.1| unnamed protein product [Triticum aestivum]
 emb|CDM80969.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L V  D AI C  V S L PC++Y  G  +    +CC GVR+L  AA +  D
Sbjct  11   LVAMVAAMLLVACDAAISCGQVTSALSPCISYARGNGANPPAACCSGVRSLAGAARSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + AG   G  +K     C V +PY IS S +C  I 
Sbjct  71   KQAACKCIKSAAGGLNAGKAAGIPSK-----CGVSVPYAISSSVDCSKIR  115



>emb|CAB96876.2| pru p 1 [Prunus persica]
Length=91

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A T  DR+AAC CLK  + S+P
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGA-VPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  59

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             G +   AA  L  +C V +PY IS STNC T+
Sbjct  60   -GVNPNNAAA-LPGKCGVSIPYKISASTNCATV  90



>sp|P81651.2|NLTP1_PRUAR RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru ar 3; AltName: Allergen=Pur 
ar 3 [Prunus armeniaca]
Length=91

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A T  DRR AC CLK  +GSI 
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGA-VPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSI-  58

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            +G +   AA  L  +C V +PY IS STNC T+
Sbjct  59   SGVNPNNAAA-LPGKCGVNIPYKISASTNCATV  90



>gb|KDP22770.1| hypothetical protein JCGZ_00357 [Jatropha curcas]
Length=116

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHAD--GAIMCSDVQSDLMPCLTYIM-GGASGVTPSCCDGVRNLKNaaat  404
            L++ +V+ ++V A    AI C  V S L PC+TY+   GA    P+CC+GVR++ +AA +
Sbjct  6    LISILVLCMFVAAPITEAITCGQVTSALAPCITYLRTRGAKTPPPNCCNGVRSINSAAKS  65

Query  403  addrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
              DR+ ACQCLK AAGS+ +G   G  A+ L   C V +PY IS+STNC+ +
Sbjct  66   TPDRQQACQCLKQAAGSV-SGIIPGN-AEALPGACKVNIPYKISLSTNCNNV  115



>gb|ABA33848.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=110

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GV++L NAA T  DRRAAC CLK+AA
Sbjct  15   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAA  74

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  75   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  110



>gb|AEN70933.1| lipid transfer protein [Gossypium davidsonii]
 gb|AEN70934.1| lipid transfer protein [Gossypium klotzschianum]
Length=120

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 7/113 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMGGASGVT-PSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V S L PC+ Y+ G  +GV  P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCIAYLTGNGAGVVPPRCCGGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            T  DR+AAC+C+KSAA S+ +G + G A+  L  +C V +PY IS ST+C+  
Sbjct  69   TTPDRQAACKCIKSAAASM-SGINYGIAS-GLPGKCGVNIPYKISPSTDCNRF  119



>pdb|2ALG|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2ALG|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2B5S|A Chain A, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
 pdb|2B5S|B Chain B, Crystal Structure Of Peach Pru P3, The Prototypic Member 
Of The Family Of Plant Non-Specific Lipid Transfer Protein 
Pan-Allergens
Length=92

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A T  DR+AAC CLK  + S+P
Sbjct  2    ITCGQVSSSLAPCIPYVRGGGA-VPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  60

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             G +   AA  L  +C V +PY IS STNC T+
Sbjct  61   -GVNPNNAAA-LPGKCGVSIPYKISASTNCATV  91



>ref|XP_003516421.1| PREDICTED: non-specific lipid-transfer protein 1-like [Glycine 
max]
Length=117

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 5/119 (4%)
 Frame = -3

Query  598  MAKIQSVA--LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA    +A  +LACMVV++  +    I C  VQ +L PCL ++  G + V+  CC+GVR+
Sbjct  1    MASFTKLACMVLACMVVMVAHNTVQGIRCGQVQGNLAPCLGFLQNGGA-VSRGCCNGVRS  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            + N A T  DRRA C CLK AAG++         A+ L  +C V +PY IS STNC++I
Sbjct  60   IVNNARTTGDRRAVCNCLKIAAGAVRKLNPYN--AQALPGKCGVNIPYKISTSTNCNSI  116



>ref|XP_008370253.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
 ref|XP_008363932.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLY------VHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCD  437
            MA    +  LAC+VV+++        A+ A+ C  V + L+PCL+Y+  G + + P+CC+
Sbjct  1    MASSGQLLKLACLVVVMFCMVAGAPKAEAAVTCGQVVNSLVPCLSYVTNGGA-LNPACCN  59

Query  436  GVRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNC  257
            GV+ L N A T  DR+  C CLK A   IP        A  L  +C V +PY IS ST+C
Sbjct  60   GVKTLYNLAQTTPDRQNVCNCLKQAINGIPYTNTNAGLAAGLPARCGVNIPYKISPSTDC  119

Query  256  DTI  248
             ++
Sbjct  120  KSV  122



>gb|AAT80652.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80660.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80661.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80662.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = -3

Query  571  LACMVVL-LYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            LA +V L + V    AI C  V S+L+PC  Y+  G   V P+CC+G+R +   A T  D
Sbjct  9    LALVVALCMAVSVAHAITCGQVSSNLVPCFDYVRSGGP-VPPACCNGIRTINGLAKTTPD  67

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            R+AAC CLKS AGS+ +G + G  A++L  +C V +PY IS STNC T+
Sbjct  68   RQAACNCLKSLAGSV-SGVNPGN-AESLPGKCGVNVPYKISTSTNCATV  114



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 78/122 (64%), Gaps = 8/122 (7%)
 Frame = -3

Query  598  MAKIQSVALL---ACMVVLLYVHADGAIMCSDVQSDLMPCLTYI-MGGASGVTPSCCDGV  431
            MAK+ S+A++   A ++ ++  HA+  + C  V +DL PCL Y+ MGGA  +   CC+G+
Sbjct  1    MAKVASLAVVCIAAMLIAIVASHAEAVVTCGTVATDLSPCLDYVRMGGA--IPAMCCNGI  58

Query  430  RNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDT  251
            R+L +AA+T  DR+  C C+KSAAG+I +G ++  AA  L  +C V +PY IS S +C  
Sbjct  59   RSLFSAASTTQDRQTVCNCMKSAAGAI-SGVNLNLAAA-LPNKCGVNIPYKISPSIDCAK  116

Query  250  IN  245
            + 
Sbjct  117  VQ  118



>gb|ACJ62319.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62329.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62330.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62331.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=116

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  S  + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  27   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-SG  85

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  86   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  116



>gb|ACJ62318.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62324.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62325.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62328.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62345.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62346.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62347.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62348.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62349.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62350.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62352.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62353.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62354.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62357.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62364.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62370.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62375.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62377.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62378.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62379.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=116

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  S  + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  27   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-SG  85

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  86   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  116



>gb|ACG40474.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
Length=120

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  SG +  CC GVR+L NAA T   RRAAC CLK+AA
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAXRRAACNCLKNAA  84

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  85   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  120



>gb|AFR43295.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 75/123 (61%), Gaps = 8/123 (7%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDG  434
            MA+  S+ L AC+VVL  +     A GAI C  V+S L+PC+ Y+ G  A    P+CC G
Sbjct  1    MARSMSLKL-ACVVVLCSLVDAPLAQGAISCDQVKSSLLPCVGYVRGNNARPAPPNCCKG  59

Query  433  VRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCD  254
            +R+LK+AA    DR+AAC+C+KS A  I +  + G AA  L  QCNV +PY IS S +C 
Sbjct  60   IRSLKSAARIRLDRQAACKCIKSLAADI-SDINYGVAA-GLPGQCNVHIPYKISPSIDCK  117

Query  253  TIN  245
             + 
Sbjct  118  RVK  120



>gb|ACL01093.1| lipid transfer protein [Castanea mollissima]
Length=118

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = -3

Query  565  CMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrra  386
            CMV+   V A  AI C  VQS L+ C+ Y+  G S  T +CC+GV++L NAA T  DR+A
Sbjct  16   CMVIGEPV-AQAAISCGQVQSSLVACIPYLRSGGS-PTQACCNGVKSLNNAAKTTADRQA  73

Query  385  ACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            AC+CLK+AAGSI +G     AA +L  +C V +PY IS STNC  + 
Sbjct  74   ACECLKTAAGSI-SGLSPANAA-SLPGKCGVNVPYKISTSTNCKNVK  118



>gb|ACJ62342.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  S  + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  32   CGQVSSAIAPCLSYARGTGSAPSGSCCSGVRNLKSAASTAADRRAACNCLKNAARGV-SG  90

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  91   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>sp|P81402.1|NLTP1_PRUPE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Allergen Pru p 1; AltName: Full=Major allergen 
Pru p 3; AltName: Allergen=Pru p 3 [Prunus persica]
Length=91

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S L PC+ Y+ GG + V P+CC+G+RN+ N A T  DR+AAC CLK  + S+P
Sbjct  1    ITCGQVSSALAPCIPYVRGGGA-VPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  59

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             G +   AA  L  +C V +PY IS STNC T+
Sbjct  60   -GVNPNNAAA-LPGKCGVHIPYKISASTNCATV  90



>gb|AAY43801.1| FSLTP3 [Gossypium hirsutum]
Length=116

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V + L PC+ Y+ G GA  V P CC G+++L +AA 
Sbjct  5    LACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNSAAQ  64

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            T  DR+AAC+C+KSAA  I  G + G A+  L  +C V +PY IS ST+C+  
Sbjct  65   TTPDRQAACRCIKSAAAGI-TGINFGLAS-GLPGKCGVNIPYKISPSTDCNRF  115



>gb|ABA33857.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  S  +  CC GVR+L NAA T  DRRAAC CLK+AA
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSAPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  84

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  85   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  120



>emb|CAN70512.1| hypothetical protein VITISV_005630 [Vitis vinifera]
Length=115

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            +L CM+V   +  +G + C DV + L PC+ Y+   A  + P+CC+GV+NLKN+AAT  D
Sbjct  13   VLMCMLVASPMAVEG-LSCGDVATQLAPCINYLRS-AGPLPPACCNGVKNLKNSAATTQD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCD  254
            RR AC+CL +A+ SI +G + G AA  L  +C V +PY IS STNCD
Sbjct  71   RRTACKCLINASKSI-SGVNFGLAA-GLPGKCGVNIPYKISPSTNCD  115



>ref|XP_007134675.1| hypothetical protein PHAVU_010G066500g [Phaseolus vulgaris]
 gb|ADC80502.1| non-specific lipid transfer protein 1a precursor [Phaseolus vulgaris]
 gb|ESW06669.1| hypothetical protein PHAVU_010G066500g [Phaseolus vulgaris]
Length=115

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPS-CCDGVRNL  422
            MA ++   ++   +V++  H    + C  VQS+L+PC+T++  G  G  P+ CC+GVRN+
Sbjct  1    MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNG--GFVPAGCCNGVRNI  58

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             N+A +  DRR  C CLK+AAG++  G +    A+ L  +C V +PY IS STNC +IN
Sbjct  59   MNSARSTADRRGICNCLKTAAGAV-RGLNPNN-AQALPGKCGVNIPYKISTSTNCASIN  115



>gb|ADY68820.1| lipid transfer protein 3 [Gossypium herbaceum subsp. africanum]
 gb|ADY68822.1| lipid transfer protein 3 [Gossypium barbadense]
 gb|ADY68824.1| lipid transfer protein 3 [Gossypium hirsutum]
 gb|AEN70921.1| lipid transfer protein [Gossypium darwinii]
 gb|AEN70923.1| lipid transfer protein [Gossypium tomentosum]
 gb|AEN70925.1| lipid transfer protein [Gossypium barbadense var. brasiliense]
 gb|AEN70927.1| lipid transfer protein [Gossypium barbadense var. peruvianum]
 gb|AEN70929.1| lipid transfer protein [Gossypium hirsutum subsp. latifolium]
Length=120

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V + L PC+ Y+ G GA  V P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            T  DR+AAC+C+KSAA  I  G + G A+  L  +C V +PY IS ST+C+  
Sbjct  69   TTPDRQAACRCIKSAAAGI-TGINFGLAS-GLPGKCGVNIPYKISPSTDCNRF  119



>gb|ACG29829.1| nonspecific lipid-transfer protein 1 precursor [Zea mays]
Length=123

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  SG + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  32   CGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-SG  90

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCD  254
             + G AA ++  +C V +PYTIS ST+C 
Sbjct  91   LNAGNAA-SIPSKCGVSIPYTISTSTDCS  118



>gb|ABB90546.1| lipid transfer protein [Triticum aestivum]
 gb|ABF14725.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
Length=115

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 60/110 (55%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L   +  ++    D AI C  V S L PC++Y  G  S    +CC GVR+L  AA +  D
Sbjct  11   LFTLVAAMVLTATDAAISCGQVSSALSPCISYARGSGSSPPAACCSGVRSLAGAARSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + AG   G  +K     C V +PY IS S +C  I 
Sbjct  71   KQAACKCIKSAAGGLNAGKAAGIPSK-----CGVSIPYAISSSVDCSKIR  115



>gb|ABA34092.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34093.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 tpg|DAA59230.1| TPA: phospholipid transfer protein-like protein [Zea mays]
Length=119

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  SG + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  32   CGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-SG  90

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCD  254
             + G AA ++  +C V +PYTIS ST+C 
Sbjct  91   LNAGNAA-SIPSKCGVSIPYTISTSTDCS  118



>gb|EMS57993.1| Non-specific lipid-transfer protein 4.1 [Triticum urartu]
Length=115

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 64/117 (55%), Gaps = 5/117 (4%)
 Frame = -3

Query  595  AKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKN  416
            A +  + L+A +  +L +  D AI C  V S L PC++Y  G  +  + +CC GVR L  
Sbjct  4    AAVARLVLVALVATMLLIATDAAISCGQVNSALSPCISYARGNGANPSAACCSGVRRLAG  63

Query  415  aaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            A  +  D++    C+KSAAG + AG      A ++  +C+V +PY IS S +C TI 
Sbjct  64   AVRSTTDKKTTFNCIKSAAGGLNAG-----KAADIPSKCSVSIPYAISPSLDCSTIR  115



>gb|AFR43294.1| lipid transfer protein precursor [Gossypium raimondii]
Length=120

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 73/122 (60%), Gaps = 6/122 (5%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHA---DGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGV  431
            MA+  S+ L   +V+ L V A    GAI C  V+S L+PC+ Y+ G  A    P+CC G+
Sbjct  1    MARSMSLKLSCVVVLCLLVDAPLAQGAISCDQVKSSLLPCVGYVRGNNARPAPPNCCKGI  60

Query  430  RNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDT  251
            R+LK+AA    DR+AAC+C+KS A  I +  + G AA  L  QCNV +PY IS S +C  
Sbjct  61   RSLKSAARIRLDRQAACKCIKSLAADI-SDINYGVAA-GLPGQCNVHIPYKISPSIDCKR  118

Query  250  IN  245
            + 
Sbjct  119  VK  120



>gb|AAF35185.1|AF195864_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43282.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43283.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43284.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 70/114 (61%), Gaps = 7/114 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            L C+VV   V     A GAI C  + S L PC+ Y+ G GA    P+CC+G+R+L +AA 
Sbjct  9    LTCVVVFCMVVGAPLAQGAISCGQITSALAPCIAYLKGNGAGSAPPACCNGIRSLNSAAK  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T  DR+AAC C+KSAA  I +G +  TAA  L  +C + +PY IS ST+C +I 
Sbjct  69   TTPDRQAACSCIKSAATGI-SGINYSTAA-GLPGKCGINIPYKISPSTDCKSIK  120



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein-like isoform 1 
[Fragaria vesca subsp. vesca]
 ref|XP_004302609.1| PREDICTED: non-specific lipid-transfer protein-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=116

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 69/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  589  IQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
            +  +AL+A + +++ V    AI C  V  ++ PC  Y+  G + V  +CC+G+R+L +AA
Sbjct  5    VMKLALVALICIVVAVPVAQAITCGQVTQNVAPCFNYVKSGGA-VPAACCNGIRSLNSAA  63

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+  C CLKSAAGSI  G +   AA  L  +C V +PY IS STNC+ +
Sbjct  64   KTTADRKQTCNCLKSAAGSIK-GLNANLAA-GLPGKCGVNVPYKISTSTNCNNV  115



>ref|XP_009757911.1| PREDICTED: non-specific lipid-transfer protein 2 [Nicotiana sylvestris]
 dbj|BAK19151.1| lipid transfer protein [Nicotiana tabacum]
Length=114

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 69/119 (58%), Gaps = 9/119 (8%)
 Frame = -3

Query  589  IQSVALLACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            ++ V  +AC VVL  V    HA+ A+ C  VQS L PCL Y+ G   G   SCC GV+ L
Sbjct  1    MEMVGKIACFVVLCMVVVAPHAE-ALSCGQVQSGLAPCLPYLQG--RGPLGSCCGGVKGL  57

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              AA +  DR+ AC CLKSAA +I  G D+G AA  L   C V +PY IS ST+C  + 
Sbjct  58   LGAAKSPSDRKTACTCLKSAANAI-KGIDMGKAA-GLPGACGVNIPYKISPSTDCSKVQ  114



>ref|XP_008388344.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 69/124 (56%), Gaps = 7/124 (6%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYV------HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCD  437
            MA    +  LAC+VV+++        A+ A+ C  + SDL PC++Y+  G + + P+CC+
Sbjct  1    MASSGQLLKLACLVVVMFCMVACVPKAEAAVTCGQMVSDLTPCISYVKXGGA-LAPACCN  59

Query  436  GVRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNC  257
            GVR L   A T  DR++ C CLK A   IP        A  L  +C+V +PY IS ST+C
Sbjct  60   GVRTLFTLAQTXPDRQSVCNCLKQAINGIPYTNTNAGLAAGLPAKCSVNIPYKISPSTDC  119

Query  256  DTIN  245
             ++ 
Sbjct  120  KSVK  123



>ref|XP_008461223.1| PREDICTED: non-specific lipid-transfer protein 8 [Cucumis melo]
Length=115

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 70/118 (59%), Gaps = 3/118 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLK  419
            MA I  +  +   V LL   +   I CSDV  DLMPC++Y++ G+     +CCDG + L 
Sbjct  1    MATIPKLGAILLFVFLLLGVSKATISCSDVTKDLMPCVSYLVSGSGKPPSACCDGAKALS  60

Query  418  NaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +AA +  D++AACQC+KSAA ++   A +   A++L   C + LP++IS   +C  IN
Sbjct  61   SAATSGADKKAACQCIKSAASNVNYNAKL---AQDLPSNCGITLPFSISAGIDCSKIN  115



>sp|Q43748.1|NLTP_BETVU RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Beta vulgaris]
 emb|CAA63407.1| IWF1' [Beta vulgaris subsp. vulgaris]
Length=117

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = -3

Query  577  ALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatad  398
            AL+ CM+V   +    AI C  V S L PC+ Y+ G A G + +CC G+++L +AAA+  
Sbjct  12   ALVMCMMVAAPLAE--AITCGLVASKLAPCIGYLQG-APGPSAACCGGIKSLNSAAASPA  68

Query  397  drraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            DR+ AC CLKSAA SI  G + G AA +L RQC V +PY IS +TNC+ I+
Sbjct  69   DRKTACTCLKSAATSI-KGINYGKAA-SLPRQCGVSVPYAISPNTNCNAIH  117



>ref|XP_006662671.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Oryza 
brachyantha]
Length=117

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 65/95 (68%), Gaps = 3/95 (3%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI C  V S + PCL+Y  GGA G + +CC GVR+L +AA+T  DRR AC CLK+AAGSI
Sbjct  26   AISCGQVNSAVGPCLSYARGGA-GPSSACCSGVRSLSSAASTTADRRTACNCLKNAAGSI  84

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             +G + G AA ++  +C V +PYTIS S +C  ++
Sbjct  85   -SGLNAGNAA-SIPSKCGVSIPYTISTSIDCSRVS  117



>gb|AAT68264.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 63/101 (62%), Gaps = 3/101 (3%)
 Frame = -3

Query  550  LYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCL  371
            L  HAD AI C  V S L+PC+ Y++ G +   P CC+G+++L N A +  DR+ AC C+
Sbjct  19   LTPHADAAIFCGRVVSSLIPCINYVIKGGAIPAP-CCNGIKSLNNQATSTPDRQTACNCI  77

Query  370  KSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            KSAA SI  G +  + A +L  +C V LPY IS S +C T+
Sbjct  78   KSAAASI-KGINF-SHAGSLPGKCGVNLPYKISPSIDCSTV  116



>emb|CDX73941.1| BnaA03g31060D [Brassica napus]
 emb|CDX73942.1| BnaA03g31050D [Brassica napus]
Length=113

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = -3

Query  541  HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSA  362
            H + A+ C++V  DL PCL+Y+M G +  + +CC GVR L + A T  DR++ C+C+K+A
Sbjct  17   HGEAAVTCNNVVGDLYPCLSYVMQGGNSPSTNCCSGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  361  AGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCD  254
             G     +     A +L  +C V LP++IS STNC+
Sbjct  77   IGGASYSSSNLKNALSLPAKCGVNLPFSISPSTNCN  112



>sp|Q03461.1|NLTP2_TOBAC RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA03044.1| lipid transfer protein [Nicotiana tabacum]
Length=114

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 69/119 (58%), Gaps = 9/119 (8%)
 Frame = -3

Query  589  IQSVALLACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            ++ V  +AC VVL  V    HA+ A+ C  VQS L PCL Y+ G   G   SCC GV+ L
Sbjct  1    MEMVGKIACFVVLCMVVVAPHAE-ALSCGQVQSGLAPCLPYLQG--RGPLGSCCGGVKGL  57

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              AA +  DR+ AC CLKSAA +I  G D+G AA  L   C V +PY IS ST+C  + 
Sbjct  58   LGAAKSLSDRKTACTCLKSAANAI-KGIDMGKAA-GLPGACGVNIPYKISPSTDCSKVQ  114



>gb|KHN29530.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=116

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 65/109 (60%), Gaps = 4/109 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            +L CM V+       A+ C+DV  +L PCL+Y+M G   V  SCC GVRN+  +A+T  D
Sbjct  10   VLMCMAVMSAPMMVQAVSCNDVSVNLAPCLSYLMQGGD-VPESCCSGVRNILGSASTTFD  68

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            ++  C+CL+ AA +     +   A   L  +CNV +PY IS STNCD+I
Sbjct  69   KQTVCKCLQQAANNYGINDEYAQA---LPARCNVSVPYKISRSTNCDSI  114



>ref|NP_001067782.1| Os11g0427800 [Oryza sativa Japonica Group]
 gb|AAX96637.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 gb|ABA93211.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28145.1| Os11g0427800 [Oryza sativa Japonica Group]
 gb|EAY80752.1| hypothetical protein OsI_35929 [Oryza sativa Indica Group]
 gb|EAZ18211.1| hypothetical protein OsJ_33751 [Oryza sativa Japonica Group]
 dbj|BAG87838.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92398.1| unnamed protein product [Oryza sativa Japonica Group]
Length=117

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PCLTY  GG +G + +CC+GVR+LK+AA T  DRR AC CLK+AA  I 
Sbjct  26   ITCGQVNSAVGPCLTYARGGGAGPSAACCNGVRSLKSAARTTADRRTACNCLKNAARGIK  85

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             G + G AA ++  +C V +PYTIS S +C  +
Sbjct  86   -GLNAGNAA-SIPSKCGVSVPYTISASIDCSRV  116



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI C  V S + PCL+Y  GG SG + +CC GVR+L +AA T  DRR AC CLK+ AGSI
Sbjct  26   AISCGQVNSAVSPCLSYARGG-SGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSI  84

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             +G + G AA ++  +C V +PYTIS S +C ++N
Sbjct  85   -SGLNAGNAA-SIPSKCGVSIPYTISPSIDCSSVN  117



>gb|ABA34089.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34091.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
Length=119

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PCL+Y  G  S  + SCC GVRNLK+AA+TA DRRAAC CLK+AA  + 
Sbjct  30   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGV-  88

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCD  254
            +G + G AA ++  +C V +PYTIS ST+C 
Sbjct  89   SGLNAGNAA-SIPSKCGVSIPYTISTSTDCS  118



>ref|XP_006663743.1| PREDICTED: non-specific lipid-transfer protein 2B-like isoform 
X1 [Oryza brachyantha]
Length=117

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 65/95 (68%), Gaps = 3/95 (3%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI C  V S + PCL+Y  GGA G + +CC GVR+L +AA+T  DRR AC CLK+AAGSI
Sbjct  26   AISCGQVNSAVGPCLSYARGGA-GPSSACCSGVRSLSSAASTTADRRTACNCLKNAAGSI  84

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             +G + G AA ++  +C V +PYTIS S +C  ++
Sbjct  85   -SGLNAGNAA-SIPSKCGVSIPYTISTSIDCSRVS  117



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 65/95 (68%), Gaps = 3/95 (3%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI C  V S + PCL+Y  GG SG + +CC GVR+L +AA+T  DRR AC CLK+ AGSI
Sbjct  27   AISCGQVNSAVSPCLSYARGG-SGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  85

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             +G + G AA ++  +C V +PYTIS S +C ++N
Sbjct  86   -SGLNAGNAA-SIPSKCGVSIPYTISPSIDCSSVN  118



>gb|ABA33856.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=117

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PC++Y  G  SG +  CC GVR+L NAA T  DRRAAC CLK+AA  + 
Sbjct  26   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGV-  84

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  85   SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  117



>ref|XP_006407743.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
 gb|ESQ49196.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
Length=113

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
             + A+ C+ V S+L PC++Y++ G + V  SCC+G+R L   A T  DR++ C+C+K+A 
Sbjct  17   GEAAVSCNSVVSELYPCISYVVQGGN-VPASCCNGIRTLNGQAQTPADRQSVCRCIKNAI  75

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            G +   ++    A +L  +C V LPY IS STNCD+IN
Sbjct  76   GGVSYSSNNLNNALSLPAKCGVNLPYRISPSTNCDSIN  113



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI C  V S + PCL+Y  GG SG + +CC GVR+L +AA T  DRR AC CLK+ AGSI
Sbjct  19   AISCGQVNSAVSPCLSYARGG-SGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSI  77

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             +G + G AA ++  +C V +PYTIS S +C ++N
Sbjct  78   -SGLNAGNAA-SIPSKCGVSIPYTISPSIDCSSVN  110



>ref|XP_002442775.1| hypothetical protein SORBIDRAFT_08g002680 [Sorghum bicolor]
 gb|EES16613.1| hypothetical protein SORBIDRAFT_08g002680 [Sorghum bicolor]
Length=119

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ A+ C  V S + PCL+Y  G  SG +  CC GVR+L +AA T  DRRAAC CLK+AA
Sbjct  24   SEAAVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAA  83

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              I  G +VG AA ++  +C V +PYTIS ST+C  ++
Sbjct  84   RGI-RGLNVGKAA-SIPSKCGVSIPYTISTSTDCSRVS  119



>ref|XP_008391369.1| PREDICTED: non-specific lipid-transfer protein [Malus domestica]
Length=113

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 3/116 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLK  419
            MA    + L   + + + V    AI C  V S+L PC+ Y+ GG   V P+CC+G+R + 
Sbjct  1    MASSAVIKLALVVALCMAVSVAHAITCGQVSSNLAPCIGYLRGGGP-VPPACCNGIRTIN  59

Query  418  NaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDT  251
            + A T  DR+A C CLKS A S+ +G + G  A++L  +C V +PY IS STNC T
Sbjct  60   SLAETTPDRQAVCNCLKSLASSV-SGVNPGN-AESLPGKCGVNVPYKISTSTNCTT  113



>gb|AAB70538.1| lipid transfer protein [Oryza sativa Indica Group]
Length=115

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PCL+Y  GG SG + +CC GVRNL +AA T  DRR AC CLK+ AGSI 
Sbjct  25   ISCGQVNSAVSPCLSYARGG-SGPSAACCSGVRNLNSAATTTADRRTACNCLKNVAGSI-  82

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +G + G AA  +  +C V +PYTIS S  C ++N
Sbjct  83   SGLNAGNAAS-IPSKCGVSIPYTISPSVYCSSVN  115



>gb|ABE11609.1| lipid-transfer protein precursor [Solanum chacoense]
Length=115

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 70/121 (58%), Gaps = 6/121 (5%)
 Frame = -3

Query  607  LPVMAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVR  428
            + +++KI    LL CMVV+   HA+ A+ C  V S L  CL Y+    +G    CC GV+
Sbjct  1    MEIVSKIACFVLL-CMVVVA-PHAEAALTCGQVTSSLFSCLPYLRN--TGPLGDCCSGVK  56

Query  427  NLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             LK  A T  DR+ AC CLKS AGSI  G + G AA +L   C+V +PY IS ST+C  +
Sbjct  57   KLKGQAQTTADRQTACNCLKSTAGSI-KGLNFGKAA-SLPSTCSVNIPYEISPSTDCSKV  114

Query  247  N  245
             
Sbjct  115  Q  115



>sp|Q43194.1|NLTP2_SORBI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Sorghum bicolor]
 emb|CAA50661.1| lipid transfer protein [Sorghum bicolor]
Length=122

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ A+ C  V S + PCL+Y  G  SG +  CC GVR+L +AA T  DRRAAC CLK+AA
Sbjct  27   SEAAVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAA  86

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              I  G +VG AA ++  +C V +PYTIS ST+C  ++
Sbjct  87   RGI-RGLNVGKAA-SIPSKCGVSIPYTISTSTDCSRVS  122



>gb|AAA74624.1| lipid transfer protein precursor [Oryza sativa]
Length=118

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 65/95 (68%), Gaps = 3/95 (3%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI C  V S + PCL+Y  GG SG + +CC GVR+L +AA+T  DRR AC CLK+ AGSI
Sbjct  27   AISCGQVNSAVSPCLSYARGG-SGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  85

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             +G + G AA ++  +C V +PYTIS S +C ++N
Sbjct  86   -SGLNAGNAA-SIPSKCGVTIPYTISPSIDCSSVN  118



>ref|XP_010683516.1| PREDICTED: non-specific lipid-transfer protein [Beta vulgaris 
subsp. vulgaris]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = -3

Query  577  ALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatad  398
            AL+ CM+V   +    AI C  V S L PC+ Y+ G A G +  CC G+++L +AAA+  
Sbjct  12   ALVMCMMVAAPLAE--AITCGLVASKLAPCIGYLQG-APGPSAGCCGGIKSLNSAAASPA  68

Query  397  drraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            DR+ AC CLKSAA SI  G + G AA +L RQC V +PY IS +TNC+ I+
Sbjct  69   DRKTACTCLKSAATSI-KGINYGKAA-SLPRQCGVSVPYAISPNTNCNAIH  117



>emb|CAH04986.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=117

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 71/116 (61%), Gaps = 6/116 (5%)
 Frame = -3

Query  580  VALLACMVVLLYVH----ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            VALLA   VL  +     A GA+ CSDV S + PC++Y  G AS  +  CC GVR L   
Sbjct  4    VALLAVFTVLAALAVAEMASGAVTCSDVTSAIAPCMSYATGQASSPSAGCCSGVRTLNGK  63

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            A+T+ DR+AAC+CLK+ AGS   G  +G AA N+  +C V + + I+ S NC+ ++
Sbjct  64   ASTSADRQAACRCLKNLAGSFN-GISMGNAA-NIPGKCGVSVSFPINNSVNCNNLH  117



>gb|AET05730.1| lipid transfer protein isoform a, partial [Pyrus communis]
Length=94

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 63/94 (67%), Gaps = 3/94 (3%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI CS V S+L PC+ Y+  G + V P+CC+G++ +   A T  DR+AAC CLK+ AGS+
Sbjct  3    AITCSQVSSNLAPCINYVRSGGA-VPPACCNGIKTINGLANTTPDRQAACNCLKNLAGSV  61

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             +G + G  A++L  +C V +PY IS STNC T+
Sbjct  62   -SGVNPGN-AESLPGKCGVNVPYKISTSTNCATV  93



>emb|CDM80964.1| unnamed protein product [Triticum aestivum]
 emb|CDJ26653.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 62/110 (56%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L +  D AI C  V   L PC++Y  G  +    +CC GVR+L  AA +  D
Sbjct  11   LVAMVAAMLLIATDAAISCGQVSPALSPCISYARGNGANPPAACCSGVRSLAGAARSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + AG   G  +K     C V +PY IS + +C  I 
Sbjct  71   KQAACKCIKSAAGGLNAGKAAGIPSK-----CGVSVPYAISATVDCSKIR  115



>gb|ADR66945.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=119

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 68/117 (58%), Gaps = 4/117 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLK  419
            M K+  V  L CMVV + +    AI C  V S L PC+ Y+  G + V P+CC+G+R L 
Sbjct  6    MTKLALVVAL-CMVVSVPIAQAQAITCGQVVSTLAPCINYVKSGGA-VPPACCNGIRTLN  63

Query  418  NaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
              A T  DR+AAC  LK  +GSIP G +   AA  L  +C V +PY IS+STNC  +
Sbjct  64   GLAKTTADRQAACNRLKQLSGSIP-GVNPNNAAA-LPGKCGVNVPYKISISTNCAAV  118



>sp|Q9M5X6.1|NLTP_PYRCO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pyr c 3; Flags: Precursor [Pyrus communis]
 gb|AAF26451.1| lipid transfer protein precursor [Pyrus communis]
Length=115

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = -3

Query  586  QSVALLACMVVL-LYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
             +V  LA +V L + V    AI CS V ++L PC+ Y+  G + V P+CC+G++ +   A
Sbjct  4    SAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGA-VPPACCNGIKTINGLA  62

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLK+ AGS+ +G + G  A++L  +C V +PY IS STNC T+
Sbjct  63   KTTPDRQAACNCLKNLAGSV-SGVNPGN-AESLPGKCGVNVPYKISTSTNCATV  114



>ref|NP_001241144.1| uncharacterized protein LOC100817318 precursor [Glycine max]
 gb|ACU20523.1| unknown [Glycine max]
Length=122

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 71/119 (60%), Gaps = 8/119 (7%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVH--ADGAIMCSDVQSDLMPCLTYIMGGASGVTPS--CCDGVRN  425
            K+  V  + CMVV + V   A  AI C  V  D+ PCL+Y+    SG  PS  CC+GV++
Sbjct  6    KVACVVAMMCMVVAMSVTPMAQAAITCGQVAGDVSPCLSYLR---SGGKPSDACCNGVKS  62

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L  AA T  DR+AAC CLK+ A ++    + G AA +L  +C V +PY IS STNC TI
Sbjct  63   LSGAAKTTADRQAACNCLKNLANNMGQSLNAGNAA-SLPGKCGVNIPYKISTSTNCATI  120



>gb|ACJ62326.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -3

Query  520  CSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIPAG  341
            C  V S + PCL+Y  G  S  + SCC GVR+LK+AA+TA DRRAAC CLK+AA  + +G
Sbjct  32   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRSLKSAASTAADRRAACNCLKNAARGV-SG  90

Query  340  ADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
             + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  91   LNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>gb|AGC08426.1| lipid transfer protein [Gossypium hirsutum]
Length=120

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 68/114 (60%), Gaps = 7/114 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMGGASGVTPS-CCDGVRNLKNaaa  407
             AC+VVL  V     A G + C  V   L PC+ Y+ G  +G  P  CC G+++L +AA 
Sbjct  9    FACVVVLCMVVGAPLAQGTVTCGQVTGSLAPCINYLRGNGAGAVPQGCCSGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T  DR+AAC+C+KSAA  IP G + G A+  L  +C V +PY IS ST+C+ + 
Sbjct  69   TTPDRQAACKCIKSAAAGIP-GINYGIAS-GLPGKCGVNIPYKISPSTDCNKVQ  120



>gb|AAT80665.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = -3

Query  571  LACMVVL-LYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            LA +V L + V    AI C  V S+L+PC  Y+  G   V P+CC+G+R +   A T  D
Sbjct  9    LALVVALCMAVSVAHAITCGQVSSNLVPCFDYVRSGGP-VPPACCNGIRTINGLAKTTPD  67

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            R+AAC CLKS AGS+ +G + G   ++L  +C V +PY IS STNC T+
Sbjct  68   RQAACNCLKSLAGSV-SGVNPGN-VESLPGKCGVNVPYKISTSTNCATV  114



>gb|AAF35184.1|AF195863_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26701.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43273.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43274.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43275.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 68/114 (60%), Gaps = 7/114 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMGGASGVTPS-CCDGVRNLKNaaa  407
            LAC+VVL  V     A G + C  V   L PC+ Y+ G  +G  P  CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGTVTCGQVTGSLAPCINYLRGNGAGAVPQGCCSGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T  DR+AAC+C+KSAA  IP G + G A+  L  +C V +PY IS ST+C  + 
Sbjct  69   TTPDRQAACKCIKSAAAGIP-GINYGIAS-GLPGKCGVNIPYKISPSTDCSRVK  120



>sp|Q42762.1|NLTP1_GOSHI RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA75599.1| nonspecific lipid transfer protein precursor [Gossypium hirsutum]
Length=116

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 70/114 (61%), Gaps = 7/114 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+    V + L PC+ Y+ G GA  V P CC G+++L +AA 
Sbjct  5    LACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQ  64

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T   R+AAC+C+KSAA  I  G + G A+  L  +C V +PY IS ST+C+++ 
Sbjct  65   TTPVRQAACRCIKSAAAGI-TGINFGLAS-GLPGKCGVNIPYKISPSTDCNSVK  116



>ref|XP_009764784.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=114

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = -3

Query  589  IQSVALLACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            ++ V  +AC VVL  V    HA+ A+ C  VQS L PCL Y+ G   G    CC GV+ L
Sbjct  1    MEMVGKIACFVVLCMVVVAPHAE-ALSCGQVQSGLAPCLPYLQG--RGPLGGCCGGVKGL  57

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              AA +  DR+ AC CLKSAA +I  G D+G AA  L   C V +PY IS ST+C  + 
Sbjct  58   LGAAKSPADRKTACTCLKSAANAI-KGIDMGKAA-GLPSACGVNIPYKISPSTDCSKVQ  114



>ref|XP_009346911.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLY------VHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCD  437
            MA    +  L C+VV+++        A+ A+ C  V + L+PC++Y+ G    + P+CC+
Sbjct  1    MASSGQLLKLGCLVVVMFCMVAGAPKAEAAVTCGQVVNSLVPCISYV-GNGGALDPACCN  59

Query  436  GVRNLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNC  257
            GVR L N A T  DR+  C CLK A   IP        A  L  +C V +PY IS ST+C
Sbjct  60   GVRTLYNLAQTTPDRQNVCNCLKQAINGIPYTNTNAGLAAGLPAKCGVNIPYKISPSTDC  119

Query  256  DTI  248
             ++
Sbjct  120  KSV  122



>sp|Q43129.1|NLTP2_GOSHI RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=GH3; Flags: Precursor [Gossypium hirsutum]
 gb|AAB34774.1| LTP [Gossypium hirsutum]
 gb|AAY43799.1| NSLTP1 [Gossypium hirsutum]
Length=120

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 70/114 (61%), Gaps = 7/114 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+    V + L PC+ Y+ G GA  V P CC G+++L +AA 
Sbjct  9    LACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            T   R+AAC+C+KSAA  I  G + G A+  L  +C V +PY IS ST+C+++ 
Sbjct  69   TTPVRQAACRCIKSAAAGI-TGINFGLAS-GLPGKCGVNIPYKISPSTDCNSVK  120



>ref|XP_009346912.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 71/114 (62%), Gaps = 4/114 (4%)
 Frame = -3

Query  586  QSVALLACMVVL-LYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaa  410
             +V  LA +V L + V    AI C  V S+L PC+ Y+  G + V P+CC+G++ +   A
Sbjct  4    SAVIKLALVVALCMAVSVAHAITCGQVSSNLAPCINYVRSGGA-VPPACCNGIKTINALA  62

Query  409  ataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             T  DR+AAC CLKS +GSI +G + G  A++L  +C V +PY IS STNC T+
Sbjct  63   KTTPDRQAACNCLKSLSGSI-SGVNPGN-AESLPGKCGVNVPYKISTSTNCATV  114



>gb|AAY43800.1| FSLTP2 [Gossypium hirsutum]
Length=120

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = -3

Query  571  LACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMG-GASGVTPSCCDGVRNLKNaaa  407
            LAC+VVL  V     A GA+ C  V + L PC+ Y+ G GA  V P CC G+++L +AA 
Sbjct  9    LACVVVLGMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNSAAQ  68

Query  406  taddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            T  DR+AAC+C+KSAA  I  G + G A+  L  +C V +PY IS +T+C+  
Sbjct  69   TTPDRQAACRCIKSAAAGI-TGINFGLAS-GLPGKCGVNIPYKISPNTDCNRF  119



>gb|EYU42011.1| hypothetical protein MIMGU_mgv1a016819mg [Erythranthe guttata]
Length=105

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 65/108 (60%), Gaps = 4/108 (4%)
 Frame = -3

Query  571  LACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddr  392
            +A  V      A+ AI C+ +QS L PCL ++ G A  + P CC GVR++ NAA +  DR
Sbjct  1    MAVQVAYYAPQAEAAITCNQLQSGLAPCLGFLQGRA--LVPQCCAGVRSMANAARSPLDR  58

Query  391  raACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            R ACQCL+SAA +   G + G  A  L  +C V+LP+ IS +T+C  +
Sbjct  59   RTACQCLQSAAKTF-KGINFGNVAA-LPAKCGVRLPFKISPTTDCSRV  104



>gb|ABF06565.1| non-specific lipid transfer-like protein [Prosopis juliflora]
Length=117

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 67/119 (56%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLYVHADG-AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            MA +  VA +A + V L V     A+ C  V S L PC+ Y+  G +   P CC+GV++L
Sbjct  1    MAGLMKVAFMAVLCVALVVAPMAEAVTCGQVSSSLAPCIAYLQKGGT-PAPGCCNGVKSL  59

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              AA T  D++A C CLK AAG +P   +    A++L   C V +PY IS STNC +I 
Sbjct  60   VGAAQTTADKQAVCNCLKGAAGQVPGLNN--QYAQSLPSLCGVNIPYKISTSTNCASIK  116



>gb|KDP21875.1| hypothetical protein JCGZ_00662 [Jatropha curcas]
Length=120

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 68/110 (62%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHAD--GAIMCSDVQSDLMPCLTYI-MGGASGVTPSCCDGVRNLKNaaat  404
            LL+ +V+ ++V A    AI C  V   L PC+ Y+   GA    P+CC+GVR++ +AA +
Sbjct  6    LLSILVLCMFVAAPITEAITCGQVSGALAPCINYLRTAGAKAPPPNCCNGVRSINSAAKS  65

Query  403  addrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCD  254
              DR+ ACQCLK AA S+     + T A+ L   C+V +PY IS+STNC+
Sbjct  66   TPDRQQACQCLKQAAASV--SGIIPTNAEALPGACSVNIPYKISLSTNCN  113



>ref|XP_006411069.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
 gb|ESQ52522.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
Length=118

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 71/119 (60%), Gaps = 4/119 (3%)
 Frame = -3

Query  598  MAKIQSVALL--ACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA +  +A L  ACM+V   + A  A+ C  V S++  C+ YI  G   V  +CC G++N
Sbjct  1    MAGLMKLAFLVLACMIVAGPITAKAALTCGTVTSNVAACIGYITQGGP-VPGACCSGIKN  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L + A T  DR+ AC+CLK+AA ++    + G AA  L + C V +P+ IS STNC+++
Sbjct  60   LNSMARTTPDRQQACRCLKTAANALGPNLNAGRAA-GLPKACGVNVPFPISTSTNCNSV  117



>gb|ACE80968.1| putative allergen Pru du 3.03 [Prunus dulcis x Prunus persica]
Length=116

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 6/120 (5%)
 Frame = -3

Query  598  MAKIQSV-ALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTP-SCCDGVRN  425
            MA ++ V AL  CMVV   +  + A+ C  +Q+ L PCL Y+  G  GV    CC G++ 
Sbjct  1    MASLKVVCALFMCMVVAAPLITEAALTCPQIQAGLAPCLGYLQRG--GVPAGGCCPGIKR  58

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            L  +A T  DR+ AC+CLK+ AG++  G + G AA  L   C VK+PY IS STNC+++ 
Sbjct  59   LVGSATTTADRQNACKCLKTVAGAV-KGINTGYAAA-LPSLCGVKIPYKISASTNCNSVK  116



>ref|XP_009797052.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=114

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = -3

Query  589  IQSVALLACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            ++ V  +AC VVL  V    HA+ A+ C  VQS L PCL Y+ G   G    CC GV+ L
Sbjct  1    MEIVGKIACFVVLCMVVVAPHAE-ALSCGQVQSGLAPCLPYLQG--RGPLGGCCGGVKGL  57

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              AA +  DR+ AC CLKSAA +I  G D+G AA  L   C V +PY IS ST+C  + 
Sbjct  58   LGAAKSPADRKTACTCLKSAANAI-KGIDMGKAA-GLPSACGVNIPYKISPSTDCSKVQ  114



>ref|XP_002442776.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
 gb|EES16614.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
Length=119

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PCL+Y  G  S  +  CC GVR+L +AA T  DRRAAC CLK+AA
Sbjct  24   SEAAISCGQVSSAIAPCLSYARGQGSAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAA  83

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              I +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  84   RGI-SGLNAGNAA-SIPSKCGVSVPYTISTSTDCSRVN  119



>ref|XP_009626829.1| PREDICTED: non-specific lipid-transfer protein 2 [Nicotiana tomentosiformis]
 gb|AAM74206.1|AF519812_1 non-specific lipid transfer protein [Nicotiana tabacum]
 dbj|BAK19150.1| lipid transfer protein [Nicotiana tabacum]
Length=114

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 70/119 (59%), Gaps = 9/119 (8%)
 Frame = -3

Query  589  IQSVALLACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            ++ V+ +AC VVL  V    HA+ A+ C  VQS L PC+ Y++G   G    CC GV+ L
Sbjct  1    MEMVSKIACFVVLCMVVVAPHAE-ALTCGQVQSSLAPCVPYLLG--RGPLGGCCGGVKRL  57

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              AA T  DR+ AC CLKSAA +   G D+G AA+ L   C V +PY IS ST+C  + 
Sbjct  58   LGAARTPADRKTACNCLKSAANTF-KGIDMGNAAR-LPGTCGVNIPYKISPSTDCSKVQ  114



>ref|XP_008662435.1| PREDICTED: non-specific lipid-transfer protein [Zea mays]
 gb|ACG24030.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
 gb|AFW55967.1| phospholipid transfer protein-like protein [Zea mays]
Length=121

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSIP  347
            I C  V S + PC++Y  G  SG +  CC GV++L NAA T  DRRAAC CLK+AA  + 
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGV-  88

Query  346  AGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  89   SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  121



>gb|AEN70936.1| lipid transfer protein [Gossypium gossypioides]
Length=119

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = -3

Query  571  LACMVVLLYVH----ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaat  404
            LAC+VVL  V     A GA+ C  V + L PC+TY+ G    V   CC G+++L +AA T
Sbjct  9    LACVVVLCMVLGAPLAQGAVTCGQVTTSLAPCITYLRGKGGPVPQGCCGGIKSLNSAAQT  68

Query  403  addrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
              DR+AAC+C+KSAA  I +G + G A+  L  +C V +PY IS ST+C+  
Sbjct  69   TPDRQAACKCIKSAAAGI-SGINYGIAS-GLPGKCGVNIPYKISPSTDCNRF  118



>gb|ABA33862.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33863.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=111

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -3

Query  538  ADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAA  359
            ++ AI C  V S + PC++Y  G  S  +  CC GV++L NAA T  DRRAAC CLK+AA
Sbjct  16   SEAAISCGQVASAIAPCISYARGQGSAPSAGCCSGVKSLNNAARTTADRRAACNCLKNAA  75

Query  358  GSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              + +G + G AA ++  +C V +PYTIS ST+C  +N
Sbjct  76   AGV-SGLNAGNAA-SIPSKCGVSIPYTISTSTDCSRVN  111



>gb|KDO49688.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=120

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 68/118 (58%), Gaps = 5/118 (4%)
 Frame = -3

Query  598  MAKIQSV-ALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            MA ++ V ALL C++V   V    AI C  V   L PC+ ++  G     P CC+GVR+L
Sbjct  1    MAALKLVCALLLCILVTAPV--TNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSL  58

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
              AA T  DR+AAC CLK A  SIP G +   AA  L RQC V +PY IS +T+C  I
Sbjct  59   NGAARTTPDRQAACNCLKQAYRSIP-GINANVAA-GLPRQCGVSIPYKISPNTDCSRI  114



>sp|Q43875.1|NLT42_HORVU RecName: Full=Non-specific lipid-transfer protein 4.2; Short=LTP 
4.2; AltName: Full=Low-temperature-responsive protein 4.9; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA91436.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 gb|AAB05812.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 prf||2115353C lipid transfer protein
Length=115

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L V  D AI C  V S L PC++Y  G  +    +CC GV+ L  AA +  D
Sbjct  11   LVAMVAAMLIVATDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + AG   G     +   C V +PY IS S +C  I 
Sbjct  71   KQAACKCIKSAAGGLNAGKAAG-----IPSMCGVSVPYAISASVDCSKIR  115



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 69/116 (59%), Gaps = 6/116 (5%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K+  VALL C+VV L +    AI C  V S++ PCLTY+  G + V  +CC G+RNL   
Sbjct  8    KLSLVALL-CIVVALPIAQ--AITCGQVASNISPCLTYVKSGGA-VPAACCSGIRNLNGM  63

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            A T  DR+AAC CLK AAG I  G +   AA  L  +C V +PY IS +TNC  + 
Sbjct  64   AKTTADRQAACNCLKQAAGGI-KGLNPNLAA-GLPGKCGVSVPYKISTTTNCAAVK  117



>sp|Q42842.1|NLT43_HORVU RecName: Full=Non-specific lipid-transfer protein 4.3; Short=LTP 
4.3; Flags: Precursor [Hordeum vulgare]
 emb|CAA91435.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85788.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L V  D AI C  V S L PC++Y  G  +    +CC GV+ L  AA +  D
Sbjct  11   LVAMVAAMLLVATDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + AG   G     +   C V +PY IS S +C  I 
Sbjct  71   KQAACKCIKSAAGGLNAGKAAG-----IPSMCGVSVPYAISASVDCSKIR  115



>gb|KHG10481.1| Non-specific lipid-transfer 3 [Gossypium arboreum]
Length=140

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 69/115 (60%), Gaps = 2/115 (2%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHA-DGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKN  416
            K+ S+ L+ CM V+    A   AI CSDV + L+PCL+Y+  G +    +CC GV+ L  
Sbjct  8    KLVSMILIVCMTVMSAPKAAKAAITCSDVVNHLIPCLSYVQNGGTPAA-ACCSGVKALYG  66

Query  415  aaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDT  251
             A T+ DR+  C+C+KSA   IP  ++    A  L  +C ++LPY+IS ST+C+ 
Sbjct  67   EAQTSPDRQNVCKCIKSAVNGIPYTSNNLNLAAGLPAKCGLQLPYSISPSTDCNN  121



>ref|XP_003605349.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES87546.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK37569.1| unknown [Medicago truncatula]
Length=117

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 67/115 (58%), Gaps = 4/115 (3%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            ++  VA + CMVV+    A+ A+ C  V   L PC+TY+ GG  G + +CC GV+ L  A
Sbjct  5    RVAIVAAIMCMVVVSAPMAE-AVTCGQVVGFLTPCITYLQGG-PGPSAACCGGVKKLNGA  62

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            A T   R+ AC CLK AAG+I    +   AA  L  +C V +PY  S STNC++I
Sbjct  63   ANTGPARKTACNCLKRAAGNIARLNNNQAAA--LPGKCGVNIPYKFSTSTNCNSI  115



>gb|AAF28385.1|AF151214_1 lipid-transfer protein [Nicotiana glauca]
Length=117

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 62/102 (61%), Gaps = 3/102 (3%)
 Frame = -3

Query  550  LYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCL  371
            L   AD AI C  V S L PC++Y+  G +   P CC G+++L N A +  DR+ AC C+
Sbjct  19   LTPQADAAISCGQVVSSLTPCISYVTKGGAIPAP-CCSGIKSLNNQATSTPDRQTACNCI  77

Query  370  KSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            KSA GSI +G + G A+ +L  +C V LPY IS S +C T+ 
Sbjct  78   KSAVGSI-SGINFGLAS-SLPGKCGVNLPYKISPSIDCSTVQ  117



>ref|XP_009757912.1| PREDICTED: uncharacterized protein LOC104210662 [Nicotiana sylvestris]
Length=260

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 70/121 (58%), Gaps = 9/121 (7%)
 Frame = -3

Query  589  IQSVALLACMVVLLYV----HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            ++ V  +AC VVL  V    HA+ A+ C  VQS L PCL Y+ G   G   SCC GV+ L
Sbjct  1    MEMVGKIACFVVLCMVVVAPHAE-ALSCGQVQSGLAPCLPYLQG--RGPLGSCCGGVKGL  57

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN*  242
              AA +  DR+ AC CLKSAA +I  G D+G AA  L   C V +PY IS ST+C   N 
Sbjct  58   LGAAKSPADRKTACTCLKSAANAI-KGIDIGKAA-GLPGACGVNIPYKISPSTDCSKYNI  115

Query  241  E  239
            E
Sbjct  116  E  116



>gb|AAM22768.1| lipid transfer protein [Prunus persica]
Length=90

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 5/94 (5%)
 Frame = -3

Query  526  IMCSDVQSDLMPCLTYI-MGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            I C  V S+L PC+ Y+ +GGA  V P+CC+G+RN+ N A T  DR+AAC CLK  + S+
Sbjct  1    ITCGQVSSNLAPCIPYVRVGGA--VPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASV  58

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            P G +   AA  L  +C V +PY IS STNC T+
Sbjct  59   P-GVNPNNAAA-LPGKCGVHIPYKISASTNCATV  90



>gb|KDP21874.1| hypothetical protein JCGZ_00661 [Jatropha curcas]
Length=119

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 71/119 (60%), Gaps = 3/119 (3%)
 Frame = -3

Query  598  MAKIQSVALLACMVVLLY--VHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRN  425
            MA ++ V +++  V++++  + A  AI C DV  +L PC+ Y+  G   V  +CC+G+R 
Sbjct  1    MASVKLVMIVSLAVMMMFAPMAARAAITCGDVVRELTPCVGYLQSGGQ-VPGNCCNGIRT  59

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            L NAA T  DR+A CQCL+SA  +    +     A++L  +CNV +PY I  STNC  +
Sbjct  60   LYNAAQTTPDRQAVCQCLESAVSNFRYSSYNLGLAQSLPAKCNVNIPYKIDPSTNCKNV  118



>ref|XP_010553199.1| PREDICTED: non-specific lipid-transfer protein 4-like [Tarenaya 
hassleriana]
Length=118

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 64/113 (57%), Gaps = 5/113 (4%)
 Frame = -3

Query  574  LLACMVVLLYVHADGA---IMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaat  404
             +ACMV++    A      I C  VQS L PC+ Y+ GG   V P CC G+++L   A T
Sbjct  8    WMACMVMVALAAAAFTDAAITCGTVQSKLAPCIMYVTGGGGTVPPPCCAGIKDLYGMAGT  67

Query  403  addrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              DRR AC CL+SAA  I  G     AA +L R C V LPY IS S NC++IN
Sbjct  68   TPDRRQACLCLQSAAKGI-TGIKPDLAA-SLPRACGVSLPYPISGSINCNSIN  118



>gb|EMS48312.1| Non-specific lipid-transfer protein 4.3 [Triticum urartu]
Length=98

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 5/102 (5%)
 Frame = -3

Query  553  LLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQC  374
            +L +  D AI C  V S L PC++Y  G  +  + +CC GVR L  A  + +D++  C C
Sbjct  1    MLLIATDAAISCGQVNSALSPCISYARGNGANPSVACCSGVRRLAGAVRSTNDKKTTCNC  60

Query  373  LKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            +KSAAG + AG      A ++  +C+V +PY IS S +C TI
Sbjct  61   IKSAAGGLNAG-----KAADIPSKCSVSIPYAISPSLDCSTI  97



>emb|CBW38504.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 5/107 (5%)
 Frame = -3

Query  565  CMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrra  386
            CMVV    H   A+ C  V S L PC+ Y+  G + V P+CC+GV+ L NAA T  DR+A
Sbjct  1    CMVVA--AHYAEALSCGQVSSSLAPCIGYLTKGGA-VPPACCNGVKGLNNAAKTTPDRQA  57

Query  385  ACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            AC CLKSA  SI +G + G AA +L  +C V +PY IS ST+C  + 
Sbjct  58   ACGCLKSAYNSI-SGINAGNAA-SLPGKCGVSIPYKISPSTDCSKVQ  102



>prf||2115353A lipid transfer protein
Length=115

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 61/110 (55%), Gaps = 5/110 (5%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            L+A +  +L V  D AI C  V S L PC++Y  G  +    +CC GV+ L  AA +  D
Sbjct  11   LVALVAAMLLVATDAAISCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTAD  70

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            ++AAC+C+KSAAG + +G   G     +   C V +PY IS S +C  I 
Sbjct  71   KQAACKCIKSAAGGLNSGKAAG-----IPSMCGVSVPYAISASVDCSKIR  115



>ref|XP_004506486.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cicer 
arietinum]
Length=119

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNa  413
            K+  +A++ CM+++    A  AI CS+V   L PCL Y+ G +S  +  CC GV+ L + 
Sbjct  5    KVTCMAIVICMMLMGAPFAVNAISCSEVIHKLDPCLGYLGGSSSAPSRKCCRGVKKLNHM  64

Query  412  aataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            A T  +RR  C CLKSAA +I +G     AA  L   C V+L Y IS STNC+ I
Sbjct  65   ARTTRERRTTCNCLKSAANAI-SGLRTNNAAA-LPGMCGVRLSYKISTSTNCNRI  117



>ref|XP_010486423.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = -3

Query  574  LLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaatadd  395
            LLA  +VL     + A+ CS   ++L PC++Y++ G + V  SCC+G++ L + A TA D
Sbjct  5    LLAMCLVLALRCGEAAVSCSTTVAELYPCVSYVVQGGA-VPESCCNGIKALNSQAQTAAD  63

Query  394  rraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            R++ C+C+KSA G +   ++    A +L  +C + LPY  S STNCD+IN
Sbjct  64   RQSVCRCIKSAIGGVSYTSNNLNNALSLPSKCGLSLPYKFSPSTNCDSIN  113



>gb|ACE80969.1| putative allergen Pru p 3.03 [Prunus dulcis x Prunus persica]
Length=116

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 6/120 (5%)
 Frame = -3

Query  598  MAKIQSV-ALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTP-SCCDGVRN  425
            MA ++ V AL  CMVV   +  + A+ C  +Q+ L PCL Y+  G  GV    CC G++ 
Sbjct  1    MASLKVVCALFMCMVVAAPLITEAALTCPQIQAGLAPCLGYLQRG--GVPAGGCCPGIKR  58

Query  424  LKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            L  +A T  DR+ AC+CLK+ AG++  G + G AA  L   C VK+PY IS STNC+++ 
Sbjct  59   LVGSATTTADRQNACKCLKTVAGAV-KGINPGYAAA-LPSLCGVKIPYKISASTNCNSVK  116



>gb|KDO49687.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=115

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 68/119 (57%), Gaps = 5/119 (4%)
 Frame = -3

Query  598  MAKIQSV-ALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNL  422
            MA ++ V ALL C++V   V    AI C  V   L PC+ ++  G     P CC+GVR+L
Sbjct  1    MAALKLVCALLLCILVTAPV--TNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSL  58

Query  421  KNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              AA T  DR+AAC CLK A  SIP G +   AA  L RQC V +PY IS +T+C  + 
Sbjct  59   NGAARTTPDRQAACNCLKQAYRSIP-GINANVAA-GLPRQCGVSIPYKISPNTDCSRVR  115



>gb|AET05731.1| lipid transfer protein isoform b, partial [Pyrus communis]
Length=94

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 63/94 (67%), Gaps = 3/94 (3%)
 Frame = -3

Query  529  AIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSAAGSI  350
            AI CS V ++L PC+ Y+  G + V P+CC+G++ +   A T  DR+AAC CLK+ AGS+
Sbjct  3    AITCSQVSANLAPCINYVRSGGA-VPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSV  61

Query  349  PAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             +G + G  A++L  +C V +PY IS STNC T+
Sbjct  62   -SGVNPGN-AESLPGKCGVNVPYKISTSTNCATV  93



>emb|CAH04987.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69192.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=122

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -3

Query  541  HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSA  362
             A  A+ C  V S L PC+ Y+ G AS ++  CC GV+ L   A ++ DR+ AC+CLKS 
Sbjct  26   EASAALSCGQVDSKLAPCVAYVTGRASSISKECCSGVQGLNGMARSSSDRKIACRCLKSL  85

Query  361  AGSIPA---GADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            A SI +   G   G   K     C V +P+ IS+STNCDT+N
Sbjct  86   ATSIKSINMGKVSGVPGK-----CGVSVPFPISMSTNCDTVN  122



>gb|AFX65219.1| lipid transfer precursor protein, partial [Triticum aestivum]
Length=121

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 66/118 (56%), Gaps = 12/118 (10%)
 Frame = -3

Query  592  KIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPS--CCDGVRNLK  419
            K+  VAL+A M++     +D AI C  V S L PC+ Y  G  SG +PS  CC+GVR L 
Sbjct  14   KLVLVALVAAMIL---AASDAAISCGQVSSALTPCVAYAKG--SGTSPSGACCNGVRKLA  68

Query  418  NaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
              A +  D++A C+CLKS AG +      G  +K     C V +PYTIS S +C  I+
Sbjct  69   GLARSTADKQATCRCLKSVAGGLNPNKAAGIPSK-----CGVSVPYTISASVDCSKIH  121



>ref|XP_003579021.1| PREDICTED: probable non-specific lipid-transfer protein 3 [Brachypodium 
distachyon]
Length=123

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = -3

Query  541  HADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQCLKSA  362
             A  A+ C  V S + PC+ Y+ G A+ V+P CC G+R L N A T  DR+AAC+CLKS 
Sbjct  27   QASAAVTCGQVGSSIAPCVAYVTGKAAAVSPGCCSGIRGLNNMARTTADRQAACRCLKSM  86

Query  361  AGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
            AGSI A  ++G  A  +  +C V + + IS+ST+C+ +
Sbjct  87   AGSIKA-LNMGKVA-GVPGKCGVNVGFPISMSTDCNKV  122



>gb|EMS62142.1| Non-specific lipid-transfer protein 4.3 [Triticum urartu]
Length=98

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 57/103 (55%), Gaps = 5/103 (5%)
 Frame = -3

Query  553  LLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVRNLKNaaataddrraACQC  374
            +L +  D AI C  V S L PC++Y  G  +  +  CC G+R L  A  +  D++  C C
Sbjct  1    MLLIATDAAISCGQVNSALSPCISYARGNGANPSAPCCSGIRRLAGAVRSTTDKKTTCNC  60

Query  373  LKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTIN  245
            +KSAAG + AG      A ++  +C+V +PY IS S +C TI 
Sbjct  61   IKSAAGGLNAG-----KAADIPSKCSVSIPYAISPSLDCSTIR  98



>ref|XP_006367395.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 70/121 (58%), Gaps = 7/121 (6%)
 Frame = -3

Query  607  LPVMAKIQSVALLACMVVLLYVHADGAIMCSDVQSDLMPCLTYIMGGASGVTPSCCDGVR  428
            + +  KI    LL CMVV+   HA+ A+ C +V S L PCL Y+ G  SG    CC GV+
Sbjct  1    MEIFGKIACFVLL-CMVVVA-PHAE-ALSCGEVTSGLAPCLPYLQG--SGPIGGCCGGVK  55

Query  427  NLKNaaataddrraACQCLKSAAGSIPAGADVGTAAKNLLRQCNVKLPYTISVSTNCDTI  248
             L  AA T +DR+ AC CLKSAA SI  G D G AA  L   C V +PY IS ST+C  +
Sbjct  56   GLLGAAKTPEDRKTACTCLKSAANSI-KGIDTGKAA-GLPGVCGVSIPYKISPSTDCSKV  113

Query  247  N  245
             
Sbjct  114  Q  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906157394839