BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82539_g1_i1 len=462 path=[1:0-461]

Length=462
                                                                      Score     E

ref|XP_011090919.1|  PREDICTED: monothiol glutaredoxin-S4-like          177   6e-54   
ref|XP_006342767.1|  PREDICTED: monothiol glutaredoxin-S3-like          174   7e-53   
ref|XP_004229211.1|  PREDICTED: monothiol glutaredoxin-S3               173   2e-52   
ref|XP_009369121.1|  PREDICTED: monothiol glutaredoxin-S2-like          172   4e-52   
gb|EYU43911.1|  hypothetical protein MIMGU_mgv1a016894mg                172   6e-52   
ref|XP_008353232.1|  PREDICTED: monothiol glutaredoxin-S2-like          172   8e-52   
ref|XP_008390722.1|  PREDICTED: monothiol glutaredoxin-S2               171   2e-51   
ref|XP_009629061.1|  PREDICTED: monothiol glutaredoxin-S2               170   2e-51   
ref|XP_011090920.1|  PREDICTED: monothiol glutaredoxin-S5-like          169   6e-51   
ref|XP_007225971.1|  hypothetical protein PRUPE_ppa013805mg             169   8e-51   
ref|XP_003550174.1|  PREDICTED: monothiol glutaredoxin-S2-like          168   2e-50   
ref|XP_007154238.1|  hypothetical protein PHAVU_003G102000g             168   2e-50   
ref|XP_010558476.1|  PREDICTED: monothiol glutaredoxin-S2               167   5e-50   
ref|XP_008223118.1|  PREDICTED: monothiol glutaredoxin-S2               167   5e-50   
ref|XP_009352227.1|  PREDICTED: monothiol glutaredoxin-S2               167   7e-50   
ref|XP_002275384.1|  PREDICTED: monothiol glutaredoxin-S2               166   8e-50   Vitis vinifera
ref|XP_007147880.1|  hypothetical protein PHAVU_006G162700g             166   1e-49   
ref|XP_009631350.1|  PREDICTED: monothiol glutaredoxin-S3-like          166   1e-49   
ref|XP_006584039.1|  PREDICTED: monothiol glutaredoxin-S2-like          166   2e-49   
ref|XP_004296808.1|  PREDICTED: monothiol glutaredoxin-S2-like          166   2e-49   
ref|XP_004296805.1|  PREDICTED: monothiol glutaredoxin-S2-like          165   3e-49   
ref|XP_010098332.1|  Monothiol glutaredoxin-S2                          165   3e-49   
ref|XP_003546092.1|  PREDICTED: monothiol glutaredoxin-S2-like          165   4e-49   
gb|EPS64180.1|  hypothetical protein M569_10600                         164   7e-49   
ref|XP_004296807.1|  PREDICTED: monothiol glutaredoxin-S2-like          164   1e-48   
ref|XP_007035505.1|  Thioredoxin superfamily protein                    163   2e-48   
ref|XP_004134195.1|  PREDICTED: monothiol glutaredoxin-S2-like          162   3e-48   
ref|XP_004296806.1|  PREDICTED: monothiol glutaredoxin-S2-like          162   4e-48   
ref|XP_011071466.1|  PREDICTED: monothiol glutaredoxin-S5-like          162   4e-48   
gb|KHN47302.1|  Monothiol glutaredoxin-S4                               162   4e-48   
ref|XP_004508301.1|  PREDICTED: monothiol glutaredoxin-S2-like          162   6e-48   
ref|NP_197361.1|  monothiol glutaredoxin-S2                             161   7e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873906.1|  glutaredoxin family protein                        161   7e-48   
gb|KFK26098.1|  hypothetical protein AALP_AA8G202600                    161   8e-48   
ref|XP_006594494.1|  PREDICTED: monothiol glutaredoxin-S2-like          163   9e-48   
ref|XP_010420636.1|  PREDICTED: monothiol glutaredoxin-S2               161   1e-47   
ref|XP_003609600.1|  Monothiol glutaredoxin-S2                          161   1e-47   
ref|XP_010454112.1|  PREDICTED: monothiol glutaredoxin-S2-like          160   1e-47   
ref|XP_004241071.1|  PREDICTED: monothiol glutaredoxin-S4-like          160   2e-47   
ref|XP_004296804.1|  PREDICTED: monothiol glutaredoxin-S2-like          160   2e-47   
gb|AFK45164.1|  unknown                                                 160   3e-47   
gb|EPS64181.1|  glutaredoxin                                            160   3e-47   
ref|XP_006380202.1|  hypothetical protein POPTR_0008s22870g             160   3e-47   
ref|XP_006400409.1|  hypothetical protein EUTSA_v10015538mg             159   4e-47   
ref|XP_006380199.1|  glutaredoxin family protein                        159   7e-47   
ref|XP_009120959.1|  PREDICTED: monothiol glutaredoxin-S2               159   8e-47   
gb|AFK39077.1|  unknown                                                 159   8e-47   
emb|CDX70828.1|  BnaC03g09120D                                          159   1e-46   
ref|XP_006288956.1|  hypothetical protein CARUB_v10002321mg             158   1e-46   
emb|CDY02610.1|  BnaC02g08250D                                          158   1e-46   
gb|EPS67026.1|  hypothetical protein M569_07752                         158   1e-46   
ref|NP_001274383.1|  monothiol glutaredoxin-S2-like                     158   1e-46   
ref|XP_009126270.1|  PREDICTED: monothiol glutaredoxin-S2-like          158   2e-46   
ref|XP_009131678.1|  PREDICTED: monothiol glutaredoxin-S2               158   2e-46   
emb|CDY13904.1|  BnaC09g39220D                                          158   2e-46   
ref|XP_006356697.1|  PREDICTED: monothiol glutaredoxin-S3-like          158   2e-46   
ref|XP_010492876.1|  PREDICTED: monothiol glutaredoxin-S2-like          158   2e-46   
ref|XP_006419644.1|  hypothetical protein CICLE_v10006286mg             157   6e-46   
gb|EYU43914.1|  hypothetical protein MIMGU_mgv1a016876mg                156   7e-46   
ref|XP_002315567.1|  glutaredoxin family protein                        156   8e-46   Populus trichocarpa [western balsam poplar]
ref|XP_004486045.1|  PREDICTED: monothiol glutaredoxin-S2-like          156   8e-46   
gb|EYU43913.1|  hypothetical protein MIMGU_mgv1a026737mg                156   9e-46   
emb|CDY68328.1|  BnaAnng26900D                                          156   1e-45   
ref|XP_003593970.1|  Monothiol glutaredoxin-S2                          155   2e-45   
ref|XP_010440264.1|  PREDICTED: monothiol glutaredoxin-S4-like          154   4e-45   
ref|XP_009146815.1|  PREDICTED: monothiol glutaredoxin-S4               154   4e-45   
gb|KFK43355.1|  hypothetical protein AALP_AA1G115300                    154   4e-45   
ref|XP_006284821.1|  hypothetical protein CARUB_v10006100mg             154   4e-45   
ref|XP_006284820.1|  hypothetical protein CARUB_v10006099mg             154   5e-45   
gb|KDP40011.1|  hypothetical protein JCGZ_02009                         154   6e-45   
ref|XP_009136708.1|  PREDICTED: monothiol glutaredoxin-S4-like          154   7e-45   
ref|XP_010024635.1|  PREDICTED: monothiol glutaredoxin-S2-like          154   7e-45   
ref|XP_002870217.1|  glutaredoxin family protein                        154   7e-45   
ref|XP_004296809.1|  PREDICTED: monothiol glutaredoxin-S2-like          154   9e-45   
ref|XP_010434931.1|  PREDICTED: monothiol glutaredoxin-S3               154   9e-45   
ref|NP_193303.1|  monothiol glutaredoxin-S4                             154   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414472.1|  hypothetical protein EUTSA_v10027374mg             153   1e-44   
gb|KCW61086.1|  hypothetical protein EUGRSUZ_H03860                     155   1e-44   
gb|ACJ83991.1|  unknown                                                 153   1e-44   Medicago truncatula
ref|XP_002870221.1|  glutaredoxin family protein                        153   1e-44   
gb|KFK24504.1|  hypothetical protein AALP_AAs55560U000400               153   1e-44   
gb|KHN33129.1|  Monothiol glutaredoxin-S4                               153   1e-44   
ref|XP_010434934.1|  PREDICTED: monothiol glutaredoxin-S4               153   2e-44   
ref|XP_006284819.1|  hypothetical protein CARUB_v10006098mg             153   2e-44   
ref|XP_010440263.1|  PREDICTED: monothiol glutaredoxin-S3-like          153   2e-44   
ref|XP_002870219.1|  glutaredoxin family protein                        153   2e-44   
ref|XP_010548927.1|  PREDICTED: monothiol glutaredoxin-S5-like          152   2e-44   
ref|XP_009146804.1|  PREDICTED: monothiol glutaredoxin-S4-like          152   3e-44   
gb|AAS47604.1|  At4g15670                                               153   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284824.1|  hypothetical protein CARUB_v10006103mg             152   3e-44   
ref|XP_010449909.1|  PREDICTED: monothiol glutaredoxin-S3-like          152   4e-44   
gb|KFK22959.1|  hypothetical protein AALP_AAs50914U000200               152   5e-44   
ref|XP_006414476.1|  hypothetical protein EUTSA_v10026878mg             151   6e-44   
ref|NP_193302.1|  monothiol glutaredoxin-S7                             151   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010524509.1|  PREDICTED: monothiol glutaredoxin-S4               151   6e-44   
ref|XP_010449908.1|  PREDICTED: monothiol glutaredoxin-S3-like          151   6e-44   
ref|XP_009146825.1|  PREDICTED: monothiol glutaredoxin-S4-like          151   6e-44   
ref|XP_006284827.1|  hypothetical protein CARUB_v10006107mg             151   7e-44   
emb|CDY54294.1|  BnaC01g41930D                                          151   7e-44   
ref|XP_010434932.1|  PREDICTED: monothiol glutaredoxin-S3-like          151   8e-44   
ref|NP_193305.1|  monothiol glutaredoxin-S3                             151   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284817.1|  hypothetical protein CARUB_v10006105mg             151   9e-44   
gb|KFK43354.1|  hypothetical protein AALP_AA1G115200                    151   9e-44   
ref|XP_002516883.1|  glutaredoxin, grx, putative                        151   1e-43   Ricinus communis
ref|XP_011013421.1|  PREDICTED: monothiol glutaredoxin-S2-like          151   1e-43   
ref|XP_010449912.1|  PREDICTED: monothiol glutaredoxin-S7-like          150   2e-43   
ref|XP_010449907.1|  PREDICTED: monothiol glutaredoxin-S5-like          150   2e-43   
ref|XP_006286199.1|  hypothetical protein CARUB_v10007765mg             150   2e-43   
ref|NP_193304.1|  monothiol glutaredoxin-S5                             150   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011005540.1|  PREDICTED: monothiol glutaredoxin-S2-like          150   2e-43   
ref|XP_010434933.1|  PREDICTED: monothiol glutaredoxin-S5-like          150   2e-43   
ref|XP_006284826.1|  hypothetical protein CARUB_v10006106mg             150   2e-43   
gb|KFK24502.1|  hypothetical protein AALP_AAs55560U000200               150   3e-43   
ref|XP_002870222.1|  glutaredoxin family protein                        149   4e-43   
emb|CDY54296.1|  BnaC01g41950D                                          149   5e-43   
gb|KFK24503.1|  hypothetical protein AALP_AAs55560U000300               149   7e-43   
ref|XP_002870218.1|  glutaredoxin family protein                        149   7e-43   
ref|XP_010434935.1|  PREDICTED: monothiol glutaredoxin-S7-like          149   7e-43   
gb|KFK24501.1|  hypothetical protein AALP_AAs55560U000100               148   1e-42   
ref|NP_193301.1|  monothiol glutaredoxin-S8                             148   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414471.1|  hypothetical protein EUTSA_v10026652mg             147   2e-42   
ref|XP_009146837.1|  PREDICTED: monothiol glutaredoxin-S4-like          147   3e-42   
ref|XP_010243566.1|  PREDICTED: monothiol glutaredoxin-S2-like          147   3e-42   
ref|XP_010449913.1|  PREDICTED: monothiol glutaredoxin-S7-like          147   4e-42   
ref|XP_010434937.1|  PREDICTED: monothiol glutaredoxin-S7               147   4e-42   
ref|XP_010445383.1|  PREDICTED: monothiol glutaredoxin-S7-like          145   2e-41   
ref|XP_009802831.1|  PREDICTED: monothiol glutaredoxin-S2-like          144   2e-41   
ref|XP_010243565.1|  PREDICTED: monothiol glutaredoxin-S2               144   7e-41   
emb|CDY22746.1|  BnaA08g05760D                                          142   2e-40   
gb|KCW61087.1|  hypothetical protein EUGRSUZ_H03861                     143   2e-40   
ref|XP_010241681.1|  PREDICTED: monothiol glutaredoxin-S2-like          142   2e-40   
ref|XP_008390723.1|  PREDICTED: monothiol glutaredoxin-S10              141   6e-40   
ref|XP_010036905.1|  PREDICTED: monothiol glutaredoxin-S10-like         141   8e-40   
ref|XP_010440259.1|  PREDICTED: monothiol glutaredoxin-S4-like          140   1e-39   
ref|XP_002516882.1|  glutaredoxin, grx, putative                        140   1e-39   Ricinus communis
ref|XP_007226534.1|  hypothetical protein PRUPE_ppa025150mg             140   1e-39   
ref|XP_006380203.1|  hypothetical protein POPTR_0008s22890g             140   2e-39   
ref|XP_004296803.1|  PREDICTED: monothiol glutaredoxin-S10-like         140   2e-39   
ref|XP_010024634.1|  PREDICTED: monothiol glutaredoxin-S10-like         140   2e-39   
ref|XP_009107851.1|  PREDICTED: monothiol glutaredoxin-S4-like          140   2e-39   
ref|XP_009107850.1|  PREDICTED: monothiol glutaredoxin-S4-like          139   3e-39   
ref|XP_010649773.1|  PREDICTED: monothiol glutaredoxin-S10              139   3e-39   
ref|XP_010098329.1|  Monothiol glutaredoxin-S10                         139   4e-39   
ref|XP_006419643.1|  hypothetical protein CICLE_v10006590mg             139   4e-39   
ref|NP_001275534.1|  monothiol glutaredoxin-S10-like                    139   6e-39   
ref|XP_003593973.1|  Monothiol glutaredoxin-S4                          139   7e-39   
ref|XP_007050809.1|  Thioredoxin superfamily protein                    138   8e-39   
ref|XP_004309710.1|  PREDICTED: monothiol glutaredoxin-S6-like          138   9e-39   
ref|XP_011016037.1|  PREDICTED: monothiol glutaredoxin-S10              138   1e-38   
ref|XP_002520671.1|  glutaredoxin, grx, putative                        138   1e-38   Ricinus communis
ref|XP_004486046.1|  PREDICTED: monothiol glutaredoxin-S10-like         138   1e-38   
emb|CDY09079.1|  BnaC08g10330D                                          137   2e-38   
ref|XP_008353233.1|  PREDICTED: monothiol glutaredoxin-S10-like         137   2e-38   
ref|XP_009369117.1|  PREDICTED: monothiol glutaredoxin-S10-like         137   3e-38   
ref|XP_002321033.1|  glutaredoxin family protein                        137   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006414473.1|  hypothetical protein EUTSA_v10027082mg             136   5e-38   
ref|XP_009612544.1|  PREDICTED: monothiol glutaredoxin-S1-like          136   6e-38   
ref|XP_010024636.1|  PREDICTED: monothiol glutaredoxin-S4-like          136   7e-38   
ref|XP_010684482.1|  PREDICTED: monothiol glutaredoxin-S1-like          136   8e-38   
ref|XP_010241661.1|  PREDICTED: monothiol glutaredoxin-S2-like          135   9e-38   
ref|XP_007035504.1|  Glutaredoxin family protein                        135   1e-37   
gb|KDP40012.1|  hypothetical protein JCGZ_02010                         135   2e-37   
ref|XP_002892143.1|  glutaredoxin family protein                        135   2e-37   
ref|XP_011033597.1|  PREDICTED: monothiol glutaredoxin-S6-like          135   2e-37   
ref|XP_007154237.1|  hypothetical protein PHAVU_003G101900g             135   2e-37   
ref|XP_009779593.1|  PREDICTED: monothiol glutaredoxin-S1-like          135   2e-37   
ref|XP_010481465.1|  PREDICTED: monothiol glutaredoxin-S1-like          134   3e-37   
ref|XP_006594493.1|  PREDICTED: monothiol glutaredoxin-S10-like         134   3e-37   
ref|XP_006444250.1|  hypothetical protein CICLE_v10022989mg             134   4e-37   
ref|XP_003546093.1|  PREDICTED: monothiol glutaredoxin-S10-like         134   4e-37   
emb|CDY32493.1|  BnaA09g51030D                                          134   5e-37   
gb|AFK43054.1|  unknown                                                 134   5e-37   
gb|KFK39456.1|  hypothetical protein AALP_AA3G247200                    134   6e-37   
ref|XP_008389183.1|  PREDICTED: monothiol glutaredoxin-S6-like          134   6e-37   
ref|XP_010457309.1|  PREDICTED: monothiol glutaredoxin-S1               133   7e-37   
gb|KDP28099.1|  hypothetical protein JCGZ_13870                         133   7e-37   
ref|XP_009118722.1|  PREDICTED: monothiol glutaredoxin-S1-like          134   9e-37   
gb|ABK28101.1|  unknown                                                 133   9e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDP12909.1|  unnamed protein product                                133   1e-36   
ref|NP_001078198.1|  monothiol glutaredoxin-S10                         133   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386628.1|  PREDICTED: monothiol glutaredoxin-S6-like          133   1e-36   
ref|XP_002885441.1|  electron carrier/ protein disulfide oxidored...    133   1e-36   
ref|XP_007147879.1|  hypothetical protein PHAVU_006G162600g             134   1e-36   
ref|XP_006299130.1|  hypothetical protein CARUB_v10015272mg             132   1e-36   
ref|XP_010243568.1|  PREDICTED: monothiol glutaredoxin-S10-like         132   1e-36   
ref|XP_009138705.1|  PREDICTED: monothiol glutaredoxin-S6-like          132   1e-36   
ref|XP_009378912.1|  PREDICTED: monothiol glutaredoxin-S6-like          132   2e-36   
ref|XP_011071467.1|  PREDICTED: monothiol glutaredoxin-S10-like         132   2e-36   
gb|KFK39447.1|  hypothetical protein AALP_AA3G246300                    132   2e-36   
ref|XP_010466387.1|  PREDICTED: monothiol glutaredoxin-S10-like         132   3e-36   
ref|XP_010522769.1|  PREDICTED: monothiol glutaredoxin-S1               132   3e-36   
emb|CDO98900.1|  unnamed protein product                                132   3e-36   
ref|XP_009773168.1|  PREDICTED: monothiol glutaredoxin-S2-like          132   3e-36   
ref|XP_006418276.1|  hypothetical protein EUTSA_v10009174mg             131   4e-36   
ref|XP_002878487.1|  glutaredoxin family protein                        131   4e-36   
emb|CDX93949.1|  BnaC04g21080D                                          131   4e-36   
ref|XP_011013022.1|  PREDICTED: monothiol glutaredoxin-S6-like          131   5e-36   
gb|EYU45572.1|  hypothetical protein MIMGU_mgv1a023883mg                131   5e-36   
ref|XP_009759599.1|  PREDICTED: monothiol glutaredoxin-S2-like          131   5e-36   
ref|XP_004247455.1|  PREDICTED: monothiol glutaredoxin-S2-like          131   6e-36   
ref|XP_003529587.1|  PREDICTED: monothiol glutaredoxin-S10-like         131   6e-36   
ref|XP_010273480.1|  PREDICTED: monothiol glutaredoxin-S2-like          130   8e-36   
ref|XP_009761867.1|  PREDICTED: monothiol glutaredoxin-S6-like          130   8e-36   
ref|XP_009135750.1|  PREDICTED: monothiol glutaredoxin-S10              130   8e-36   
ref|XP_007200001.1|  hypothetical protein PRUPE_ppa024889mg             130   9e-36   
ref|XP_006389682.1|  glutaredoxin family protein                        130   9e-36   
ref|XP_008674047.1|  PREDICTED: glutaredoxin-C1                         130   1e-35   
emb|CDP12904.1|  unnamed protein product                                130   1e-35   
ref|XP_011071468.1|  PREDICTED: monothiol glutaredoxin-S10-like         130   1e-35   
ref|XP_006414475.1|  hypothetical protein EUTSA_v10027336mg             130   1e-35   
ref|XP_009607405.1|  PREDICTED: monothiol glutaredoxin-S10              130   1e-35   
ref|XP_009399249.1|  PREDICTED: glutaredoxin-C1-like                    130   2e-35   
ref|XP_009781310.1|  PREDICTED: monothiol glutaredoxin-S6-like          129   2e-35   
ref|NP_171801.1|  monothiol glutaredoxin-S1                             129   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KCW84427.1|  hypothetical protein EUGRSUZ_B01275                     129   2e-35   
emb|CDP12907.1|  unnamed protein product                                129   2e-35   
emb|CDP03537.1|  unnamed protein product                                129   3e-35   
ref|XP_006359425.1|  PREDICTED: monothiol glutaredoxin-S2-like          129   3e-35   
ref|XP_010243570.1|  PREDICTED: glutaredoxin-C11-like                   129   3e-35   
ref|XP_006342768.1|  PREDICTED: monothiol glutaredoxin-S10-like         129   3e-35   
ref|XP_002321032.1|  hypothetical protein POPTR_0014s12840g             129   3e-35   Populus trichocarpa [western balsam poplar]
emb|CDP12908.1|  unnamed protein product                                129   4e-35   
ref|XP_002455626.1|  hypothetical protein SORBIDRAFT_03g014800          129   4e-35   Sorghum bicolor [broomcorn]
ref|XP_010413219.1|  PREDICTED: monothiol glutaredoxin-S6               129   4e-35   
ref|XP_006359426.1|  PREDICTED: monothiol glutaredoxin-S2-like          129   4e-35   
ref|XP_006389688.1|  hypothetical protein POPTR_0020s00470g             129   4e-35   
ref|XP_010512690.1|  PREDICTED: monothiol glutaredoxin-S6-like          129   4e-35   
emb|CDY25124.1|  BnaC06g18660D                                          129   4e-35   
emb|CDO98899.1|  unnamed protein product                                129   5e-35   
ref|XP_006303520.1|  hypothetical protein CARUB_v10010921mg             129   5e-35   
ref|NP_001043047.1|  Os01g0368900                                       129   5e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009624458.1|  PREDICTED: monothiol glutaredoxin-S6-like          129   5e-35   
ref|XP_009603211.1|  PREDICTED: monothiol glutaredoxin-S6-like          129   5e-35   
ref|XP_011013688.1|  PREDICTED: monothiol glutaredoxin-S1-like          129   5e-35   
ref|XP_009598903.1|  PREDICTED: monothiol glutaredoxin-S1-like          129   5e-35   
ref|XP_009116959.1|  PREDICTED: monothiol glutaredoxin-S6               129   5e-35   
emb|CDY32430.1|  BnaC03g42140D                                          129   6e-35   
ref|XP_009384168.1|  PREDICTED: putative glutaredoxin-C14               129   6e-35   
ref|XP_004247454.1|  PREDICTED: monothiol glutaredoxin-S2-like          128   7e-35   
ref|XP_009757078.1|  PREDICTED: monothiol glutaredoxin-S1-like          128   7e-35   
ref|XP_009624459.1|  PREDICTED: monothiol glutaredoxin-S6-like          128   7e-35   
ref|XP_009761795.1|  PREDICTED: monothiol glutaredoxin-S6-like          128   8e-35   
gb|KFK35469.1|  hypothetical protein AALP_AA5G288100                    128   9e-35   
emb|CDX76675.1|  BnaC08g32610D                                          128   9e-35   
ref|XP_006290445.1|  hypothetical protein CARUB_v10019414mg             128   9e-35   
ref|XP_010545040.1|  PREDICTED: monothiol glutaredoxin-S6               128   1e-34   
emb|CDY18141.1|  BnaC05g01640D                                          128   1e-34   
ref|XP_009761870.1|  PREDICTED: monothiol glutaredoxin-S1-like          128   1e-34   
ref|XP_008458480.1|  PREDICTED: monothiol glutaredoxin-S10              128   1e-34   
ref|XP_009135749.1|  PREDICTED: monothiol glutaredoxin-S10-like         128   1e-34   
ref|XP_006402325.1|  hypothetical protein EUTSA_v10006332mg             128   1e-34   
ref|XP_006575105.1|  PREDICTED: monothiol glutaredoxin-S6-like          128   1e-34   
ref|XP_006406268.1|  hypothetical protein EUTSA_v10021818mg             127   1e-34   
ref|XP_009773169.1|  PREDICTED: monothiol glutaredoxin-S1-like          127   1e-34   
ref|XP_006406267.1|  hypothetical protein EUTSA_v10021819mg             127   1e-34   
ref|XP_009605617.1|  PREDICTED: monothiol glutaredoxin-S2-like          127   1e-34   
ref|XP_008386629.1|  PREDICTED: monothiol glutaredoxin-S6-like          127   1e-34   
ref|XP_006479886.1|  PREDICTED: monothiol glutaredoxin-S1-like          127   2e-34   
ref|XP_003521539.1|  PREDICTED: monothiol glutaredoxin-S6-like          127   2e-34   
ref|XP_011090617.1|  PREDICTED: monothiol glutaredoxin-S1-like          127   2e-34   
ref|XP_006346726.1|  PREDICTED: monothiol glutaredoxin-S2-like          127   2e-34   
ref|XP_003625874.1|  Monothiol glutaredoxin-S6                          127   2e-34   
gb|KFK42662.1|  hypothetical protein AALP_AA1G023500                    127   2e-34   
ref|XP_010241641.1|  PREDICTED: monothiol glutaredoxin-S10-like         127   2e-34   
ref|XP_006664080.1|  PREDICTED: putative glutaredoxin-C14-like          127   2e-34   
ref|XP_007163069.1|  hypothetical protein PHAVU_001G203500g             127   2e-34   
ref|XP_009793157.1|  PREDICTED: monothiol glutaredoxin-S2               127   2e-34   
ref|XP_009383750.1|  PREDICTED: putative glutaredoxin-C14               127   2e-34   
ref|XP_009775406.1|  PREDICTED: monothiol glutaredoxin-S6-like          127   3e-34   
ref|XP_004229212.1|  PREDICTED: monothiol glutaredoxin-S10              127   3e-34   
ref|XP_009104403.1|  PREDICTED: monothiol glutaredoxin-S6-like          127   3e-34   
ref|XP_006346723.1|  PREDICTED: monothiol glutaredoxin-S1-like          127   3e-34   
ref|XP_009593070.1|  PREDICTED: monothiol glutaredoxin-S1-like          127   4e-34   
ref|XP_010549174.1|  PREDICTED: monothiol glutaredoxin-S4-like          126   4e-34   
ref|XP_009757079.1|  PREDICTED: monothiol glutaredoxin-S1-like          126   4e-34   
ref|XP_003554509.1|  PREDICTED: monothiol glutaredoxin-S6-like          126   4e-34   
ref|XP_010319782.1|  PREDICTED: monothiol glutaredoxin-S6-like          126   5e-34   
ref|XP_009109577.1|  PREDICTED: monothiol glutaredoxin-S10-like         126   5e-34   
ref|XP_004236721.1|  PREDICTED: monothiol glutaredoxin-S1-like          126   5e-34   
ref|XP_004968750.1|  PREDICTED: glutaredoxin-C1-like                    126   5e-34   
ref|XP_011079731.1|  PREDICTED: glutaredoxin-C11                        126   6e-34   
ref|XP_006644173.1|  PREDICTED: glutaredoxin-C1-like                    126   6e-34   
ref|XP_009119584.1|  PREDICTED: monothiol glutaredoxin-S1               126   6e-34   
emb|CDP12910.1|  unnamed protein product                                126   6e-34   
ref|XP_004236714.1|  PREDICTED: monothiol glutaredoxin-S1-like          126   6e-34   
ref|XP_011033594.1|  PREDICTED: monothiol glutaredoxin-S6-like          125   6e-34   
gb|KEH43250.1|  monothiol glutaredoxin-S2 protein                       125   7e-34   
gb|EYU43910.1|  hypothetical protein MIMGU_mgv1a020927mg                125   7e-34   
ref|XP_004160199.1|  PREDICTED: LOW QUALITY PROTEIN: monothiol gl...    125   7e-34   
ref|XP_004494336.1|  PREDICTED: monothiol glutaredoxin-S6-like          125   9e-34   
ref|XP_011090614.1|  PREDICTED: monothiol glutaredoxin-S2-like          125   9e-34   
ref|XP_006346725.1|  PREDICTED: monothiol glutaredoxin-S2-like          125   9e-34   
ref|XP_006362794.1|  PREDICTED: monothiol glutaredoxin-S1-like          125   1e-33   
gb|KCW84428.1|  hypothetical protein EUGRSUZ_B01276                     125   1e-33   
ref|NP_191852.1|  monothiol glutaredoxin-S6                             125   1e-33   
ref|XP_009622506.1|  PREDICTED: monothiol glutaredoxin-S2-like          125   1e-33   
gb|EMS62879.1|  Glutaredoxin-C1                                         125   1e-33   
ref|XP_004150812.1|  PREDICTED: monothiol glutaredoxin-S10-like         125   1e-33   
ref|XP_011033595.1|  PREDICTED: monothiol glutaredoxin-S6-like          125   1e-33   
ref|XP_011079730.1|  PREDICTED: monothiol glutaredoxin-S2-like          125   1e-33   
ref|XP_008796225.1|  PREDICTED: glutaredoxin-C1-like                    125   1e-33   
ref|XP_003567688.1|  PREDICTED: glutaredoxin-C1                         125   1e-33   
ref|XP_004236716.1|  PREDICTED: monothiol glutaredoxin-S1-like          125   1e-33   
ref|XP_004962841.1|  PREDICTED: putative glutaredoxin-C14-like          125   1e-33   
ref|XP_003575739.1|  PREDICTED: putative glutaredoxin-C14               125   2e-33   
dbj|BAJ86342.1|  predicted protein                                      125   2e-33   
ref|XP_011090618.1|  PREDICTED: monothiol glutaredoxin-S2-like          125   2e-33   
ref|XP_004236715.1|  PREDICTED: monothiol glutaredoxin-S1-like          125   2e-33   
ref|XP_004236713.1|  PREDICTED: monothiol glutaredoxin-S1-like          124   2e-33   
ref|XP_004236719.1|  PREDICTED: monothiol glutaredoxin-S1-like          124   2e-33   
ref|XP_009593069.1|  PREDICTED: monothiol glutaredoxin-S1-like          124   2e-33   
ref|XP_004962839.1|  PREDICTED: putative glutaredoxin-C14-like          125   2e-33   
ref|XP_006444249.1|  hypothetical protein CICLE_v10023013mg             124   2e-33   
ref|XP_007199103.1|  hypothetical protein PRUPE_ppa020594mg             124   2e-33   
ref|XP_009399247.1|  PREDICTED: putative glutaredoxin-C14               124   2e-33   
ref|XP_009381963.1|  PREDICTED: putative glutaredoxin-C14               124   2e-33   
ref|XP_008389182.1|  PREDICTED: monothiol glutaredoxin-S6-like          124   2e-33   
gb|EYU45573.1|  hypothetical protein MIMGU_mgv1a019538mg                124   3e-33   
ref|XP_002321030.1|  hypothetical protein POPTR_0014s12820g             124   3e-33   
ref|XP_004236717.1|  PREDICTED: monothiol glutaredoxin-S1-like          124   3e-33   
ref|NP_001066942.2|  Os12g0538600                                       124   3e-33   
ref|XP_009382560.1|  PREDICTED: glutaredoxin-C1-like                    124   3e-33   
ref|XP_004968749.1|  PREDICTED: glutaredoxin-C1-like                    124   3e-33   
ref|XP_006362795.1|  PREDICTED: monothiol glutaredoxin-S6-like          124   3e-33   
ref|XP_004236718.1|  PREDICTED: monothiol glutaredoxin-S1-like          124   3e-33   
ref|XP_002321031.1|  hypothetical protein POPTR_0014s12830g             124   3e-33   
ref|XP_009624457.1|  PREDICTED: monothiol glutaredoxin-S2-like          124   4e-33   
ref|XP_011090623.1|  PREDICTED: monothiol glutaredoxin-S6-like          124   4e-33   
ref|XP_004962842.1|  PREDICTED: putative glutaredoxin-C14-like          124   5e-33   
gb|ABF69995.1|  glutaredoxin family protein                             123   5e-33   
ref|XP_006346724.1|  PREDICTED: monothiol glutaredoxin-S2-like          123   5e-33   
ref|XP_009411702.1|  PREDICTED: glutaredoxin-C1-like                    123   6e-33   
ref|XP_009624461.1|  PREDICTED: monothiol glutaredoxin-S1-like          124   6e-33   
ref|XP_004236720.1|  PREDICTED: monothiol glutaredoxin-S1-like          123   8e-33   
gb|EMS46251.1|  Putative glutaredoxin-C14                               123   8e-33   
ref|XP_011033596.1|  PREDICTED: monothiol glutaredoxin-S6-like          123   9e-33   
dbj|BAJ89491.1|  predicted protein                                      123   9e-33   
ref|XP_010904787.1|  PREDICTED: putative glutaredoxin-C14               123   9e-33   
ref|XP_010666487.1|  PREDICTED: glutaredoxin-C11-like                   123   1e-32   
ref|XP_003536267.1|  PREDICTED: monothiol glutaredoxin-S6-like          123   1e-32   
ref|XP_011082490.1|  PREDICTED: monothiol glutaredoxin-S2-like          122   1e-32   
ref|XP_009378914.1|  PREDICTED: monothiol glutaredoxin-S6-like          123   1e-32   
gb|EYU34223.1|  hypothetical protein MIMGU_mgv1a023043mg                122   1e-32   
ref|XP_009800086.1|  PREDICTED: monothiol glutaredoxin-S1-like          122   1e-32   
ref|XP_008670904.1|  PREDICTED: putative glutaredoxin-C14               122   1e-32   
ref|XP_010666488.1|  PREDICTED: glutaredoxin-C11-like                   122   1e-32   
ref|XP_004253341.1|  PREDICTED: monothiol glutaredoxin-S1-like          122   1e-32   
ref|XP_008802104.1|  PREDICTED: glutaredoxin-C1-like                    122   2e-32   
ref|XP_009622507.1|  PREDICTED: monothiol glutaredoxin-S2-like          122   2e-32   
ref|XP_010272731.1|  PREDICTED: monothiol glutaredoxin-S2-like          122   2e-32   
ref|XP_009378906.1|  PREDICTED: monothiol glutaredoxin-S9-like          122   2e-32   
gb|EMT22949.1|  Glutaredoxin-C1                                         122   2e-32   
ref|XP_010486752.1|  PREDICTED: monothiol glutaredoxin-S11              122   2e-32   
ref|XP_004136055.1|  PREDICTED: monothiol glutaredoxin-S11-like         122   2e-32   
gb|EMT12569.1|  Glutaredoxin-C1                                         122   2e-32   
ref|XP_010691988.1|  PREDICTED: monothiol glutaredoxin-S1-like          122   2e-32   
ref|XP_006417875.1|  hypothetical protein EUTSA_v10009180mg             122   2e-32   
ref|XP_003575736.1|  PREDICTED: putative glutaredoxin-C14               122   3e-32   
ref|XP_010684490.1|  PREDICTED: monothiol glutaredoxin-S6-like          122   3e-32   
gb|EMT19730.1|  Putative glutaredoxin-C14                               122   3e-32   
gb|KHN28226.1|  Monothiol glutaredoxin-S6                               121   3e-32   
ref|XP_003575732.1|  PREDICTED: putative glutaredoxin-C14               122   3e-32   
ref|XP_002520672.1|  glutaredoxin, grx, putative                        121   3e-32   
gb|EMT12570.1|  Glutaredoxin-C1                                         121   4e-32   
gb|KDP28097.1|  hypothetical protein JCGZ_13868                         121   4e-32   
ref|XP_007050806.1|  Glutaredoxin                                       121   5e-32   
ref|XP_006830226.1|  hypothetical protein AMTR_s00130p00050470          121   5e-32   
ref|XP_002889620.1|  glutaredoxin family protein                        121   5e-32   
ref|XP_011090615.1|  PREDICTED: monothiol glutaredoxin-S6-like          121   5e-32   
ref|XP_008375847.1|  PREDICTED: monothiol glutaredoxin-S9-like          120   6e-32   
emb|CDP12905.1|  unnamed protein product                                121   6e-32   
emb|CAN67225.1|  hypothetical protein VITISV_043905                     121   6e-32   
gb|KHN43542.1|  Monothiol glutaredoxin-S6                               120   7e-32   
ref|XP_010243569.1|  PREDICTED: monothiol glutaredoxin-S11-like         120   8e-32   
ref|XP_006389677.1|  glutaredoxin family protein                        120   8e-32   
ref|XP_002267962.1|  PREDICTED: glutaredoxin-C11                        120   8e-32   
ref|XP_010069984.1|  PREDICTED: glutaredoxin-C13-like                   120   8e-32   
ref|XP_006663084.1|  PREDICTED: glutaredoxin-C10-like                   120   9e-32   
ref|XP_006855454.1|  hypothetical protein AMTR_s00057p00176460          120   9e-32   
ref|XP_008799330.1|  PREDICTED: glutaredoxin-C1-like                    120   9e-32   
ref|XP_002264542.2|  PREDICTED: glutaredoxin-C1-like                    121   1e-31   
ref|NP_172168.1|  monothiol glutaredoxin-S11                            120   1e-31   
emb|CDM85466.1|  unnamed protein product                                120   1e-31   
ref|XP_010694078.1|  PREDICTED: monothiol glutaredoxin-S1-like          120   2e-31   
ref|NP_180612.1|  monothiol glutaredoxin-S9                             119   2e-31   
ref|XP_010557174.1|  PREDICTED: monothiol glutaredoxin-S9-like          119   2e-31   
tpg|DAA43403.1|  TPA: hypothetical protein ZEAMMB73_785146              119   2e-31   
ref|XP_008341254.1|  PREDICTED: glutaredoxin-C5-like                    120   2e-31   
gb|EYU24044.1|  hypothetical protein MIMGU_mgv1a018162mg                119   2e-31   
ref|XP_002455625.1|  hypothetical protein SORBIDRAFT_03g014790          119   2e-31   
gb|KDP28095.1|  hypothetical protein JCGZ_13866                         119   3e-31   
ref|XP_006304582.1|  hypothetical protein CARUB_v10011626mg             119   3e-31   
ref|XP_007201438.1|  hypothetical protein PRUPE_ppa013777mg             119   3e-31   
gb|ACH63240.1|  glutaredoxin                                            119   3e-31   
ref|XP_008222218.1|  PREDICTED: glutaredoxin-C1-like                    120   3e-31   
ref|XP_007227610.1|  hypothetical protein PRUPE_ppa021177mg             120   3e-31   
ref|XP_008665182.1|  PREDICTED: putative glutaredoxin-C14               119   3e-31   
ref|XP_010904788.1|  PREDICTED: glutaredoxin-C1-like                    119   4e-31   
emb|CDY54881.1|  BnaA10g27940D                                          119   4e-31   
ref|XP_010486713.1|  PREDICTED: monothiol glutaredoxin-S11-like         119   4e-31   
ref|XP_009419009.1|  PREDICTED: putative glutaredoxin-C14               119   4e-31   
gb|EMS62279.1|  Glutaredoxin-C1                                         119   4e-31   
ref|XP_008386625.1|  PREDICTED: monothiol glutaredoxin-S11              118   6e-31   
ref|XP_006444243.1|  hypothetical protein CICLE_v10023999mg             118   6e-31   
ref|XP_002268050.1|  PREDICTED: glutaredoxin-C13                        118   6e-31   
ref|XP_006444242.1|  hypothetical protein CICLE_v10023018mg             118   7e-31   
ref|XP_010241630.1|  PREDICTED: monothiol glutaredoxin-S11-like         118   7e-31   
ref|XP_009141071.1|  PREDICTED: monothiol glutaredoxin-S9               118   7e-31   
ref|XP_010694077.1|  PREDICTED: monothiol glutaredoxin-S1-like          118   7e-31   
ref|XP_010510342.1|  PREDICTED: monothiol glutaredoxin-S9               118   7e-31   
ref|XP_008234999.1|  PREDICTED: glutaredoxin-C13-like                   118   8e-31   
ref|XP_009119027.1|  PREDICTED: monothiol glutaredoxin-S11              118   8e-31   
ref|XP_006844586.1|  hypothetical protein AMTR_s00016p00206670          118   8e-31   
gb|EPS63130.1|  hypothetical protein M569_11657                         118   8e-31   
ref|XP_008451626.1|  PREDICTED: monothiol glutaredoxin-S1-like          118   9e-31   
emb|CDY23990.1|  BnaC03g17010D                                          117   9e-31   
emb|CDP03538.1|  unnamed protein product                                117   9e-31   
gb|EMT20536.1|  Putative glutaredoxin-C14                               117   1e-30   
ref|XP_006389678.1|  glutaredoxin family protein                        117   1e-30   
ref|XP_006410157.1|  hypothetical protein EUTSA_v10017804mg             117   1e-30   
ref|XP_004494334.1|  PREDICTED: glutaredoxin-C11-like                   117   1e-30   
ref|XP_007163066.1|  hypothetical protein PHAVU_001G203300g             117   1e-30   
ref|XP_007163065.1|  hypothetical protein PHAVU_001G203200g             117   1e-30   
ref|XP_010241671.1|  PREDICTED: monothiol glutaredoxin-S6-like          117   1e-30   
ref|XP_010242707.1|  PREDICTED: monothiol glutaredoxin-S2-like          117   1e-30   
ref|XP_002881118.1|  glutaredoxin family protein                        117   1e-30   
ref|XP_011009413.1|  PREDICTED: monothiol glutaredoxin-S9-like          117   2e-30   
gb|EYU45570.1|  hypothetical protein MIMGU_mgv1a024526mg                117   2e-30   
tpg|DAA42401.1|  TPA: hypothetical protein ZEAMMB73_785246              117   2e-30   
ref|XP_010250605.1|  PREDICTED: glutaredoxin-C1-like                    117   2e-30   
ref|XP_006355540.1|  PREDICTED: monothiol glutaredoxin-S1-like          117   2e-30   
ref|XP_006663086.1|  PREDICTED: glutaredoxin-C13-like                   117   2e-30   
ref|XP_009344217.1|  PREDICTED: glutaredoxin-C5-like                    118   2e-30   
ref|XP_004136053.1|  PREDICTED: monothiol glutaredoxin-S1-like          117   2e-30   
ref|XP_008450140.1|  PREDICTED: glutaredoxin-C1-like                    117   2e-30   
ref|XP_004148005.1|  PREDICTED: glutaredoxin-C1-like                    117   2e-30   
ref|XP_002300130.1|  glutaredoxin family protein                        117   2e-30   
ref|XP_004140545.1|  PREDICTED: glutaredoxin-C3-like                    117   2e-30   
ref|XP_010414255.1|  PREDICTED: monothiol glutaredoxin-S9-like          117   2e-30   
gb|KFK42997.1|  hypothetical protein AALP_AA1G066100                    117   2e-30   
ref|XP_009336451.1|  PREDICTED: glutaredoxin-C1-like                    117   2e-30   
gb|ACJ85884.1|  unknown                                                 117   2e-30   
ref|XP_008389917.1|  PREDICTED: glutaredoxin-C1-like                    117   2e-30   
ref|XP_011033600.1|  PREDICTED: glutaredoxin-C11                        117   2e-30   
ref|XP_002520675.1|  glutaredoxin, grx, putative                        116   3e-30   
ref|XP_008674046.1|  PREDICTED: glutaredoxin-C1-like                    116   3e-30   
ref|XP_008651112.1|  PREDICTED: glutaredoxin-C1-like                    119   3e-30   
ref|XP_003521537.1|  PREDICTED: glutaredoxin-C11-like                   116   3e-30   
ref|XP_009118476.1|  PREDICTED: monothiol glutaredoxin-S11-like         116   3e-30   
emb|CDY10229.1|  BnaC05g04720D                                          116   3e-30   
ref|XP_007216287.1|  hypothetical protein PRUPE_ppa020474mg             117   3e-30   
ref|XP_002963851.1|  hypothetical protein SELMODRAFT_80143              116   3e-30   
ref|XP_011045755.1|  PREDICTED: glutaredoxin-C1                         117   3e-30   
ref|XP_009621532.1|  PREDICTED: glutaredoxin-C11-like                   116   3e-30   
emb|CDY52638.1|  BnaCnng23060D                                          116   3e-30   
ref|XP_002320360.1|  glutaredoxin family protein                        116   3e-30   
ref|XP_008347995.1|  PREDICTED: glutaredoxin-C5-like                    117   3e-30   
ref|XP_009603428.1|  PREDICTED: monothiol glutaredoxin-S6-like          116   3e-30   
ref|XP_008779419.1|  PREDICTED: glutaredoxin-C1-like                    117   3e-30   
ref|XP_008775588.1|  PREDICTED: glutaredoxin-C1-like                    117   4e-30   
gb|EYU46715.1|  hypothetical protein MIMGU_mgv1a020763mg                116   4e-30   
ref|XP_010024181.1|  PREDICTED: glutaredoxin-C1                         117   4e-30   
ref|XP_008799336.1|  PREDICTED: glutaredoxin-C1-like                    116   4e-30   
ref|XP_008459889.1|  PREDICTED: glutaredoxin-C1-like                    117   4e-30   
gb|ADV56687.1|  glutaredoxin                                            117   4e-30   
ref|XP_004309686.1|  PREDICTED: glutaredoxin-C11-like                   116   4e-30   
gb|AGX01499.1|  glutaredoxin                                            117   4e-30   
ref|XP_011082491.1|  PREDICTED: glutaredoxin-C11-like                   116   4e-30   
ref|XP_009758128.1|  PREDICTED: glutaredoxin-C13-like                   116   4e-30   
ref|XP_009346791.1|  PREDICTED: glutaredoxin-C1                         117   4e-30   
ref|XP_010249120.1|  PREDICTED: glutaredoxin-C1-like                    117   4e-30   
ref|XP_002272852.1|  PREDICTED: glutaredoxin-C1                         117   4e-30   
ref|XP_002442254.1|  hypothetical protein SORBIDRAFT_08g017090          116   4e-30   
gb|AFK47066.1|  unknown                                                 116   4e-30   
ref|NP_001235876.1|  uncharacterized protein LOC100305984               116   4e-30   
ref|XP_009414476.1|  PREDICTED: putative glutaredoxin-C14               116   4e-30   
gb|EPS67459.1|  hypothetical protein M569_07317                         116   4e-30   
ref|XP_010694080.1|  PREDICTED: monothiol glutaredoxin-S1-like          116   5e-30   
gb|EMT31793.1|  Putative glutaredoxin-C14                               115   5e-30   
ref|XP_010545041.1|  PREDICTED: glutaredoxin-C11                        116   5e-30   
ref|XP_010666489.1|  PREDICTED: glutaredoxin-C11-like                   115   5e-30   
ref|XP_008804595.1|  PREDICTED: glutaredoxin-C1                         118   6e-30   
ref|XP_006366679.1|  PREDICTED: glutaredoxin-C11-like                   115   6e-30   
ref|XP_007201440.1|  hypothetical protein PRUPE_ppa013797mg             115   6e-30   
ref|XP_004309685.1|  PREDICTED: monothiol glutaredoxin-S6-like          115   6e-30   
ref|XP_004310231.1|  PREDICTED: glutaredoxin-C1-like                    116   7e-30   
ref|NP_001235478.1|  uncharacterized protein LOC100499748               115   7e-30   
gb|AFC01204.1|  glutaredoxin family protein                             115   8e-30   
ref|XP_010694076.1|  PREDICTED: monothiol glutaredoxin-S1-like          115   8e-30   
ref|XP_006389684.1|  hypothetical protein POPTR_0020s00440g             115   8e-30   
ref|XP_010522020.1|  PREDICTED: monothiol glutaredoxin-S9               115   8e-30   
ref|XP_009144292.1|  PREDICTED: monothiol glutaredoxin-S9-like          115   8e-30   
ref|XP_011013754.1|  PREDICTED: monothiol glutaredoxin-S6-like          115   9e-30   
ref|XP_008791106.1|  PREDICTED: glutaredoxin-C1-like                    116   9e-30   
ref|XP_009378908.1|  PREDICTED: glutaredoxin-C11-like                   115   1e-29   
ref|XP_009615101.1|  PREDICTED: glutaredoxin-C11-like                   115   1e-29   
ref|XP_009591194.1|  PREDICTED: monothiol glutaredoxin-S1-like          115   1e-29   
ref|XP_010038172.1|  PREDICTED: glutaredoxin-C11-like                   115   1e-29   
ref|XP_009762083.1|  PREDICTED: glutaredoxin-C11-like                   115   1e-29   
gb|AGX01496.1|  glutaredoxin                                            115   1e-29   



>ref|XP_011090919.1| PREDICTED: monothiol glutaredoxin-S4-like [Sesamum indicum]
Length=102

 Score =   177 bits (449),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRVS+M +E+PVV+FSK+ CCMSHTIRSL  D GVNP VYELD I RGREIEQALSRLG
Sbjct  1    MDRVSKMVSEKPVVIFSKTQCCMSHTIRSLFCDFGVNPTVYELDEISRGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGE VGG NEIM+LHL+++LKP LKRAGALWV
Sbjct  61   CNPTVPAVFIGGEFVGGANEIMSLHLKRSLKPMLKRAGALWV  102



>ref|XP_006342767.1| PREDICTED: monothiol glutaredoxin-S3-like [Solanum tuberosum]
Length=102

 Score =   174 bits (442),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RVSRM AE+PVV+FSK+SCCMSHTI+SL  D+GV+P+V+ELD + RGREIE ALSRLG
Sbjct  1    MERVSRMVAEKPVVIFSKNSCCMSHTIKSLFCDLGVHPSVHELDEMQRGREIEAALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGELVGGENE+M+LHLQ++LKP LKRAGALWV
Sbjct  61   CNPTVPAVFIGGELVGGENEVMSLHLQRSLKPMLKRAGALWV  102



>ref|XP_004229211.1| PREDICTED: monothiol glutaredoxin-S3 [Solanum lycopersicum]
Length=102

 Score =   173 bits (439),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RVSRM +E+PVV+FSK+SCCMSHTI+SL  D+GV+P+V+ELD + RGREIE ALSRLG
Sbjct  1    MERVSRMVSEKPVVIFSKNSCCMSHTIKSLFCDLGVHPSVHELDEMQRGREIEAALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGELVGGENE+M+LHLQ++LKP LKRAGALWV
Sbjct  61   CNPTVPAVFIGGELVGGENEVMSLHLQRSLKPMLKRAGALWV  102



>ref|XP_009369121.1| PREDICTED: monothiol glutaredoxin-S2-like [Pyrus x bretschneideri]
 ref|XP_009339842.1| PREDICTED: monothiol glutaredoxin-S2-like [Pyrus x bretschneideri]
Length=102

 Score =   172 bits (437),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+ MA+ERPVV+FSKSSCCMSHTI++LL D GVNPAVYELD + RGREIEQALSRLG
Sbjct  1    MDAVTNMASERPVVIFSKSSCCMSHTIKTLLCDFGVNPAVYELDQMQRGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGELVGG NE+M+LHL+++L P LKR GALWV
Sbjct  61   CNPTVPAVFIGGELVGGANEVMSLHLRRSLIPMLKRVGALWV  102



>gb|EYU43911.1| hypothetical protein MIMGU_mgv1a016894mg [Erythranthe guttata]
Length=102

 Score =   172 bits (436),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RVS+M +E+PVV+FS ++CCMSHTI SL +D GVNP VYELD I RGREIEQALSRLG
Sbjct  1    MERVSKMVSEKPVVIFSMTTCCMSHTIISLFSDFGVNPMVYELDEISRGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGE VGG NE+M+LHL++ALKP LKRAGALWV
Sbjct  61   CNPTVPAVFIGGEFVGGANEVMSLHLKRALKPMLKRAGALWV  102



>ref|XP_008353232.1| PREDICTED: monothiol glutaredoxin-S2-like [Malus domestica]
 ref|XP_008361967.1| PREDICTED: monothiol glutaredoxin-S2-like [Malus domestica]
Length=102

 Score =   172 bits (435),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+ MA+ERPVV+FSKSSCCMSH+I++LL D GVNPAVYELD + RGREIEQALSRLG
Sbjct  1    MDAVTNMASERPVVIFSKSSCCMSHSIKTLLCDFGVNPAVYELDQMQRGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGELVGG NE+M+LHL+++L P LKR GALWV
Sbjct  61   CNPTVPAVFIGGELVGGANEVMSLHLKRSLIPMLKRVGALWV  102



>ref|XP_008390722.1| PREDICTED: monothiol glutaredoxin-S2 [Malus domestica]
Length=102

 Score =   171 bits (432),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++MA+ERPVV+FSKSSCCMSH+I++LL D GVNPAVYELD + RGREIEQALSRLG
Sbjct  1    MEAVTKMASERPVVIFSKSSCCMSHSIKTLLCDFGVNPAVYELDEMQRGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGELVGG NE+M+LHL+++L P LKR GALWV
Sbjct  61   CNPTVPAVFIGGELVGGANEVMSLHLKRSLIPMLKRVGALWV  102



>ref|XP_009629061.1| PREDICTED: monothiol glutaredoxin-S2 [Nicotiana tomentosiformis]
 ref|XP_009763279.1| PREDICTED: monothiol glutaredoxin-S2-like [Nicotiana sylvestris]
Length=103

 Score =   170 bits (431),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRG-REIEQALSRL  157
            M+RVSRM AE+PVV+FSKSSCCMSHTI+SL  D+GV+PAV+ELD + RG REIE ALSRL
Sbjct  1    MERVSRMVAEKPVVIFSKSSCCMSHTIKSLFCDLGVHPAVHELDEMQRGGREIEAALSRL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GCNPTVPAVFIGGELVGGE+E+M+LHLQ++LKP LKRAGALWV
Sbjct  61   GCNPTVPAVFIGGELVGGESEVMSLHLQRSLKPMLKRAGALWV  103



>ref|XP_011090920.1| PREDICTED: monothiol glutaredoxin-S5-like [Sesamum indicum]
Length=102

 Score =   169 bits (429),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RVS+M +E+P+V+FSK+ CCMSHTI+SL  D GVNP +YELD IPRGREIEQA+SR G
Sbjct  1    MERVSKMVSEKPLVIFSKTQCCMSHTIKSLFYDFGVNPTIYELDEIPRGREIEQAISRHG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP VPAVFIGGE VGG +EIM+LHL++ALKP LKRAGALWV
Sbjct  61   CNPPVPAVFIGGEFVGGADEIMSLHLKRALKPMLKRAGALWV  102



>ref|XP_007225971.1| hypothetical protein PRUPE_ppa013805mg [Prunus persica]
 gb|EMJ27170.1| hypothetical protein PRUPE_ppa013805mg [Prunus persica]
Length=102

 Score =   169 bits (428),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++MA+ERPVV+FSKSSCCM H+I++L +D GVNPAVYELD + RG+EIEQALSRLG
Sbjct  1    MEVVTKMASERPVVIFSKSSCCMCHSIKTLFSDFGVNPAVYELDEMQRGKEIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGE VGG NE+M LHLQ++L P LKRAGALWV
Sbjct  61   CNPTVPAVFIGGEFVGGANEVMNLHLQRSLIPMLKRAGALWV  102



>ref|XP_003550174.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max]
 gb|KHN03384.1| Monothiol glutaredoxin-S2 [Glycine soja]
Length=102

 Score =   168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV++M +ERPVV+FSKSSCCMSHTI++LL D GVNPAV+ELD IPRGR+IEQALSRLG
Sbjct  1    MERVTKMVSERPVVIFSKSSCCMSHTIKTLLCDFGVNPAVHELDEIPRGRDIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFI GELVGG NE+M+LHL ++L P LK+AGALWV
Sbjct  61   CSPSVPAVFISGELVGGANEVMSLHLNRSLIPMLKKAGALWV  102



>ref|XP_007154238.1| hypothetical protein PHAVU_003G102000g [Phaseolus vulgaris]
 gb|ESW26232.1| hypothetical protein PHAVU_003G102000g [Phaseolus vulgaris]
Length=102

 Score =   168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV++M +ERPVV+FSKSSCCMSH+I++L  D GVNP+V+ELD IPRGR+IEQALSRLG
Sbjct  1    MDRVTKMVSERPVVIFSKSSCCMSHSIKTLFCDFGVNPSVHELDEIPRGRDIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFI GELVGG NE+MTLHL ++L P LK+AGALWV
Sbjct  61   CSPSVPAVFIAGELVGGANEVMTLHLNRSLIPMLKKAGALWV  102



>ref|XP_010558476.1| PREDICTED: monothiol glutaredoxin-S2 [Tarenaya hassleriana]
Length=102

 Score =   167 bits (423),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+R+++M  ERPVV+FSKSSCCMSHTI++LL D GVNPAV ELD +PRGREIEQALSRLG
Sbjct  1    MERITKMVKERPVVIFSKSSCCMSHTIKTLLCDFGVNPAVQELDEVPRGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFIGGE VGG NE+M+LHL ++L P LKRAGALW+
Sbjct  61   CSPSVPAVFIGGEFVGGANEVMSLHLNRSLIPMLKRAGALWL  102



>ref|XP_008223118.1| PREDICTED: monothiol glutaredoxin-S2 [Prunus mume]
Length=102

 Score =   167 bits (423),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++MA+ERPVV+FSKSSCCM H+I++L +D GVNPAVYELD + RGREIEQALSRLG
Sbjct  1    MEVVTKMASERPVVIFSKSSCCMCHSIKTLFSDFGVNPAVYELDEMQRGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGG+ VGG NE+M LHLQ++L P LKR GALWV
Sbjct  61   CNPTVPAVFIGGDFVGGANEVMNLHLQRSLIPMLKRVGALWV  102



>ref|XP_009352227.1| PREDICTED: monothiol glutaredoxin-S2 [Pyrus x bretschneideri]
Length=102

 Score =   167 bits (422),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++MA+ERPVV+FSKSSCC+SH+I++LL D GVNPAVYELD + RGREIEQALSRLG
Sbjct  1    MEAVTKMASERPVVIFSKSSCCISHSIKTLLCDFGVNPAVYELDEMQRGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGELVGG NE+M+LHL+++L P L R GALWV
Sbjct  61   CNPTVPAVFIGGELVGGANEVMSLHLKRSLIPMLMRVGALWV  102



>ref|XP_002275384.1| PREDICTED: monothiol glutaredoxin-S2 [Vitis vinifera]
 emb|CBI26100.3| unnamed protein product [Vitis vinifera]
Length=103

 Score =   166 bits (421),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 92/103 (89%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDR-VSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRL  157
            M+R V+R+A+ERPVV+FSKSSCCM HTI++L +D GVNPAV+ELD +PRGREIEQAL+RL
Sbjct  1    MERAVARLASERPVVIFSKSSCCMCHTIKTLFSDFGVNPAVHELDEMPRGREIEQALARL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GCNPTVP VFIGGE VGG NEIMTLHL ++L P LKRAGALWV
Sbjct  61   GCNPTVPTVFIGGERVGGTNEIMTLHLNRSLIPMLKRAGALWV  103



>ref|XP_007147880.1| hypothetical protein PHAVU_006G162700g [Phaseolus vulgaris]
 gb|ESW19874.1| hypothetical protein PHAVU_006G162700g [Phaseolus vulgaris]
Length=102

 Score =   166 bits (420),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV +MA+ERPVV+FS+SSCCM HTI++L ND GVNP V+ELD IPRGR+IEQALSRLG
Sbjct  1    MDRVVQMASERPVVIFSRSSCCMCHTIKTLFNDFGVNPNVHELDEIPRGRDIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGGELVGG +E+M+LHL + L P+L  AGALWV
Sbjct  61   CNPSVPAVFIGGELVGGASEVMSLHLNRTLIPRLMNAGALWV  102



>ref|XP_009631350.1| PREDICTED: monothiol glutaredoxin-S3-like [Nicotiana tomentosiformis]
Length=102

 Score =   166 bits (420),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RVSR+  E+PVV+FSKS CCMSH+I+SL +D+GVN A+YELD + RG EIE ALS LG
Sbjct  1    MERVSRIVTEKPVVIFSKSCCCMSHSIKSLFSDLGVNTAIYELDEMQRGHEIEAALSNLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGE+VGGENE+M+LHL+ +LKPKLK AGALWV
Sbjct  61   CNPTVPAVFIGGEMVGGENEVMSLHLRGSLKPKLKSAGALWV  102



>ref|XP_006584039.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max]
 gb|KHN02995.1| Monothiol glutaredoxin-S2 [Glycine soja]
Length=102

 Score =   166 bits (419),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV++M +ERPVV+FSKSSCCMSHTI++L  D GVNPAV+ELD IPRGR+IEQALSRLG
Sbjct  1    MERVTKMVSERPVVIFSKSSCCMSHTIKTLFCDFGVNPAVHELDEIPRGRDIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFI G+L+GG NE+M+LHL ++L P LK+AGALWV
Sbjct  61   CSPSVPAVFIAGDLIGGANEVMSLHLNRSLIPMLKKAGALWV  102



>ref|XP_004296808.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   166 bits (419),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++MA+ERPVV+FSKSSCCMSH+I++LL+D GVNPAVYELD + RGREIEQAL RLG
Sbjct  1    MEAVTKMASERPVVIFSKSSCCMSHSIKTLLSDFGVNPAVYELDEMQRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFIGGE VGG NE+M+LHL+++L P LKR GALWV
Sbjct  61   CSPSVPAVFIGGEFVGGANEVMSLHLKRSLIPMLKRVGALWV  102



>ref|XP_004296805.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   165 bits (418),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++MA+ERPVV+FSKSSCCMSH+I++LL+D GVNPAVYELD + RGREIEQAL RLG
Sbjct  1    MEAVTKMASERPVVIFSKSSCCMSHSIKTLLSDFGVNPAVYELDEMHRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFIGGE VGG NE+M+LHL+++L P LKR GALWV
Sbjct  61   CSPSVPAVFIGGEFVGGANEVMSLHLKRSLIPMLKRVGALWV  102



>ref|XP_010098332.1| Monothiol glutaredoxin-S2 [Morus notabilis]
 gb|EXB74836.1| Monothiol glutaredoxin-S2 [Morus notabilis]
Length=102

 Score =   165 bits (417),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV++M +E+PVV+FS+S+CCM HTI++L  D GVNPAVYELD  PRGREIEQALS LG
Sbjct  1    MERVTKMVSEKPVVIFSRSTCCMCHTIKTLFCDFGVNPAVYELDEEPRGREIEQALSMLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVFIGGELVGG NE+M+LHL+++L P LKRAGALWV
Sbjct  61   CSPTVPAVFIGGELVGGANEVMSLHLKRSLIPMLKRAGALWV  102



>ref|XP_003546092.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max]
Length=102

 Score =   165 bits (417),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV++MA+ERPVV+FS+SSCCM HTI++L +D GV+P V+ELD IPRG++IEQALSRLG
Sbjct  1    MDRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELDEIPRGKDIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFIGGELVGG NE+M+LHL ++L P L+RAGALWV
Sbjct  61   CSPSVPAVFIGGELVGGANEVMSLHLNRSLIPMLRRAGALWV  102



>gb|EPS64180.1| hypothetical protein M569_10600 [Genlisea aurea]
Length=102

 Score =   164 bits (415),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ VS+M AE+PVV+FSKSSCC+SHTIRSLL+D GVNP VYELD + RGRE+EQAL R+G
Sbjct  1    MEMVSKMVAEKPVVVFSKSSCCISHTIRSLLSDFGVNPTVYELDEMARGREVEQALMRIG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VGG  E+M+LHL+++LKP LK AGALWV
Sbjct  61   CNPSVPAVFIGGKFVGGATEVMSLHLRRSLKPMLKTAGALWV  102



>ref|XP_004296807.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   164 bits (414),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++MA+ERPVV+FSKSSCCMSH+I++LL+D GVNPAVYELD + RGREIEQ L RLG
Sbjct  1    MEAVTKMASERPVVIFSKSSCCMSHSIKTLLSDFGVNPAVYELDEMQRGREIEQVLLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFIGGE VGG NE+M+LHL+++L P LKR GALWV
Sbjct  61   CSPSVPAVFIGGEFVGGANEVMSLHLKRSLIPMLKRVGALWV  102



>ref|XP_007035505.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOY06431.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=102

 Score =   163 bits (412),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+++A+E+PVV+FSKSSCCM HTI++L  D GVNPAV+ELD I RGREIEQALSRLG
Sbjct  1    MERVTKLASEKPVVIFSKSSCCMCHTIKTLFYDFGVNPAVHELDEIARGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVF+GGELVGG NE+M+LHL ++L P L+R GALWV
Sbjct  61   CSPSVPAVFVGGELVGGANEVMSLHLNRSLIPMLRRVGALWV  102



>ref|XP_004134195.1| PREDICTED: monothiol glutaredoxin-S2-like [Cucumis sativus]
 ref|XP_004170037.1| PREDICTED: monothiol glutaredoxin-S2-like [Cucumis sativus]
 ref|XP_008438823.1| PREDICTED: monothiol glutaredoxin-S2 [Cucumis melo]
 gb|KGN57082.1| hypothetical protein Csa_3G152090 [Cucumis sativus]
Length=102

 Score =   162 bits (411),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+R+ +ERPVV+FSKS+CCMSHT+  LL+  GVNPAV+ELD I RGRE+EQALSRLG
Sbjct  1    MDRVTRLISERPVVIFSKSTCCMSHTVMRLLSGFGVNPAVHELDQISRGREVEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
             NPTVPAVFIGGELVGG NE+M+LHL ++L P L++AGALWV
Sbjct  61   FNPTVPAVFIGGELVGGANEVMSLHLNRSLIPMLRKAGALWV  102



>ref|XP_004296806.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   162 bits (410),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++M +ERPVV+FSKSSCC+SH+I++LL+D GVNPAVYELD + RGREIEQAL RLG
Sbjct  1    MEAVTKMVSERPVVIFSKSSCCISHSIKTLLSDFGVNPAVYELDEMQRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFIGGE VGG NE+M+LHL+++L P LKR GALWV
Sbjct  61   CSPSVPAVFIGGEFVGGANEVMSLHLKRSLIPMLKRVGALWV  102



>ref|XP_011071466.1| PREDICTED: monothiol glutaredoxin-S5-like [Sesamum indicum]
Length=102

 Score =   162 bits (410),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +S M +  PVV+FSK+SCC+SHTIRSL +D GVNP VYELD + RGREIEQALSRLG
Sbjct  1    MEGISDMVSNNPVVIFSKTSCCISHTIRSLFSDFGVNPTVYELDGVARGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIGGE VGG NE+M+LHL  +LKP L+ AGALW+
Sbjct  61   CNPTVPAVFIGGEFVGGANEVMSLHLSGSLKPMLRNAGALWL  102



>gb|KHN47302.1| Monothiol glutaredoxin-S4 [Glycine soja]
Length=102

 Score =   162 bits (410),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV++MA+ERPVV+FS+SSCCM HTI++L +D GV+P V+ELD IPRG +IEQALSRLG
Sbjct  1    MDRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELDEIPRGNDIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VP VFIGGELVGG NE+M+LHL ++L P L+RAGALWV
Sbjct  61   CSPSVPVVFIGGELVGGANEVMSLHLNRSLIPMLRRAGALWV  102



>ref|XP_004508301.1| PREDICTED: monothiol glutaredoxin-S2-like [Cicer arietinum]
 ref|XP_004508302.1| PREDICTED: monothiol glutaredoxin-S2-like [Cicer arietinum]
Length=102

 Score =   162 bits (409),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+R+++M +ERPVV+FSKS+CCMSHTI++LL++ GVNPAV+ELD IPRGREIEQALSRLG
Sbjct  1    MERITKMVSERPVVIFSKSTCCMSHTIKTLLSEFGVNPAVHELDEIPRGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP ++I G+L+GG N++M+LHL ++L P LK+AGALW+
Sbjct  61   CSPTVPTLYIAGDLIGGANQVMSLHLNRSLIPMLKKAGALWL  102



>ref|NP_197361.1| monothiol glutaredoxin-S2 [Arabidopsis thaliana]
 sp|Q8L8Z8.1|GRXS2_ARATH RecName: Full=Monothiol glutaredoxin-S2; Short=AtGrxS2; AltName: 
Full=Protein ROXY 10 [Arabidopsis thaliana]
 gb|AAM67033.1| glutaredoxin-like protein [Arabidopsis thaliana]
 dbj|BAC42196.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAO50549.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|ACO50415.1| glutaredoxin [Arabidopsis thaliana]
 gb|AED92584.1| monothiol glutaredoxin-S2 [Arabidopsis thaliana]
Length=102

 Score =   161 bits (408),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD +++M  ERPVV++SKSSCCMSHTI++LL D G NPAVYELD I RGREIEQAL RLG
Sbjct  1    MDMITKMVMERPVVIYSKSSCCMSHTIKTLLCDFGANPAVYELDEISRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VP VFIGGELVGG NE+M+LHL  +L P LKRAGALWV
Sbjct  61   CSPAVPGVFIGGELVGGANEVMSLHLNGSLIPMLKRAGALWV  102



>ref|XP_002873906.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50165.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   161 bits (408),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD +++M  ERPVV++SKSSCCMSHTI++LL D G NPAVYELD +PRGR+IE+AL RLG
Sbjct  1    MDMITKMVMERPVVIYSKSSCCMSHTIKTLLCDFGANPAVYELDELPRGRDIERALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NE+M+LHL  +L P LKRAGALWV
Sbjct  61   CSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLKRAGALWV  102



>gb|KFK26098.1| hypothetical protein AALP_AA8G202600 [Arabis alpina]
Length=102

 Score =   161 bits (408),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD +++M  ERPVV++SKSSCCMSHTI++LL D G NPAVYELD + RGREIEQAL R G
Sbjct  1    MDMITKMVMERPVVIYSKSSCCMSHTIKTLLCDFGANPAVYELDEVSRGREIEQALLRFG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NE+M+LHL  +L P LKRAGALWV
Sbjct  61   CSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLKRAGALWV  102



>ref|XP_006594494.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max]
Length=154

 Score =   163 bits (412),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV++MA+ERPVV+FS+SSCCM HTI++L +D GV+P V+ELD IPRG +IEQALSRLG
Sbjct  53   MDRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELDEIPRGNDIEQALSRLG  112

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VP VFIGGELVGG NE+M+LHL ++L P L+RAGALWV
Sbjct  113  CSPSVPVVFIGGELVGGANEVMSLHLNRSLIPMLRRAGALWV  154



>ref|XP_010420636.1| PREDICTED: monothiol glutaredoxin-S2 [Camelina sativa]
Length=102

 Score =   161 bits (407),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +++M  ERPVV++SKSSCCMSHTI++LL D G NPAVYELD I RGREIEQAL R+G
Sbjct  1    MEMITKMVMERPVVIYSKSSCCMSHTIKTLLCDFGANPAVYELDEISRGREIEQALLRIG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NEIM+LHL  +L P LKRAGALWV
Sbjct  61   CSPAVPAVFIGGELVGGANEIMSLHLNGSLIPMLKRAGALWV  102



>ref|XP_003609600.1| Monothiol glutaredoxin-S2 [Medicago truncatula]
 ref|XP_003609601.1| Monothiol glutaredoxin-S2 [Medicago truncatula]
 ref|XP_003609602.1| Monothiol glutaredoxin-S2 [Medicago truncatula]
 gb|AES91797.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
 gb|AES91798.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
 gb|AES91799.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
 gb|AFK47399.1| unknown [Medicago truncatula]
Length=103

 Score =   161 bits (407),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 91/103 (88%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQAL-SRL  157
            M+RV++M +ERPVV+FSKSSCCMSHTI++L  D GVNPAVYELD IPRGREIEQAL SRL
Sbjct  1    MERVTKMVSERPVVIFSKSSCCMSHTIKTLFCDFGVNPAVYELDEIPRGREIEQALISRL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            G +P+VP VFIGGELVGG N++M+LHL ++L P LK+AGALW+
Sbjct  61   GSSPSVPTVFIGGELVGGANQVMSLHLNRSLIPMLKKAGALWL  103



>ref|XP_010454112.1| PREDICTED: monothiol glutaredoxin-S2-like [Camelina sativa]
Length=102

 Score =   160 bits (406),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +++M  ERPVV++SKSSCCMSHTI++LL D G NPAVYELD I RGREIEQAL R+G
Sbjct  1    MEMITKMVMERPVVIYSKSSCCMSHTIKTLLCDFGANPAVYELDEISRGREIEQALLRIG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NE+M+LHL  +L P LKRAGALWV
Sbjct  61   CSPAVPAVFIGGELVGGANEVMSLHLSGSLIPMLKRAGALWV  102



>ref|XP_004241071.1| PREDICTED: monothiol glutaredoxin-S4-like [Solanum lycopersicum]
Length=103

 Score =   160 bits (406),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPR-GREIEQALSRL  157
            MD++S+M  E+PVV+FSK+ CCMSH+I+S  +D+GVN AVYELD + R GREIE  LS L
Sbjct  1    MDKLSKMVTEKPVVIFSKTGCCMSHSIKSFFSDLGVNTAVYELDEMLRTGREIETVLSNL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GCNPTVPAVFIGG++VGGE+E+M+LHLQ ALKPKLK AGALWV
Sbjct  61   GCNPTVPAVFIGGQMVGGESEVMSLHLQGALKPKLKTAGALWV  103



>ref|XP_004296804.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   160 bits (406),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++M +ERPVV+FSKSSCC+S++I++LL+D GVNPAVYELD + RGREIEQAL RLG
Sbjct  1    MEAVTKMVSERPVVIFSKSSCCISYSIKTLLSDFGVNPAVYELDEMQRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFIGGE VGG NEIM+LHL+++L P LKR GALW+
Sbjct  61   CSPSVPAVFIGGEFVGGANEIMSLHLKRSLIPMLKRVGALWI  102



>gb|AFK45164.1| unknown [Lotus japonicus]
Length=103

 Score =   160 bits (405),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 91/103 (88%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSR-L  157
            M+RV++M +ERPVV+FSKSSCCMSH+I++L  D GVNPAVYELD IPRGR+IEQALSR L
Sbjct  1    MERVTKMVSERPVVIFSKSSCCMSHSIKTLFCDFGVNPAVYELDEIPRGRDIEQALSRQL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GC+P+VP VFIGGELVGG N+ M+LHL ++L P LK+AGALW+
Sbjct  61   GCSPSVPTVFIGGELVGGANQAMSLHLNRSLIPMLKKAGALWL  103



>gb|EPS64181.1| glutaredoxin [Genlisea aurea]
Length=102

 Score =   160 bits (404),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V ++A+E+PVV+FSK+SCCMSHTI+SL  D GV+P +YE+D IPRGREIEQAL  LG
Sbjct  1    MEGVKKLASEKPVVIFSKTSCCMSHTIKSLFYDFGVDPKIYEIDEIPRGREIEQALLTLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFIGGE  GG NEIM+LH+++ LKP LK+AGALWV
Sbjct  61   CDPSVPAVFIGGEFAGGANEIMSLHIKRDLKPMLKKAGALWV  102



>ref|XP_006380202.1| hypothetical protein POPTR_0008s22870g [Populus trichocarpa]
 gb|ERP57999.1| hypothetical protein POPTR_0008s22870g [Populus trichocarpa]
Length=101

 Score =   160 bits (404),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 90/102 (88%), Gaps = 1/102 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+ +A+ERPVV+FSKSSCCM HTI++L N+ GVN AV+ELD +PRGREIEQALSR G
Sbjct  1    MERVTNLASERPVVIFSKSSCCMCHTIKTLFNEFGVNVAVHELDEMPRGREIEQALSRFG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PT+PAVFIGGELVGG NE+M+LHL ++L P LKRAGALWV
Sbjct  61   C-PTLPAVFIGGELVGGANEVMSLHLNRSLIPMLKRAGALWV  101



>ref|XP_006400409.1| hypothetical protein EUTSA_v10015538mg [Eutrema salsugineum]
 gb|ESQ41862.1| hypothetical protein EUTSA_v10015538mg [Eutrema salsugineum]
Length=102

 Score =   159 bits (403),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +++M  ERPVV++SKS+CCMSHTI++LL D G NPAVYELD + RGREIEQAL RLG
Sbjct  1    MEMITKMVLERPVVIYSKSACCMSHTIKTLLCDFGANPAVYELDEVSRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NE+M+LHL  +L P LKRAGALWV
Sbjct  61   CSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLKRAGALWV  102



>ref|XP_006380199.1| glutaredoxin family protein [Populus trichocarpa]
 gb|ERP57996.1| glutaredoxin family protein [Populus trichocarpa]
Length=101

 Score =   159 bits (402),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 90/102 (88%), Gaps = 1/102 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+ +A+ERPVV+FSKS+CCM HTI++L N+ GVN AV+ELD +PRGREIEQALSR G
Sbjct  1    MERVTNLASERPVVIFSKSTCCMCHTIKTLFNEFGVNVAVHELDEMPRGREIEQALSRFG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PT+PAVFIGGELVGG NE+M+LHL ++L P LKRAGALWV
Sbjct  61   C-PTLPAVFIGGELVGGANEVMSLHLNRSLIPMLKRAGALWV  101



>ref|XP_009120959.1| PREDICTED: monothiol glutaredoxin-S2 [Brassica rapa]
 emb|CDX92597.1| BnaA10g16360D [Brassica napus]
Length=102

 Score =   159 bits (402),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V+RM  ERPVV++SKS CCMSHT+++LL D G NPAVYELD + RGREIEQAL RLG
Sbjct  1    MEMVTRMVLERPVVIYSKSLCCMSHTVKTLLCDFGANPAVYELDEVSRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NE+M+LHL  +L P LKRAGALWV
Sbjct  61   CSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLKRAGALWV  102



>gb|AFK39077.1| unknown [Lotus japonicus]
Length=102

 Score =   159 bits (401),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+ +A+ER VV+FSKS+CCM HTI +L +D GVNP V+E+D +PRGR+IEQALSRLG
Sbjct  1    MDRVTTLASERSVVIFSKSTCCMCHTIITLFSDFGVNPTVHEIDEMPRGRDIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NE+M+LHL ++L P L+RAGA+WV
Sbjct  61   CSPAVPAVFIGGELVGGANEVMSLHLNRSLIPMLRRAGAIWV  102



>emb|CDX70828.1| BnaC03g09120D [Brassica napus]
Length=102

 Score =   159 bits (401),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +++M  ERPVV++SKSSCCMSHT+++LL D G NPAVYELD + RGREIEQAL RLG
Sbjct  1    MEMITKMVLERPVVIYSKSSCCMSHTVKTLLCDFGANPAVYELDEVSRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NE+M+LHL  +L P LK+AGALWV
Sbjct  61   CSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLKQAGALWV  102



>ref|XP_006288956.1| hypothetical protein CARUB_v10002321mg [Capsella rubella]
 gb|EOA21854.1| hypothetical protein CARUB_v10002321mg [Capsella rubella]
Length=102

 Score =   158 bits (400),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++M  ERPVV++SKS CCMSHTI++LL D G NPAVYELD I RGREIEQAL R+G
Sbjct  1    MEMVTKMVMERPVVIYSKSLCCMSHTIKTLLCDFGANPAVYELDEISRGREIEQALLRIG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NE+M+LHL  +L P LKRAGALWV
Sbjct  61   CSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLKRAGALWV  102



>emb|CDY02610.1| BnaC02g08250D [Brassica napus]
Length=102

 Score =   158 bits (400),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +++M  ERPVV++SK+SCCMSHT+++LL D G NPAV+ELD IPRGREIEQAL RLG
Sbjct  1    MEMITKMVLERPVVIYSKTSCCMSHTVKTLLCDFGANPAVHELDEIPRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPA+FIGGELVGG NE+M+LHL  +L P LK+AGALWV
Sbjct  61   CSPAVPAIFIGGELVGGANEVMSLHLNGSLIPMLKQAGALWV  102



>gb|EPS67026.1| hypothetical protein M569_07752 [Genlisea aurea]
Length=102

 Score =   158 bits (400),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+R+ RM +E+ VV+FSK+SCCMSHTI+SL  D+GV+P ++ELD IPRGR+IEQAL ++G
Sbjct  1    MERMKRMGSEKAVVIFSKTSCCMSHTIKSLFYDLGVDPKIFELDEIPRGRDIEQALLKIG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVFIGGE  GG NEIM+LH+++ LKP LK+AGA+WV
Sbjct  61   CDPTVPAVFIGGEFAGGANEIMSLHIRRDLKPMLKKAGAIWV  102



>ref|NP_001274383.1| monothiol glutaredoxin-S2-like [Cucumis sativus]
 ref|XP_008458479.1| PREDICTED: monothiol glutaredoxin-S2-like [Cucumis melo]
 gb|AGX01495.1| glutaredoxin [Cucumis sativus]
 gb|KGN47200.1| Glutaredoxin family protein [Cucumis sativus]
Length=102

 Score =   158 bits (400),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V+++ ++RPVV+FSK+SCCMSH+I++LL D GVNP VYELD +PRG+EIEQAL R+G
Sbjct  1    METVNKLVSDRPVVVFSKNSCCMSHSIKTLLCDFGVNPTVYELDELPRGKEIEQALLRIG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP VPAVFIGGELVGG NE+M+LHL++ L P L++AGALWV
Sbjct  61   CNPAVPAVFIGGELVGGANEVMSLHLKRNLIPMLRKAGALWV  102



>ref|XP_009126270.1| PREDICTED: monothiol glutaredoxin-S2-like [Brassica rapa]
Length=102

 Score =   158 bits (400),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +++M  ERPVV++SKSSCCMSHT+++LL D G NPAV+ELD +PRGREIEQAL RLG
Sbjct  1    MEMITKMVLERPVVIYSKSSCCMSHTVKTLLCDFGANPAVHELDEVPRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPA+FIGGELVGG NE+M+LHL  +L P LK AGALWV
Sbjct  61   CSPAVPAIFIGGELVGGANEVMSLHLNGSLIPMLKHAGALWV  102



>ref|XP_009131678.1| PREDICTED: monothiol glutaredoxin-S2 [Brassica rapa]
 emb|CDX88929.1| BnaA03g07200D [Brassica napus]
Length=102

 Score =   158 bits (399),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +++M  ERPVV++SKSSCCMSHT+++LL D G NPAVYELD + RGREIEQAL RLG
Sbjct  1    MEMITKMVLERPVVIYSKSSCCMSHTVKTLLCDFGANPAVYELDEVSRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P VPAVFIGGELVGG NE+M+LHL  +L P LK+AGALWV
Sbjct  61   CGPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLKQAGALWV  102



>emb|CDY13904.1| BnaC09g39220D [Brassica napus]
Length=102

 Score =   158 bits (399),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V RM  ERPVV++SKS CCMSHT+++LL D G NPAVYELD + RGREIEQAL RLG
Sbjct  1    MEMVKRMVLERPVVIYSKSLCCMSHTVKTLLCDFGANPAVYELDEVSRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NE+M+LHL  +L P LKRAGALWV
Sbjct  61   CSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLKRAGALWV  102



>ref|XP_006356697.1| PREDICTED: monothiol glutaredoxin-S3-like [Solanum tuberosum]
Length=103

 Score =   158 bits (399),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPR-GREIEQALSRL  157
            M+RV++M  E+PVV+FSK+ CCMS++I+S  +D+GVN AVYELD + R GREIE  LS L
Sbjct  1    MERVNKMVTEKPVVIFSKTGCCMSYSIKSFFSDLGVNTAVYELDEMQRAGREIEAVLSNL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GCNPTVPAVFIGG++VGGE+E+M+LHLQ ALKPKLK AGALWV
Sbjct  61   GCNPTVPAVFIGGQMVGGESEVMSLHLQGALKPKLKTAGALWV  103



>ref|XP_010492876.1| PREDICTED: monothiol glutaredoxin-S2-like [Camelina sativa]
Length=102

 Score =   158 bits (399),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +++M  ERPVV++SKS CCMSHTI++LL D G NPAVYELD I RGREIEQAL R+G
Sbjct  1    MEMITKMVMERPVVIYSKSLCCMSHTIKTLLCDFGANPAVYELDEISRGREIEQALLRIG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG NE+M+LHL  +L P LKRAGALWV
Sbjct  61   CSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLKRAGALWV  102



>ref|XP_006419644.1| hypothetical protein CICLE_v10006286mg [Citrus clementina]
 ref|XP_006489134.1| PREDICTED: monothiol glutaredoxin-S2-like [Citrus sinensis]
 gb|ESR32884.1| hypothetical protein CICLE_v10006286mg [Citrus clementina]
 gb|KDO75111.1| hypothetical protein CISIN_1g034075mg [Citrus sinensis]
Length=104

 Score =   157 bits (396),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV++MA+ERPVV+FSKSSCC+ H+I++L  D GVNPAVYELD +P GRE+EQ L RLG
Sbjct  3    MERVAKMASERPVVIFSKSSCCICHSIKTLFCDFGVNPAVYELDEMPGGRELEQDLQRLG  62

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGGELVGG N++M+LHL ++L P LKR GA+WV
Sbjct  63   CSPAVPAVFIGGELVGGANQVMSLHLNRSLIPMLKRVGAIWV  104



>gb|EYU43914.1| hypothetical protein MIMGU_mgv1a016876mg [Erythranthe guttata]
Length=103

 Score =   156 bits (395),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 89/103 (86%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+R++++ +++P+V+FS ++CCMSHTI+SL  D GVNP +YELD I  GREIEQALSRLG
Sbjct  1    MERLNKLVSKKPLVIFSMTTCCMSHTIKSLFYDFGVNPTIYELDEIANGREIEQALSRLG  60

Query  153  CNPT-VPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPT +PAVFIGGE VGG NEIM+LHL+++LKP LK AGALWV
Sbjct  61   CNPTMMPAVFIGGEFVGGANEIMSLHLKRSLKPMLKNAGALWV  103



>ref|XP_002315567.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEF01738.1| glutaredoxin family protein [Populus trichocarpa]
Length=101

 Score =   156 bits (395),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 90/102 (88%), Gaps = 1/102 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+++A+ERPVV+FSK++CCM HTI++L  D GVNPAV+ELD +PRGREIEQAL+R G
Sbjct  1    MERVTKLASERPVVIFSKTTCCMCHTIKTLFCDFGVNPAVHELDEMPRGREIEQALTRAG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PT+PAVFIGGE+VGG NE+M+LHL ++L P LK AGALWV
Sbjct  61   C-PTLPAVFIGGEIVGGANEVMSLHLSRSLIPMLKHAGALWV  101



>ref|XP_004486045.1| PREDICTED: monothiol glutaredoxin-S2-like [Cicer arietinum]
Length=102

 Score =   156 bits (395),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+ +A+ER VV+FSKSSCCM HTI++LL+D GVNP V+ELD I  GR+IEQAL RLG
Sbjct  1    MERVTELASERSVVIFSKSSCCMCHTIKTLLSDFGVNPEVHELDEINGGRDIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGGE VGG NE+M+LHL ++L P L+RAGALWV
Sbjct  61   CNPSVPAVFIGGEFVGGANEVMSLHLNRSLIPMLRRAGALWV  102



>gb|EYU43913.1| hypothetical protein MIMGU_mgv1a026737mg [Erythranthe guttata]
Length=103

 Score =   156 bits (395),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+R++++  ++P+V+FS ++CCMSHTI+SL  D GVNP +YELD I  GREIEQALSRLG
Sbjct  1    MERLNKLVTKKPLVIFSMTTCCMSHTIKSLFYDFGVNPTIYELDEIANGREIEQALSRLG  60

Query  153  CNPT-VPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPT +PAVFIGGE VGG NEIM+LHL+++LKP LK AGALWV
Sbjct  61   CNPTMMPAVFIGGEFVGGANEIMSLHLKRSLKPMLKNAGALWV  103



>emb|CDY68328.1| BnaAnng26900D [Brassica napus]
Length=102

 Score =   156 bits (394),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +++M  ERPVV++SKS CCMSHT+++LL D G NPAV+ELD +PRGREIEQAL RLG
Sbjct  1    MEMITKMVLERPVVIYSKSLCCMSHTVKTLLCDFGANPAVHELDEVPRGREIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPA+FIGGELVGG NE+M+LHL  +L P LK+AGALWV
Sbjct  61   CSPAVPAIFIGGELVGGANEVMSLHLNGSLIPMLKQAGALWV  102



>ref|XP_003593970.1| Monothiol glutaredoxin-S2 [Medicago truncatula]
 gb|AES64221.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=102

 Score =   155 bits (392),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+++A+ER VV+FSKSSCCM HTI++L +D GVNP V+ELD +  GR+IEQAL RLG
Sbjct  1    MERVTQLASERSVVIFSKSSCCMCHTIKTLFSDFGVNPEVHELDEMSGGRDIEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGGELVGG NE+M+LHL ++L P L+RAGA+WV
Sbjct  61   CNPSVPAVFIGGELVGGANEVMSLHLNRSLIPMLRRAGAIWV  102



>ref|XP_010440264.1| PREDICTED: monothiol glutaredoxin-S4-like [Camelina sativa]
Length=102

 Score =   154 bits (390),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MDKLQKMISEKSVVIFSKNSCCMSHTIKTLFIDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VP VFIGG+LVGG N++MTLHL ++L P LKRAGALW+
Sbjct  61   CSPAVPVVFIGGQLVGGANQVMTLHLNRSLVPMLKRAGALWL  102



>ref|XP_009146815.1| PREDICTED: monothiol glutaredoxin-S4 [Brassica rapa]
 emb|CDY66333.1| BnaA01g35500D [Brassica napus]
Length=102

 Score =   154 bits (390),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL+ LG
Sbjct  1    MDKLQKMISEKSVVIFSKNSCCMSHTIKTLFIDFGVNPTIYELDEINRGKEIEQALAHLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>gb|KFK43355.1| hypothetical protein AALP_AA1G115300 [Arabis alpina]
Length=102

 Score =   154 bits (390),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ RM +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQRMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEITRGKEIEQALTQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPMVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_006284821.1| hypothetical protein CARUB_v10006100mg [Capsella rubella]
 gb|EOA17719.1| hypothetical protein CARUB_v10006100mg [Capsella rubella]
Length=102

 Score =   154 bits (390),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD++ +M +E+ VV+FSK+SCCMSHT+++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MDKLQKMISEKSVVIFSKNSCCMSHTVKTLFIDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_006284820.1| hypothetical protein CARUB_v10006099mg [Capsella rubella]
 gb|EOA17718.1| hypothetical protein CARUB_v10006099mg [Capsella rubella]
Length=102

 Score =   154 bits (390),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L  D+GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDLGVNPTIYELDEITRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPAVFIGGQLVGGANQVMSLHLNRSLLPMLKRVGALWL  102



>gb|KDP40011.1| hypothetical protein JCGZ_02009 [Jatropha curcas]
Length=101

 Score =   154 bits (389),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 90/102 (88%), Gaps = 1/102 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+++AA+RPVV+FS+S+CCM H I++LL+D GVNPAV+ELD I RGREIEQALSRLG
Sbjct  1    MERVTQLAAQRPVVIFSRSTCCMCHAIKTLLSDFGVNPAVHELDEIARGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
             +PT+PAVFIGGELVGG NE+M LHL ++L P L RAGALWV
Sbjct  61   -SPTLPAVFIGGELVGGANEVMALHLNRSLIPMLIRAGALWV  101



>ref|XP_009136708.1| PREDICTED: monothiol glutaredoxin-S4-like [Brassica rapa]
 emb|CDY09747.1| BnaC07g33140D [Brassica napus]
 emb|CDX90576.1| BnaA03g42050D [Brassica napus]
Length=102

 Score =   154 bits (389),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+PVV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQKMVSEKPVVIFSKNSCCMSHTIKTLFVDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIG +LVGG N++M+LHL ++L P LKR GALWV
Sbjct  61   CSPTVPVVFIGAQLVGGANQVMSLHLNRSLVPMLKRVGALWV  102



>ref|XP_010024635.1| PREDICTED: monothiol glutaredoxin-S2-like [Eucalyptus grandis]
Length=102

 Score =   154 bits (388),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+R++RM  ERPVV+FS+SSCCM HTI+ L  + GVNP V+ELD IPRGREIEQALSRLG
Sbjct  1    MERINRMVLERPVVIFSRSSCCMCHTIKMLFREFGVNPVVHELDEIPRGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
             +P VPAVFIGGELVGG NE+M+LHL ++L P+L +AGA+WV
Sbjct  61   RSPAVPAVFIGGELVGGTNEVMSLHLNRSLIPRLIQAGAMWV  102



>ref|XP_002870217.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46476.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   154 bits (388),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++  M  E+PVV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQTMVYEKPVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GALWV
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRVGALWV  102



>ref|XP_004296809.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   154 bits (388),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V+++A+ERPVV+FSKSSCCMS+TI++L  D GVNPAV+ELD + RG+EIEQAL RL 
Sbjct  1    MEVVTKLASERPVVIFSKSSCCMSYTIKTLFCDFGVNPAVHELDEMQRGKEIEQALLRLR  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFIGGE VGG NE+M+LHL+++L P LKR GALWV
Sbjct  61   CSPSVPAVFIGGEFVGGANEVMSLHLKRSLIPMLKRVGALWV  102



>ref|XP_010434931.1| PREDICTED: monothiol glutaredoxin-S3 [Camelina sativa]
Length=102

 Score =   154 bits (388),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M  + +M +E+ VV+FSK+SCCMSHTI++L  DMGVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MSNLQKMISEKSVVIFSKNSCCMSHTIKTLFLDMGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|NP_193303.1| monothiol glutaredoxin-S4 [Arabidopsis thaliana]
 ref|XP_002870220.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 sp|O23419.1|GRXS4_ARATH RecName: Full=Monothiol glutaredoxin-S4; Short=AtGrxS4; AltName: 
Full=Protein ROXY 13 [Arabidopsis thaliana]
 emb|CAB10346.1| glutaredoxin [Arabidopsis thaliana]
 emb|CAB78610.1| glutaredoxin [Arabidopsis thaliana]
 gb|AAM64702.1| glutaredoxin [Arabidopsis thaliana]
 gb|ABD57490.1| At4g15680 [Arabidopsis thaliana]
 gb|ACO50418.1| glutaredoxin [Arabidopsis thaliana]
 gb|EFH46479.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEE83635.1| monothiol glutaredoxin-S4 [Arabidopsis thaliana]
Length=102

 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MDKLQKMISEKSVVIFSKNSCCMSHTIKTLFIDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRVGALWL  102



>ref|XP_006414472.1| hypothetical protein EUTSA_v10027374mg [Eutrema salsugineum]
 gb|ESQ55925.1| hypothetical protein EUTSA_v10027374mg [Eutrema salsugineum]
Length=102

 Score =   153 bits (387),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MDKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLLPMLKRVGALWL  102



>gb|KCW61086.1| hypothetical protein EUGRSUZ_H03860 [Eucalyptus grandis]
Length=162

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+R++RM  ERPVV+FS+SSCCM HTI+ L  + GVNP V+ELD IPRGREIEQALSRLG
Sbjct  61   MERINRMVLERPVVIFSRSSCCMCHTIKMLFREFGVNPVVHELDEIPRGREIEQALSRLG  120

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
             +P VPAVFIGGELVGG NE+M+LHL ++L P+L +AGA+WV
Sbjct  121  RSPAVPAVFIGGELVGGTNEVMSLHLNRSLIPRLIQAGAMWV  162



>gb|ACJ83991.1| unknown [Medicago truncatula]
 gb|AFK46546.1| unknown [Medicago truncatula]
Length=102

 Score =   153 bits (387),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+++A+ER VV+FSKSSCCM HTI++L +D GVNP V+ELD +  GR+ EQAL RLG
Sbjct  1    MERVTQLASERSVVIFSKSSCCMCHTIKTLFSDFGVNPEVHELDEMSGGRDTEQALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGGELVGG NE+M+LHL ++L P L+RAGA+WV
Sbjct  61   CNPSVPAVFIGGELVGGANEVMSLHLNRSLIPMLRRAGAIWV  102



>ref|XP_002870221.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46480.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   153 bits (387),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L  D+GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDIGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLKRAGALWL  102



>gb|KFK24504.1| hypothetical protein AALP_AAs55560U000400 [Arabis alpina]
Length=96

 Score =   153 bits (386),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -1

Query  315  MAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLGCNPTVP  136
            M +E+PVV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LGC+PTVP
Sbjct  1    MVSEKPVVIFSKNSCCMSHTIKTLFVDFGVNPTIYELDEISRGKEIEQALAQLGCSPTVP  60

Query  135  AVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
             VFIGG+LVGG N++M+LHL Q+L P LKR GALWV
Sbjct  61   VVFIGGQLVGGANQVMSLHLNQSLVPMLKRVGALWV  96



>gb|KHN33129.1| Monothiol glutaredoxin-S4 [Glycine soja]
Length=96

 Score =   153 bits (386),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -1

Query  315  MAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLGCNPTVP  136
            MA+ERPVV+FS+SSCCM HTI++L +D GV+  V+ELD IPRG++IEQALSRLGC+P+VP
Sbjct  1    MASERPVVIFSRSSCCMCHTIKTLFSDFGVHANVHELDEIPRGKDIEQALSRLGCSPSVP  60

Query  135  AVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            AVFIGGELVGG NE+M+LHL ++L P L+RAGALWV
Sbjct  61   AVFIGGELVGGANEVMSLHLNRSLIPMLRRAGALWV  96



>ref|XP_010434934.1| PREDICTED: monothiol glutaredoxin-S4 [Camelina sativa]
 ref|XP_010449911.1| PREDICTED: monothiol glutaredoxin-S4 [Camelina sativa]
Length=102

 Score =   153 bits (386),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MDKLQKMISEKSVVIFSKNSCCMSHTIKTLFIDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPAVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_006284819.1| hypothetical protein CARUB_v10006098mg [Capsella rubella]
 gb|EOA17717.1| hypothetical protein CARUB_v10006098mg [Capsella rubella]
Length=102

 Score =   153 bits (386),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD++ +M +E+ VV+FSK+SCCMSHTI++L  D+GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MDKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDLGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GA+W+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLKRVGAIWL  102



>ref|XP_010440263.1| PREDICTED: monothiol glutaredoxin-S3-like [Camelina sativa]
Length=102

 Score =   153 bits (386),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M  + +M +E+ VV+FSK+SCCMSHTI++L  DMGVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MANLQKMISEKSVVIFSKNSCCMSHTIKTLFLDMGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_002870219.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46478.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   153 bits (386),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ + +M  E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RGREIEQAL++LG
Sbjct  1    MENLQKMITEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEINRGREIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_010548927.1| PREDICTED: monothiol glutaredoxin-S5-like [Tarenaya hassleriana]
Length=102

 Score =   152 bits (385),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V++  +E+PVV+FSKSSCCMSHTI++L +D GVN  V+ELD + RGRE+EQAL+ LG
Sbjct  1    MEAVTKFVSEKPVVIFSKSSCCMSHTIKTLFHDFGVNATVHELDEMARGREVEQALAILG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVFIGG+LVGG N++M+LHL ++L P LK AGALWV
Sbjct  61   CSPTVPAVFIGGQLVGGANQVMSLHLSRSLIPMLKNAGALWV  102



>ref|XP_009146804.1| PREDICTED: monothiol glutaredoxin-S4-like [Brassica rapa]
 ref|XP_009134975.1| PREDICTED: monothiol glutaredoxin-S4-like [Brassica rapa]
 ref|XP_009134977.1| PREDICTED: monothiol glutaredoxin-S4-like [Brassica rapa]
 ref|XP_009134978.1| PREDICTED: monothiol glutaredoxin-S4-like [Brassica rapa]
 emb|CDY66332.1| BnaA01g35490D [Brassica napus]
Length=102

 Score =   152 bits (385),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+PVV+FSK+SCCMSH+I++L  D GVNPA+YELD I RG+EIE AL++LG
Sbjct  1    MEKLQKMVSEKPVVIFSKNSCCMSHSIKTLFIDFGVNPAIYELDEITRGKEIEHALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LK  GALWV
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLKSVGALWV  102



>gb|AAS47604.1| At4g15670 [Arabidopsis thaliana]
 gb|AAS76724.1| At4g15670 [Arabidopsis thaliana]
Length=125

 Score =   153 bits (386),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -1

Query  336  EMDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRL  157
            +M+++ +M +E+ +V+FSK+SCCMSHTI++L  D+GVNP +YELD I RG+EIEQAL++L
Sbjct  23   KMEKLQKMTSEKSLVIFSKNSCCMSHTIKTLFLDLGVNPTIYELDEINRGKEIEQALAQL  82

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GC+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  83   GCSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLKRVGALWL  125



>ref|XP_006284824.1| hypothetical protein CARUB_v10006103mg [Capsella rubella]
 ref|XP_010440261.1| PREDICTED: monothiol glutaredoxin-S5 [Camelina sativa]
 ref|XP_010440262.1| PREDICTED: monothiol glutaredoxin-S5 [Camelina sativa]
 gb|EOA17722.1| hypothetical protein CARUB_v10006103mg [Capsella rubella]
Length=102

 Score =   152 bits (384),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ + +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+E+EQAL++LG
Sbjct  1    MENLQKMISEKSVVIFSKNSCCMSHTIKTLFFDFGVNPTIYELDEINRGKEVEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLLPMLKRAGALWL  102



>ref|XP_010449909.1| PREDICTED: monothiol glutaredoxin-S3-like [Camelina sativa]
Length=102

 Score =   152 bits (384),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M  + +M +E+ VV+F+K+SCCMSHTI++L  DMGVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MASLQKMISEKSVVIFTKNSCCMSHTIKTLFLDMGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>gb|KFK22959.1| hypothetical protein AALP_AAs50914U000200 [Arabis alpina]
Length=102

 Score =   152 bits (383),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M++V +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG++IEQAL++LG
Sbjct  1    MEKVQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEITRGKDIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+L+GG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLIGGANQVMSLHLNRSLIPMLKRVGALWL  102



>ref|XP_006414476.1| hypothetical protein EUTSA_v10026878mg [Eutrema salsugineum]
 gb|ESQ55929.1| hypothetical protein EUTSA_v10026878mg [Eutrema salsugineum]
Length=102

 Score =   151 bits (382),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRVGALWL  102



>ref|NP_193302.1| monothiol glutaredoxin-S7 [Arabidopsis thaliana]
 sp|Q6NLU2.2|GRXS7_ARATH RecName: Full=Monothiol glutaredoxin-S7; Short=AtGrxS7; AltName: 
Full=Protein ROXY 14 [Arabidopsis thaliana]
 emb|CAB10345.1| glutaredoxin [Arabidopsis thaliana]
 emb|CAB78609.1| glutaredoxin [Arabidopsis thaliana]
 gb|ACO50419.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE83634.1| monothiol glutaredoxin-S7 [Arabidopsis thaliana]
Length=102

 Score =   151 bits (382),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ +V+FSK+SCCMSHTI++L  D+GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQKMTSEKSLVIFSKNSCCMSHTIKTLFLDLGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLKRVGALWL  102



>ref|XP_010524509.1| PREDICTED: monothiol glutaredoxin-S4 [Tarenaya hassleriana]
Length=102

 Score =   151 bits (382),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+PVV+FSK+SCCMSHTI++L  D GVNP VYELD I  GRE+E+AL++LG
Sbjct  1    MEKLQKMVSEKPVVIFSKNSCCMSHTIKTLFYDFGVNPTVYELDEIDNGREMERALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVF+GG+LVGG N++M+LHL ++L P LK  GALWV
Sbjct  61   CSPTVPAVFVGGQLVGGANQVMSLHLNRSLIPMLKSVGALWV  102



>ref|XP_010449908.1| PREDICTED: monothiol glutaredoxin-S3-like [Camelina sativa]
Length=102

 Score =   151 bits (382),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M  + +M +E+ VV+FSK+SCCMSHTI++L  DMGVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MANLQKMISEKSVVIFSKNSCCMSHTIKTLFLDMGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CIPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_009146825.1| PREDICTED: monothiol glutaredoxin-S4-like [Brassica rapa]
Length=102

 Score =   151 bits (382),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG EIEQAL++LG
Sbjct  1    MDKLQKMISEKSVVIFSKNSCCMSHTIKTLFIDFGVNPTIYELDEISRGHEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VP V+IGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPAVPVVYIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_006284827.1| hypothetical protein CARUB_v10006107mg [Capsella rubella]
 gb|EOA17725.1| hypothetical protein CARUB_v10006107mg [Capsella rubella]
Length=102

 Score =   151 bits (382),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M  + +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MANLQKMISEKSVVIFSKNSCCMSHTIKTLFFDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLLPMLKRAGALWL  102



>emb|CDY54294.1| BnaC01g41930D [Brassica napus]
Length=102

 Score =   151 bits (382),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG EIEQAL+++G
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEINRGNEIEQALAQIG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPAVFIGGQLVGGANQVMSLHLNRSLLPMLKRVGALWL  102



>ref|XP_010434932.1| PREDICTED: monothiol glutaredoxin-S3-like [Camelina sativa]
Length=102

 Score =   151 bits (382),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M  + +M +E+ VV+FSK+SCCMSHTI++L  DMGVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MASLQKMISEKSVVIFSKNSCCMSHTIKTLFLDMGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVP VFIGG+LVGG N++M+LHL  +L P LKRAGALW+
Sbjct  61   CTPTVPVVFIGGQLVGGANQVMSLHLNCSLVPMLKRAGALWL  102



>ref|NP_193305.1| monothiol glutaredoxin-S3 [Arabidopsis thaliana]
 sp|O23421.1|GRXS3_ARATH RecName: Full=Monothiol glutaredoxin-S3; Short=AtGrxS3; AltName: 
Full=Protein ROXY 11 [Arabidopsis thaliana]
 emb|CAB10348.1| glutaredoxin homolog [Arabidopsis thaliana]
 emb|CAB78612.1| glutaredoxin homolog [Arabidopsis thaliana]
 gb|AAR24171.1| At4g15700 [Arabidopsis thaliana]
 gb|AAR92328.1| At4g15700 [Arabidopsis thaliana]
 gb|ACO50416.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE83637.1| monothiol glutaredoxin-S3 [Arabidopsis thaliana]
Length=102

 Score =   151 bits (381),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ + +M +E+ VV+FSK+SCCMSHTI++L  D+GVNP +YELD I RG+EIE AL++LG
Sbjct  1    MENLQKMISEKSVVIFSKNSCCMSHTIKTLFLDLGVNPTIYELDEISRGKEIEHALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_006284817.1| hypothetical protein CARUB_v10006105mg [Capsella rubella]
 gb|EOA17715.1| hypothetical protein CARUB_v10006105mg [Capsella rubella]
Length=102

 Score =   151 bits (381),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M  + +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MANLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>gb|KFK43354.1| hypothetical protein AALP_AA1G115200 [Arabis alpina]
Length=102

 Score =   151 bits (381),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++ G
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEITRGKEIEQALAQFG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLKRVGALWL  102



>ref|XP_002516883.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF45497.1| glutaredoxin, grx, putative [Ricinus communis]
Length=101

 Score =   151 bits (381),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV ++AAERPVV+FS+S+CCM H I++LL D GVNPAV+ELD + RGREIEQALSRLG
Sbjct  1    MERVIQLAAERPVVIFSRSTCCMCHAIKTLLCDFGVNPAVHELDEMARGREIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
             +PT+PAVFIG ELVGG NE+M+LHL ++L P L+RAGALWV
Sbjct  61   -SPTLPAVFIGSELVGGANEVMSLHLNRSLIPMLRRAGALWV  101



>ref|XP_011013421.1| PREDICTED: monothiol glutaredoxin-S2-like [Populus euphratica]
Length=99

 Score =   151 bits (381),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+ +A+ERPVV+FSKS+CCM HTI++L N+ GVN AV+ELD +PRGREIEQALSR G
Sbjct  1    MERVTNLASERPVVIFSKSTCCMCHTIKTLFNEFGVNVAVHELDEMPRGREIEQALSRFG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGAL  34
            C PT+PAVFIGGELVGG  E+M+LHL ++L P LKRAGAL
Sbjct  61   C-PTLPAVFIGGELVGGAKEVMSLHLNRSLIPMLKRAGAL  99



>ref|XP_010449912.1| PREDICTED: monothiol glutaredoxin-S7-like [Camelina sativa]
Length=102

 Score =   150 bits (379),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L  D+GVNP +YELD I RGREIEQAL++LG
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDLGVNPTIYELDEINRGREIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LK  GALWV
Sbjct  61   CSPTVPVVFIGGKLVGGANQVMSLHLNRSLIPMLKCVGALWV  102



>ref|XP_010449907.1| PREDICTED: monothiol glutaredoxin-S5-like [Camelina sativa]
Length=102

 Score =   150 bits (379),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ + +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+E+E+AL++LG
Sbjct  1    MENLQKMISEKSVVIFSKNSCCMSHTIKTLFFDFGVNPTIYELDEINRGKEVEKALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLLPMLKRAGALWL  102



>ref|XP_006286199.1| hypothetical protein CARUB_v10007765mg [Capsella rubella]
 gb|EOA19097.1| hypothetical protein CARUB_v10007765mg [Capsella rubella]
Length=102

 Score =   150 bits (379),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ + +M +E+ VV+FSK+SCCMSHT+++L  D GVNP +YELD + RG+EIEQAL++LG
Sbjct  1    MENLQKMISEKSVVIFSKNSCCMSHTVKTLFLDFGVNPTIYELDEMNRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|NP_193304.1| monothiol glutaredoxin-S5 [Arabidopsis thaliana]
 sp|O23420.1|GRXS5_ARATH RecName: Full=Monothiol glutaredoxin-S5; Short=AtGrxS5; AltName: 
Full=Protein ROXY 12 [Arabidopsis thaliana]
 emb|CAB10347.1| glutaredoxin [Arabidopsis thaliana]
 emb|CAB78611.1| glutaredoxin [Arabidopsis thaliana]
 gb|AAR24178.1| At4g15690 [Arabidopsis thaliana]
 gb|AAR92329.1| At4g15690 [Arabidopsis thaliana]
 gb|ACO50417.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE83636.1| monothiol glutaredoxin-S5 [Arabidopsis thaliana]
Length=102

 Score =   150 bits (379),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ + +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I  GREIEQAL++LG
Sbjct  1    MENLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEINIGREIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_011005540.1| PREDICTED: monothiol glutaredoxin-S2-like [Populus euphratica]
Length=101

 Score =   150 bits (379),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+++A+ERPVV+FSK++CCM HTI++L  D GVNPAV+ELD +P GREIEQAL R G
Sbjct  1    MERVTKLASERPVVIFSKTTCCMCHTIKTLFCDFGVNPAVHELDEMPGGREIEQALRRAG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PT+PAVFIGGE VGG NE+M+LHL ++L P LK AGALWV
Sbjct  61   C-PTLPAVFIGGENVGGSNEVMSLHLSRSLIPMLKNAGALWV  101



>ref|XP_010434933.1| PREDICTED: monothiol glutaredoxin-S5-like [Camelina sativa]
 ref|XP_010449910.1| PREDICTED: monothiol glutaredoxin-S5-like [Camelina sativa]
Length=102

 Score =   150 bits (379),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ + +M +E+ VV+FSK+SCCMSHT+++L  D GVNP +YELD + RG+EIEQAL++LG
Sbjct  1    MENLQKMISEKSVVIFSKNSCCMSHTVKTLFLDFGVNPTIYELDEMHRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_006284826.1| hypothetical protein CARUB_v10006106mg [Capsella rubella]
 gb|EOA17724.1| hypothetical protein CARUB_v10006106mg [Capsella rubella]
Length=102

 Score =   150 bits (379),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M  + +M +++ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MANLQKMISDKSVVIFSKNSCCMSHTIKTLFFDFGVNPTIYELDEINRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLLPMLKRAGALWL  102



>gb|KFK24502.1| hypothetical protein AALP_AAs55560U000200 [Arabis alpina]
Length=102

 Score =   150 bits (378),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ ++ +++ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQKLISDKSVVIFSKNSCCMSHTIKTLFIDFGVNPTIYELDEITRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRVGALWL  102



>ref|XP_002870222.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46481.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   149 bits (377),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L  D+GVNP +YELD I RG+E+E AL++LG
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDLGVNPTIYELDEINRGKEVEHALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLKRVGALWL  102



>emb|CDY54296.1| BnaC01g41950D [Brassica napus]
Length=102

 Score =   149 bits (376),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+PVV+FSK+SCCMSH+I++L  + GVNP +YELD I RG+EIE AL++LG
Sbjct  1    MEKLQKMVSEKPVVIFSKNSCCMSHSIKTLFVNFGVNPTIYELDEITRGKEIEHALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LK  GALWV
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLKSVGALWV  102



>gb|KFK24503.1| hypothetical protein AALP_AAs55560U000300 [Arabis alpina]
Length=100

 Score =   149 bits (375),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M AE+ VV+FSK+SCCMSHTI+SL  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQKMIAEKSVVIFSKNSCCMSHTIKSLFLDFGVNPTIYELDEITRGKEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGAL  34
            C+PTVP VFIGG+L+GG N++M+LHL ++L P LKR GAL
Sbjct  61   CSPTVPVVFIGGQLIGGANQVMSLHLNRSLVPMLKRFGAL  100



>ref|XP_002870218.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46477.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   149 bits (375),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ + +M +E+ VV+FSK+SCCMSHTI++L  D G+NP +YELD I RG+EIE AL++LG
Sbjct  1    MENLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGMNPTIYELDEINRGKEIEHALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRAGALWL  102



>ref|XP_010434935.1| PREDICTED: monothiol glutaredoxin-S7-like [Camelina sativa]
Length=102

 Score =   149 bits (375),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHT+++L  D+GVNP +YELD I +GREIEQAL++LG
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTVKTLFLDLGVNPTIYELDEINKGREIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LK  GALWV
Sbjct  61   CSPTVPVVFIGGKLVGGANQVMSLHLNRSLIPMLKCVGALWV  102



>gb|KFK24501.1| hypothetical protein AALP_AAs55560U000100 [Arabis alpina]
Length=96

 Score =   148 bits (373),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -1

Query  315  MAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLGCNPTVP  136
            M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LGC+PTVP
Sbjct  1    MISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEITRGKEIEQALAQLGCSPTVP  60

Query  135  AVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
             VFIGG+LVGG N++M+LHL ++L P LKRAGALW+
Sbjct  61   VVFIGGQLVGGANQVMSLHLNRSLIPMLKRAGALWL  96



>ref|NP_193301.1| monothiol glutaredoxin-S8 [Arabidopsis thaliana]
 sp|O23417.1|GRXS8_ARATH RecName: Full=Monothiol glutaredoxin-S8; Short=AtGrxS8; AltName: 
Full=Protein ROXY 15 [Arabidopsis thaliana]
 emb|CAB10344.1| glutaredoxin [Arabidopsis thaliana]
 emb|CAB78608.1| glutaredoxin [Arabidopsis thaliana]
 gb|AAS99660.1| At4g15660 [Arabidopsis thaliana]
 gb|AAT71969.1| At4g15660 [Arabidopsis thaliana]
 gb|ACO50420.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE83633.1| monothiol glutaredoxin-S8 [Arabidopsis thaliana]
Length=102

 Score =   148 bits (373),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FS +SCCMSHTI++L  D+GVNP +YELD I RG+EIE AL++LG
Sbjct  1    MEKIQKMISEKSVVIFSNNSCCMSHTIKTLFLDLGVNPTIYELDEINRGKEIEYALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLKRFGALWL  102



>ref|XP_006414471.1| hypothetical protein EUTSA_v10026652mg [Eutrema salsugineum]
 dbj|BAJ34088.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55924.1| hypothetical protein EUTSA_v10026652mg [Eutrema salsugineum]
Length=102

 Score =   147 bits (372),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ ++ +E+ VV+FSK+SCCMSHT+++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQKLISEKSVVIFSKNSCCMSHTVKTLFVDFGVNPTIYELDEINRGQEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG +++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGASQVMSLHLNRSLVPMLKRVGALWL  102



>ref|XP_009146837.1| PREDICTED: monothiol glutaredoxin-S4-like [Brassica rapa]
 emb|CDY69190.1| BnaA01g35510D [Brassica napus]
Length=104

 Score =   147 bits (371),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L+ D GVNP +YELD I RG EIEQAL++LG
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLILDFGVNPTIYELDEINRGNEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGAL  34
            C+PTVPAVFIGG+LVGG N++M+LHL ++L P LKR GAL
Sbjct  61   CSPTVPAVFIGGQLVGGANQVMSLHLNRSLLPMLKRVGAL  100



>ref|XP_010243566.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=102

 Score =   147 bits (371),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV ++A++R VV+FSKSSCC+ HTI++L +D GV+P VYELD  PRGRE+E+AL RLG
Sbjct  1    MERVMKLASQRAVVIFSKSSCCICHTIKTLFSDFGVSPTVYELDEDPRGRELEKALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+LVGG  E+MT  L  +LK  LKRAGALW+
Sbjct  61   CNPSVPAVFIGGKLVGGAKEVMTRQLDGSLKELLKRAGALWL  102



>ref|XP_010449913.1| PREDICTED: monothiol glutaredoxin-S7-like [Camelina sativa]
Length=102

 Score =   147 bits (370),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK++CCMSHTI++L  D+GVNP +YELD I R ++IEQAL++LG
Sbjct  1    MEKLQKMISEKTVVIFSKNTCCMSHTIKTLFLDLGVNPTIYELDEINRAKDIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P L+R GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLQRVGALWL  102



>ref|XP_010434937.1| PREDICTED: monothiol glutaredoxin-S7 [Camelina sativa]
 ref|XP_010445385.1| PREDICTED: monothiol glutaredoxin-S7 [Camelina sativa]
Length=102

 Score =   147 bits (370),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK++CCMSHTI++L  D+GVNP +YELD I R ++IEQAL++LG
Sbjct  1    MEKLQKMISEKSVVIFSKNTCCMSHTIKTLFLDLGVNPTIYELDEINRAKDIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N++M+LHL ++L P L+R GALW+
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLIPMLQRVGALWL  102



>ref|XP_010445383.1| PREDICTED: monothiol glutaredoxin-S7-like [Camelina sativa]
Length=102

 Score =   145 bits (366),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHT+++L  D+GVNP +YELD I +GREIEQAL++LG
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTVKTLFLDLGVNPTIYELDEINKGREIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP V IGG+LVGG N++M+LHL ++L P LK  GALWV
Sbjct  61   CSPTVPVVCIGGKLVGGANQVMSLHLNRSLIPMLKCVGALWV  102



>ref|XP_009802831.1| PREDICTED: monothiol glutaredoxin-S2-like [Nicotiana sylvestris]
Length=93

 Score =   144 bits (364),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 3/96 (3%)
 Frame = -1

Query  315  MAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLGCNPTVP  136
            M  E+PVV+FS S CCMSH+I+SL +D+GVN A+YELD + RG EIE  LS LGCNPT  
Sbjct  1    MVTEKPVVIFSNSCCCMSHSIKSLFSDLGVNTAIYELDEMQRGHEIEAVLSNLGCNPT--  58

Query  135  AVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
             VFIGGE+VGGENE+M+LHLQ +LKPKLK AGALWV
Sbjct  59   -VFIGGEMVGGENEVMSLHLQGSLKPKLKSAGALWV  93



>ref|XP_010243565.1| PREDICTED: monothiol glutaredoxin-S2 [Nelumbo nucifera]
Length=102

 Score =   144 bits (362),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV+ +A++ PVV+FSKSSCCM HTI++L++D G +P VYELD+ PRGREIE+AL RLG
Sbjct  1    MERVTSLASQSPVVIFSKSSCCMCHTIKTLISDYGASPTVYELDLDPRGREIERALVRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIGG LVGG NE+MT  L ++LK  L RAGA+++
Sbjct  61   CKPSVPAVFIGGRLVGGANEVMTRQLDRSLKELLIRAGAIFL  102



>emb|CDY22746.1| BnaA08g05760D [Brassica napus]
Length=102

 Score =   142 bits (359),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP + ELD I RG+EIEQAL++L 
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTICELDEINRGKEIEQALAQLD  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LV G N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGGQLVSGANQVMSLHLNRSLVPMLKRVGALWL  102



>gb|KCW61087.1| hypothetical protein EUGRSUZ_H03861 [Eucalyptus grandis]
Length=117

 Score =   143 bits (360),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDR++RM  ERPVV+FS+SSCCM HT++ L  + GVNP V+ELD IPRG+EIEQALSRLG
Sbjct  1    MDRINRMVLERPVVIFSRSSCCMCHTVKMLFREFGVNPVVHELDEIPRGQEIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGAL  34
             +PTVPAVFIGGELVGG NE+ +LHL ++L   +KR GA+
Sbjct  61   RSPTVPAVFIGGELVGGINEVTSLHLNRSLTTCVKRIGAV  100



>ref|XP_010241681.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=103

 Score =   142 bits (359),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSR-L  157
            M++V ++ +++PVV+FSKSSCCM HTI++L  D+GVNPAVYELD  P+G+EIE+AL R L
Sbjct  1    MEKVMKLVSQKPVVIFSKSSCCMCHTIKTLFCDLGVNPAVYELDEDPQGKEIEKALLRLL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GCNP VPAVF+GG LVGG NE+MT  L  +LK +LK AGA+W+
Sbjct  61   GCNPAVPAVFVGGNLVGGANEVMTRQLNGSLKTQLKCAGAIWL  103



>ref|XP_008390723.1| PREDICTED: monothiol glutaredoxin-S10 [Malus domestica]
 ref|XP_009352226.1| PREDICTED: monothiol glutaredoxin-S10-like [Pyrus x bretschneideri]
Length=102

 Score =   141 bits (356),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKSSCCMSH I+ L  + GV+PA+YELD   RG+E+E AL RLG
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIYELDEESRGKEMEWALIRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIGG+LVG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CQPSVPAVFIGGKLVGSANTVMTLHLNGSLKKLLKDAGALWL  102



>ref|XP_010036905.1| PREDICTED: monothiol glutaredoxin-S10-like [Eucalyptus grandis]
 gb|KCW84426.1| hypothetical protein EUGRSUZ_B01274 [Eucalyptus grandis]
Length=102

 Score =   141 bits (355),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD+V+R+A+++ VV+FSKSSCCM H I+ L  D GV+PA++ELD  PRGRE+E+AL RLG
Sbjct  1    MDKVARLASQKAVVIFSKSSCCMCHAIKRLFYDQGVSPAIHELDEDPRGREMERALIRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP VPAVFIGG+ VG  N +MTL L  +LK  LK AGALW+
Sbjct  61   CNPAVPAVFIGGKFVGSANAVMTLQLNGSLKKMLKDAGALWL  102



>ref|XP_010440259.1| PREDICTED: monothiol glutaredoxin-S4-like [Camelina sativa]
Length=105

 Score =   140 bits (354),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ ++ +E+P+V+FSK+SCCMSHTI++L  D GVNP +YELD I + ++IEQ L++LG
Sbjct  1    MEKIQKLVSEKPLVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEIKKEKDIEQVLAQLG  60

Query  153  CNPTVPAVFIGGELVGGEN---EIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIGG+LVGG N   ++M+LHL ++L P LK  GALWV
Sbjct  61   CSPTVPVVFIGGQLVGGANQDYQVMSLHLNRSLVPMLKHVGALWV  105



>ref|XP_002516882.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF45496.1| glutaredoxin, grx, putative [Ricinus communis]
Length=102

 Score =   140 bits (354),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKSSCCM H I+ L  + GV+PA+YELD   RG E+E AL RLG
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPAIYELDEDSRGTEMEWALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N IMTLHL  +LK  LK AGALW+
Sbjct  61   CNPSVPAVFIGGKFVGSANTIMTLHLNGSLKKLLKEAGALWL  102



>ref|XP_007226534.1| hypothetical protein PRUPE_ppa025150mg [Prunus persica]
 ref|XP_008223117.1| PREDICTED: monothiol glutaredoxin-S10 [Prunus mume]
 gb|EMJ27733.1| hypothetical protein PRUPE_ppa025150mg [Prunus persica]
Length=102

 Score =   140 bits (354),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKSSCCMSH I+ L  + GV+PA+YELD   RG+E+E AL RLG
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIYELDEESRGKEMEWALVRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIGG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CQPSVPAVFIGGKFVGSANAVMTLHLNGSLKKLLKDAGALWL  102



>ref|XP_006380203.1| hypothetical protein POPTR_0008s22890g [Populus trichocarpa]
 gb|ERP58000.1| hypothetical protein POPTR_0008s22890g [Populus trichocarpa]
Length=102

 Score =   140 bits (353),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKSSCCM H I+ L  D GV+PA+YELD   RG+E+E AL RLG
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMCHAIKRLFYDQGVSPAIYELDEDSRGKEMEWALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N +MTL L  +LK  LK AGALW+
Sbjct  61   CNPSVPAVFIGGKFVGSANTVMTLQLNGSLKKLLKEAGALWL  102



>ref|XP_004296803.1| PREDICTED: monothiol glutaredoxin-S10-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score =   140 bits (353),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKSSCCMSH I+ L  + GV+PA+YELD   RG+E+E AL RLG
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIYELDEESRGKEMEWALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIGG+ VG  N +MTLHL   LK  LK AGALW+
Sbjct  61   CQPSVPAVFIGGKFVGSANTVMTLHLNGTLKKLLKDAGALWL  102



>ref|XP_010024634.1| PREDICTED: monothiol glutaredoxin-S10-like [Eucalyptus grandis]
Length=102

 Score =   140 bits (352),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKS+CCM H ++SL  ++GV+PA+YELD   RG+E+E+AL+RLG
Sbjct  1    MDRVAKLASQKAVVIFSKSTCCMCHAVKSLFYELGVSPAIYELDEDSRGKEMERALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGG+ VG  N +MT HL  +LK  LK AGALW+
Sbjct  61   CSPAVPAVFIGGKFVGSANTVMTYHLSGSLKRMLKDAGALWL  102



>ref|XP_009107851.1| PREDICTED: monothiol glutaredoxin-S4-like [Brassica rapa]
Length=102

 Score =   140 bits (352),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP + ELD I RG+EIEQAL++L 
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTICELDEINRGKEIEQALAQLD  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFI G+LV G N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIVGQLVSGANQVMSLHLNRSLVPMLKRVGALWL  102



>ref|XP_009107850.1| PREDICTED: monothiol glutaredoxin-S4-like [Brassica rapa]
 emb|CDY22745.1| BnaA08g05750D [Brassica napus]
 emb|CDY09078.1| BnaC08g10320D [Brassica napus]
Length=101

 Score =   139 bits (351),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M + + VV+FS +SCCMSHTI++L  D GVNP +YELD I RG+EIE+ L++LG
Sbjct  1    MEKLQKMISGKSVVIFSNNSCCMSHTIKTLFLDFGVNPTIYELDEISRGKEIEKVLAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGAL  34
            C+PTVP VFIGG+LVGG N++M+LHL ++L P LKR GAL
Sbjct  61   CSPTVPVVFIGGQLVGGANQVMSLHLNRSLVPMLKRVGAL  100



>ref|XP_010649773.1| PREDICTED: monothiol glutaredoxin-S10 [Vitis vinifera]
 emb|CBI26101.3| unnamed protein product [Vitis vinifera]
Length=102

 Score =   139 bits (351),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV ++A+++ VV+FSKSSCCMSH I+ L  + GV+PA++ELD   RG+E+E AL RLG
Sbjct  1    MDRVGKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIHELDEDSRGKEMEWALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N +MTLHL  +LK  LK AGA+W+
Sbjct  61   CNPSVPAVFIGGKFVGSANTVMTLHLNGSLKKMLKEAGAIWL  102



>ref|XP_010098329.1| Monothiol glutaredoxin-S10 [Morus notabilis]
 gb|EXB74833.1| Monothiol glutaredoxin-S10 [Morus notabilis]
Length=102

 Score =   139 bits (350),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKSSCCMSH I+ L  + GV+PAVYE+D   RG+E+E AL RLG
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAVYEIDEDSRGKEMEWALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP VPAVFIGG  VG  N IMTL L  +LK  LK AGALW+
Sbjct  61   CNPAVPAVFIGGNFVGSANTIMTLQLNGSLKKLLKDAGALWL  102



>ref|XP_006419643.1| hypothetical protein CICLE_v10006590mg [Citrus clementina]
 ref|XP_006489133.1| PREDICTED: monothiol glutaredoxin-S10-like [Citrus sinensis]
 gb|ESR32883.1| hypothetical protein CICLE_v10006590mg [Citrus clementina]
 gb|KDO75112.1| hypothetical protein CISIN_1g034165mg [Citrus sinensis]
Length=102

 Score =   139 bits (350),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV R+A+++ VV+FSKSSCCM H I+ L  D GV+PA+YELD   RG+E+E AL RLG
Sbjct  1    MDRVGRLASQKAVVIFSKSSCCMCHAIKRLFYDQGVSPAIYELDEDARGKEMEWALVRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N +MTL L  +LK  LK AGA+W+
Sbjct  61   CNPSVPAVFIGGKFVGSANTVMTLQLNGSLKKLLKDAGAIWL  102



>ref|NP_001275534.1| monothiol glutaredoxin-S10-like [Cucumis sativus]
 ref|XP_004170038.1| PREDICTED: monothiol glutaredoxin-S10-like [Cucumis sativus]
 ref|XP_008438822.1| PREDICTED: monothiol glutaredoxin-S10-like [Cucumis melo]
 gb|AGX01497.1| glutaredoxin [Cucumis sativus]
 gb|KGN57081.1| Glutaredoxin [Cucumis sativus]
Length=102

 Score =   139 bits (349),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+R++++A+++ VV+FSKSSCCMSH I+ L  D GV+PAVYELD   RG+EIE AL RLG
Sbjct  1    MERIAKVASQKAVVIFSKSSCCMSHAIKRLFYDQGVSPAVYELDEDSRGKEIEWALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP VPAVFIGG  VG  N I+TLHL   L   LK AGALW+
Sbjct  61   CNPAVPAVFIGGRFVGSANAIITLHLNGCLNKLLKEAGALWL  102



>ref|XP_003593973.1| Monothiol glutaredoxin-S4 [Medicago truncatula]
 gb|AES64224.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=102

 Score =   139 bits (349),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDR+S++A+++ VV+FSKSSC MSH I+ L  + GV PA+YELD   RGRE+E AL RLG
Sbjct  1    MDRISKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEDKRGREMEWALIRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N IMTLHL  +LK  L+ AGALW+
Sbjct  61   CNPSVPAVFIGGKFVGSANIIMTLHLNGSLKKMLREAGALWL  102



>ref|XP_007050809.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOX94966.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=102

 Score =   138 bits (348),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V+RM A+RPVV+FS+SSCCMSHTI++L++  G NP VYELD I  G+++E+AL ++G
Sbjct  1    MEVVTRMVADRPVVIFSRSSCCMSHTIKTLISGFGANPTVYELDEIQNGQQVERALQQMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG +L+GG N++MTL ++  L P L RAGA+W+
Sbjct  61   CKPSVPAVFIGQQLIGGPNQVMTLQVKNQLVPLLIRAGAIWI  102



>ref|XP_004309710.1| PREDICTED: monothiol glutaredoxin-S6-like [Fragaria vesca subsp. 
vesca]
Length=106

 Score =   138 bits (348),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+  ++P+V+FSKSSCCMSH+I++ L D G NP VYELD +P G++IE+AL +LG
Sbjct  1    MDMVARLVDQKPLVIFSKSSCCMSHSIKTFLYDFGANPTVYELDQMPNGQQIERALLQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG + +GG N +M+LH+Q  L P L RA A+W+
Sbjct  61   CRPSVPAVFIGQQFIGGTNTVMSLHMQNKLVPLLMRAKAIWI  102



>ref|XP_011016037.1| PREDICTED: monothiol glutaredoxin-S10 [Populus euphratica]
Length=102

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKSSCCM H I+ L  + GV+PA+YELD   RG+E+E AL RLG
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPAIYELDEDSRGKEMEWALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N +MTL L  +LK  LK AGALW+
Sbjct  61   CNPSVPAVFIGGKFVGTANTVMTLQLNGSLKKLLKEAGALWL  102



>ref|XP_002520671.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF41633.1| glutaredoxin, grx, putative [Ricinus communis]
Length=102

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V+R+  E+PVV+FSKSSCCMSHTI+SL+   G NP VYELD IP G++IE+ L +LG
Sbjct  1    MEMVNRLVKEKPVVIFSKSSCCMSHTIKSLICGFGANPTVYELDRIPNGQQIERTLMQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VP+VFIG +LVGGE ++M+LH+Q  L P L  AGA+W+
Sbjct  61   CQPSVPSVFIGQKLVGGEKQVMSLHVQNQLIPLLIDAGAIWI  102



>ref|XP_004486046.1| PREDICTED: monothiol glutaredoxin-S10-like [Cicer arietinum]
Length=102

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRVS++A+++ VV+FSKSSC MSH I+ L  + GV PA+YELD   RG+E+E AL RLG
Sbjct  1    MDRVSKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEDKRGKEMEWALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N IMTLHL  +LK  L+ AGALW+
Sbjct  61   CNPSVPAVFIGGKFVGSANIIMTLHLNGSLKKMLRDAGALWL  102



>emb|CDY09079.1| BnaC08g10330D [Brassica napus]
Length=102

 Score =   137 bits (346),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M ++ +  +E+ VV+FSK+SCCMSHTI++L  D GV+P +YELD I RG+EIEQ L++L 
Sbjct  1    MKKLPKKISEKSVVIFSKNSCCMSHTIKTLFLDFGVSPTIYELDEINRGKEIEQPLAQLD  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVP VFIG +LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   CSPTVPVVFIGDQLVGGANKVMSLHLNRSLVPMLKRVGALWL  102



>ref|XP_008353233.1| PREDICTED: monothiol glutaredoxin-S10-like [Malus domestica]
 ref|XP_008361968.1| PREDICTED: monothiol glutaredoxin-S10-like [Malus domestica]
Length=102

 Score =   137 bits (346),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A++  VV+FSKSSCCMSH ++ L  + GV+P +YELD   RG+E+E AL+RLG
Sbjct  1    MDRVTKLASQNAVVIFSKSSCCMSHAVKRLFYEQGVSPEIYELDEESRGKEMECALTRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIGG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CQPSVPAVFIGGKFVGSANTVMTLHLNGSLKKLLKDAGALWL  102



>ref|XP_009369117.1| PREDICTED: monothiol glutaredoxin-S10-like [Pyrus x bretschneideri]
 ref|XP_009339846.1| PREDICTED: monothiol glutaredoxin-S10-like [Pyrus x bretschneideri]
Length=102

 Score =   137 bits (344),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+ +A++  +V+FSKSSCCMSH ++ L  + GV+PA+YELD   RG+E+E AL+RLG
Sbjct  1    MDRVTNLASQNAIVIFSKSSCCMSHAVKRLFYEQGVSPAIYELDEESRGKEMECALTRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIGG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CQPSVPAVFIGGKCVGSANTVMTLHLNGSLKKLLKDAGALWL  102



>ref|XP_002321033.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEE99348.1| glutaredoxin family protein [Populus trichocarpa]
Length=103

 Score =   137 bits (344),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQAL-SRL  157
            MD V+R+ A+RPVV+FS+S+CCMSH+I++L++  G NP VYELD IP G++IE+AL  +L
Sbjct  1    MDMVNRLVADRPVVVFSRSTCCMSHSIKTLISSFGANPTVYELDQIPNGKQIEKALVQQL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GC P+VPAVFIG E VGG+ ++M+L ++  L P L++AGA+W+
Sbjct  61   GCQPSVPAVFIGQEFVGGDKQVMSLQVRNELAPLLRKAGAIWI  103



>ref|XP_006414473.1| hypothetical protein EUTSA_v10027082mg, partial [Eutrema salsugineum]
 gb|ESQ55926.1| hypothetical protein EUTSA_v10027082mg, partial [Eutrema salsugineum]
Length=92

 Score =   136 bits (342),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  303  RPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLGCNPTVPAVFI  124
            + VV+FSK+ CCMSHTI++L  D GVNP +YELD   RG+EIEQAL++LGC+PTVP VFI
Sbjct  1    KSVVIFSKNLCCMSHTIKTLFLDFGVNPTIYELDETNRGQEIEQALAQLGCSPTVPVVFI  60

Query  123  GGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GG+LVGG N++M+LHL ++L P LKR GALW+
Sbjct  61   GGQLVGGANQVMSLHLNRSLVPMLKRVGALWL  92



>ref|XP_009612544.1| PREDICTED: monothiol glutaredoxin-S1-like [Nicotiana tomentosiformis]
Length=103

 Score =   136 bits (342),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV ++ AE PVV+FSKSSCC+SH+I +L+   G NPAVYELD +P GRE+E+AL  LG
Sbjct  1    MERVMKLGAESPVVIFSKSSCCISHSIETLIRSFGANPAVYELDELPNGREMEKALVELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQ-QALKPKLKRAGALWV  28
            C P+VPAVFIG ELVGG NEIM+L+L+   LK  L RA A+WV
Sbjct  61   CKPSVPAVFIGKELVGGSNEIMSLNLRGNKLKQLLIRANAIWV  103



>ref|XP_010024636.1| PREDICTED: monothiol glutaredoxin-S4-like [Eucalyptus grandis]
Length=108

 Score =   136 bits (342),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDR++RM  ERPVV+FS+SSCCM HT++ L  + GVNP V+ELD IPRG+EIEQALSRLG
Sbjct  1    MDRINRMVLERPVVIFSRSSCCMCHTVKMLFREFGVNPVVHELDEIPRGQEIEQALSRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQAL  64
             +PTVPAVFIGGELVGG NE+ +LHL ++L
Sbjct  61   RSPTVPAVFIGGELVGGINEVTSLHLNRSL  90



>ref|XP_010684482.1| PREDICTED: monothiol glutaredoxin-S1-like [Beta vulgaris subsp. 
vulgaris]
Length=107

 Score =   136 bits (342),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+  E+PVV+FSKSSCCMSH+++ L++  G NP VYELD +P GREI++AL +LG
Sbjct  1    MDTVTRLVEEKPVVIFSKSSCCMSHSMKQLISSYGANPTVYELDELPNGREIDRALKKLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P VPAVFIG +L+GG N+I++L +Q  L P L  AGA+W+
Sbjct  61   CKPGVPAVFIGRKLIGGANDIISLQVQGKLVPALMDAGAIWI  102



>ref|XP_010241661.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=102

 Score =   135 bits (341),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV  +A++ PVV+FSKSSCCM H I++L +D G +P VYE+D+ PRGREIE+AL  LG
Sbjct  1    MERVVALASQMPVVIFSKSSCCMCHAIKTLFSDYGASPVVYEIDLDPRGREIERALLGLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIGG+LVGG NE+MT  L ++LK  L RAGA+++
Sbjct  61   CKPSVPAVFIGGKLVGGANEVMTRQLDRSLKELLMRAGAIFL  102



>ref|XP_007035504.1| Glutaredoxin family protein [Theobroma cacao]
 gb|EOY06430.1| Glutaredoxin family protein [Theobroma cacao]
Length=102

 Score =   135 bits (341),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKSSCCM H I+ L  + GV+PA+YELD   RG+E+E AL RLG
Sbjct  1    MDRVAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPAIYELDEDARGKEMEWALVRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP VPAVFIGG+ VG  N IMTL L  +LK  LK AGA+W+
Sbjct  61   CNPPVPAVFIGGKFVGSANTIMTLQLNGSLKNLLKNAGAIWL  102



>gb|KDP40012.1| hypothetical protein JCGZ_02010 [Jatropha curcas]
Length=102

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A ++ VV+FSKSSCCM H I+ L  +  V+PA+YELD   RG+E+E AL RLG
Sbjct  1    MDRVAKLAGQKAVVIFSKSSCCMCHAIKRLFYEQAVSPAIYELDEDSRGKEMECALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N +MTLHL  +LK  L+ AGA+W+
Sbjct  61   CNPSVPAVFIGGKFVGSANTVMTLHLNGSLKKLLRDAGAIWL  102



>ref|XP_002892143.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68402.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++S +  ++PVV+FSK+SCCMSHTI+SL++  G NP VYELD +  G EIE+AL  LG
Sbjct  1    MEKISNLLEDKPVVIFSKTSCCMSHTIKSLISGYGANPTVYELDEMSNGSEIERALVELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVPAVFIG ELVGG N++M+L ++  L   L+RAGA+W+
Sbjct  61   CKPTVPAVFIGQELVGGANQLMSLQVRNQLASLLRRAGAIWI  102



>ref|XP_011033597.1| PREDICTED: monothiol glutaredoxin-S6-like [Populus euphratica]
Length=103

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQAL-SRL  157
            MD V R+ A+RPVV+FS+S+CCMSH I++L++  G NP VYELD IP G++IE+AL  +L
Sbjct  1    MDMVKRLVADRPVVVFSRSTCCMSHAIKTLISSFGANPTVYELDQIPNGKQIEKALVQQL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GC P+VPAVFIG + VGG+ ++M+L ++  L P L++AGA+W+
Sbjct  61   GCQPSVPAVFIGQDFVGGDKQVMSLQVRNELAPLLRKAGAIWI  103



>ref|XP_007154237.1| hypothetical protein PHAVU_003G101900g [Phaseolus vulgaris]
 gb|ESW26231.1| hypothetical protein PHAVU_003G101900g [Phaseolus vulgaris]
Length=102

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKSSC M H I+ L  ++GV PA+YE+D + RG+EIE  L +LG
Sbjct  1    MDRVAKLASQKAVVIFSKSSCGMCHAIKRLFYELGVAPAIYEVDEVSRGKEIEWCLMKLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N +MTLHL  +LK  L+ AGALW+
Sbjct  61   CNPSVPAVFIGGKFVGAANTVMTLHLNGSLKKMLRDAGALWL  102



>ref|XP_009779593.1| PREDICTED: monothiol glutaredoxin-S1-like [Nicotiana sylvestris]
Length=103

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+RV ++ AE PVV+FSKSSCC+SH+I +L+   G NP VYELD +P GRE+E+AL  LG
Sbjct  1    MERVMKLGAESPVVIFSKSSCCISHSIETLIRSFGANPTVYELDELPNGREMEKALVELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQ-QALKPKLKRAGALWV  28
            C P+VPAVFIG ELVGG NEIM+L+L+   LK  L RA A+WV
Sbjct  61   CKPSVPAVFIGKELVGGSNEIMSLNLRGNKLKQLLIRANAIWV  103



>ref|XP_010481465.1| PREDICTED: monothiol glutaredoxin-S1-like [Camelina sativa]
Length=102

 Score =   134 bits (338),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++S +  ++PVV+FSK+SCCMSHTI+SL++  G NP VYELD +  G E+E+AL+ LG
Sbjct  1    MEKISNLLEDKPVVIFSKTSCCMSHTIKSLISGYGANPTVYELDAMSNGAEVERALAELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVPAVFIG +LVGG N++M+L ++  L   L+RAGA+W+
Sbjct  61   CKPTVPAVFIGQQLVGGANQLMSLQVRNQLGSLLRRAGAIWI  102



>ref|XP_006594493.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max]
 gb|KHN47301.1| Monothiol glutaredoxin-S10 [Glycine soja]
Length=102

 Score =   134 bits (338),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+R++++A+++ VV+FSKSSC MSH I+ L  + GV PA+YELD   RG+E+E AL RLG
Sbjct  1    MERITKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEDTRGKEMEWALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVF+GG+ VG  N +MTLHL  +LK  L+ AGALW+
Sbjct  61   CNPSVPAVFVGGKFVGSANTVMTLHLNGSLKKMLRDAGALWL  102



>ref|XP_006444250.1| hypothetical protein CICLE_v10022989mg [Citrus clementina]
 ref|XP_006479887.1| PREDICTED: monothiol glutaredoxin-S1-like [Citrus sinensis]
 gb|ESR57490.1| hypothetical protein CICLE_v10022989mg [Citrus clementina]
 gb|KDO87369.1| hypothetical protein CISIN_1g042938mg [Citrus sinensis]
Length=106

 Score =   134 bits (337),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+RM  E+PVV+FSKS CC+  +I++L+   G NP VYELD IP G +IE+AL +LG
Sbjct  1    MDMVTRMVNEKPVVIFSKSECCICFSIQTLICGFGANPTVYELDQIPNGPQIERALQQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVPAVFIG  LVGG N++M+LH+Q  L P L RAGA+W+
Sbjct  61   CQPTVPAVFIGQRLVGGPNQVMSLHVQNELGPLLVRAGAIWL  102



>ref|XP_003546093.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max]
 gb|KHN33128.1| Monothiol glutaredoxin-S10 [Glycine soja]
Length=102

 Score =   134 bits (337),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+R++++A+++ VV+FSKSSC MSH I+ L  + GV PA+YELD   RG+E+E AL RLG
Sbjct  1    MERITKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEDTRGKEMEWALLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVF+GG+ VG  N +MTLHL  +LK  L+ AGALW+
Sbjct  61   CNPSVPAVFVGGKFVGSANTVMTLHLNGSLKKMLRDAGALWL  102



>emb|CDY32493.1| BnaA09g51030D [Brassica napus]
Length=102

 Score =   134 bits (336),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++S++  ++PVV+FS +SCCMSHTI+SL++  G NP VYELD +  G EIE+AL  LG
Sbjct  1    MEKISKLLEDKPVVIFSMTSCCMSHTIKSLISGYGANPTVYELDEMSNGSEIERALVELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIG +L+GG N++M+L ++  L   L+RAGA+W+
Sbjct  61   CNPTVPAVFIGQQLIGGANQLMSLQVRNQLGSVLRRAGAIWI  102



>gb|AFK43054.1| unknown [Lotus japonicus]
Length=102

 Score =   134 bits (336),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRVS++A+++ VV+FSKSSC MSH I+ L  + GV PA+YELD   RG+E+E AL RLG
Sbjct  1    MDRVSKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEELRGKEMEWALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N ++TLHL  +LK  L+ AG+LW+
Sbjct  61   CNPSVPAVFIGGKFVGSANTVITLHLSGSLKRMLRDAGSLWL  102



>gb|KFK39456.1| hypothetical protein AALP_AA3G247200 [Arabis alpina]
Length=102

 Score =   134 bits (336),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+A++R VV+FSKS+CCMSH I+ L  + GV+PA+ E+D    G++IE AL+RLG
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIIEIDQDMYGKDIEWALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVF+GG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CSPTVPAVFVGGKFVGTANTVMTLHLNGSLKKLLKDAGALWL  102



>ref|XP_008389183.1| PREDICTED: monothiol glutaredoxin-S6-like [Malus domestica]
Length=106

 Score =   134 bits (336),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+  E+P+V+FSKSSCCMSH+ +S L   G NP +YELD +P G++IE+AL +LG
Sbjct  1    MDTVARLVDEKPLVIFSKSSCCMSHSTKSFLRGFGANPTIYELDQMPNGQQIERALLQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG + VGG N +M LH+Q  L P L RA A+W+
Sbjct  61   CRPSVPAVFIGQQFVGGNNTVMGLHVQNKLVPLLMRAKAIWI  102



>ref|XP_010457309.1| PREDICTED: monothiol glutaredoxin-S1 [Camelina sativa]
 ref|XP_010474905.1| PREDICTED: monothiol glutaredoxin-S1 [Camelina sativa]
Length=102

 Score =   133 bits (335),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++S +  ++PVV+FSK+SCCMSHTI+SL++  G NP VYELD +  G E+E+AL+ LG
Sbjct  1    MEKISNLLEDKPVVIFSKTSCCMSHTIKSLISGYGANPTVYELDEMSNGAEVERALAELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVPAVFIG +LVGG N++M+L ++  L   L+RAGA+W+
Sbjct  61   CKPTVPAVFIGQQLVGGANQLMSLQVRNQLGSLLRRAGAIWI  102



>gb|KDP28099.1| hypothetical protein JCGZ_13870 [Jatropha curcas]
Length=103

 Score =   133 bits (335),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQAL-SRL  157
            M+ V+ M  E+PVV+FSKSSCCMSH+I+SL+   G NP VYELD IP G++IE+AL  +L
Sbjct  1    MEMVNSMVKEKPVVIFSKSSCCMSHSIKSLICGFGANPTVYELDRIPNGQQIERALVQQL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GC P+VPAVFIG + VGGE ++M+LH+Q  L P L  AGA+W+
Sbjct  61   GCQPSVPAVFIGQKFVGGEKQVMSLHVQNQLIPWLMDAGAIWI  103



>ref|XP_009118722.1| PREDICTED: monothiol glutaredoxin-S1-like [Brassica rapa]
Length=133

 Score =   134 bits (337),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++S++  ++PVV+FS +SCCMSHTI+SL++  G NP VYELD +  G EIE+AL  LG
Sbjct  32   MEKISKLLEDKPVVIFSMTSCCMSHTIKSLISGYGANPTVYELDEMSNGSEIERALVELG  91

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNPTVPAVFIG +L+GG N++M+L ++  L   L+RAGA+W+
Sbjct  92   CNPTVPAVFIGQQLIGGANQLMSLQVRNQLGSVLRRAGAIWI  133



>gb|ABK28101.1| unknown [Arabidopsis thaliana]
Length=103

 Score =   133 bits (335),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+A++R VV+FSKS+CCMSH I+ L  + GV+PA+ E+D    G++IE AL+RLG
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMYGKDIEWALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVF+GG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CSPTVPAVFVGGKFVGTANTVMTLHLNGSLKILLKEAGALWL  102



>emb|CDP12909.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V R+ +E+PVV+FSKS+CC+SH I+ L++  G NP VYELD +P+GRE+E AL  LG
Sbjct  1    METVRRLGSEKPVVIFSKSNCCISHAIKILISSFGANPTVYELDQLPKGREVENALLTLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIG   VGG NE+M+L+++  LKP L  A A+W+
Sbjct  61   CNPSVPAVFIGKIFVGGSNEVMSLNVKGKLKPLLIEANAIWM  102



>ref|NP_001078198.1| monothiol glutaredoxin-S10 [Arabidopsis thaliana]
 sp|Q9LIF1.1|GRS10_ARATH RecName: Full=Monothiol glutaredoxin-S10; Short=AtGrxS10; AltName: 
Full=Protein ROXY 3 [Arabidopsis thaliana]
 dbj|BAB03058.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|ABF59441.1| unknown protein [Arabidopsis thaliana]
 gb|ACO50408.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE76510.1| monothiol glutaredoxin-S10 [Arabidopsis thaliana]
Length=102

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+A++R VV+FSKS+CCMSH I+ L  + GV+PA+ E+D    G++IE AL+RLG
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMYGKDIEWALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVF+GG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CSPTVPAVFVGGKFVGTANTVMTLHLNGSLKILLKEAGALWL  102



>ref|XP_008386628.1| PREDICTED: monothiol glutaredoxin-S6-like [Malus domestica]
Length=106

 Score =   133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+  E+P+V+FSKSSCCMSH+ +S L   G NP +YELD +P G++IE+AL +LG
Sbjct  1    MDTVARLVDEKPLVIFSKSSCCMSHSTKSFLRGFGANPTIYELDQMPNGQQIERALLQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG + VGG N +M LH+Q  L P L RA A+W+
Sbjct  61   CRPSVPAVFIGQQFVGGNNTVMGLHVQNRLVPLLMRAKAIWI  102



>ref|XP_002885441.1| electron carrier/ protein disulfide oxidoreductase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH61700.1| electron carrier/ protein disulfide oxidoreductase [Arabidopsis 
lyrata subsp. lyrata]
Length=102

 Score =   133 bits (334),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+A++R VV+FSKS+CCMSH I+ L  + GV+PA+ E+D    G++IE AL+RLG
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMYGKDIEWALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVF+GG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CSPTVPAVFVGGKFVGTANTVMTLHLNGSLKMLLKEAGALWL  102



>ref|XP_007147879.1| hypothetical protein PHAVU_006G162600g [Phaseolus vulgaris]
 gb|ESW19873.1| hypothetical protein PHAVU_006G162600g [Phaseolus vulgaris]
Length=147

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -1

Query  366  SESLRFLE**EMDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRG  187
            S S+ F     M+R++++A+++ VV+FSKSSC MSH I+ L  + GV PA+YELD   RG
Sbjct  35   SHSIYFTIKYIMERITKLASQKAVVIFSKSSCGMSHAIKRLFYEQGVGPAIYELDEDIRG  94

Query  186  REIEQALSRLGCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            +E+E AL RLGCNP+VPAVF+GG  VG  N +MTLHL  +LK  L+ AGALW+
Sbjct  95   KEMEWALMRLGCNPSVPAVFVGGNFVGSANTVMTLHLNGSLKKMLRDAGALWL  147



>ref|XP_006299130.1| hypothetical protein CARUB_v10015272mg [Capsella rubella]
 ref|XP_010510226.1| PREDICTED: monothiol glutaredoxin-S10 [Camelina sativa]
 gb|EOA32028.1| hypothetical protein CARUB_v10015272mg [Capsella rubella]
Length=102

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+A++R VV+FSKS+CCMSH I+ L  + GV+PA+ E+D    G++IE AL+RLG
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMYGKDIEWALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVF+GG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CSPTVPAVFVGGKFVGTANTVMTLHLNGSLKMLLKDAGALWL  102



>ref|XP_010243568.1| PREDICTED: monothiol glutaredoxin-S10-like [Nelumbo nucifera]
Length=102

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A++   V+FSKSSCCMSH I+    ++GVNPA++ELD   RGRE+E AL +LG
Sbjct  1    MDRVTKLASQSAAVVFSKSSCCMSHVIKRFFYELGVNPAIHELDEEYRGREMEMALLKLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP VPAVFIGG+ +G   ++M LH+  +L P LK AGA+W+
Sbjct  61   CNPAVPAVFIGGKFIGSTQKVMALHINGSLIPLLKEAGAIWL  102



>ref|XP_009138705.1| PREDICTED: monothiol glutaredoxin-S6-like [Brassica rapa]
 emb|CDX89159.1| BnaA04g00270D [Brassica napus]
Length=102

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +  + AE+PVV+FSKSSCCMSH+I++L++  G N  VYELD +  G+E+E+AL ++G
Sbjct  1    MESIRSLVAEKPVVIFSKSSCCMSHSIQTLISGYGANVTVYELDQLSNGQEVEKALVQMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG +L+GG N++MT+H++  L   L+RAGA+WV
Sbjct  61   CKPSVPAVFIGEQLIGGANQVMTIHVKNQLAALLRRAGAIWV  102



>ref|XP_009378912.1| PREDICTED: monothiol glutaredoxin-S6-like [Pyrus x bretschneideri]
Length=106

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD ++R+  E+P+V+FSKSSCCMSH+ +S L   G NP +YELD +P G++IE+AL +LG
Sbjct  1    MDTLARLVDEKPLVIFSKSSCCMSHSTKSFLRGFGANPTIYELDQMPNGQQIERALLQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG + VGG N +M LH+Q  L P L RA A+W+
Sbjct  61   CRPSVPAVFIGQQFVGGNNTVMGLHVQNKLVPLLMRAKAIWI  102



>ref|XP_011071467.1| PREDICTED: monothiol glutaredoxin-S10-like [Sesamum indicum]
Length=102

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V ++A+++ VV+FSKS+CCM H I+ L  + GV+P VYE+D  P GRE E+AL RLG
Sbjct  1    METVMKLASQKAVVIFSKSTCCMCHAIKRLFYEQGVSPMVYEIDEQPNGRETERALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVFIGG+ VG  N I+TLHL  +LK  LK AGALW+
Sbjct  61   CSPTVPAVFIGGKFVGSANNILTLHLDGSLKKMLKDAGALWL  102



>gb|KFK39447.1| hypothetical protein AALP_AA3G246300 [Arabis alpina]
Length=102

 Score =   132 bits (332),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+A++R VV+FSKS+CCMSH I+ L  + GV+P + E+D    G+EIE AL+RLG
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPEIIEIDQDMYGKEIEWALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVF+GG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CSPTVPAVFVGGKFVGTANTVMTLHLNGSLKKLLKDAGALWL  102



>ref|XP_010466387.1| PREDICTED: monothiol glutaredoxin-S10-like [Camelina sativa]
 ref|XP_010488159.1| PREDICTED: monothiol glutaredoxin-S10-like [Camelina sativa]
Length=102

 Score =   132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+A++R VV+FSKS+CCMSH I+ L  + GV+PA+ E+D    G++IE AL+RLG
Sbjct  1    MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMYGKDIEWALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVF+GG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CSPTVPAVFVGGKFVGMANTVMTLHLNGSLKMLLKDAGALWL  102



>ref|XP_010522769.1| PREDICTED: monothiol glutaredoxin-S1 [Tarenaya hassleriana]
Length=104

 Score =   132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -1

Query  324  VSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLGCNP  145
            +S M  E+PVV+FS+S+CCMSH I+SL++  G NP VYELD +P G+EIE+AL  LGC P
Sbjct  6    ISEMLVEKPVVIFSRSTCCMSHAIKSLISGFGANPTVYELDELPNGQEIEEALVGLGCKP  65

Query  144  TVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            TVPAVFIG +LVGG N++M+L ++  L   L++AGA+W+
Sbjct  66   TVPAVFIGQQLVGGANQVMSLQVRNQLGSLLRKAGAIWI  104



>emb|CDO98900.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDR++++A+++ VV+FSKSSCCM H I+ L  + GV+P + ELD   RG+E+E AL RLG
Sbjct  1    MDRIAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMILELDEESRGQEMEWALMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N +MTLH+  +LK  LK AGA+W+
Sbjct  61   CNPSVPAVFIGGKFVGSANTVMTLHVNGSLKKMLKDAGAMWL  102



>ref|XP_009773168.1| PREDICTED: monothiol glutaredoxin-S2-like [Nicotiana sylvestris]
Length=102

 Score =   132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V ++ A+ PVV+FS S+CCMSHTI +L+ + G NP +YELD +  GRE+E+AL  LG
Sbjct  1    MDMVMKLGAQSPVVIFSSSTCCMSHTIETLIRNFGANPTIYELDRLQNGRELEKALIELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+ PAVFIG ELVGG NEIM+L+++  LK  L RA A+WV
Sbjct  61   CQPSFPAVFIGNELVGGSNEIMSLNIRGKLKQLLIRANAIWV  102



>ref|XP_006418276.1| hypothetical protein EUTSA_v10009174mg [Eutrema salsugineum]
 gb|ESQ36629.1| hypothetical protein EUTSA_v10009174mg [Eutrema salsugineum]
Length=102

 Score =   131 bits (330),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++S +  ++PVV+FS+SSCCMSHTI+SL++  G NP VYELD +  G EIE+AL  LG
Sbjct  1    MEKISNLLEDKPVVIFSRSSCCMSHTIKSLISGYGANPTVYELDEMSNGPEIERALVELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVPAVFIG +L+GG N++M+L ++  L   L+RAGA+W+
Sbjct  61   CKPTVPAVFIGQQLIGGANQLMSLQVRNQLASLLRRAGAIWI  102



>ref|XP_002878487.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54746.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   131 bits (330),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V  + A++PVV+FSKSSCCMSH+I++L++  G    VYELD    G+EIE+AL ++G
Sbjct  1    MESVGSLVADKPVVIFSKSSCCMSHSIQTLISGFGAKMTVYELDQFSNGQEIEKALVQMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG +L+GG N++MTLH++  L   L+RAGA+WV
Sbjct  61   CKPSVPAVFIGQQLIGGANQVMTLHVKNQLAALLRRAGAIWV  102



>emb|CDX93949.1| BnaC04g21080D [Brassica napus]
Length=102

 Score =   131 bits (330),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +  + AE+PVV+FSKSSCCMSH+I++L++  G N  VYELD +  G+E+E+AL ++G
Sbjct  1    MESIRSLVAEKPVVIFSKSSCCMSHSIQTLISGYGANMTVYELDQLSNGQEVEKALVQMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG +L+GG N++MT H++  L   L+RAGA+WV
Sbjct  61   CKPSVPAVFIGEQLIGGANQVMTTHVKNQLASLLRRAGAIWV  102



>ref|XP_011013022.1| PREDICTED: monothiol glutaredoxin-S6-like [Populus euphratica]
Length=103

 Score =   131 bits (330),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQAL-SRL  157
            MD V R+ A+RPVV+FS+S+CCMSH+I++L++  G NP VYELD IP G++IE+AL  +L
Sbjct  1    MDIVRRLVADRPVVIFSRSTCCMSHSIKTLISSFGANPTVYELDQIPNGKQIEKALVQQL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GC P+VPAVFIG E VGG+ ++M+L ++  L   L+ AGA+W+
Sbjct  61   GCQPSVPAVFIGQEFVGGDKQVMSLQVRNELGSLLRNAGAIWI  103



>gb|EYU45572.1| hypothetical protein MIMGU_mgv1a023883mg [Erythranthe guttata]
Length=102

 Score =   131 bits (330),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V ++AA++ VV+FSKS+CCM H I+ L  + GV+P VYELD    G+E+E+AL RLG
Sbjct  1    MECVVKLAAQKAVVIFSKSTCCMCHAIKRLFYEQGVSPMVYELDEQINGKEMERALIRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVPAVF+GG+ +G  N+++TLHL  +LK KLK AGALW+
Sbjct  61   CTPTVPAVFVGGKFIGSANDVLTLHLDGSLKKKLKAAGALWL  102



>ref|XP_009759599.1| PREDICTED: monothiol glutaredoxin-S2-like [Nicotiana sylvestris]
Length=102

 Score =   131 bits (329),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V ++ A+ PVV+FS+S+CCMSHTI +L+ + G NP +YELD +  GRE+E+AL  LG
Sbjct  1    MDMVMKLGAQSPVVIFSRSTCCMSHTIETLIRNFGANPTIYELDRLQNGRELERALIELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C  +VPAVFIG ELVGG NEIM+L+++  LK  L RA A+WV
Sbjct  61   CQTSVPAVFIGNELVGGSNEIMSLNIRGKLKQLLIRANAIWV  102



>ref|XP_004247455.1| PREDICTED: monothiol glutaredoxin-S2-like [Solanum lycopersicum]
Length=102

 Score =   131 bits (329),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V +M AE+PVVMFSKS CCM HTI++L++  G N  VYELD +P G ++E+AL  LG
Sbjct  1    MESVKKMVAEKPVVMFSKSKCCMCHTIKTLISSFGANLTVYELDELPNGLQVERALMMLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
              P+VPAVFIG EL+GG NEIM+LHL+  L P L +A ALW+
Sbjct  61   LRPSVPAVFIGQELIGGANEIMSLHLEGNLVPLLMKAKALWL  102



>ref|XP_003529587.1| PREDICTED: monothiol glutaredoxin-S10-like [Glycine max]
 gb|KHN02996.1| Monothiol glutaredoxin-S10 [Glycine soja]
Length=102

 Score =   131 bits (329),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++A+++ VV+FSKSSC M H I+ L  ++GV P +YE+D   RG+EIE  L RLG
Sbjct  1    MDRVAKLASQKAVVIFSKSSCGMCHAIKRLFYELGVGPTIYEVDEESRGKEIEWCLMRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG+ VG  N +MTLHL  +LK  L+ AGALW+
Sbjct  61   CNPSVPAVFIGGKFVGAPNTVMTLHLNGSLKKMLRDAGALWL  102



>ref|XP_010273480.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=104

 Score =   130 bits (328),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV  +A+E PVV+FS+SSCCM HT+++L  D GVNPA+YELD+ PRGREIE+AL +LG
Sbjct  1    MDRVLALASEAPVVIFSQSSCCMCHTVKTLFYDYGVNPAIYELDLDPRGREIERALLKLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMT--LHLQQALKPKLKRAGAL  34
            CNP+VPAVFIGG LVGG  E+M   L++   L+  L  AGA+
Sbjct  61   CNPSVPAVFIGGRLVGGAREVMIHQLNISPTLRNLLIGAGAI  102



>ref|XP_009761867.1| PREDICTED: monothiol glutaredoxin-S6-like [Nicotiana sylvestris]
Length=102

 Score =   130 bits (328),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V ++ A  PVV+FSKSSCC+SH+I +L+   G NP VYELD  P G++IE+AL  LG
Sbjct  1    MDMVMKLGAASPVVIFSKSSCCISHSIETLIRSFGANPTVYELDRHPNGKQIEKALIELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG E +GG NEIM+L+++  LK  L RA A+WV
Sbjct  61   CQPSVPAVFIGNEFIGGSNEIMSLNVRSKLKQLLIRANAIWV  102



>ref|XP_009135750.1| PREDICTED: monothiol glutaredoxin-S10 [Brassica rapa]
 emb|CDY48891.1| BnaA03g36300D [Brassica napus]
 emb|CDY32431.1| BnaC03g42150D [Brassica napus]
Length=102

 Score =   130 bits (328),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+ +A++R VV+FSKS+CCMSH I+ L  + GV+PA+ E+D    G++IE AL+RLG
Sbjct  1    MDVVATLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQNMYGKDIEWALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVF+GG+ VG  N +MTLHL  +LK  LK AGALW+
Sbjct  61   CSPTVPAVFVGGKFVGTANTVMTLHLNGSLKRLLKEAGALWL  102



>ref|XP_007200001.1| hypothetical protein PRUPE_ppa024889mg [Prunus persica]
 ref|XP_008235003.1| PREDICTED: monothiol glutaredoxin-S1-like [Prunus mume]
 gb|EMJ01200.1| hypothetical protein PRUPE_ppa024889mg [Prunus persica]
Length=106

 Score =   130 bits (328),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+ +  E+P+V+FSKSSCCMSH+ +S L   G NP VYELD +P G++IE+AL + G
Sbjct  1    MDMVAGLVDEKPLVIFSKSSCCMSHSTKSFLRGFGANPTVYELDQMPNGQQIERALLQRG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG ELVGG N +M+LH+Q  L P L RA A+W+
Sbjct  61   CRPSVPAVFIGQELVGGTNTVMSLHVQNRLVPLLMRAKAIWI  102



>ref|XP_006389682.1| glutaredoxin family protein [Populus trichocarpa]
 gb|ERP48596.1| glutaredoxin family protein [Populus trichocarpa]
Length=103

 Score =   130 bits (328),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQAL-SRL  157
            MD V R+ A+RPVV+FS+S+CCMSH+I++L++  G NP VYELD IP G++IE+AL  +L
Sbjct  1    MDIVRRLVADRPVVIFSRSTCCMSHSIKTLISSFGANPTVYELDQIPNGKQIERALVQQL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GC P+VP VFIG E VGG+ ++M+L ++  L   L++AGA+W+
Sbjct  61   GCQPSVPTVFIGQEFVGGDKQVMSLQVRNELGSLLRKAGAIWI  103



>ref|XP_008674047.1| PREDICTED: glutaredoxin-C1 [Zea mays]
 tpg|DAA54578.1| TPA: hypothetical protein ZEAMMB73_315594 [Zea mays]
Length=103

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSR-L  157
            MDRV+++A++R VV+FS SSCCM HT+  L  ++GVNP V ELD  PRG+E+E+AL+R L
Sbjct  1    MDRVTKLASQRAVVIFSTSSCCMCHTVTRLFRELGVNPTVVELDEDPRGKEMEKALARLL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            G NP VPAVFIGG LVG  +++M+LHL   L P L+ AGALWV
Sbjct  61   GRNPAVPAVFIGGRLVGSTDKVMSLHLSGNLVPLLRNAGALWV  103



>emb|CDP12904.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   130 bits (327),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V R+ +E+PVV+FSKS+CC+SH I  L+   G NP VYELD  P GR+IE AL  LG
Sbjct  1    MDIVKRLGSEKPVVIFSKSNCCISHAIHMLICSFGANPTVYELDQYPEGRDIENALLALG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+PTVPAVFIG  LVGG +E+M L++Q  LKP L +A A+W+
Sbjct  61   CHPTVPAVFIGKLLVGGSDEVMNLNVQGKLKPLLIKANAIWM  102



>ref|XP_011071468.1| PREDICTED: monothiol glutaredoxin-S10-like [Sesamum indicum]
Length=102

 Score =   130 bits (327),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV+++ +++ VV+FSKSSCCM H I+ L  + GV+P V+E+D   RG++IE AL++LG
Sbjct  1    MDRVAKIVSQKAVVIFSKSSCCMCHAIKRLFYEQGVSPLVHEIDEDSRGKDIEWALTKLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGG+LVG  N +MTL L  +LK  LK AGALW+
Sbjct  61   CSPAVPAVFIGGKLVGSANTVMTLQLNGSLKKMLKDAGALWL  102



>ref|XP_006414475.1| hypothetical protein EUTSA_v10027336mg [Eutrema salsugineum]
 gb|ESQ55928.1| hypothetical protein EUTSA_v10027336mg [Eutrema salsugineum]
Length=94

 Score =   130 bits (326),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++ +M +E+ VV+FSK+SCCMSHTI++L  D GVNP +YELD I RG+EIEQAL++LG
Sbjct  1    MEKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDDINRGQEIEQALAQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKP  58
            C+PTVP VFIGG+LV G N++M+LHL +  +P
Sbjct  61   CSPTVPVVFIGGQLVVGANQVMSLHLNRLSRP  92



>ref|XP_009607405.1| PREDICTED: monothiol glutaredoxin-S10 [Nicotiana tomentosiformis]
 ref|XP_009782550.1| PREDICTED: monothiol glutaredoxin-S10 [Nicotiana sylvestris]
Length=102

 Score =   130 bits (326),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV ++A+++ VV+FSKSSCCM H I+ L  + GV+P +YELD    GRE+E++L RLG
Sbjct  1    MDRVVKVASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMIYELDEDINGREMERSLLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGG  VG  N +MTLH+  +LK  LK AGALW+
Sbjct  61   CSPAVPAVFIGGRFVGSANTVMTLHINGSLKKMLKDAGALWL  102



>ref|XP_009399249.1| PREDICTED: glutaredoxin-C1-like [Musa acuminata subsp. malaccensis]
 gb|ABF69994.1| glutaredoxin family protein [Musa acuminata]
Length=103

 Score =   130 bits (326),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSR-L  157
            MDRV ++A+++ VV+FS SSCCM HTI+ L  ++GVNPAVYELD  PRGRE+E+AL + L
Sbjct  1    MDRVMKLASQKAVVIFSLSSCCMCHTIKRLFCELGVNPAVYELDEDPRGREMEKALVKLL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            G NP+VP VFIGG+LVG  + IM LHL   L P L+ AGALW+
Sbjct  61   GRNPSVPVVFIGGKLVGSTDRIMALHLGGKLTPLLREAGALWL  103



>ref|XP_009781310.1| PREDICTED: monothiol glutaredoxin-S6-like [Nicotiana sylvestris]
Length=102

 Score =   129 bits (325),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+  E PVV+FSKS+CCMSH+I +L+ + G NP VY+LD +P+G+++E+AL  +G
Sbjct  1    MDAVNRLGEESPVVIFSKSNCCMSHSIETLIRNFGANPTVYKLDELPKGKKMEKALIEMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+ PA+FIG E VGG +E+M+L+++  LK  L +A A+W+
Sbjct  61   CNPSTPAIFIGKEFVGGSDEVMSLNVKGKLKDLLIKANAIWI  102



>ref|NP_171801.1| monothiol glutaredoxin-S1 [Arabidopsis thaliana]
 sp|Q9SA68.1|GRXS1_ARATH RecName: Full=Monothiol glutaredoxin-S1; Short=AtGrxS1; AltName: 
Full=Protein ROXY 16 [Arabidopsis thaliana]
 gb|AAD25807.1|AC006550_15 Strong similarity to gb|Z49699 glutaredoxin from Ricinus communis 
[Arabidopsis thaliana]
 gb|ACO50426.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE27515.1| monothiol glutaredoxin-S1 [Arabidopsis thaliana]
Length=102

 Score =   129 bits (325),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++S +  ++PVV+FSK+SCCMSH+I+SL++  G N  VYELD +  G EIE+AL  LG
Sbjct  1    MEKISNLLEDKPVVIFSKTSCCMSHSIKSLISGYGANSTVYELDEMSNGPEIERALVELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVPAVFIG ELVGG N++M+L ++  L   L+RAGA+W+
Sbjct  61   CKPTVPAVFIGQELVGGANQLMSLQVRNQLASLLRRAGAIWI  102



>gb|KCW84427.1| hypothetical protein EUGRSUZ_B01275 [Eucalyptus grandis]
Length=90

 Score =   129 bits (324),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -1

Query  330  DRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLGC  151
            D V++M++E+PVV+FSKSSCCM HTI++LL D G NP V+ELD IPRG+EIEQAL R GC
Sbjct  3    DLVAKMSSEKPVVIFSKSSCCMCHTIKTLLCDFGANPTVHELDEIPRGKEIEQALVRRGC  62

Query  150  NPTVPAVFIGGELVGGENEIMT  85
            NP VPAVFIGG+LVGG NE+M+
Sbjct  63   NPAVPAVFIGGQLVGGANEVMS  84



>emb|CDP12907.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   129 bits (325),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V R+ +E+PVV+FSKS+CC+SH I+ LL+  G NP VYELD  P+G+EIE AL  LG
Sbjct  1    MEAVRRLGSEKPVVIFSKSNCCISHAIKMLLSSFGANPTVYELDQHPKGQEIENALLALG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P+VPAVFIG   VGG +E+M+L++Q  LKP L +A A+W+
Sbjct  61   CHPSVPAVFIGKLFVGGSDEVMSLNVQGKLKPLLIKANAIWM  102



>emb|CDP03537.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   129 bits (325),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD ++R+ A++P+V+FSKSSCCM HTI++L+   G NP VYELD +P G ++E+AL   G
Sbjct  1    MDSITRLTADKPLVIFSKSSCCMCHTIKTLIRSFGANPTVYELDELPNGHQLERALVASG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
              P+VPAV+IG ELVGG NE+M+LH++  L P LK+A A+W+
Sbjct  61   RRPSVPAVYIGEELVGGANEVMSLHVKGKLVPLLKQAKAIWI  102



>ref|XP_006359425.1| PREDICTED: monothiol glutaredoxin-S2-like [Solanum tuberosum]
Length=102

 Score =   129 bits (325),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V +M AE+PVVMFSKS CCM HTI++L++  G N  VYELD +P G ++E+AL  LG
Sbjct  1    MESVKKMVAEKPVVMFSKSKCCMCHTIKTLISSFGANLTVYELDELPNGLQVERALLMLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
              P+VPAVFIG EL+GG NEIM+LHL+  L P L +A ALW+
Sbjct  61   RRPSVPAVFIGQELIGGANEIMSLHLEGNLVPLLMKAKALWL  102



>ref|XP_010243570.1| PREDICTED: glutaredoxin-C11-like [Nelumbo nucifera]
Length=102

 Score =   129 bits (324),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V ++A+++ VV+FSKSSCCM H I++L  D+GV+PA+YELD   +GRE+E+AL  LG
Sbjct  1    MDIVMKLASKKAVVIFSKSSCCMCHAIKTLFYDLGVSPAIYELDEEAKGREMERALQSLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
             NP+VPAVFIGG LV   + IM+LHL  +L P LK AGA+W+
Sbjct  61   LNPSVPAVFIGGRLVNSTSTIMSLHLCGSLVPMLKEAGAIWL  102



>ref|XP_006342768.1| PREDICTED: monothiol glutaredoxin-S10-like [Solanum tuberosum]
Length=102

 Score =   129 bits (324),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MDRV ++A+++ VV+FSKSSCCM H I+ L  + GV+P +YELD    GR++E++L RLG
Sbjct  1    MDRVVKIASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMIYELDEDMNGRDMERSLLRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VPAVFIGG  VG  N +MTLH+  +LK  LK AGALW+
Sbjct  61   CSPAVPAVFIGGRFVGSANTVMTLHINGSLKKMLKDAGALWL  102



>ref|XP_002321032.1| hypothetical protein POPTR_0014s12840g [Populus trichocarpa]
 gb|EEE99347.1| hypothetical protein POPTR_0014s12840g [Populus trichocarpa]
Length=102

 Score =   129 bits (324),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+ M  E+PVV+FSKSSCCMSH+I SL+   G NP +Y+LD IP G++IE+AL +LG
Sbjct  1    MDVVNVMIQEKPVVIFSKSSCCMSHSIESLMRGFGANPTIYQLDQIPNGQQIERALMQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
               +VPAVFIG +L+G E ++M+LH+Q  L P L +AGA+W+
Sbjct  61   FRQSVPAVFIGQQLIGNERQVMSLHIQNQLVPLLIQAGAIWI  102



>emb|CDP12908.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   129 bits (324),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V R+ +E+PVV+FSKS+CC+S+ I+ L++  G NP VYELD  P+GREIE AL  LG
Sbjct  1    METVRRLGSEKPVVIFSKSNCCISYAIKVLISSFGANPTVYELDHHPKGREIENALLTLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIG   VGG NE+M+L+++  LKP L  A A+W+
Sbjct  61   CNPSVPAVFIGKLFVGGSNEVMSLNVRGKLKPLLIEANAIWM  102



>ref|XP_002455626.1| hypothetical protein SORBIDRAFT_03g014800 [Sorghum bicolor]
 gb|EES00746.1| hypothetical protein SORBIDRAFT_03g014800 [Sorghum bicolor]
Length=103

 Score =   129 bits (324),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSR-L  157
            MDRV+++A++R VV+FS SSCCM HT+  L  ++GVNP V ELD  PRG+E+++AL+R L
Sbjct  1    MDRVTKLASQRAVVIFSTSSCCMCHTVTRLFRELGVNPTVVELDQDPRGKEMDKALARLL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            G NP VPAVFIGG LVG  + +M+LHL   L P L+ AGALWV
Sbjct  61   GRNPAVPAVFIGGRLVGSTDRVMSLHLSGNLVPLLRNAGALWV  103



>ref|XP_010413219.1| PREDICTED: monothiol glutaredoxin-S6 [Camelina sativa]
 ref|XP_010468905.1| PREDICTED: monothiol glutaredoxin-S6 [Camelina sativa]
Length=102

 Score =   129 bits (324),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V  + A++PVV+FSKSSCCMSH+I++L++  G    VYELD    G+EIE+AL ++G
Sbjct  1    MESVKSLVADKPVVIFSKSSCCMSHSIQTLISGFGAKMTVYELDQFSNGQEIEKALVQMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG +L+GG N++MTL ++  L   L+RAGA+WV
Sbjct  61   CKPSVPAVFIGQQLIGGANQVMTLQVKNQLAALLRRAGAIWV  102



>ref|XP_006359426.1| PREDICTED: monothiol glutaredoxin-S2-like [Solanum tuberosum]
Length=102

 Score =   129 bits (324),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V +M AE+PVVMFSK+ CCM HTI++L++  G N  VYELD +P G ++E+AL  LG
Sbjct  1    MESVKKMVAEKPVVMFSKNKCCMCHTIKTLISSFGANLTVYELDELPNGLQVERALLMLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
              P+VPAVFIG EL+GG NEIM+LHL+  L P L +A ALW+
Sbjct  61   LRPSVPAVFIGRELIGGANEIMSLHLEGNLVPLLMKAKALWL  102



>ref|XP_006389688.1| hypothetical protein POPTR_0020s00470g [Populus trichocarpa]
 gb|ERP48602.1| hypothetical protein POPTR_0020s00470g [Populus trichocarpa]
Length=102

 Score =   129 bits (324),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD ++ M  E+PVV+FSKSSCCMSH+I+SL+   G NP VYELD IP G++IE+AL +LG
Sbjct  1    MDVLNVMIQEKPVVIFSKSSCCMSHSIKSLIRGFGANPTVYELDRIPNGQQIERALVQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
               +VPAVFIG  LVG E ++M+LH+Q  L P L +AGA+W+
Sbjct  61   FGQSVPAVFIGQRLVGNERQVMSLHVQNQLVPLLIQAGAIWI  102



>ref|XP_010512690.1| PREDICTED: monothiol glutaredoxin-S6-like [Camelina sativa]
Length=102

 Score =   129 bits (323),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ V  + A++PVV+FSKSSCCMSH+I++L++  G    VYELD    G+EIE+AL ++G
Sbjct  1    MESVKSLVADKPVVIFSKSSCCMSHSIQTLISGFGAKMTVYELDKFSNGQEIEKALVQMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG +L+GG N++MTL ++  L   L+RAGA+WV
Sbjct  61   CKPSVPAVFIGQQLIGGANQVMTLQVKNQLAALLRRAGAIWV  102



>emb|CDY25124.1| BnaC06g18660D [Brassica napus]
Length=102

 Score =   129 bits (323),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +  + A+ PVV+FSKS+CCMSH+I++L++  G    VYELD +  G+E+E+AL ++G
Sbjct  1    MESIRSLVADNPVVIFSKSTCCMSHSIQTLISGFGAKMTVYELDQLSNGQEMEKALKQMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIG +L+GG N++MTL ++  L   LKRAGA+WV
Sbjct  61   CNPSVPAVFIGEQLIGGANQVMTLQVKNQLAALLKRAGAIWV  102



>emb|CDO98899.1| unnamed protein product [Coffea canephora]
Length=102

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD + ++A+++ VV+FSKSSCCM H I+ L  + GV+P +YE+D I  G EIE AL RLG
Sbjct  1    MDSIVKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMIYEIDQISNGTEIEWALIRLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+VPAVFIGG  VG  + +MTL +  +LK  LK AGALW+
Sbjct  61   CNPSVPAVFIGGNFVGSASTVMTLQINGSLKKMLKGAGALWL  102



>ref|XP_006303520.1| hypothetical protein CARUB_v10010921mg [Capsella rubella]
 gb|EOA36418.1| hypothetical protein CARUB_v10010921mg [Capsella rubella]
Length=102

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++S +  ++PVV+FSK+SCCMSHTI+SL++  G N  VYELD +  G E+E+AL  LG
Sbjct  1    MEKISNLLEDKPVVIFSKTSCCMSHTIKSLISGYGANSTVYELDEMSNGPEVERALVELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVPAVFIG +LVGG N++M+L ++  L   L+RAGA+W+
Sbjct  61   CKPTVPAVFIGQQLVGGANQLMSLQVRNQLGSLLRRAGAIWI  102



>ref|NP_001043047.1| Os01g0368900 [Oryza sativa Japonica Group]
 sp|Q7G8Y5.1|GRXC1_ORYSJ RecName: Full=Glutaredoxin-C1 [Oryza sativa Japonica Group]
 gb|AAK53837.1|AC011806_14 Putative glutaredoxin [Oryza sativa]
 dbj|BAB64731.1| glutaredoxin-like protein [Oryza sativa Japonica Group]
 dbj|BAB64761.1| P0560B06.28 [Oryza sativa Japonica Group]
 dbj|BAD88356.1| glutaredoxin-like protein [Oryza sativa Japonica Group]
 dbj|BAD89485.1| putative glutaredoxin 1 [Oryza sativa Japonica Group]
 dbj|BAF04961.1| Os01g0368900 [Oryza sativa Japonica Group]
 gb|EAY74062.1| hypothetical protein OsI_01950 [Oryza sativa Indica Group]
 gb|EAZ11913.1| hypothetical protein OsJ_01785 [Oryza sativa Japonica Group]
Length=103

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSR-L  157
            MDRV+R+AA+R VV+FS SSCCM HT+  L  ++GVNP V ELD  PRG+E+E+AL+R L
Sbjct  1    MDRVNRLAAQRAVVIFSMSSCCMCHTVTRLFCELGVNPTVVELDEDPRGKEMEKALARLL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            G +P VPAVFIGG LVG  +++M+LHL   L P L+ AGALWV
Sbjct  61   GRSPAVPAVFIGGRLVGSTDKVMSLHLSGNLVPLLRNAGALWV  103



>ref|XP_009624458.1| PREDICTED: monothiol glutaredoxin-S6-like [Nicotiana tomentosiformis]
Length=102

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V ++ A  PVV+FSKSSCC+SH+I +L+   G NP VYELD    G++IE+AL+ LG
Sbjct  1    MDMVMKLGATSPVVIFSKSSCCISHSIETLIRSFGANPTVYELDRHSNGKQIEKALTELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG E +GG NEIM+L+++  LK  L RA A+WV
Sbjct  61   CQPSVPAVFIGNEFIGGSNEIMSLNVRGKLKHLLIRANAIWV  102



>ref|XP_009603211.1| PREDICTED: monothiol glutaredoxin-S6-like [Nicotiana tomentosiformis]
Length=102

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+  E PVV+FSKS+CCMSH+I +L+ + G NP VY+LD +P+G+++E+AL  +G
Sbjct  1    MDAVNRLGEESPVVIFSKSNCCMSHSIETLIRNFGANPTVYKLDELPKGKKMEKALIEMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            CNP+ PA+FIG E VGG +E+M+L+++  LK  L  A A+W+
Sbjct  61   CNPSTPAIFIGKEFVGGSDEVMSLNVKGKLKELLINANAIWI  102



>ref|XP_011013688.1| PREDICTED: monothiol glutaredoxin-S1-like [Populus euphratica]
Length=102

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD +  M  E+PVV+FSKSSCCMSH+I+SL+   G NP VYELD IP G++IE+AL +LG
Sbjct  1    MDVLDVMIQEKPVVIFSKSSCCMSHSIKSLIRGFGANPTVYELDRIPNGQQIERALVQLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
               +VPAVFIG  LVG E ++M+LH+Q  L P L +AGA+W+
Sbjct  61   FGQSVPAVFIGQRLVGNERQVMSLHVQNQLVPLLIQAGAIWI  102



>ref|XP_009598903.1| PREDICTED: monothiol glutaredoxin-S1-like [Nicotiana tomentosiformis]
Length=102

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V ++ AE PVV+FSKS+CCMSH+I +L+   G NP VYELD +P GR++E AL  LG
Sbjct  1    MDMVMKLGAESPVVIFSKSTCCMSHSIETLIRGFGANPTVYELDKLPTGRQMENALVELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C  +VPAVFIG + VGG NEIM+L+++  LK  L RA A+W+
Sbjct  61   CQLSVPAVFIGKDFVGGSNEIMSLNVRGKLKQLLLRANAIWI  102



>ref|XP_009116959.1| PREDICTED: monothiol glutaredoxin-S6 [Brassica rapa]
 emb|CDY11462.1| BnaA09g40280D [Brassica napus]
Length=102

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +  + A++PVV+FSKSSCCMSH+I++L++  G    VYELD +  G+EIE+AL ++G
Sbjct  1    MESIRSLVADKPVVLFSKSSCCMSHSIQTLISGFGAKMTVYELDQLSNGKEIEKALVQMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG +L+GG N++MTL ++  L   L+RAGA+WV
Sbjct  61   CKPSVPAVFIGEQLIGGANQVMTLQVKNQLAALLRRAGAIWV  102



>emb|CDY32430.1| BnaC03g42140D [Brassica napus]
Length=102

 Score =   129 bits (323),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+A++  VV+FSKS+CCMSH I+ L  + GV+PA+ E+D    G++IE+AL+RLG
Sbjct  1    MDVVARLASQSAVVIFSKSTCCMSHAIKCLFYEQGVSPAIVEIDQYMYGKDIERALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VP VFIGG+LVG    +MTLHL  +LK  LK AGALW+
Sbjct  61   CSPQVPVVFIGGKLVGTATTVMTLHLDGSLKRLLKEAGALWL  102



>ref|XP_009384168.1| PREDICTED: putative glutaredoxin-C14 [Musa acuminata subsp. malaccensis]
Length=103

 Score =   129 bits (323),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRL-  157
            MD+V +MA++R VV+FS SSCCM HT+ SL +D+GVN  ++ELD  PRGRE+E+AL+RL 
Sbjct  1    MDKVMKMASQRAVVVFSLSSCCMCHTVLSLFHDLGVNATIHELDEDPRGREMERALARLV  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            G NP VP VFIGG+LVG  + IM+LHL   L P L+ AGALWV
Sbjct  61   GRNPPVPVVFIGGKLVGSTDRIMSLHLGGKLVPLLREAGALWV  103



>ref|XP_004247454.1| PREDICTED: monothiol glutaredoxin-S2-like [Solanum lycopersicum]
Length=102

 Score =   128 bits (322),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ + +M AE+PVVMFSKS CCM HTI++L++  G N  VYELD +P G ++E+AL  LG
Sbjct  1    MESLKKMVAEKPVVMFSKSKCCMCHTIKTLISSFGANLTVYELDELPNGLQVERALLMLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
              P+VPAVFIG EL+GG NEIM+LHL+  L P L +A ALW+
Sbjct  61   RRPSVPAVFIGQELIGGANEIMSLHLEGNLVPLLMKAKALWL  102



>ref|XP_009757078.1| PREDICTED: monothiol glutaredoxin-S1-like [Nicotiana sylvestris]
Length=102

 Score =   128 bits (322),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V ++ AE PVV+FSK+SCCMSH+I +L+   G NP VYELD +P GR++E AL  LG
Sbjct  1    MDMVMKLGAESPVVIFSKTSCCMSHSIETLIRGFGANPTVYELDKLPNGRQMENALIELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C  +VPAVFIG + VGG NEIM+L+++  LK  L RA A+W+
Sbjct  61   CQLSVPAVFIGKDFVGGSNEIMSLNVRGELKQLLLRANAIWI  102



>ref|XP_009624459.1| PREDICTED: monothiol glutaredoxin-S6-like [Nicotiana tomentosiformis]
Length=102

 Score =   128 bits (322),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V ++ A  PVV+F+KSSCC+SH+I +L+   G NP VYELD  P G+++E+AL  LG
Sbjct  1    MDMVMKLGATSPVVIFTKSSCCISHSIETLIRSFGANPTVYELDRHPNGKQMEKALIELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVF+G E +GG NEIM+L+++  LK  L RA A+WV
Sbjct  61   CQPSVPAVFVGNEFIGGSNEIMSLNVRSKLKQLLMRANAIWV  102



>ref|XP_009761795.1| PREDICTED: monothiol glutaredoxin-S6-like [Nicotiana sylvestris]
Length=102

 Score =   128 bits (322),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V ++ AE PVV+FSKS+CCMSH+I +L+   G NP VYELD +P GR++E AL  LG
Sbjct  1    MDMVMKLGAESPVVIFSKSTCCMSHSIETLIRGFGANPTVYELDKLPNGRQMENALVELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C  +VPAVFIG   VGG NEIM+L+++  LK  L RA A+W+
Sbjct  61   CQLSVPAVFIGKNFVGGSNEIMSLNVRGKLKQLLLRANAIWI  102



>gb|KFK35469.1| hypothetical protein AALP_AA5G288100 [Arabis alpina]
Length=102

 Score =   128 bits (321),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +  +  ++PVV+FSKSSCCMSH+I++L++  G    VYELD    G+EIE+AL R+G
Sbjct  1    MESIRSLVEDKPVVIFSKSSCCMSHSIQTLISGFGAKMTVYELDQFSNGQEIEKALVRMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG +L+GG NEIMTL ++  L   L+RAGA+WV
Sbjct  61   CKPSVPAVFIGQQLIGGANEIMTLQVKNQLAVLLRRAGAIWV  102



>emb|CDX76675.1| BnaC08g32610D [Brassica napus]
Length=102

 Score =   128 bits (321),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +  + A++PVV+FSKSSCCMSH+I++L++  G    VYELD +  G+EIE+AL ++G
Sbjct  1    MESIRSLVADKPVVVFSKSSCCMSHSIQTLISGFGAKMTVYELDQLSNGKEIEKALVQMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG +L+GG N++MTL ++  L   L+RAGA+WV
Sbjct  61   CKPSVPAVFIGEQLIGGANQVMTLQVKNQLAALLRRAGAIWV  102



>ref|XP_006290445.1| hypothetical protein CARUB_v10019414mg [Capsella rubella]
 gb|EOA23343.1| hypothetical protein CARUB_v10019414mg [Capsella rubella]
Length=102

 Score =   128 bits (321),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+ +  + A++PVV+FSKSSCCMSH+I++L++  G    VYELD +  G+EIE+AL ++G
Sbjct  1    MESIRSLVADKPVVVFSKSSCCMSHSIQTLISGFGAKMTVYELDQLSNGQEIEKALVQMG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPAVFIG +L+GG N++MTL ++  L   L+RAGA+WV
Sbjct  61   CKPSVPAVFIGQQLIGGANQVMTLQVKNQLAALLRRAGAIWV  102



>ref|XP_010545040.1| PREDICTED: monothiol glutaredoxin-S6 [Tarenaya hassleriana]
Length=103

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQAL-SRL  157
            M+ +  + AE+PVV+FS+SSCCMSH+I+SL++  G N  VYELD +  G+EIE+AL S+L
Sbjct  1    MESIRGLVAEKPVVVFSRSSCCMSHSIQSLISGYGANVTVYELDQMSNGQEIEKALSSQL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GC PTVPAVFI  +LVGG N++M+L ++  L P L++AGA+W+
Sbjct  61   GCKPTVPAVFIAQQLVGGANQVMSLQVKNQLAPLLRKAGAIWI  103



>emb|CDY18141.1| BnaC05g01640D [Brassica napus]
Length=102

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            M+++S +  ++PVV+FSK+SCCMSHTI+ L++  G NP VYELD +  G EIE+AL  LG
Sbjct  1    MEKISNLLEDKPVVIFSKTSCCMSHTIKLLISGYGANPTVYELDEMSNGPEIERALVELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C PTVPAVFIG +L GG N++M+L ++  L   L+RAGA+W+
Sbjct  61   CKPTVPAVFIGQQLTGGANQLMSLQVRNQLGALLRRAGAIWI  102



>ref|XP_009761870.1| PREDICTED: monothiol glutaredoxin-S1-like [Nicotiana sylvestris]
Length=102

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V ++ A  PVV+FSKSSCC+SH+I +L+   G NP  YELD  P G+++E+AL  LG
Sbjct  1    MDMVMKLGAISPVVIFSKSSCCISHSIETLIRSFGANPTAYELDRHPNGKQMEKALIELG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C P+VPA+FIG ELVGG NEIM+L+++  LK  L RA A+WV
Sbjct  61   CQPSVPAIFIGNELVGGSNEIMSLNVRSKLKQLLIRANAIWV  102



>ref|XP_008458480.1| PREDICTED: monothiol glutaredoxin-S10 [Cucumis melo]
Length=103

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSR-L  157
            MD V++MAA++ VV+F+KS+CCM H I  L  D G +P ++ELD   RG+E+E ALS+ L
Sbjct  1    MDLVAKMAAKKAVVIFTKSTCCMCHAIERLFYDQGASPEIHELDRESRGKEMESALSKTL  60

Query  156  GCNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            GC+PTVP VFIGG+L+G  N +MTLHL  +LK  LK AGA+W+
Sbjct  61   GCSPTVPVVFIGGKLIGSANTVMTLHLNGSLKKLLKEAGAIWL  103



>ref|XP_009135749.1| PREDICTED: monothiol glutaredoxin-S10-like [Brassica rapa]
 emb|CDY48890.1| BnaA03g36290D [Brassica napus]
Length=102

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  333  MDRVSRMAAERPVVMFSKSSCCMSHTIRSLLNDMGVNPAVYELDVIPRGREIEQALSRLG  154
            MD V+R+A++  VV+FSKS+CCMSH I+ L  + GV+PA+ E+D    G++IE+AL+RLG
Sbjct  1    MDVVARLASQSAVVIFSKSTCCMSHAIKCLFYEQGVSPAIVEIDQYMYGKDIERALARLG  60

Query  153  CNPTVPAVFIGGELVGGENEIMTLHLQQALKPKLKRAGALWV  28
            C+P VP VFIGG+L+G    +MTLHL   LK  LK AGALW+
Sbjct  61   CSPQVPVVFIGGKLIGTATTVMTLHLDGTLKRLLKEAGALWL  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516943081458