BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82462_g1_i1 len=772 path=[1:0-771]

Length=772
                                                                      Score     E

ref|XP_006365577.1|  PREDICTED: uncharacterized protein LOC102595643    221   4e-68   
ref|XP_010275059.1|  PREDICTED: uncharacterized protein LOC104610232    213   1e-65   
ref|XP_008225460.1|  PREDICTED: uncharacterized protein LOC103325105    207   9e-63   
gb|KDP37957.1|  hypothetical protein JCGZ_04600                         205   4e-62   
ref|XP_002519702.1|  conserved hypothetical protein                     203   4e-61   Ricinus communis
ref|XP_010111003.1|  BON1-associated protein 2                          181   6e-53   
ref|XP_007213255.1|  hypothetical protein PRUPE_ppb020632mg             176   3e-51   
ref|XP_007025109.1|  Uncharacterized protein TCM_029510                 152   1e-42   
gb|AEW08214.1|  hypothetical protein 2_3193_01                          136   5e-36   
gb|AFG52320.1|  hypothetical protein 2_3193_01                          135   7e-36   
gb|AFG52315.1|  hypothetical protein 2_3193_01                          134   2e-35   
gb|ABK22654.1|  unknown                                                 136   3e-35   Picea sitchensis
gb|ABK23345.1|  unknown                                                 125   4e-31   Picea sitchensis
gb|ABK24127.1|  unknown                                                 111   4e-26   Picea sitchensis
ref|XP_002967740.1|  hypothetical protein SELMODRAFT_408999           92.4    1e-18   
ref|XP_002992362.1|  hypothetical protein SELMODRAFT_430579           91.7    2e-18   
ref|XP_006339653.1|  PREDICTED: uncharacterized protein LOC102592387  82.4    3e-15   
ref|XP_004229965.1|  PREDICTED: BON1-associated protein 2             80.9    1e-14   
ref|XP_009591358.1|  PREDICTED: uncharacterized protein LOC104088405  78.6    5e-14   
gb|EPS68074.1|  hypothetical protein M569_06693                       77.4    1e-13   
emb|CDP08734.1|  unnamed protein product                              77.4    2e-13   
ref|XP_009764572.1|  PREDICTED: uncharacterized protein LOC104216252  76.6    3e-13   
ref|XP_007051663.1|  Calcium-dependent lipid-binding family prote...  75.9    6e-13   
gb|EYU39518.1|  hypothetical protein MIMGU_mgv1a007478mg              77.4    7e-13   
ref|XP_008233233.1|  PREDICTED: uncharacterized protein LOC103332288  75.1    1e-12   
gb|ABR18223.1|  unknown                                               75.5    1e-12   Picea sitchensis
ref|XP_006842901.1|  hypothetical protein AMTR_s00075p00073210        75.9    2e-12   
gb|ABR17336.1|  unknown                                               74.7    2e-12   Picea sitchensis
ref|XP_007145354.1|  hypothetical protein PHAVU_007G232100g           75.9    2e-12   
ref|XP_010043310.1|  PREDICTED: uncharacterized protein LOC104432551  75.1    3e-12   
gb|KCW85316.1|  hypothetical protein EUGRSUZ_B02156                   75.1    3e-12   
emb|CDP17419.1|  unnamed protein product                              73.9    3e-12   
emb|CDP04278.1|  unnamed protein product                              74.7    4e-12   
gb|ACN40336.1|  unknown                                               73.6    5e-12   Picea sitchensis
ref|XP_006444911.1|  hypothetical protein CICLE_v10021815mg           72.8    5e-12   
gb|KDO86360.1|  hypothetical protein CISIN_1g047341mg                 72.8    5e-12   
ref|XP_011077059.1|  PREDICTED: uncharacterized protein LOC105161156  74.3    6e-12   
ref|XP_007218843.1|  hypothetical protein PRUPE_ppa010336mg           72.4    8e-12   
gb|KDP23730.1|  hypothetical protein JCGZ_23563                       73.9    8e-12   
ref|XP_002964639.1|  hypothetical protein SELMODRAFT_406042           70.9    1e-11   
gb|KFK31057.1|  hypothetical protein AALP_AA6G062700                  73.2    1e-11   
ref|XP_002989504.1|  hypothetical protein SELMODRAFT_428112           70.1    2e-11   
ref|XP_009141305.1|  PREDICTED: uncharacterized protein LOC103865261  73.6    2e-11   
ref|XP_006293875.1|  hypothetical protein CARUB_v10022860mg           73.2    2e-11   
emb|CDY37732.1|  BnaA04g19360D                                        73.2    2e-11   
ref|XP_002881275.1|  C2 domain-containing protein                     73.2    2e-11   
ref|XP_006410470.1|  hypothetical protein EUTSA_v10016412mg           73.2    2e-11   
ref|XP_010456220.1|  PREDICTED: BON1-associated protein 2-like        70.9    3e-11   
ref|XP_009377282.1|  PREDICTED: BON1-associated protein 2             70.1    3e-11   
ref|XP_002276427.1|  PREDICTED: uncharacterized protein LOC100258448  70.9    3e-11   Vitis vinifera
emb|CDM83636.1|  unnamed protein product                              71.6    5e-11   
ref|XP_009350266.1|  PREDICTED: uncharacterized protein LOC103941795  70.5    5e-11   
ref|XP_001782058.1|  predicted protein                                70.1    6e-11   
ref|XP_009411685.1|  PREDICTED: ingression protein fic1-like          70.1    8e-11   
ref|XP_001765335.1|  predicted protein                                67.8    8e-11   
ref|NP_192029.1|  calcium-dependent lipid-binding domain-containi...  69.3    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669605.1|  PREDICTED: uncharacterized protein LOC104886787  69.7    8e-11   
ref|XP_010427687.1|  PREDICTED: BON1-associated protein 2-like        69.3    1e-10   
ref|XP_002521996.1|  conserved hypothetical protein                   70.9    1e-10   Ricinus communis
ref|XP_011077131.1|  PREDICTED: uncharacterized protein LOC105161211  70.5    1e-10   
ref|XP_001758594.1|  predicted protein                                68.6    1e-10   
gb|EYU38921.1|  hypothetical protein MIMGU_mgv1a022778mg              68.9    1e-10   
ref|XP_011093241.1|  PREDICTED: uncharacterized protein LOC105173247  69.3    1e-10   
emb|CDY23753.1|  BnaC04g43690D                                        70.9    1e-10   
ref|XP_003556915.1|  PREDICTED: uncharacterized protein LOC100779058  70.5    1e-10   
ref|XP_002968005.1|  hypothetical protein SELMODRAFT_440190           68.2    1e-10   
ref|XP_004497792.1|  PREDICTED: uncharacterized protein LOC101505544  70.5    1e-10   
ref|XP_009347863.1|  PREDICTED: uncharacterized protein LOC103939495  69.3    1e-10   
ref|XP_004308328.1|  PREDICTED: uncharacterized protein LOC101301728  69.3    2e-10   
ref|XP_011093070.1|  PREDICTED: uncharacterized protein LOC105173112  68.6    2e-10   
gb|KDP28538.1|  hypothetical protein JCGZ_14309                       68.6    2e-10   
ref|NP_180890.1|  calcium-dependent lipid-binding domain-containi...  70.1    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872904.1|  C2 domain-containing protein                     68.2    2e-10   
ref|XP_006342681.1|  PREDICTED: uncharacterized protein LOC102596842  69.7    3e-10   
ref|XP_008441789.1|  PREDICTED: uncharacterized protein LOC103485843  69.3    3e-10   
ref|XP_006289671.1|  hypothetical protein CARUB_v10003230mg           67.8    3e-10   
ref|XP_002511946.1|  conserved hypothetical protein                   68.2    3e-10   Ricinus communis
ref|XP_006855523.1|  hypothetical protein AMTR_s00057p00209740        68.6    3e-10   
ref|XP_010251574.1|  PREDICTED: uncharacterized protein LOC104593437  68.2    3e-10   
ref|XP_010413889.1|  PREDICTED: uncharacterized protein LOC104700118  69.7    3e-10   
ref|XP_009111426.1|  PREDICTED: uncharacterized protein LOC103836878  67.8    3e-10   
ref|XP_010556931.1|  PREDICTED: uncharacterized protein LOC104826097  69.3    3e-10   
ref|XP_010025828.1|  PREDICTED: uncharacterized protein LOC104416088  66.2    3e-10   
ref|XP_003590193.1|  hypothetical protein MTR_1g045780                69.3    4e-10   
ref|XP_010422779.1|  PREDICTED: BON1-associated protein 2-like        67.8    4e-10   
ref|XP_004495257.1|  PREDICTED: proteoglycan 4-like                   69.3    4e-10   
ref|XP_010469493.1|  PREDICTED: uncharacterized protein LOC104749540  69.3    4e-10   
ref|XP_010558947.1|  PREDICTED: uncharacterized protein LOC104827473  68.9    4e-10   
ref|XP_010509905.1|  PREDICTED: serine/arginine repetitive matrix...  69.3    4e-10   
ref|XP_006396291.1|  hypothetical protein EUTSA_v10028892mg           67.8    4e-10   
ref|XP_004297932.1|  PREDICTED: uncharacterized protein LOC101311957  68.9    4e-10   
ref|XP_004253020.1|  PREDICTED: uncharacterized protein LOC101244358  68.9    4e-10   
dbj|BAJ85055.1|  predicted protein                                    68.6    4e-10   
ref|XP_004133823.1|  PREDICTED: uncharacterized protein LOC101212280  67.8    5e-10   
gb|EYU43768.1|  hypothetical protein MIMGU_mgv1a006114mg              68.9    5e-10   
ref|XP_006418119.1|  hypothetical protein EUTSA_v10007144mg           68.9    5e-10   
ref|XP_007035276.1|  Calcium-dependent lipid-binding family prote...  68.9    5e-10   
ref|XP_008362824.1|  PREDICTED: uncharacterized protein LOC103426513  67.4    6e-10   
ref|XP_001782642.1|  predicted protein                                67.4    6e-10   
ref|XP_001778275.1|  predicted protein                                66.2    8e-10   
emb|CDP04279.1|  unnamed protein product                              67.8    8e-10   
emb|CDY53195.1|  BnaAnng12200D                                        68.2    9e-10   
emb|CDY59181.1|  BnaC08g50140D                                        68.2    1e-09   
ref|XP_009604695.1|  PREDICTED: uncharacterized protein LOC104099416  68.2    1e-09   
ref|XP_009118638.1|  PREDICTED: uncharacterized protein LOC103843645  68.2    1e-09   
ref|XP_004152866.1|  PREDICTED: uncharacterized protein LOC101218582  67.8    1e-09   
ref|XP_010522448.1|  PREDICTED: uncharacterized protein LOC104801063  68.2    1e-09   
ref|XP_002272904.1|  PREDICTED: cytokinesis protein sepA-like         66.6    1e-09   Vitis vinifera
ref|XP_004247791.2|  PREDICTED: uncharacterized protein LOC101245204  67.4    1e-09   
ref|XP_009143873.1|  PREDICTED: uncharacterized protein LOC103867544  67.4    1e-09   
ref|XP_004155136.1|  PREDICTED: uncharacterized protein LOC101227028  67.0    2e-09   
emb|CDM83573.1|  unnamed protein product                              66.6    2e-09   
ref|XP_010557577.1|  PREDICTED: uncharacterized protein LOC104826528  67.0    2e-09   
emb|CDY18242.1|  BnaC05g02650D                                        67.0    2e-09   
ref|XP_010090794.1|  16 kDa phloem protein 2                          65.9    2e-09   
gb|KFK42792.1|  hypothetical protein AALP_AA1G039700                  67.0    2e-09   
ref|XP_011091348.1|  PREDICTED: uncharacterized protein LOC105171810  67.0    2e-09   
ref|XP_008437926.1|  PREDICTED: uncharacterized protein LOC103483209  65.9    2e-09   
ref|XP_001756871.1|  predicted protein                                66.2    2e-09   
ref|XP_009795412.1|  PREDICTED: uncharacterized protein LOC104242110  67.0    2e-09   
emb|CDY48509.1|  BnaA09g00140D                                        67.4    2e-09   
emb|CDX74290.1|  BnaA03g27570D                                        64.3    3e-09   
gb|KDP46959.1|  hypothetical protein JCGZ_07976                       65.9    3e-09   
ref|XP_002314508.1|  C2 domain-containing family protein              66.6    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_002325345.1|  hypothetical protein POPTR_0019s03780g           66.2    3e-09   Populus trichocarpa [western balsam poplar]
gb|KDO41882.1|  hypothetical protein CISIN_1g041258mg                 66.6    3e-09   
ref|XP_010667096.1|  PREDICTED: uncharacterized protein LOC104884184  66.6    3e-09   
ref|XP_006489752.1|  PREDICTED: uncharacterized protein DDB_G0271...  66.6    3e-09   
gb|KCW57324.1|  hypothetical protein EUGRSUZ_H00123                   66.2    3e-09   
ref|XP_003590735.1|  RNA-binding protein 12B                          66.6    3e-09   
ref|XP_010025827.1|  PREDICTED: uncharacterized protein LOC104416087  66.2    3e-09   
ref|XP_009135963.1|  PREDICTED: uncharacterized protein LOC103860112  63.9    4e-09   
ref|XP_011069440.1|  PREDICTED: uncharacterized protein LOC105155266  65.9    4e-09   
ref|XP_007147256.1|  hypothetical protein PHAVU_006G109100g           64.7    4e-09   
ref|XP_003569491.1|  PREDICTED: uncharacterized protein LOC100842238  65.5    4e-09   
ref|XP_009383915.1|  PREDICTED: BON1-associated protein 2-like        64.7    4e-09   
ref|XP_008224037.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.9    5e-09   
ref|XP_009792812.1|  PREDICTED: uncharacterized protein LOC104239795  65.9    5e-09   
ref|XP_004304780.1|  PREDICTED: uncharacterized protein LOC101296310  65.9    5e-09   
ref|XP_006358324.1|  PREDICTED: uncharacterized protein LOC102592049  65.5    5e-09   
ref|XP_010105208.1|  hypothetical protein L484_011265                 65.9    5e-09   
ref|XP_010544424.1|  PREDICTED: uncharacterized protein LOC104817045  64.7    5e-09   
ref|XP_011036375.1|  PREDICTED: uncharacterized protein LOC105133911  65.5    5e-09   
ref|XP_011023248.1|  PREDICTED: uncharacterized protein LOC105124808  64.7    6e-09   
ref|XP_002311697.2|  C2 domain-containing family protein              65.9    6e-09   Populus trichocarpa [western balsam poplar]
gb|KDO53064.1|  hypothetical protein CISIN_1g035970mg                 65.5    6e-09   
ref|XP_006437469.1|  hypothetical protein CICLE_v10033675mg           65.5    6e-09   
ref|NP_001043768.1|  Os01g0659800                                     64.7    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002301388.2|  hypothetical protein POPTR_0002s16800g           63.9    7e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004508275.1|  PREDICTED: uncharacterized protein LOC101495376  63.5    7e-09   
ref|XP_002872084.1|  hypothetical protein ARALYDRAFT_910412           63.9    8e-09   
ref|XP_006577334.1|  PREDICTED: BON1-associated protein 2-like        63.2    8e-09   
ref|XP_010485810.1|  PREDICTED: putative lysozyme-like protein        65.1    8e-09   
tpg|DAA55958.1|  TPA: hypothetical protein ZEAMMB73_567157            64.7    9e-09   
ref|XP_004494776.1|  PREDICTED: uncharacterized protein LOC101496947  63.9    9e-09   
emb|CDY07180.1|  BnaCnng01950D                                        65.5    9e-09   
ref|XP_002319115.2|  hypothetical protein POPTR_0013s04590g           65.1    9e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010055064.1|  PREDICTED: uncharacterized protein LOC104443389  63.9    9e-09   
gb|KDP27783.1|  hypothetical protein JCGZ_18863                       64.7    9e-09   
ref|XP_010060582.1|  PREDICTED: uncharacterized protein LOC104448451  64.3    9e-09   
ref|XP_011029742.1|  PREDICTED: uncharacterized protein LOC105129399  65.1    9e-09   
ref|XP_009625035.1|  PREDICTED: uncharacterized protein LOC104115988  65.1    9e-09   
ref|XP_010463915.1|  PREDICTED: uncharacterized protein LOC104744544  65.1    9e-09   
ref|XP_011038591.1|  PREDICTED: uncharacterized protein LOC105135426  64.7    9e-09   
ref|XP_006645033.1|  PREDICTED: protein enabled homolog               64.7    1e-08   
ref|XP_010550541.1|  PREDICTED: uncharacterized protein LOC104821382  63.9    1e-08   
ref|XP_004985379.1|  PREDICTED: uncharacterized protein LOC101774...  64.3    1e-08   
gb|KCW90655.1|  hypothetical protein EUGRSUZ_A02756                   64.3    1e-08   
ref|XP_010025284.1|  PREDICTED: uncharacterized protein LOC104415652  62.8    1e-08   
ref|XP_008366882.1|  PREDICTED: uncharacterized protein LOC103430513  64.7    1e-08   
ref|XP_002315561.1|  shock protein SRC2                               63.9    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009804994.1|  PREDICTED: uncharacterized protein DDB_G0292...  64.7    1e-08   
ref|XP_006297897.1|  hypothetical protein CARUB_v10013938mg           64.3    1e-08   
ref|XP_007226487.1|  hypothetical protein PRUPE_ppa026634mg           64.7    1e-08   
ref|XP_009119477.1|  PREDICTED: uncharacterized protein LOC103844449  64.7    1e-08   
ref|XP_004985378.1|  PREDICTED: uncharacterized protein LOC101774...  63.9    1e-08   
ref|XP_006303752.1|  hypothetical protein CARUB_v10011922mg           64.7    1e-08   
ref|XP_010483923.1|  PREDICTED: uncharacterized protein LOC104762347  64.7    1e-08   
ref|XP_002889512.1|  hypothetical protein ARALYDRAFT_470434           64.7    1e-08   
gb|AAB80639.1|  Contains similarity to Glycine SRC2 (gb|AB000130)     64.7    1e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDO99320.1|  unnamed protein product                              64.3    2e-08   
ref|XP_006420366.1|  hypothetical protein CICLE_v10006849mg           64.3    2e-08   
emb|CDX81442.1|  BnaC09g08530D                                        64.3    2e-08   
ref|NP_171948.1|  calcium-dependent lipid-binding domain-containi...  64.3    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385178.1|  PREDICTED: uncharacterized protein LOC103972545  63.9    2e-08   
emb|CDY37207.1|  BnaA09g08280D                                        64.3    2e-08   
ref|XP_009112245.1|  PREDICTED: uncharacterized protein LOC103837642  64.3    2e-08   
emb|CDY37206.1|  BnaA09g08270D                                        64.3    2e-08   
ref|XP_003555498.1|  PREDICTED: uncharacterized protein LOC100812185  64.3    2e-08   
emb|CDY72474.1|  BnaCnng77840D                                        62.4    2e-08   
ref|XP_002884443.1|  hypothetical protein ARALYDRAFT_477695           63.9    2e-08   
ref|XP_011041447.1|  PREDICTED: uncharacterized protein LOC105137420  64.3    2e-08   
ref|XP_008388740.1|  PREDICTED: uncharacterized protein LOC103451084  63.9    2e-08   
ref|XP_010457504.1|  PREDICTED: uncharacterized protein LOC104738975  64.3    2e-08   
ref|XP_003564634.1|  PREDICTED: leucine-rich repeat extensin-like...  63.9    2e-08   
ref|XP_008798687.1|  PREDICTED: uncharacterized protein LOC103713510  62.8    2e-08   
ref|XP_007030351.1|  Calcium-dependent lipid-binding (CaLB domain...  63.9    2e-08   
gb|AAM67146.1|  unknown                                               63.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAF26778.1|AC016829_2  hypothetical protein                        63.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|EAY76529.1|  hypothetical protein OsI_04471                        63.5    3e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001044834.1|  Os01g0853800                                     63.5    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006300066.1|  hypothetical protein CARUB_v10016294mg           63.5    3e-08   
emb|CDX92066.1|  BnaC03g33680D                                        63.5    3e-08   
ref|XP_008218351.1|  PREDICTED: uncharacterized protein LOC103318712  63.5    3e-08   
ref|XP_009134757.1|  PREDICTED: uncharacterized protein LOC103859027  63.5    3e-08   
emb|CDX87149.1|  BnaC09g04640D                                        62.0    3e-08   
ref|XP_002885870.1|  hypothetical protein ARALYDRAFT_480303           63.5    3e-08   
ref|XP_007205372.1|  hypothetical protein PRUPE_ppa007276mg           63.5    3e-08   
ref|NP_178968.1|  C2 domain-containing protein                        63.5    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008340669.1|  PREDICTED: uncharacterized protein LOC103403599  63.5    4e-08   
ref|XP_010269468.1|  PREDICTED: abl interactor homolog                62.4    4e-08   
ref|XP_010475114.1|  PREDICTED: uncharacterized protein LOC104754591  63.2    4e-08   
ref|XP_009136211.1|  PREDICTED: uncharacterized protein LOC103860372  63.2    4e-08   
emb|CDX89605.1|  BnaC03g45190D                                        63.2    4e-08   
ref|XP_006408192.1|  hypothetical protein EUTSA_v10020890mg           63.2    4e-08   
ref|XP_003553776.1|  PREDICTED: uncharacterized protein LOC100793541  62.0    4e-08   
ref|XP_010467176.1|  PREDICTED: uncharacterized protein LOC104747266  63.2    4e-08   
ref|XP_010518533.1|  PREDICTED: uncharacterized protein LOC104793798  63.2    4e-08   
ref|XP_010488836.1|  PREDICTED: uncharacterized protein LOC104766620  62.8    4e-08   
ref|XP_010519178.1|  PREDICTED: uncharacterized protein LOC104798699  62.4    4e-08   
ref|XP_002965668.1|  hypothetical protein SELMODRAFT_407234           62.8    5e-08   
ref|XP_001773661.1|  predicted protein                                61.6    5e-08   
gb|KFK39933.1|  hypothetical protein AALP_AA3G308600                  62.8    5e-08   
ref|XP_002970540.1|  hypothetical protein SELMODRAFT_441151           62.0    5e-08   
ref|XP_010092894.1|  hypothetical protein L484_022489                 62.0    5e-08   
ref|XP_004173200.1|  PREDICTED: uncharacterized LOC101215059          62.8    6e-08   
gb|ABK28543.1|  unknown                                               62.4    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|EPS62035.1|  hypothetical protein M569_12761                       60.1    6e-08   
ref|XP_009590587.1|  PREDICTED: ankyrin repeat-containing protein...  62.8    6e-08   
ref|XP_008460692.1|  PREDICTED: uncharacterized protein LOC103499460  62.8    6e-08   
ref|XP_004147189.1|  PREDICTED: uncharacterized protein LOC101215059  62.8    6e-08   
ref|XP_003535258.1|  PREDICTED: uncharacterized protein LOC100787698  62.8    6e-08   
emb|CBI23723.3|  unnamed protein product                              62.4    7e-08   
ref|XP_009767920.1|  PREDICTED: uncharacterized protein LOC104218993  62.4    7e-08   
ref|NP_566225.4|  calcium-dependent lipid-binding family protein      62.4    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044520.1|  PREDICTED: actin cytoskeleton-regulatory com...  62.0    7e-08   
ref|XP_002282144.1|  PREDICTED: uncharacterized protein LOC100256206  62.4    7e-08   Vitis vinifera
ref|XP_002976843.1|  hypothetical protein SELMODRAFT_443351           62.0    8e-08   
ref|XP_009123999.1|  PREDICTED: uncharacterized protein LOC103848923  62.4    8e-08   
ref|XP_007144140.1|  hypothetical protein PHAVU_007G132000g           62.4    8e-08   
ref|XP_006356117.1|  PREDICTED: uncharacterized protein LOC102592369  62.4    8e-08   
gb|KFK37859.1|  hypothetical protein AALP_AA3G038400                  62.0    8e-08   
emb|CAN83108.1|  hypothetical protein VITISV_026570                   62.4    8e-08   Vitis vinifera
ref|XP_011073723.1|  PREDICTED: uncharacterized protein LOC105158612  62.4    9e-08   
emb|CDY49343.1|  BnaA05g33050D                                        62.0    9e-08   
ref|XP_002978619.1|  hypothetical protein SELMODRAFT_443918           62.0    9e-08   
ref|XP_002456081.1|  hypothetical protein SORBIDRAFT_03g030080        61.6    9e-08   Sorghum bicolor [broomcorn]
ref|XP_004242771.1|  PREDICTED: formin-J                              62.0    1e-07   
ref|XP_009379739.1|  PREDICTED: uncharacterized protein LOC103968123  62.0    1e-07   
ref|XP_010914657.1|  PREDICTED: uncharacterized protein LOC105039993  60.8    1e-07   
ref|XP_006577748.1|  PREDICTED: uncharacterized protein LOC102667983  61.6    1e-07   
ref|XP_009343786.1|  PREDICTED: uncharacterized protein LOC103935702  61.6    1e-07   
ref|XP_010920373.1|  PREDICTED: CASP-like protein 4A1                 61.6    1e-07   
ref|XP_003529574.1|  PREDICTED: toll-interacting protein-like         61.2    1e-07   
ref|XP_009136710.1|  PREDICTED: uncharacterized protein LOC103860797  60.1    1e-07   
ref|XP_002440984.1|  hypothetical protein SORBIDRAFT_09g018410        60.1    2e-07   Sorghum bicolor [broomcorn]
emb|CDX91956.1|  BnaC03g32580D                                        59.7    2e-07   
ref|XP_002971671.1|  hypothetical protein SELMODRAFT_412188           61.2    2e-07   
ref|XP_010914471.1|  PREDICTED: uncharacterized protein LOC105039856  60.1    2e-07   
ref|XP_008370760.1|  PREDICTED: uncharacterized protein LOC103434221  60.8    2e-07   
ref|XP_004963822.1|  PREDICTED: uncharacterized protein LOC101774976  59.7    2e-07   
ref|XP_006489264.1|  PREDICTED: uncharacterized protein LOC102618659  61.2    2e-07   
emb|CDP21817.1|  unnamed protein product                              60.5    2e-07   
ref|XP_009357966.1|  PREDICTED: uncharacterized protein LOC103948651  61.2    2e-07   
ref|XP_009421318.1|  PREDICTED: leucine-rich repeat extensin-like...  60.8    2e-07   
ref|XP_006842598.1|  hypothetical protein AMTR_s00077p00167680        60.8    2e-07   
ref|XP_006394656.1|  hypothetical protein EUTSA_v10004867mg           59.7    2e-07   
ref|XP_009141839.1|  PREDICTED: uncharacterized protein LOC103865744  60.1    2e-07   
gb|ABU98655.1|  SRC2 protein                                          60.5    2e-07   Taiwania cryptomerioides
ref|XP_008800861.1|  PREDICTED: formin-like protein 18                60.5    3e-07   
emb|CDY42921.1|  BnaC05g47300D                                        60.5    3e-07   
ref|XP_002868185.1|  predicted protein                                60.1    3e-07   
ref|XP_009627866.1|  PREDICTED: uncharacterized protein LOC104118341  59.7    3e-07   
ref|XP_011071658.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  60.1    3e-07   
emb|CDY16874.1|  BnaA09g05080D                                        58.9    3e-07   
gb|KDP30266.1|  hypothetical protein JCGZ_17048                       58.9    3e-07   
ref|XP_009621969.1|  PREDICTED: uncharacterized protein LOC104113496  60.5    3e-07   
emb|CDX74193.1|  BnaA03g28540D                                        60.5    3e-07   
gb|KHN31488.1|  hypothetical protein glysoja_035595                   59.3    3e-07   
ref|XP_006409691.1|  hypothetical protein EUTSA_v10022712mg           60.5    3e-07   
ref|XP_007035560.1|  Soybean gene regulated by cold-2, putative       60.1    3e-07   
ref|XP_002459044.1|  hypothetical protein SORBIDRAFT_03g045000        60.1    3e-07   
ref|XP_009795461.1|  PREDICTED: uncharacterized protein LOC104242159  60.1    4e-07   
gb|KCW57325.1|  hypothetical protein EUGRSUZ_H00124                   57.8    4e-07   
gb|EYU39778.1|  hypothetical protein MIMGU_mgv1a009123mg              60.1    4e-07   
emb|CAN79006.1|  hypothetical protein VITISV_040896                   60.1    4e-07   
ref|XP_002516905.1|  conserved hypothetical protein                   59.7    4e-07   
ref|XP_009774894.1|  PREDICTED: uncharacterized protein LOC104224872  59.3    5e-07   
ref|XP_010533203.1|  PREDICTED: uncharacterized protein LOC104809...  59.7    5e-07   
ref|XP_009401591.1|  PREDICTED: uncharacterized protein LOC103985575  58.9    7e-07   
ref|XP_004234051.1|  PREDICTED: uncharacterized protein LOC101265801  59.7    7e-07   
ref|XP_009591729.1|  PREDICTED: uncharacterized protein LOC104088710  59.3    7e-07   
ref|XP_008789935.1|  PREDICTED: small nuclear ribonucleoprotein-a...  58.9    7e-07   
ref|XP_001761054.1|  predicted protein                                58.2    7e-07   
dbj|BAK04609.1|  predicted protein                                    58.9    7e-07   
ref|XP_010921798.1|  PREDICTED: ingression protein fic1-like          59.3    7e-07   
gb|AFW77608.1|  hypothetical protein ZEAMMB73_790193                  57.8    7e-07   
ref|XP_010264865.1|  PREDICTED: uncharacterized protein LOC104602763  59.3    8e-07   
ref|XP_008791481.1|  PREDICTED: uncharacterized protein LOC103708363  58.2    8e-07   
ref|XP_002513669.1|  conserved hypothetical protein                   58.5    8e-07   
ref|XP_009399250.1|  PREDICTED: MAPK-interacting and spindle-stab...  58.9    8e-07   
gb|KDO36355.1|  hypothetical protein CISIN_1g021949mg                 58.9    8e-07   
gb|ABF69997.1|  C2 domain-containing protein / XYPPX domain-conta...  58.9    9e-07   
ref|XP_011076131.1|  PREDICTED: WW domain-containing protein C11B...  58.5    1e-06   
ref|XP_008801291.1|  PREDICTED: uncharacterized protein LOC103715451  58.9    1e-06   
ref|XP_009401202.1|  PREDICTED: uncharacterized protein LOC103985274  58.5    1e-06   
ref|XP_006646653.1|  PREDICTED: C2 domain-containing protein At1g...  57.8    1e-06   
ref|XP_008650604.1|  PREDICTED: uncharacterized protein LOC103631481  57.8    1e-06   
ref|XP_004240724.1|  PREDICTED: uncharacterized protein LOC101263030  58.2    1e-06   
ref|XP_011030162.1|  PREDICTED: uncharacterized protein LOC105129684  58.2    1e-06   
emb|CDP21225.1|  unnamed protein product                              56.2    1e-06   
ref|XP_004134204.1|  PREDICTED: uncharacterized protein LOC101222610  58.5    1e-06   
ref|XP_004159813.1|  PREDICTED: uncharacterized protein LOC101229597  58.5    1e-06   
ref|XP_002456650.1|  hypothetical protein SORBIDRAFT_03g040170        58.5    1e-06   
ref|XP_006419603.1|  hypothetical protein CICLE_v10005259mg           58.5    1e-06   
ref|NP_001045308.1|  Os01g0934100                                     58.5    1e-06   
ref|XP_001759306.1|  predicted protein                                58.9    1e-06   
ref|NP_001170657.1|  hypothetical protein                             58.2    1e-06   
ref|XP_003565019.1|  PREDICTED: basic salivary proline-rich prote...  58.2    2e-06   
gb|AFK33423.1|  unknown                                               57.4    2e-06   
ref|XP_010671655.1|  PREDICTED: uncharacterized protein LOC104888395  57.8    2e-06   
ref|XP_010652026.1|  PREDICTED: uncharacterized protein LOC104879761  57.8    2e-06   
gb|EYU23910.1|  hypothetical protein MIMGU_mgv1a015398mg              55.8    2e-06   
ref|XP_003609663.1|  hypothetical protein MTR_4g119780                57.0    2e-06   
ref|XP_004970615.1|  PREDICTED: leucine-rich repeat extensin-like...  57.8    2e-06   
ref|XP_010096867.1|  hypothetical protein L484_003038                 57.8    2e-06   
ref|XP_008438876.1|  PREDICTED: protein diaphanous homolog 1          57.8    2e-06   
ref|NP_001152648.1|  C2 domain containing protein                     57.4    3e-06   
gb|EYU25119.1|  hypothetical protein MIMGU_mgv1a021760mg              57.4    3e-06   
gb|AES82742.2|  calcium-dependent lipid-binding (CaLB domain) fam...  57.0    3e-06   
ref|XP_003626524.1|  hypothetical protein MTR_7g116840                57.0    3e-06   
emb|CAN68775.1|  hypothetical protein VITISV_006805                   57.0    3e-06   
ref|XP_002462013.1|  hypothetical protein SORBIDRAFT_02g012580        57.4    3e-06   
ref|XP_004494967.1|  PREDICTED: uncharacterized protein LOC101508328  57.4    3e-06   
ref|XP_004971180.1|  PREDICTED: calcium-binding protein P-like        57.0    4e-06   
ref|XP_002271267.1|  PREDICTED: uncharacterized protein LOC100249100  56.6    4e-06   
tpg|DAA60682.1|  TPA: hypothetical protein ZEAMMB73_781558            57.0    4e-06   
ref|XP_010255304.1|  PREDICTED: uncharacterized protein LOC104596023  56.6    4e-06   
ref|NP_001145939.1|  uncharacterized protein LOC100279462             56.6    5e-06   
ref|XP_004956261.1|  PREDICTED: tropomyosin-1, isoforms 33/34-like    56.6    5e-06   
ref|NP_001063992.1|  Os09g0571200                                     56.6    5e-06   
ref|XP_001772125.1|  predicted protein                                57.0    5e-06   
ref|XP_007132356.1|  hypothetical protein PHAVU_011G087800g           56.6    5e-06   
ref|XP_006419602.1|  hypothetical protein CICLE_v10005548mg           56.2    6e-06   
ref|XP_002512414.1|  conserved hypothetical protein                   56.2    6e-06   
dbj|BAJ94268.1|  predicted protein                                    55.1    6e-06   
ref|XP_009384169.1|  PREDICTED: basic proline-rich protein-like       56.2    6e-06   
ref|XP_002461180.1|  hypothetical protein SORBIDRAFT_02g042460        56.2    6e-06   
ref|NP_001149536.1|  src2-like protein                                56.2    7e-06   
ref|XP_010035163.1|  PREDICTED: uncharacterized protein DDB_G0290...  56.6    7e-06   
ref|XP_010548935.1|  PREDICTED: extensin isoform X1                   56.2    8e-06   
ref|NP_001132444.1|  Ras association and pleckstrin y domain 1 is...  56.2    8e-06   
ref|XP_007147205.1|  hypothetical protein PHAVU_006G104400g           56.2    8e-06   
gb|AFW84033.1|  src2-like protein                                     56.2    9e-06   
ref|XP_010269469.1|  PREDICTED: uncharacterized protein LOC104606112  54.7    9e-06   
tpg|DAA38720.1|  TPA: hypothetical protein ZEAMMB73_918265            55.8    9e-06   
emb|CAN69351.1|  hypothetical protein VITISV_017753                   55.5    9e-06   
ref|XP_007208693.1|  hypothetical protein PRUPE_ppa1027138mg          54.7    9e-06   
ref|NP_001062521.1|  Os08g0562600                                     55.8    1e-05   
ref|XP_003535375.1|  PREDICTED: uncharacterized protein LOC100795448  55.8    1e-05   
ref|XP_009404578.1|  PREDICTED: pollen-specific leucine-rich repe...  55.8    1e-05   
ref|XP_010035164.1|  PREDICTED: uncharacterized protein DDB_G0290...  55.8    1e-05   
ref|XP_010940561.1|  PREDICTED: transcription elongation factor SPT5  55.5    1e-05   
ref|NP_001141178.1|  hypothetical protein                             55.5    1e-05   
gb|ACG26368.1|  SRC2                                                  55.5    1e-05   
ref|XP_010038446.1|  PREDICTED: uncharacterized protein LOC104426980  54.7    1e-05   
ref|XP_003634095.1|  PREDICTED: uncharacterized protein LOC100852496  55.5    1e-05   
gb|ACG40316.1|  SRC2                                                  55.5    1e-05   
ref|NP_001142084.1|  uncharacterized protein LOC100274244             55.5    1e-05   
ref|XP_007154268.1|  hypothetical protein PHAVU_003G104400g           55.1    1e-05   
ref|XP_009800792.1|  PREDICTED: WW domain-containing protein C11B...  55.5    1e-05   
emb|CAN78886.1|  hypothetical protein VITISV_002549                   55.1    1e-05   
ref|XP_004974238.1|  PREDICTED: transcriptional repressor scratch...  55.1    1e-05   
ref|XP_010549648.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  55.5    1e-05   
ref|XP_008785412.1|  PREDICTED: extensin-like                         55.5    1e-05   
gb|KDP33324.1|  hypothetical protein JCGZ_12873                       55.5    1e-05   
ref|XP_002275480.1|  PREDICTED: uncharacterized protein LOC100242355  55.1    2e-05   
ref|NP_001141810.1|  uncharacterized protein LOC100273948             55.1    2e-05   
ref|XP_006414453.1|  hypothetical protein EUTSA_v10026994mg           52.4    2e-05   
ref|XP_006389230.1|  shock protein SRC2                               55.1    2e-05   
ref|XP_002528347.1|  hypothetical protein RCOM_1217340                55.5    2e-05   
ref|XP_008379961.1|  PREDICTED: WW domain-containing protein C11B...  55.1    2e-05   
ref|XP_009387361.1|  PREDICTED: uncharacterized protein LOC103974297  55.1    2e-05   
ref|XP_006363329.1|  PREDICTED: uncharacterized protein LOC102600321  54.7    2e-05   
ref|XP_006345991.1|  PREDICTED: uncharacterized protein LOC102591105  55.1    2e-05   
ref|XP_006353889.1|  PREDICTED: RNA-binding protein EWS-like isof...  55.1    2e-05   
ref|XP_007031704.1|  Calcium-dependent lipid-binding (CaLB domain...  55.1    2e-05   
ref|XP_006353888.1|  PREDICTED: RNA-binding protein EWS-like isof...  55.1    2e-05   
gb|ACN35874.1|  unknown                                               55.1    2e-05   
ref|XP_004239688.1|  PREDICTED: putative uncharacterized protein ...  55.1    2e-05   
ref|XP_003590980.1|  hypothetical protein MTR_1g080360                54.7    2e-05   
ref|XP_007224302.1|  hypothetical protein PRUPE_ppa020127mg           54.7    2e-05   
ref|XP_010451491.1|  PREDICTED: uncharacterized protein LOC104733619  53.9    2e-05   
ref|XP_004309433.1|  PREDICTED: uncharacterized protein LOC101294323  54.3    3e-05   
ref|XP_006659707.1|  PREDICTED: uncharacterized protein LOC102701649  54.3    3e-05   
ref|XP_004234422.1|  PREDICTED: probable calcium-binding protein ...  54.7    3e-05   
ref|XP_006422081.1|  hypothetical protein CICLE_v10005598mg           54.3    3e-05   
ref|XP_011084443.1|  PREDICTED: uncharacterized protein LOC105166693  53.9    3e-05   
gb|KDO56853.1|  hypothetical protein CISIN_1g023810mg                 53.9    3e-05   
gb|KFK27692.1|  hypothetical protein AALP_AA8G416000                  53.9    3e-05   
ref|XP_008223177.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  53.9    3e-05   
ref|XP_009400560.1|  PREDICTED: uncharacterized protein LOC103984726  53.9    3e-05   
ref|XP_004958643.1|  PREDICTED: uncharacterized protein LOC101761694  53.9    4e-05   
dbj|BAJ97521.1|  predicted protein                                    54.3    4e-05   
ref|NP_197783.2|  calcium-dependent lipid-binding domain-containi...  53.1    4e-05   
ref|XP_009368751.1|  PREDICTED: WW domain-containing protein C11B...  53.9    4e-05   
emb|CDP19538.1|  unnamed protein product                              53.9    4e-05   
gb|KEH18937.1|  C2 domain protein                                     52.4    4e-05   
gb|AFK45032.1|  unknown                                               52.4    4e-05   
ref|XP_009382785.1|  PREDICTED: uncharacterized protein LOC103970647  53.5    4e-05   
gb|KEH24577.1|  calcium-dependent lipid-binding (CaLB domain) fam...  53.9    5e-05   
ref|XP_003566318.1|  PREDICTED: uncharacterized protein LOC100822736  52.8    5e-05   
ref|XP_004140766.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  52.8    5e-05   
dbj|BAB10068.1|  unnamed protein product                              53.1    5e-05   
ref|XP_010024687.1|  PREDICTED: formin-F-like                         53.5    5e-05   
ref|XP_010259665.1|  PREDICTED: uncharacterized protein LOC104599004  52.0    5e-05   
ref|XP_009612128.1|  PREDICTED: cyclin-dependent kinase inhibitor...  53.5    5e-05   
ref|XP_008801062.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  53.9    5e-05   
ref|XP_011090948.1|  PREDICTED: protein diaphanous homolog 1-like     53.5    6e-05   
ref|XP_004495587.1|  PREDICTED: uncharacterized protein LOC101488962  53.5    6e-05   
gb|AFW83462.1|  C2 domain containing protein                          53.5    6e-05   
ref|XP_007132355.1|  hypothetical protein PHAVU_011G087700g           53.5    6e-05   
ref|XP_010938433.1|  PREDICTED: neural Wiskott-Aldrich syndrome p...  53.1    6e-05   
ref|XP_006489104.1|  PREDICTED: uncharacterized protein LOC102622...  52.0    6e-05   
ref|XP_010440511.1|  PREDICTED: uncharacterized protein LOC104723800  53.1    7e-05   
ref|XP_002318206.1|  hypothetical protein POPTR_0012s12880g           52.4    7e-05   
ref|XP_008779256.1|  PREDICTED: uncharacterized protein LOC103698987  53.1    8e-05   
ref|XP_006344645.1|  PREDICTED: uncharacterized protein LOC102597391  53.1    8e-05   
dbj|BAK04302.1|  predicted protein                                    52.8    8e-05   
ref|XP_010262513.1|  PREDICTED: uncharacterized protein LOC104601031  52.8    1e-04   
ref|XP_004967742.1|  PREDICTED: forkhead box protein D1-like          52.8    1e-04   
gb|KDP23491.1|  hypothetical protein JCGZ_23324                       52.8    1e-04   
ref|XP_010671657.1|  PREDICTED: uncharacterized protein LOC104888396  52.8    1e-04   
ref|XP_010421203.1|  PREDICTED: actin cytoskeleton-regulatory com...  52.4    1e-04   
ref|XP_004296826.1|  PREDICTED: uncharacterized protein LOC101304564  52.8    1e-04   
ref|XP_006445133.1|  hypothetical protein CICLE_v10022337mg           51.6    1e-04   
ref|XP_002455634.1|  hypothetical protein SORBIDRAFT_03g015060        52.4    1e-04   
ref|XP_010024685.1|  PREDICTED: uncharacterized protein LOC104415126  50.4    1e-04   
ref|XP_010454681.1|  PREDICTED: uncharacterized protein LOC104736407  52.4    1e-04   
ref|XP_003578699.1|  PREDICTED: tropomyosin-1, isoforms 33/34-like    52.4    1e-04   
ref|XP_010103360.1|  hypothetical protein L484_002544                 51.6    1e-04   
ref|XP_009625033.1|  PREDICTED: uncharacterized protein LOC104115986  52.4    1e-04   
ref|XP_010545020.1|  PREDICTED: uncharacterized protein LOC104817502  52.0    1e-04   
ref|XP_009779320.1|  PREDICTED: pollen-specific leucine-rich repe...  52.0    2e-04   
ref|NP_001168114.1|  hypothetical protein                             52.0    2e-04   
ref|XP_010674263.1|  PREDICTED: uncharacterized protein LOC104890461  52.0    2e-04   
gb|EYU32591.1|  hypothetical protein MIMGU_mgv1a006056mg              52.0    2e-04   
ref|XP_006358166.1|  PREDICTED: uncharacterized protein LOC102591162  52.0    2e-04   
ref|NP_001060593.1|  Os07g0670300                                     51.6    2e-04   
ref|XP_011012859.1|  PREDICTED: formin-like protein 18                51.6    2e-04   
ref|XP_010493524.1|  PREDICTED: uncharacterized protein LOC104770764  51.6    2e-04   
ref|XP_003571266.1|  PREDICTED: uncharacterized protein LOC100829104  51.6    2e-04   
ref|XP_004157192.1|  PREDICTED: uncharacterized protein LOC101224685  51.6    2e-04   
ref|XP_006288435.1|  hypothetical protein CARUB_v10001693mg           51.6    2e-04   
ref|XP_008439269.1|  PREDICTED: zinc finger matrin-type protein C...  51.6    2e-04   
ref|XP_009420756.1|  PREDICTED: uncharacterized protein LOC104000435  51.2    3e-04   
gb|EMS68380.1|  hypothetical protein TRIUR3_29334                     50.4    3e-04   
gb|EMT25283.1|  hypothetical protein F775_18261                       51.2    3e-04   
ref|XP_007218770.1|  hypothetical protein PRUPE_ppa009523mg           51.2    3e-04   
ref|XP_008234191.1|  PREDICTED: WW domain-containing protein C11B...  51.2    3e-04   
ref|XP_010910417.1|  PREDICTED: extensin-2-like                       51.2    3e-04   
emb|CDX89815.1|  BnaA10g02670D                                        51.6    3e-04   
ref|XP_004250568.1|  PREDICTED: uncharacterized protein LOC101255161  49.7    3e-04   
ref|XP_004235211.1|  PREDICTED: uncharacterized protein LOC101249714  51.2    3e-04   
gb|AFK13837.1|  C2 domain-containing protein SRC2                     51.2    3e-04   
emb|CAI58613.1|  C2 domain-containing protein                         51.2    3e-04   
gb|EAY97779.1|  hypothetical protein OsI_19691                        50.4    3e-04   
gb|EMS56449.1|  hypothetical protein TRIUR3_20632                     50.8    4e-04   
ref|XP_010098296.1|  hypothetical protein L484_023544                 50.8    4e-04   
ref|XP_010523731.1|  PREDICTED: BON1-associated protein 2-like        50.1    4e-04   
ref|XP_009588589.1|  PREDICTED: pollen-specific leucine-rich repe...  50.8    4e-04   
ref|XP_004487863.1|  PREDICTED: ribonucleoprotein RB97D-like          50.8    5e-04   
gb|AAV31231.1|  hypothetical protein                                  50.1    5e-04   
ref|XP_010104923.1|  hypothetical protein L484_006665                 50.1    5e-04   
gb|AAK53845.1|AC011806_22  Putative shock protein                     50.8    5e-04   
ref|XP_004968753.1|  PREDICTED: formin-like protein 18-like           50.4    5e-04   
ref|XP_006414452.1|  hypothetical protein EUTSA_v10026991mg           50.4    5e-04   
ref|XP_010662792.1|  PREDICTED: uncharacterized protein LOC104882216  49.3    5e-04   
gb|ABE98328.1|  SRC2-like protein                                     50.4    5e-04   
gb|EEC70662.1|  hypothetical protein OsI_01954                        50.4    6e-04   
ref|XP_006489103.1|  PREDICTED: uncharacterized protein LOC102622...  49.3    6e-04   
gb|ABK23901.1|  unknown                                               50.4    6e-04   
ref|XP_010666732.1|  PREDICTED: uncharacterized protein LOC104883866  50.1    6e-04   
gb|EYU43935.1|  hypothetical protein MIMGU_mgv1a013059mg              49.7    6e-04   
ref|NP_001043051.2|  Os01g0369500                                     50.4    6e-04   
dbj|BAK04679.1|  predicted protein                                    50.1    6e-04   
ref|XP_009791711.1|  PREDICTED: uncharacterized protein LOC104238906  50.1    7e-04   
emb|CAN68012.1|  hypothetical protein VITISV_005112                   48.9    7e-04   
ref|XP_003565758.2|  PREDICTED: uncharacterized protein LOC100826019  50.1    8e-04   
ref|XP_009600682.1|  PREDICTED: uncharacterized protein LOC104096081  50.1    8e-04   
gb|EAZ08028.1|  hypothetical protein OsI_30293                        47.8    9e-04   
ref|NP_001055350.2|  Os05g0370300                                     49.7    0.001   
ref|XP_004134335.1|  PREDICTED: BON1-associated protein 2-like        48.5    0.001   
ref|XP_004289725.1|  PREDICTED: uncharacterized protein LOC101315189  49.7    0.001   
gb|KEH18936.1|  BON1-associated-like protein                          48.5    0.001   



>ref|XP_006365577.1| PREDICTED: uncharacterized protein LOC102595643 [Solanum tuberosum]
Length=196

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = +2

Query  224  LREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGG--ANPVWNQVVKL  397
            LREIEVL+YSA  LKNVKHL++MRTYAE YVE+ VHVA+T+V EH G   NP+WNQVVK+
Sbjct  17   LREIEVLIYSAEGLKNVKHLTRMRTYAEVYVEKDVHVAKTKVAEHTGDGTNPIWNQVVKV  76

Query  398  KFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
            KFH+ LPEND+MAALNVD+YAHGH+REK VGSARVLLSDVLK      + E    NPIQF
Sbjct  77   KFHEKLPENDIMAALNVDMYAHGHIREKLVGSARVLLSDVLKDTKSSES-EMLENNPIQF  135

Query  578  LTVQVWRPSSRPHGLLNLWVPPTGRflvsfkslsfslRGRD  700
            +TV VWRPS RP G+LNLWVPPTGRFLV   SLSFSLRGRD
Sbjct  136  MTVLVWRPSGRPQGVLNLWVPPTGRFLVPLNSLSFSLRGRD  176



>ref|XP_010275059.1| PREDICTED: uncharacterized protein LOC104610232 [Nelumbo nucifera]
Length=175

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 5/146 (3%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            + ++REIEVL++SA DLKNVKH++KMR YA  YVER  HVA+T+VDE GG +P WN+VVK
Sbjct  15   ERRMREIEVLIHSAQDLKNVKHVTKMRAYAVVYVERE-HVAKTKVDEEGGVDPTWNEVVK  73

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
            +KFH+ L E+DVM+ALNVDIYAHGH+REKPVGSARVLL DVLKGG        P  NPIQ
Sbjct  74   VKFHEDLSEDDVMSALNVDIYAHGHIREKPVGSARVLLCDVLKGGDAS----EPADNPIQ  129

Query  575  FLTVQVWRPSSRPHGLLNLWVPPTGR  652
             + +QVWRPS RP GLLNLWVPPTGR
Sbjct  130  CMAIQVWRPSGRPQGLLNLWVPPTGR  155



>ref|XP_008225460.1| PREDICTED: uncharacterized protein LOC103325105 [Prunus mume]
Length=192

 Score =   207 bits (526),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 114/144 (79%), Gaps = 4/144 (3%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            +LREIEVL+ S  DLK+VKH++ +R YA  YVE+  H ART VDE GG NP WN+VVK+K
Sbjct  18   KLREIEVLIISGQDLKDVKHVTHVRAYAVVYVEKEYHAARTGVDEQGGTNPTWNEVVKVK  77

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
            F + L ENDV+AALNVDIYAHGHVREKPVGSARVLL DVLKGG     +  P  NP+Q +
Sbjct  78   FREDLLENDVLAALNVDIYAHGHVREKPVGSARVLLCDVLKGGD----EREPADNPVQCM  133

Query  581  TVQVWRPSSRPHGLLNLWVPPTGR  652
            TVQVWRPS RP GLLNLWVPPTGR
Sbjct  134  TVQVWRPSGRPQGLLNLWVPPTGR  157



>gb|KDP37957.1| hypothetical protein JCGZ_04600 [Jatropha curcas]
Length=188

 Score =   205 bits (521),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 116/145 (80%), Gaps = 4/145 (3%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKL  397
            +QLREIEVL+ SA +LKNV H++KM+ YA  YVE+ VHVART +DEHGG +P WN+ VK+
Sbjct  17   DQLREIEVLIISAENLKNVSHVTKMKPYALVYVEKYVHVARTHIDEHGGTDPTWNETVKV  76

Query  398  KFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
             F Q L ENDVMAALNVDIYAHGH+ +K VGSAR+LL DVLK   GG  DE P  NPIQ 
Sbjct  77   SFRQKLLENDVMAALNVDIYAHGHLSDKMVGSARILLCDVLK---GGKPDE-PADNPIQC  132

Query  578  LTVQVWRPSSRPHGLLNLWVPPTGR  652
            +TVQVWRPS RP GLLNLWVPPTG+
Sbjct  133  MTVQVWRPSGRPQGLLNLWVPPTGK  157



>ref|XP_002519702.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42675.1| conserved hypothetical protein [Ricinus communis]
Length=209

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 117/146 (80%), Gaps = 4/146 (3%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            Q+QLREIEVL+ SA +LKNVKH++KM+ YA  YVE+ +HVA+T VD HGG +P WN+ VK
Sbjct  19   QDQLREIEVLIISAENLKNVKHVTKMKPYALVYVEKDLHVAKTHVDNHGGTDPTWNETVK  78

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
            + F + L E +++AALNVDIYAHGHVR+KPVGSARVLL DVLKGG      + P+ NPIQ
Sbjct  79   VMFRENLLETNIIAALNVDIYAHGHVRDKPVGSARVLLCDVLKGG----RPDVPVDNPIQ  134

Query  575  FLTVQVWRPSSRPHGLLNLWVPPTGR  652
             +TVQVWRPS RP GLL LWVPPTG+
Sbjct  135  CMTVQVWRPSGRPQGLLTLWVPPTGK  160



>ref|XP_010111003.1| BON1-associated protein 2 [Morus notabilis]
 gb|EXC29389.1| BON1-associated protein 2 [Morus notabilis]
Length=191

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 108/144 (75%), Gaps = 9/144 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            +LREIEVL+ SA  LKNVKH +KMRT+A+ YVE+  HVA T +DE GG NP W  +VK+K
Sbjct  19   RLREIEVLIISAEGLKNVKHATKMRTHAQVYVEKDRHVATTHLDEKGGTNPTWKDIVKVK  78

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
            F +   E+DV+AALNVDIYA G VREKPVGSARVLL DVLK  GG AAD  P  NP    
Sbjct  79   FREDPRESDVIAALNVDIYARGRVREKPVGSARVLLCDVLK--GGDAAD--PAENP----  130

Query  581  TVQVWRPSSRPHGLLNLWVPPTGR  652
             VQVWR S RP GLLNLWVPPTGR
Sbjct  131  -VQVWRRSGRPQGLLNLWVPPTGR  153



>ref|XP_007213255.1| hypothetical protein PRUPE_ppb020632mg [Prunus persica]
 gb|EMJ14454.1| hypothetical protein PRUPE_ppb020632mg [Prunus persica]
Length=167

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 4/130 (3%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            +LREIEV++ SA DLKNVKH++++R YA  YVE+  H ART VDE GG +P WN+VVK+K
Sbjct  7    KLREIEVMIISAQDLKNVKHVTQVRAYAVVYVEKEYHAARTGVDEQGGTSPTWNEVVKVK  66

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
            F + L ENDV+AALNVDIYA G VREKPVGSARVLL DVLKGG     +  P  NP+Q +
Sbjct  67   FREDLLENDVLAALNVDIYAQGRVREKPVGSARVLLCDVLKGGD----EREPADNPVQCM  122

Query  581  TVQVWRPSSR  610
            TVQVWRPS R
Sbjct  123  TVQVWRPSGR  132



>ref|XP_007025109.1| Uncharacterized protein TCM_029510 [Theobroma cacao]
 gb|EOY27731.1| Uncharacterized protein TCM_029510 [Theobroma cacao]
Length=109

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 85/114 (75%), Gaps = 5/114 (4%)
 Frame = +2

Query  290  MRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQGLPENDVMAALNVDIYAHGH  469
            M+TYA  YVE   HVA+  VDEHGG NP WN+VVK+KFH  LPE DV+AALN DIYAHGH
Sbjct  1    MKTYAVVYVEDD-HVAKAHVDEHGGTNPSWNEVVKVKFHAKLPEKDVLAALNFDIYAHGH  59

Query  470  VREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQVWRPSSRPHGLLNL  631
            +REKPVG ARVLL DVLKGG        P+ NP+Q +TV VWR S RP GLLNL
Sbjct  60   MREKPVGGARVLLCDVLKGGD----TSEPVDNPVQSMTVYVWRSSGRPQGLLNL  109



>gb|AEW08214.1| hypothetical protein 2_3193_01, partial [Pinus radiata]
 gb|AFG52317.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52318.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52322.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52323.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52324.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52328.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52329.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52331.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52332.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 91/133 (68%), Gaps = 6/133 (5%)
 Frame = +2

Query  254  ANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQGLPENDVM  433
            A DLKNVK + KM+ YA AY++   H A TR+D+ GG NP W+Q + L     L  N V+
Sbjct  1    AEDLKNVKRIRKMKCYAVAYIDPD-HKASTRIDQDGGINPNWHQKLVLAADDELLSN-VL  58

Query  434  AALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQVWRPSSRP  613
            AA+ VDIY++ H+R+K VG+AR+L+ D+LKGG        P  NPIQ + VQV RPS RP
Sbjct  59   AAITVDIYSYSHIRDKLVGTARILVPDLLKGGDPA----NPSDNPIQCIAVQVRRPSGRP  114

Query  614  HGLLNLWVPPTGR  652
             G+LN+WVPPTGR
Sbjct  115  QGILNIWVPPTGR  127



>gb|AFG52320.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52321.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52326.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score =   135 bits (340),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 90/133 (68%), Gaps = 6/133 (5%)
 Frame = +2

Query  254  ANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQGLPENDVM  433
            A DLKNVK + KM+ YA AY++   H A TR+D+ GG NP W+Q + L     L  N V+
Sbjct  1    AEDLKNVKRIRKMKCYAVAYIDPD-HKASTRIDQDGGINPNWHQKLVLAADDELLSN-VL  58

Query  434  AALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQVWRPSSRP  613
            AA+ VDIY++ H+R+K VG+AR+L+ D+LKGG        P  NPIQ   VQV RPS RP
Sbjct  59   AAITVDIYSYSHIRDKLVGTARILVPDLLKGGDPA----NPFDNPIQCSAVQVRRPSGRP  114

Query  614  HGLLNLWVPPTGR  652
             G+LN+WVPPTGR
Sbjct  115  QGILNIWVPPTGR  127



>gb|AFG52315.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52316.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52319.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52325.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52327.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52330.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 90/133 (68%), Gaps = 6/133 (5%)
 Frame = +2

Query  254  ANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQGLPENDVM  433
            A DLKNVK + KM+ YA AY++   H A TR+D+ GG NP W+Q + L     L  N V+
Sbjct  1    AEDLKNVKRIRKMKCYAVAYIDPD-HKASTRIDQDGGINPNWHQKLVLAADDELLSN-VL  58

Query  434  AALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQVWRPSSRP  613
            AA+ VDIY++ H+R+K VG+AR+L+ D+LKGG        P  NPIQ   VQV RPS RP
Sbjct  59   AAITVDIYSYSHIRDKLVGTARILVPDLLKGGDPA----NPSDNPIQCSAVQVRRPSGRP  114

Query  614  HGLLNLWVPPTGR  652
             G+LN+WVPPTGR
Sbjct  115  QGILNIWVPPTGR  127



>gb|ABK22654.1| unknown [Picea sitchensis]
Length=203

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            Q + R IEV + SA DL++VK + KMR YA  Y++   H A TR+DE+GG NP WN+++ 
Sbjct  12   QPKKRAIEVRIISAQDLEDVKLIGKMRCYAVLYIDPE-HKASTRIDENGGINPFWNELLV  70

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
            L+    L   + MAA+NVDIYA GH+R+K VG++R+L+S VLKGG           NPI 
Sbjct  71   LQADDELLSQN-MAAVNVDIYARGHMRDKLVGTSRILISQVLKGGDAA----NLYDNPIG  125

Query  575  FLTVQVWRPSSRPHGLLNLWVPPTGR  652
             + V V RPS RP G+LN+W+PP G+
Sbjct  126  CMPVLVRRPSGRPQGILNIWIPPAGK  151



>gb|ABK23345.1| unknown [Picea sitchensis]
Length=194

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (69%), Gaps = 6/121 (5%)
 Frame = +2

Query  290  MRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQGLPENDVMAALNVDIYAHGH  469
            MR YA AY++     A TR+D+ GG NP WN+ + L     L  N V+AA+ V+IY++ H
Sbjct  1    MRCYAVAYIDPE-QKASTRIDQDGGINPTWNEKLVLAADDELLSN-VLAAITVEIYSYSH  58

Query  470  VREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQVWRPSSRPHGLLNLWVPPTG  649
            +R+K VG+AR+L+SD+LKGG        P  NPIQ + VQV RPSSRP G+LN+WVPPTG
Sbjct  59   IRDKLVGTARILISDLLKGGDPA----NPSDNPIQCIAVQVRRPSSRPQGILNVWVPPTG  114

Query  650  R  652
            R
Sbjct  115  R  115



>gb|ABK24127.1| unknown [Picea sitchensis]
Length=186

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 87/146 (60%), Gaps = 23/146 (16%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            Q + R IEV + SA DL++VK + KMR YA  Y++   H A TR+DE+GG NP WN+++ 
Sbjct  12   QPKKRAIEVRIISAQDLEDVKLIGKMRCYAVLYIDPE-HKASTRIDENGGINPFWNELLV  70

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
            L+    L   + MAA+NVDIYA GH+R+K VG++R+L+S VLKGG      + P      
Sbjct  71   LQADDELLSQN-MAAVNVDIYARGHMRDKLVGTSRILISQVLKGGDAANLYDNP------  123

Query  575  FLTVQVWRPSSRPHGLLNLWVPPTGR  652
                           +LN+W+PP G+
Sbjct  124  ---------------ILNIWIPPAGK  134



>ref|XP_002967740.1| hypothetical protein SELMODRAFT_408999 [Selaginella moellendorffii]
 gb|EFJ31087.1| hypothetical protein SELMODRAFT_408999 [Selaginella moellendorffii]
Length=262

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 82/151 (54%), Gaps = 12/151 (8%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKNVKHLSKMRTYAEA--YVERSVHVARTRVDEHGGANPVWNQV  388
            Q + R IE  + SA DLK+     +MR+YA A  Y +R V    TR+D  GG NP W+  
Sbjct  37   QPRTRAIEFCIISAQDLKSATKFGRMRSYAVASIYPDRKVS---TRIDCEGGTNPTWDAK  93

Query  389  VKLKFHQGL---PENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPL  559
            + L+  + +    E+D    L +DI++ G +R+K VG+ R+L+ D ++    G  +   +
Sbjct  94   LVLEVDERVLVGDEDDTHTQLTIDIFSRGSLRDKLVGTVRILVCDAVR----GERNMRSI  149

Query  560  GNPIQFLTVQVWRPSSRPHGLLNLWVPPTGR  652
             N     +  V+RP   P G+LN+ +PP GR
Sbjct  150  VNRFPVASYLVFRPGGCPQGILNVCIPPGGR  180



>ref|XP_002992362.1| hypothetical protein SELMODRAFT_430579 [Selaginella moellendorffii]
 gb|EFJ06512.1| hypothetical protein SELMODRAFT_430579 [Selaginella moellendorffii]
Length=262

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 82/151 (54%), Gaps = 12/151 (8%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKNVKHLSKMRTYAEA--YVERSVHVARTRVDEHGGANPVWNQV  388
            Q + R +E  + SA DLK+     +MR+YA A  Y +R V    TR+D  GG NP W+  
Sbjct  37   QPRTRALEFCIISAQDLKSATKFGRMRSYAVASIYPDRKVS---TRIDCEGGTNPTWDAK  93

Query  389  VKLKFHQGL---PENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPL  559
            + L+  + +    E+D    L +DI++ G +R+K VG+ R+L+ D ++G     +    +
Sbjct  94   LVLEVDERVLVGDEDDTHTQLTIDIFSRGSLRDKLVGTVRILVCDAVRGERNMRS----I  149

Query  560  GNPIQFLTVQVWRPSSRPHGLLNLWVPPTGR  652
             N     +  V+RP   P G+LN+ +PP GR
Sbjct  150  VNRFPVASYLVFRPGGCPQGILNVCIPPGGR  180



>ref|XP_006339653.1| PREDICTED: uncharacterized protein LOC102592387 [Solanum tuberosum]
Length=269

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 9/141 (6%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVV  391
            +E  + +E+ L SA  LK  V +L +M+TYA  +V+ S  + RT++D  GG NP WN   
Sbjct  2    EEGTQILEINLISAQSLKTPVANLRRMQTYAILWVDSSTKL-RTKIDHLGGENPTWNDKF  60

Query  392  KLKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKG-GGGGAADETPLGNP  568
              +        +  + ++V+IYA G++++  +G+ R+L+S  LKG    G    TP    
Sbjct  61   LFRVSPEFISGET-SGVSVEIYAVGYIKDFLIGTVRLLISSCLKGIANHGITTATP----  115

Query  569  IQFLTVQVWRPSSRPHGLLNL  631
              F  VQV RPS R HG+LN+
Sbjct  116  -AFTAVQVRRPSGRFHGVLNI  135



>ref|XP_004229965.1| PREDICTED: BON1-associated protein 2 [Solanum lycopersicum]
Length=270

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 9/141 (6%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVV  391
            +E  + +E+ L SA  LK  V +L +M+TYA  +V+ S  + RT++D  GG NP WN   
Sbjct  2    EEGTQILEINLISAQSLKTPVANLRRMQTYAILWVDSSTKL-RTKIDHLGGENPTWNDKF  60

Query  392  KLKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKG-GGGGAADETPLGNP  568
              +        +  + ++V+IYA G++++  +G+ R+L+S  LKG    G    TP    
Sbjct  61   LFRVSPEFISGET-SGVSVEIYAVGYIKDFLIGTVRLLISSCLKGIAKHGITTATP----  115

Query  569  IQFLTVQVWRPSSRPHGLLNL  631
              F  VQV RPS R HG+LN+
Sbjct  116  -AFNAVQVRRPSGRFHGVLNI  135



>ref|XP_009591358.1| PREDICTED: uncharacterized protein LOC104088405 [Nicotiana tomentosiformis]
Length=267

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 77/141 (55%), Gaps = 9/141 (6%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVV  391
            +E  + +E+ L SA  LK  + +  +++TYA  +V+ S  + RT++D  GG NP WN   
Sbjct  3    EENTQILEINLISAQSLKTPIANFRRLQTYALIFVDSSNKL-RTKIDHFGGENPTWNDKF  61

Query  392  KLKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGG-GGGAADETPLGNP  568
              +        D  + ++V+IYA G +++  VG+ R+LLS   KG    G +  TP+   
Sbjct  62   LFRVSPKFISGDT-SGVSVEIYAVGVLKDFLVGTVRLLLSSCFKGMVNSGISTATPV---  117

Query  569  IQFLTVQVWRPSSRPHGLLNL  631
              F  VQ+ RPS R  G+LN+
Sbjct  118  --FTAVQIRRPSGRFQGVLNI  136



>gb|EPS68074.1| hypothetical protein M569_06693, partial [Genlisea aurea]
Length=233

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKF  403
            R +E+ L SA  +K    +L +++TYA  +V  +  + RTRVD  GG NP WN     + 
Sbjct  4    RILEITLISAQGIKPPSGNLRRLQTYAVTWVNPATKL-RTRVDSMGGENPTWNDKFLFRV  62

Query  404  HQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGG--AADETPLGNPIQF  577
                   D  +A++V+I+A G++++  +G+ R LLS   K  G    + +E  +G P  F
Sbjct  63   CNDFISGDT-SAVSVEIFAVGYIKDFLIGTVRFLLSSCFKRPGSVELSREEGTIGTP-AF  120

Query  578  LTVQVWRPSSRPHGLLNL  631
              VQ+ RPS R  G+LN+
Sbjct  121  TAVQIRRPSGRFQGVLNI  138



>emb|CDP08734.1| unnamed protein product [Coffea canephora]
Length=296

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 74/140 (53%), Gaps = 5/140 (4%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVV  391
            QE  + +E+ L SA  LK       +M TYA A+V+ +  + RTR D  G  NP WN   
Sbjct  17   QEGDQILEINLISAQGLKTPSGSRRRMHTYALAWVDPTAKL-RTRTDRVGAENPTWNDKF  75

Query  392  KLKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI  571
              +        +  + + V+IYA G++R+  +G+ R LLS  L G    +AD   +G P 
Sbjct  76   LFRVSSRFLACET-SGVTVEIYAVGYIRDYLIGTVRFLLSSCL-GKFPSSADAIAIGTP-  132

Query  572  QFLTVQVWRPSSRPHGLLNL  631
             F  VQ+ RPS R HG+LN+
Sbjct  133  AFTAVQIQRPSGRFHGVLNI  152



>ref|XP_009764572.1| PREDICTED: uncharacterized protein LOC104216252 [Nicotiana sylvestris]
Length=263

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 75/140 (54%), Gaps = 11/140 (8%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVV  391
            +E  + +E+ L SA  LK  + +L +M+TYA  +V  S  + RT++D  GG NP WN   
Sbjct  3    EENTQILEINLISAQSLKTPITNLRRMQTYALLWVNSSNKL-RTKIDHFGGENPTWNDKF  61

Query  392  KLKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI  571
              +        D  + ++V+IYA G +++  VG+ R+LLS   KG    A   TP     
Sbjct  62   LFRVSPKFISGDT-SGVSVEIYAVGVLKDFLVGTVRLLLSSCFKGMVNTA---TP-----  112

Query  572  QFLTVQVWRPSSRPHGLLNL  631
             F  VQ+ RPS R  G+LN+
Sbjct  113  AFTAVQIRRPSGRFQGVLNI  132



>ref|XP_007051663.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOX95820.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=266

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 73/134 (54%), Gaps = 8/134 (6%)
 Frame = +2

Query  233  IEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK     L +M+TYA A+++ SV + RT VD  GG NP WN     K   
Sbjct  7    LEITLISAQGLKEPSGKLRRMQTYALAWIDSSVKL-RTCVDRVGGENPTWNDKFLFKVSS  65

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                ++  + ++V+I+A G +R+  VG+ R L+S+ L  G    A +T       F  VQ
Sbjct  66   EFLSSET-SGISVEIFAVGVLRDSLVGTVRFLVSNFLPSGSAFNAAKTH-----SFNAVQ  119

Query  590  VWRPSSRPHGLLNL  631
            + RPS R  G+LN+
Sbjct  120  IRRPSGRFQGVLNI  133



>gb|EYU39518.1| hypothetical protein MIMGU_mgv1a007478mg [Erythranthe guttata]
Length=406

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 12/138 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH--  406
            +E+ L SA DL  +     MRTYA A+V  +  +  TR D+HG  +P WN   KL F   
Sbjct  32   LEISLISAQDLTPITK--SMRTYAIAWVNPNRKLT-TRTDQHGNTHPTWND--KLTFRVD  86

Query  407  -QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
             Q L  +D  AA+ V+IY     R+  VG+ RVL+SD++    G      P    ++F+ 
Sbjct  87   SQFLASDD--AAITVEIYTVSWFRDVLVGTVRVLISDLMSPPSGVPLQSLPKN--MRFVA  142

Query  584  VQVWRPSSRPHGLLNLWV  637
            +QV RPS  P G+LN+ V
Sbjct  143  LQVRRPSGAPQGILNMGV  160



>ref|XP_008233233.1| PREDICTED: uncharacterized protein LOC103332288 [Prunus mume]
Length=273

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 77/140 (55%), Gaps = 13/140 (9%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVV  391
            ++ +R +E+ L SA  LK     L +M+TYA A+V+ S H  R+RVD+ G +NP WN   
Sbjct  10   EDTMRVLEIHLISAQGLKAPAGTLRRMQTYALAWVD-SAHKLRSRVDKIGASNPTWNDRF  68

Query  392  KLKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI  571
              K   G   ++  +A++V IYA G  R+  VGS R L+++ L         + P     
Sbjct  69   LFKVPPGFLSSET-SAVSVQIYAVGTFRDHLVGSVRFLINNFLD-----VHSKMP-----  117

Query  572  QFLTVQVWRPSSRPHGLLNL  631
             F  VQ+ RPS R +G+LN+
Sbjct  118  SFTAVQIRRPSGRFYGVLNV  137



>gb|ABR18223.1| unknown [Picea sitchensis]
Length=304

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 72/140 (51%), Gaps = 6/140 (4%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKL  397
            + R +E+ L SA DL N   LSK + YA A++     +  RT +D+  G +P WNQV+K 
Sbjct  2    ESRSMEITLISARDLNNTNILSKTKAYAVAWISNDHRNRQRTPLDKDHGTDPTWNQVMKF  61

Query  398  KFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
               +   +   +  L + IYA     +K +G   + L++ LK  GG     T      QF
Sbjct  62   NLDEAALQQGRL-VLEIAIYADATFGDKEIGHVSIPLNEFLKPAGGNKGATTSA----QF  116

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            ++ QV +PS +  G++NL V
Sbjct  117  VSYQVRKPSGKAKGIINLSV  136



>ref|XP_006842901.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
 gb|ERN04576.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
Length=404

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 77/140 (55%), Gaps = 15/140 (11%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKNVKHLSK-MRTYAEAYVERSVHVARTRVDEHGGANPVWNQVV  391
             E+ + +EV L SA DLK + H +K + TYA A+V+    + RTRVD  G  NP WN   
Sbjct  13   SEKYQLLEVNLISAQDLKPIIHSNKTIHTYAVAWVDPRKKL-RTRVDTLGRENPTWNDKF  71

Query  392  KLKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI  571
                 Q     +  +A++++I+   ++R+   G+ R L++D++KGGG            +
Sbjct  72   IFTVDQSFLSGES-SAISIEIFYVRYLRDVLAGTVRALVADLMKGGG------------L  118

Query  572  QFLTVQVWRPSSRPHGLLNL  631
             F  +QV RPS R HG+LNL
Sbjct  119  SFAALQVRRPSGRFHGVLNL  138



>gb|ABR17336.1| unknown [Picea sitchensis]
Length=304

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 71/140 (51%), Gaps = 6/140 (4%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKL  397
            + R +E+ L SA DL N   LSK + YA A++     +  RT +D+  G +P WNQV+K 
Sbjct  2    ESRSMEITLISARDLNNTNILSKTKAYAVAWISNDHRNRQRTPLDKDHGTDPTWNQVMKF  61

Query  398  KFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
               +   +   +  L + IYA     +K +G   + L++ LK  GG     T      QF
Sbjct  62   NLDEAALQQGRL-VLEIAIYADATFGDKEIGHVSIPLNEFLKPAGGNKGATTSA----QF  116

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            ++ QV +PS +  G +NL V
Sbjct  117  VSYQVRKPSGKAKGTINLSV  136



>ref|XP_007145354.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
 gb|ESW17348.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
Length=438

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 71/137 (52%), Gaps = 6/137 (4%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL        MRTYA A+++    ++ TRVD HGG NP WN     +
Sbjct  9    QLLELHVI--SAQDLAPAGR--SMRTYAVAWIDPDRKLS-TRVDSHGGTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              Q    +D  + + +DIYA    R+  VG+A VL +D+                 ++FL
Sbjct  64   MDQDFLYDDS-SVITIDIYALHWFRDIHVGTAEVLSTDLFPPSSQPQQPNAYKSTGMRFL  122

Query  581  TVQVWRPSSRPHGLLNL  631
             +QV RPS RP G+LN+
Sbjct  123  GLQVQRPSGRPKGILNV  139



>ref|XP_010043310.1| PREDICTED: uncharacterized protein LOC104432551 [Eucalyptus grandis]
Length=355

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 71/137 (52%), Gaps = 8/137 (6%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            R +E+ L SA DL  V     MRTYA A+V     +  TRVDE G ANP WN+    + +
Sbjct  9    RLLELNLISAQDLAPVSK--SMRTYAVAWVHPDRKLT-TRVDEKGHANPNWNEKFVFRVN  65

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
                E D    + ++IYA   +R   VG+ R LLS ++          TP+    +F+T+
Sbjct  66   DVSLETDT-CVITIEIYALTWLRVVLVGTVRALLSSLIPPSTRTRTKNTPM----RFMTL  120

Query  587  QVWRPSSRPHGLLNLWV  637
            QV RPS RP G +N  V
Sbjct  121  QVLRPSGRPQGAINFGV  137



>gb|KCW85316.1| hypothetical protein EUGRSUZ_B02156 [Eucalyptus grandis]
Length=352

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 71/137 (52%), Gaps = 8/137 (6%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            R +E+ L SA DL  V     MRTYA A+V     +  TRVDE G ANP WN+    + +
Sbjct  9    RLLELNLISAQDLAPVSK--SMRTYAVAWVHPDRKLT-TRVDEKGHANPNWNEKFVFRVN  65

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
                E D    + ++IYA   +R   VG+ R LLS ++          TP+    +F+T+
Sbjct  66   DVSLETDT-CVITIEIYALTWLRVVLVGTVRALLSSLIPPSTRTRTKNTPM----RFMTL  120

Query  587  QVWRPSSRPHGLLNLWV  637
            QV RPS RP G +N  V
Sbjct  121  QVLRPSGRPQGAINFGV  137



>emb|CDP17419.1| unnamed protein product [Coffea canephora]
Length=293

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 74/134 (55%), Gaps = 7/134 (5%)
 Frame = +2

Query  233  IEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK       +M+TYA A+V+ +  + RTR D  G  NP WN++   +   
Sbjct  22   LEINLISAQGLKTPSGSRRRMQTYALAWVDPATKL-RTRTDRVGAENPTWNELFLFRVSS  80

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                 +  + + V+IYA G++R+  +G+ R LLS  L G    +AD   +G P  F  VQ
Sbjct  81   HFLACEP-SGVTVEIYAVGYIRDYLIGTVRFLLSSCL-GKFPSSAD--AIGTP-AFTAVQ  135

Query  590  VWRPSSRPHGLLNL  631
            + RPS R HG+LN+
Sbjct  136  IRRPSGRFHGVLNI  149



>emb|CDP04278.1| unnamed protein product [Coffea canephora]
Length=377

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 79/141 (56%), Gaps = 15/141 (11%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYV--ERSVHVARTRVDEHGGANPVWNQVVK  394
            QL E+ V+  SA DL  V     +RTYA A++  ER +   RTRVD+ G  NP WN    
Sbjct  7    QLLELNVI--SAQDLAPVSQ--NLRTYAVAWMNPERKL---RTRVDQQGKTNPTWNDKFV  59

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
             +  +   +++  + + +++YA G +R+ PVGS RVL+S+++        +        +
Sbjct  60   FRVDEKFLDSETSSVM-IEVYAIGWLRDTPVGSVRVLISNLIPQNVRKTNNSQ-----RR  113

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F+ +Q+ RPS RP G+LN+ V
Sbjct  114  FVALQIRRPSGRPQGILNMGV  134



>gb|ACN40336.1| unknown [Picea sitchensis]
Length=304

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 71/140 (51%), Gaps = 6/140 (4%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKL  397
            + R +E+ + SA DL N   LSK + YA A++     +  RT +D+  G +P WNQV+K 
Sbjct  2    ESRSMEITIISARDLNNTNILSKTKAYAVAWISNDHRNRQRTPLDKDHGTHPTWNQVMKF  61

Query  398  KFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
               +   +   +  L + IYA     +K +G   + L++ LK  GG     T      QF
Sbjct  62   NLDEAALQQGRL-VLEIAIYADATFGDKEIGRVSIPLNEFLKPAGGNKGATTSA----QF  116

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            ++ QV +PS +  G +NL V
Sbjct  117  VSYQVRKPSGKAKGTINLSV  136



>ref|XP_006444911.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
 ref|XP_006491213.1| PREDICTED: BON1-associated protein 2-like [Citrus sinensis]
 gb|ESR58151.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
Length=254

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 75/134 (56%), Gaps = 12/134 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E++L SA  LK+    + +M+TYA  +++ S  +  TRVD  G  +P+WN+    K   
Sbjct  6    LEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLC-TRVDRAGAESPIWNEKFLFKVTP  64

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                ++  +A++V+IYA G++R+  +G+ R L+S++        A +TP      F   Q
Sbjct  65   EFLSSET-SAISVEIYASGYLRDYLIGTVRFLVSNI----SLSVATKTP-----SFTAFQ  114

Query  590  VWRPSSRPHGLLNL  631
            + RPS R  G+L++
Sbjct  115  IRRPSGRFQGVLSI  128



>gb|KDO86360.1| hypothetical protein CISIN_1g047341mg [Citrus sinensis]
Length=254

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 75/134 (56%), Gaps = 12/134 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E++L SA  LK+    + +M+TYA  +++ S  +  TRVD  G  +P+WN+    K   
Sbjct  6    LEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLC-TRVDRAGAESPIWNEKFLFKVTP  64

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                ++  +A++V+IYA G++R+  +G+ R L+S++        A +TP      F   Q
Sbjct  65   EFLSSET-SAISVEIYASGYLRDYLIGTVRFLVSNI----SLSVATKTP-----SFTAFQ  114

Query  590  VWRPSSRPHGLLNL  631
            + RPS R  G+L++
Sbjct  115  IRRPSGRFQGVLSI  128



>ref|XP_011077059.1| PREDICTED: uncharacterized protein LOC105161156 [Sesamum indicum]
Length=397

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 73/135 (54%), Gaps = 10/135 (7%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA DL +V     +RTYA  ++  +  + +TRVD  G  NP WN     +    
Sbjct  9    LELAIISAQDLASVSR--NLRTYATTWINPNRKL-KTRVDNQGLNNPTWNDKFIFRVDDK  65

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
               N   +++ ++IYA G +R+ PVGS  VL+S+++             G+  +F+ +Q+
Sbjct  66   F-LNSATSSVMIEIYAQGWLRDTPVGSVSVLISNLI------PPSVRQEGSSRRFVALQI  118

Query  593  WRPSSRPHGLLNLWV  637
             RPS RP G+LN+ V
Sbjct  119  RRPSGRPQGILNMGV  133



>ref|XP_007218843.1| hypothetical protein PRUPE_ppa010336mg [Prunus persica]
 gb|EMJ20042.1| hypothetical protein PRUPE_ppa010336mg [Prunus persica]
Length=253

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 74/137 (54%), Gaps = 13/137 (9%)
 Frame = +2

Query  224  LREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            +R +E+ L SA  LK     L +M+TYA A+V+ S H  R+RVD+ G +NP WN     K
Sbjct  12   MRVLEIHLISAQGLKAPTGTLRRMQTYALAWVD-SAHKLRSRVDKIGASNPTWNDRFLFK  70

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
               G   ++  +A++V IY  G  R+  VGS R L+++ L         + P      F 
Sbjct  71   VPPGFLSSET-SAVSVQIYTVGTFRDHLVGSVRFLINNFLD-----VHSKMP-----SFT  119

Query  581  TVQVWRPSSRPHGLLNL  631
             VQ+ RPS R +G+LN+
Sbjct  120  AVQIRRPSGRFYGVLNV  136



>gb|KDP23730.1| hypothetical protein JCGZ_23563 [Jatropha curcas]
Length=375

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 77/141 (55%), Gaps = 18/141 (13%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYV--ERSVHVARTRVDEHGGANPVWNQVVK  394
            QL EI V+  SA DL  V     MRTYA  +V  ER +    TR+D++G  NP WN+   
Sbjct  9    QLLEINVI--SAQDLATVSK--SMRTYAVVWVHPERKL---TTRIDQNGHTNPQWNEKFV  61

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
             +      +++  +A+ ++IYA   +R+  +GS RVL+S++       +         ++
Sbjct  62   FRVDDAFLDSET-SAIMIEIYAAAWLRDVQIGSVRVLVSNLFPSNNNNSK--------MR  112

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F+ +Q+ RPS RP G+LN+ V
Sbjct  113  FVALQIRRPSGRPQGILNMGV  133



>ref|XP_002964639.1| hypothetical protein SELMODRAFT_406042 [Selaginella moellendorffii]
 gb|EFJ34972.1| hypothetical protein SELMODRAFT_406042 [Selaginella moellendorffii]
Length=174

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 78/148 (53%), Gaps = 18/148 (12%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVAR--TRVDEHGGANPVWNQVV  391
            ++ R +E+ + SA  L  V +  + R YA A+++ S H  +  T VD  GG NP WN + 
Sbjct  14   DKKRPLEIHIISAQRLSKVSYFQRTRAYAVAWID-SQHETKLSTPVDRKGGRNPSWNAI-  71

Query  392  KLKFHQGLPE----NDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPL  559
             L F+  + +    + + A + ++IY    VR+K +GS RVL++D++KG           
Sbjct  72   -LTFYVDMDDLVERHGINAGMTIEIYTKAWVRDKLIGSVRVLIADLVKGM------RESK  124

Query  560  GNPIQFLTVQVWRPSSRPHGLLNLWVPP  643
            G  + F+ +   RPS    GLLNL V P
Sbjct  125  GLCLSFMVI---RPSGLRKGLLNLGVRP  149



>gb|KFK31057.1| hypothetical protein AALP_AA6G062700 [Arabis alpina]
Length=367

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 78/144 (54%), Gaps = 11/144 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    KM+TYA A+V     +  TRVD  GGANP WN     +
Sbjct  8    QLLELNII--SAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYSGGANPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADETPLGNP-  568
              +     D  A + ++IYA    R+  VG+ RVL+S+++   +  G    DE     P 
Sbjct  63   VSEDFLYADTSAVV-IEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRTNDEYRHTPPP  121

Query  569  -IQFLTVQVWRPSSRPHGLLNLWV  637
             ++F+ +QV RPS RP G+LN+ V
Sbjct  122  GMRFVALQVRRPSGRPQGILNIGV  145



>ref|XP_002989504.1| hypothetical protein SELMODRAFT_428112 [Selaginella moellendorffii]
 gb|EFJ09380.1| hypothetical protein SELMODRAFT_428112 [Selaginella moellendorffii]
Length=174

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 75/146 (51%), Gaps = 14/146 (10%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVAR--TRVDEHGGANPVWNQVV  391
            ++ R +E+ + SA  L  V +  + R YA A+++ S H  +  T VD  GG NP WN ++
Sbjct  14   DKKRPLEIHIISAQRLSKVSYFQRTRAYAVAWID-SQHETKLSTPVDRKGGRNPSWNAIL  72

Query  392  KLKFHQG--LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGN  565
                     +  + + A + ++IY    VR+K +GS RVL++D++KG           G 
Sbjct  73   TFYVDTDDLVERHGINAGMTIEIYTKAWVRDKLIGSVRVLIADLVKGM------RESKGL  126

Query  566  PIQFLTVQVWRPSSRPHGLLNLWVPP  643
             + F+ +   RPS    GLLNL V P
Sbjct  127  CLSFMVI---RPSGLRKGLLNLGVRP  149



>ref|XP_009141305.1| PREDICTED: uncharacterized protein LOC103865261 [Brassica rapa]
Length=611

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 76/140 (54%), Gaps = 9/140 (6%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL  V    KM+TYA A+V     +  TRVD  GGANP WN     +  + 
Sbjct  10   LELNLISAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYTGGANPTWNDKFVFRVSED  66

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADETPLGNP--IQF  577
                D  A + V+IYA    R+  VG+ RVL+S+++   +  G    DE     P  ++F
Sbjct  67   FLYADTSAVV-VEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRF  125

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            + +QV RPS RP G+LN+ V
Sbjct  126  VALQVRRPSGRPQGILNIGV  145



>ref|XP_006293875.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
 gb|EOA26773.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
Length=597

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 79/144 (55%), Gaps = 11/144 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    KM+TYA A+V     +  TRVD  GGANP WN     +
Sbjct  8    QLLELNII--SAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYTGGANPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADETPLGNP-  568
              +     D  A + V+IYA    R+  VG+ RVL+S+++   +  G  + DE     P 
Sbjct  63   VSEDFLYADTSAVV-VEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPP  121

Query  569  -IQFLTVQVWRPSSRPHGLLNLWV  637
             ++F+ +QV RPS RP G+LN+ V
Sbjct  122  GMRFVALQVRRPSGRPQGILNIGV  145



>emb|CDY37732.1| BnaA04g19360D [Brassica napus]
Length=611

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 76/140 (54%), Gaps = 9/140 (6%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL  V    KM+TYA A+V     +  TRVD  GGANP WN     +  + 
Sbjct  10   LELNLISAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYTGGANPTWNDKFVFRVSED  66

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADETPLGNP--IQF  577
                D  A + V+IYA    R+  VG+ RVL+S+++   +  G    DE     P  ++F
Sbjct  67   FLYADTSAVV-VEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRF  125

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            + +QV RPS RP G+LN+ V
Sbjct  126  VALQVRRPSGRPQGILNIGV  145



>ref|XP_002881275.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57534.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=595

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 79/144 (55%), Gaps = 11/144 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    KM+TYA A+V     +  TRVD  GGANP WN     +
Sbjct  8    QLLELNII--SAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYTGGANPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADETPLGNP-  568
              +     D  A + V+IYA    R+  VG+ RVL+S+++   +  G  + DE     P 
Sbjct  63   VSEDFLYADTSAVV-VEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRSNDEYRRTPPP  121

Query  569  -IQFLTVQVWRPSSRPHGLLNLWV  637
             ++F+ +QV RPS RP G+LN+ V
Sbjct  122  GMRFVALQVRRPSGRPQGILNIGV  145



>ref|XP_006410470.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
 gb|ESQ51923.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
Length=597

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 79/144 (55%), Gaps = 11/144 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    KM+TYA A+V     +  TRVD  GGANP WN     +
Sbjct  8    QLLELNII--SAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYTGGANPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADETPLGNP-  568
              +     D  A + V+IYA    R+  VG+ RVL+S+++   +  G  + DE     P 
Sbjct  63   VSEDFLYADTSAVV-VEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRSNDEYRRTPPP  121

Query  569  -IQFLTVQVWRPSSRPHGLLNLWV  637
             ++F+ +QV RPS RP G+LN+ V
Sbjct  122  GMRFVALQVRRPSGRPQGILNIGV  145



>ref|XP_010456220.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=252

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 80/141 (57%), Gaps = 16/141 (11%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E+   +E+ L SA DLK     L +++TYA  +V+ S  + RTR+D  G  NP+WN   K
Sbjct  3    EETHVLEINLISAQDLKEPTGKLRQLQTYASVWVDSSNKL-RTRIDRIGAENPIWND--K  59

Query  395  LKFHQGLPE--NDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP  568
              F Q  PE  +   + ++++IYA G++R+  +G+ R L+S+ L      AA + P    
Sbjct  60   FVF-QVSPEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLP----TAAVKVP----  110

Query  569  IQFLTVQVWRPSSRPHGLLNL  631
               + +Q+ RPS + HG+LN+
Sbjct  111  -SLVALQIRRPSGKFHGVLNI  130



>ref|XP_009377282.1| PREDICTED: BON1-associated protein 2 [Pyrus x bretschneideri]
Length=223

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 72/134 (54%), Gaps = 13/134 (10%)
 Frame = +2

Query  233  IEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DLK     L +M+TYA A+V+ S H  R+RVD+ GG NP WN     K   
Sbjct  15   LEINLISAQDLKPPSAALRRMQTYALAWVD-SAHKIRSRVDKIGGENPTWNDRFLFKVPS  73

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                ++  + +++ IYA G   +  VG+ R+L+++ L       A + P      F  +Q
Sbjct  74   AFLSSET-SQVSIQIYAVGCFSDHLVGTVRLLINNFLD-----VASKVP-----SFTAIQ  122

Query  590  VWRPSSRPHGLLNL  631
            + RPS R  G+LN+
Sbjct  123  IRRPSGRFQGVLNV  136



>ref|XP_002276427.1| PREDICTED: uncharacterized protein LOC100258448 [Vitis vinifera]
Length=265

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 11/137 (8%)
 Frame = +2

Query  233  IEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E++L SA  LK    +L +M+TYA A+++ S +  RT+VD  G  NP WN     +   
Sbjct  6    LEIILISAQGLKPPSGNLRRMQTYAIAWID-SANKLRTQVDRVGAENPTWNDKFIFRVSS  64

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGG---GGGAADETPLGNPIQFL  580
                 D  +A+ V+IYA G +R+  +G+ R+L+S+ L          A  +P        
Sbjct  65   DFLACDT-SAVAVEIYAVGVIRDHLIGTVRILISNCLPAADLRSRNFAARSP-----SLT  118

Query  581  TVQVWRPSSRPHGLLNL  631
             VQ+ RPS R HG+LN+
Sbjct  119  AVQIRRPSGRFHGVLNV  135



>emb|CDM83636.1| unnamed protein product [Triticum aestivum]
Length=380

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 75/140 (54%), Gaps = 9/140 (6%)
 Frame = +2

Query  230  EIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            ++EV + S   LKNV      +R YA AY++ S   A TR D+ GG  P WN+ + L+  
Sbjct  50   DLEVTVVSGKHLKNVNWRRGDLRAYAVAYLDPSRRTA-TRPDDAGGCKPAWNERITLQLP  108

Query  407  QGLPENDVMAALNVDIYAHGHVREKP---VGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
              L  +D    L++D++ H    + P   VGSAR  L D+L   G   + ++P  +PI  
Sbjct  109  PHLSPHDPSLLLSLDVF-HSKPSDSPKPLVGSARSPLRDLLFPAGPNPSSDSPT-SPI--  164

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            +T+ + RPS RP G L + V
Sbjct  165  ITLPLLRPSGRPQGKLRIRV  184



>ref|XP_009350266.1| PREDICTED: uncharacterized protein LOC103941795 [Pyrus x bretschneideri]
 ref|XP_009350267.1| PREDICTED: uncharacterized protein LOC103941796 [Pyrus x bretschneideri]
Length=271

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 71/134 (53%), Gaps = 13/134 (10%)
 Frame = +2

Query  233  IEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK     L +M+TYA A+V+ S H  R+RVD+ GG NP WN     K   
Sbjct  15   LEINLVSAQGLKAPSVTLRRMQTYALAWVD-SAHKIRSRVDKVGGENPTWNDRCLFKVPS  73

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
            G   ++  + ++V IYA G  R+  VG+ R L+++ L       +   P      F  +Q
Sbjct  74   GFLSSET-SQVSVQIYAVGCFRDHLVGTVRFLINNFLD-----VSSAIP-----SFTAIQ  122

Query  590  VWRPSSRPHGLLNL  631
            + RPS R  G+LN+
Sbjct  123  IRRPSGRFRGVLNV  136



>ref|XP_001782058.1| predicted protein [Physcomitrella patens]
 gb|EDQ53122.1| predicted protein [Physcomitrella patens]
Length=269

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 71/140 (51%), Gaps = 9/140 (6%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKL  397
            ++ R+++V+L+SA  LK V   SKM  YA A++E SV V      +  G NPVWN  + +
Sbjct  2    KEARKLDVVLHSATGLKKVS-ASKMSVYAVAWIEPSVRVPSPMHLKAHGTNPVWNTTISM  60

Query  398  KFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
                    + +   LN+++  HG V  + +G   V LSD+   G  GAA  +      QF
Sbjct  61   SLDLRTLGHGMY--LNIELLGHGLVSTRRIGFVSVNLSDIFLEGSKGAAVYS------QF  112

Query  578  LTVQVWRPSSRPHGLLNLWV  637
              + V RPS R  G LN  V
Sbjct  113  HALPVRRPSGRQQGFLNFVV  132



>ref|XP_009411685.1| PREDICTED: ingression protein fic1-like [Musa acuminata subsp. 
malaccensis]
Length=286

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 67/140 (48%), Gaps = 16/140 (11%)
 Frame = +2

Query  224  LREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHV-ARTRVDEHGGANPVWNQVVKLK  400
             R +E+ L SA DLKNV   SKM  YA   +     V  RT  D  GG NP WN   +L 
Sbjct  3    FRTMEITLISAKDLKNVNVFSKMTVYAVVTISSDPRVWQRTTTDREGGRNPSWNSTHRLT  62

Query  401  FHQGLPENDVM--AALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
                   NDV     L++ +     + ++ +G  RV LSD+L G G G         P+Q
Sbjct  63   V-----PNDVAHRHFLHILLRTERALGDRDIGEVRVPLSDLLAGAGDGP-------RPVQ  110

Query  575  FLTVQV-WRPSSRPHGLLNL  631
            F++ QV    S +P G+LN 
Sbjct  111  FVSYQVHGMTSGKPKGVLNF  130



>ref|XP_001765335.1| predicted protein [Physcomitrella patens]
 gb|EDQ69798.1| predicted protein [Physcomitrella patens]
Length=153

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 74/136 (54%), Gaps = 12/136 (9%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            R++EVLL SA DLK V   +KM  YA A+V+  + V    VD   G+NPVW   + L   
Sbjct  4    RKLEVLLKSATDLKKVNK-TKMHAYAVAWVDPIIRVPGP-VDRINGSNPVWETPITLTLK  61

Query  407  -QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
             + L ++   + LN+++   G V  KP+GS  V L+++L+ G  GAA +       +++ 
Sbjct  62   GRSLGQS---SKLNIELLGLGFVSTKPIGSVVVDLAEILQQGASGAAVKK------EYVN  112

Query  584  VQVWRPSSRPHGLLNL  631
              V+ PS   HG ++ 
Sbjct  113  YPVFLPSGASHGSISF  128



>ref|NP_192029.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 emb|CAB80929.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL87353.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45098.1| unknown protein [Arabidopsis thaliana]
 gb|AEE81993.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=250

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 80/141 (57%), Gaps = 16/141 (11%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E+ + +E+ L SA  LK     L +++TYA  +V+ S  + RTR+D  G  NP+WN   K
Sbjct  2    EETQVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSSKL-RTRIDRIGSENPIWND--K  58

Query  395  LKFHQGLPE--NDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP  568
              F Q  PE  +   + ++++IYA G++R+  +G+ R L+S+ L      AA + P    
Sbjct  59   FVF-QVSPEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLP----TAAVKVP----  109

Query  569  IQFLTVQVWRPSSRPHGLLNL  631
               + +Q+ RPS + HG+LN+
Sbjct  110  -SLVALQIRRPSGKFHGVLNI  129



>ref|XP_010669605.1| PREDICTED: uncharacterized protein LOC104886787 [Beta vulgaris 
subsp. vulgaris]
Length=271

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 72/136 (53%), Gaps = 12/136 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA +LK    +L +++TYA AY+  S  + RTRVD  G  NP WN     +   
Sbjct  21   LEINLISAQNLKPPSTNLRRLQTYAVAYINPSRKL-RTRVDRLGAENPTWNDKFIFRISD  79

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                +   ++  VDI++ G +++  +GS R +LS+ +            +G P   + VQ
Sbjct  80   AFLSSQT-SSFTVDIFSVGVLKDAILGSVRFILSNCVT--------RNSIGLP-SCVAVQ  129

Query  590  VWRPSSRPHGLLNLWV  637
            + RPS R HG+LN+ V
Sbjct  130  IRRPSGRFHGVLNVGV  145



>ref|XP_010427687.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=256

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 79/141 (56%), Gaps = 16/141 (11%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E+   +E+ L SA  LK     L +++TYA  +VE S  + RTR+D  G  NP+WN   K
Sbjct  3    EETHVLEINLISAQRLKEPTGKLRRLQTYASVWVESSNKL-RTRIDRIGAENPIWND--K  59

Query  395  LKFHQGLPE--NDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP  568
              F Q  PE  +   + ++++IYA G++R+  +G+ R L+S+ L      AA + P    
Sbjct  60   FVF-QVSPEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLP----TAAVKVP----  110

Query  569  IQFLTVQVWRPSSRPHGLLNL  631
               + +Q+ RPS + HG+LN+
Sbjct  111  -SLVALQIRRPSGKFHGVLNI  130



>ref|XP_002521996.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40400.1| conserved hypothetical protein [Ricinus communis]
Length=380

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 77/143 (54%), Gaps = 21/143 (15%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYV--ERSVHVARTRVDEHGGANPVWNQVVK  394
            QL EI V+  SA DL  V     MRTYA  +V  ER +    TRVD++G  NP WN+   
Sbjct  9    QLLEINVI--SAQDLAPVSK--SMRTYAVVWVHPERKL---TTRVDQNGHTNPQWNEKFV  61

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGN--P  568
             +       N   +++ ++IYA   +R+  +GS RVL+S++           +P  N   
Sbjct  62   FRVDDTF-LNSETSSIMIEIYAAAWLRDVQIGSVRVLISNLFP---------SPTNNNSK  111

Query  569  IQFLTVQVWRPSSRPHGLLNLWV  637
            ++F+ +Q+ RPS RP G+LN+ V
Sbjct  112  MRFVALQIRRPSGRPQGILNMGV  134



>ref|XP_011077131.1| PREDICTED: uncharacterized protein LOC105161211 [Sesamum indicum]
Length=377

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 72/139 (52%), Gaps = 16/139 (12%)
 Frame = +2

Query  236  EVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG-  412
            +V L SA DL  V     MRTYA A++  +  +  TR D+ G  +P WN+    +     
Sbjct  35   DVSLISAQDLSPV--CKSMRTYAVAWINPNRKLT-TRTDQQGHTHPTWNEKFSFRVDTKS  91

Query  413  -LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGN---PIQFL  580
             + EN   +A+ V+IY     R+  VG+ RVL+SD+L    G      PL N     +F+
Sbjct  92   LISEN---SAMTVEIYTVSWFRDVLVGTVRVLISDLLAPPSG-----IPLQNLPRSTRFI  143

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS  P G+LN+ V
Sbjct  144  ALQVRRPSGAPQGILNMGV  162



>ref|XP_001758594.1| predicted protein [Physcomitrella patens]
 gb|EDQ76572.1| predicted protein [Physcomitrella patens]
Length=220

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 73/154 (47%), Gaps = 19/154 (12%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            REI V + SA DLK V    KM  Y  A++  SV V+ + +D++G A+P WN  ++L   
Sbjct  4    REILVTVISAQDLKKVNTFGKMTVYCVAWIYPSVKVS-SPMDKNGNASPTWNATLRLIAE  62

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKG-------GGGGAADETPL--  559
            + L + D  A L +D+Y HG    K VGS  + L  + K             AD+ P   
Sbjct  63   ERLVQ-DGNAVLVIDLYDHGTFGNKHVGSCTIPLQSLAKAIKPTEVEKDKDKADKVPADE  121

Query  560  --------GNPIQFLTVQVWRPSSRPHGLLNLWV  637
                     N   F++V V R S +  G LN+ +
Sbjct  122  ANASEGSSSNSANFMSVPVLRKSGKAKGTLNVSI  155



>gb|EYU38921.1| hypothetical protein MIMGU_mgv1a022778mg [Erythranthe guttata]
Length=242

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 73/136 (54%), Gaps = 6/136 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK    +L +++TYA  +++ +  + RT VD  GG NP WN     +   
Sbjct  6    LEINLISAQGLKPPSANLRRIQTYAITWIDPATKL-RTHVDSVGGENPTWNDKFLFRVSD  64

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGG--GAADETPLGNPIQFLT  583
                 D  +A+ V+I+A G++++  +G+ R LLS  LK       +A E  +G P     
Sbjct  65   EFIAGDT-SAVAVEIFAVGYIKDILIGTVRFLLSTCLKRAASPIDSAGEGSIGTP-SCTG  122

Query  584  VQVWRPSSRPHGLLNL  631
            +Q+ RPS R  G+LN+
Sbjct  123  LQIRRPSGRFQGVLNI  138



>ref|XP_011093241.1| PREDICTED: uncharacterized protein LOC105173247 [Sesamum indicum]
Length=262

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = +2

Query  233  IEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L +A  LK    +L +M+TYA  +V     + RTR+D  GG NP WN     +   
Sbjct  7    LEINLITAQGLKTPSANLRRMQTYAVIWVNPGKKL-RTRLDSLGGENPTWNDKFLFRVSN  65

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                 D  +A++V+I+A G++++  +G+ R LLS  LK     A+          F  VQ
Sbjct  66   EFISGDT-SAVSVEIFALGYIKDFLIGTVRFLLSTCLKRTIPIASAGGGSVGSSAFTAVQ  124

Query  590  VWRPSSRPHGLLNL  631
            + RPS R  G+LN+
Sbjct  125  IRRPSGRFQGVLNI  138



>emb|CDY23753.1| BnaC04g43690D [Brassica napus]
Length=610

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 75/140 (54%), Gaps = 9/140 (6%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL  V    KM+TYA A+V     +  TRVD  G ANP WN     +  + 
Sbjct  10   LELNLISAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYTGEANPTWNDKFVFRVSED  66

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADETPLGNP--IQF  577
                D  A + V+IYA    R+  VG+ RVL+S+++   +  G    DE     P  ++F
Sbjct  67   FLYADTSAVV-VEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRF  125

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            + +QV RPS RP G+LN+ V
Sbjct  126  IALQVRRPSGRPQGILNIGV  145



>ref|XP_003556915.1| PREDICTED: uncharacterized protein LOC100779058 [Glycine max]
Length=449

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 72/137 (53%), Gaps = 7/137 (5%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V     MRTYA A+++    ++ TRVD  GG NP WN     +
Sbjct  9    QLLELNVI--SAQDLAPVGR--SMRTYAIAWIDPDRKLS-TRVDSQGGTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +     D  + + +DIYA    R+  VGSA+VL  D+         + T     +QF+
Sbjct  64   VDEDF-LYDEESVITIDIYALHWFRDIHVGSAQVLSGDLFPPPTQPQKN-TYKSTGMQFM  121

Query  581  TVQVWRPSSRPHGLLNL  631
             +QV RPS RP G+LN+
Sbjct  122  GLQVQRPSGRPKGILNI  138



>ref|XP_002968005.1| hypothetical protein SELMODRAFT_440190 [Selaginella moellendorffii]
 gb|EFJ31352.1| hypothetical protein SELMODRAFT_440190 [Selaginella moellendorffii]
Length=207

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 67/145 (46%), Gaps = 13/145 (9%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            Q Q+R +E  + SA +L+ V+    M  +  AYV     V +T +D  G   P W + + 
Sbjct  16   QPQMRLLEFYVISAQELRRVRK--DMNCFVVAYVSADKKV-KTEIDFEGITEPTWQEKLS  72

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
            L+  +   + D  + L  DI+  G +R+K VG+ R+ L D +K          P   P  
Sbjct  73   LEVEEAAFKEDSNSQLTFDIFCPGFLRDKLVGTVRISLVDAVK----------PSNQPYP  122

Query  575  FLTVQVWRPSSRPHGLLNLWVPPTG  649
              +  V+ P     G+LN+ V P G
Sbjct  123  ISSYLVFTPDGDSQGMLNVCVAPGG  147



>ref|XP_004497792.1| PREDICTED: uncharacterized protein LOC101505544 [Cicer arietinum]
Length=451

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 75/140 (54%), Gaps = 9/140 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V     MRTYA A+V+    ++ TRVD HGG NP WN     +
Sbjct  9    QLLELNVI--SAQDLAPVGR--SMRTYAVAWVDPDRKLS-TRVDSHGGINPAWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGG-GGGAADETPLGNPIQF  577
                   ND  + + +DIYA    ++  VG+A VL  D++         +  P G  ++F
Sbjct  64   VDDDF-LNDENSIITIDIYALHWFKDIHVGTALVLADDIIPPSRPSHNKNYKPPG--MRF  120

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            + +QV RPS RP G+LN+ V
Sbjct  121  VGLQVRRPSGRPKGILNVGV  140



>ref|XP_009347863.1| PREDICTED: uncharacterized protein LOC103939495 [Pyrus x bretschneideri]
Length=271

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 71/134 (53%), Gaps = 13/134 (10%)
 Frame = +2

Query  233  IEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK     L +M+TYA A+V+ S H  R+R+D+ GG NP WN     K   
Sbjct  15   LEINLVSAQGLKAPSVTLRRMQTYALAWVD-SAHKIRSRLDKVGGENPTWNDRCLFKVPS  73

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
            G   ++  + ++V IYA G  R+  VG+ R L+++ L       +   P      F  +Q
Sbjct  74   GFLSSET-SQVSVQIYAVGCFRDHLVGTVRFLINNFLD-----VSSTIP-----SFTAIQ  122

Query  590  VWRPSSRPHGLLNL  631
            + RPS R  G+LN+
Sbjct  123  IRRPSGRFRGVLNV  136



>ref|XP_004308328.1| PREDICTED: uncharacterized protein LOC101301728 [Fragaria vesca 
subsp. vesca]
Length=293

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 73/140 (52%), Gaps = 15/140 (11%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E+++ +E+ L S   LK     L +M+TYA A+VE S H  RTRVD+ G  NP WN    
Sbjct  8    EKMQVLEINLISGQGLKPPSGTLRRMKTYAVAWVESS-HKIRTRVDKVGAENPTWNDRFL  66

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI-  571
             K        +  + + ++IYA G  R+  VG+ R++LS+ L            L + I 
Sbjct  67   FKVSSEFLARET-SGITIEIYAVGSFRDHLVGTVRLILSNFLD-----------LDSKIP  114

Query  572  QFLTVQVWRPSSRPHGLLNL  631
             F  +Q+ R S R HG+LN+
Sbjct  115  SFTALQIRRRSGRFHGVLNV  134



>ref|XP_011093070.1| PREDICTED: uncharacterized protein LOC105173112 [Sesamum indicum]
Length=258

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 73/138 (53%), Gaps = 6/138 (4%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKL  397
            +++ +E+ L SA  LK    +L +++TYA  ++  +  + RT  D  GG NP WN     
Sbjct  2    EMQILEIDLISAQGLKTPSGNLRRLQTYAVTWINSAAKL-RTCTDSLGGENPNWNDKFLF  60

Query  398  KFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
            +        +  +A+ V+I+  G +++  +GS R LLS  LK     A+  T  G P+ F
Sbjct  61   RVSNEFISRET-SAVAVEIFVVGRIKDILIGSVRFLLSTCLKRATPLASGST--GTPV-F  116

Query  578  LTVQVWRPSSRPHGLLNL  631
              VQ+ RPS R  G+LN+
Sbjct  117  TAVQIRRPSGRFQGVLNI  134



>gb|KDP28538.1| hypothetical protein JCGZ_14309 [Jatropha curcas]
Length=259

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 78/145 (54%), Gaps = 21/145 (14%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E+++ +E+ L SA  LK    ++ +M+TYA  +++ S  + RTRVD  G  +P+WN    
Sbjct  2    EEMKILEINLISAQGLKPPSANIRRMQTYAVVWIDSSTKL-RTRVDRVGSGDPIWNDKFL  60

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
             K        +  + + V+IYA G++R+  +G+ R+L+S++            PL  P +
Sbjct  61   FKVSPEFLAGET-SGVCVEIYAVGYLRDALLGTVRLLISNI------------PLFLPNE  107

Query  575  ------FLTVQVWRPSSRPHGLLNL  631
                  F+ +Q+ RPS R  GLLN+
Sbjct  108  RMRTPSFIALQIRRPSGRFQGLLNI  132



>ref|NP_180890.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAB80650.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08815.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=602

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 75/140 (54%), Gaps = 9/140 (6%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA DL  V    KM+TYA A+V     +  TRVD  GG NP WN     +  + 
Sbjct  10   LELNIISAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYTGGGNPTWNDKFVFRVSED  66

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGG--GGGAADETPLGNP---IQF  577
                D  A + V+IYA    R+  VG+ RVL+S+++      G  ++E     P   ++F
Sbjct  67   FLYADTSAVV-VEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNEEYRRTPPPGMRF  125

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            + +QV RPS RP G+LN+ V
Sbjct  126  VALQVRRPSGRPQGILNIGV  145



>ref|XP_002872904.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49163.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 79/141 (56%), Gaps = 16/141 (11%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E+   +E+ L SA  LK     L +++TYA  +V+ S  + RTR+D  G  NP+WN   K
Sbjct  2    EETHVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSNKL-RTRIDRIGSENPIWND--K  58

Query  395  LKFHQGLPE--NDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP  568
              F Q  PE  +   + ++++IYA G++R+  +G+ R L+S+ L      AA + P    
Sbjct  59   FVF-QVSPEFLSSETSGVSIEIYAVGYLRDHQIGTVRFLVSNFLP----TAAVKVP----  109

Query  569  IQFLTVQVWRPSSRPHGLLNL  631
               + +Q+ RPS + HG+LN+
Sbjct  110  -SLVALQIRRPSGKFHGVLNI  129



>ref|XP_006342681.1| PREDICTED: uncharacterized protein LOC102596842 [Solanum tuberosum]
Length=528

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (55%), Gaps = 6/135 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +EV + SA DL+ +    KM+TYA A+V  +  +  T VD  GG NP WN     +    
Sbjct  14   LEVNIISAQDLEPISK--KMKTYASAWVHPTRKLT-TGVDTEGGNNPTWNDKFVFRVDDE  70

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
              + D  +A+ +DI++    R+  VGS RVL+ +++         +  +G  ++F+ +Q+
Sbjct  71   FLQQDT-SAIQIDIFSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQQHHIG--MRFVALQI  127

Query  593  WRPSSRPHGLLNLWV  637
             RPS RP G+LN+ V
Sbjct  128  RRPSGRPQGILNIGV  142



>ref|XP_008441789.1| PREDICTED: uncharacterized protein LOC103485843 [Cucumis melo]
Length=361

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 74/135 (55%), Gaps = 12/135 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SANDL +V     MRT+A A++     +  TRVD+ G  NP WN+    K    
Sbjct  9    LELSLLSANDLASVSKT--MRTFAVAWINPDRKLT-TRVDQVGLTNPTWNEKFVFKVDDD  65

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
            L E D  + + ++IY+   +R+  VG+   ++S+++          +P  N ++FLT+QV
Sbjct  66   LLE-DPTSTVTIEIYSSALLRDILVGTVTEVVSNLI-------PQSSPKSN-MRFLTLQV  116

Query  593  WRPSSRPHGLLNLWV  637
             RPS RP G + + V
Sbjct  117  RRPSGRPKGTVKVGV  131



>ref|XP_006289671.1| hypothetical protein CARUB_v10003230mg [Capsella rubella]
 gb|EOA22569.1| hypothetical protein CARUB_v10003230mg [Capsella rubella]
Length=244

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 80/141 (57%), Gaps = 16/141 (11%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E+ + +E+ L SA  +K     L +++TYA  +V+ S  + RTR+D  G  NP+WN   K
Sbjct  2    EETQVLEINLISAQGIKEPTGKLRRLQTYASVWVDSSNKL-RTRIDRIGAENPIWND--K  58

Query  395  LKFHQGLPE--NDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP  568
              F Q  PE  +   + ++++IYA G++R+  +G+ R L+S+ L      AA + P    
Sbjct  59   FVF-QVSPEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLP----TAAVKVP----  109

Query  569  IQFLTVQVWRPSSRPHGLLNL  631
               + +Q+ RPS + HG+LN+
Sbjct  110  -SLVALQIRRPSGKFHGVLNI  129



>ref|XP_002511946.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50615.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 74/145 (51%), Gaps = 21/145 (14%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E  + +E+ L SA DLK     L +M+TYA  +++ +  + RTR+D  GG NP WN    
Sbjct  2    ETTKILEINLISAQDLKPPSASLRQMQTYAVVWLDSTAKL-RTRIDRVGGENPTWNDKFL  60

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
             K    +   +  + ++ +IYA G  R+  +G+ R L+S +            PL +PI+
Sbjct  61   FKVTPEILSRET-SGVSFEIYAVGCFRDPLIGTVRFLISTI------------PLPSPIK  107

Query  575  ------FLTVQVWRPSSRPHGLLNL  631
                   + +Q+ RPS R  G+LN+
Sbjct  108  PTRTPSCIALQIQRPSGRFQGVLNI  132



>ref|XP_006855523.1| hypothetical protein AMTR_s00057p00209740 [Amborella trichopoda]
 gb|ERN16990.1| hypothetical protein AMTR_s00057p00209740 [Amborella trichopoda]
Length=304

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 68/143 (48%), Gaps = 22/143 (15%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVE---RSVHVARTRVDEHGGANPVWNQVV  391
            + R ++V L SA DLK+V    KM  YA AY+    R+ H  RT +D  G  NP WN  V
Sbjct  2    EYRHLDVTLVSAKDLKDVSFFGKMEVYAVAYLSTDPRTKH--RTTIDHSGDRNPSWNFPV  59

Query  392  KLKFHQGLPENDVM---AALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLG  562
            K      +PE  +    AAL V I A   + +K VG  ++ L ++  G            
Sbjct  60   KFS----VPEAAIQQGHAALQVTIRAEKALGDKDVGEVKIPLKELFSG----------EQ  105

Query  563  NPIQFLTVQVWRPSSRPHGLLNL  631
            N  + +T QV +PS +P G L  
Sbjct  106  NTAKTVTYQVLKPSGKPKGSLTF  128



>ref|XP_010251574.1| PREDICTED: uncharacterized protein LOC104593437 [Nelumbo nucifera]
Length=269

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 73/135 (54%), Gaps = 16/135 (12%)
 Frame = +2

Query  233  IEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK    +L +M+TYA A+++ ++ + RTRVD  G  NP WN     +   
Sbjct  8    LEINLISAQGLKPPSANLRRMQTYAVAWIDSAIKL-RTRVDRVGCENPTWNDKFIFRVSS  66

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                 D  +A++V+IY  G++++  +G+ R L+ + L       +   P      F  +Q
Sbjct  67   AFLSTDT-SAVSVEIYVVGYLKDTLIGTVRFLIGNCL-------SSSAP-----TFSALQ  113

Query  590  VWRPSS-RPHGLLNL  631
            + RPSS R HG+LN+
Sbjct  114  IRRPSSGRFHGVLNI  128



>ref|XP_010413889.1| PREDICTED: uncharacterized protein LOC104700118 [Camelina sativa]
Length=596

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 11/144 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  +    KM+TYA A+V     +  TRVD  GG NP WN     +
Sbjct  8    QLLELNII--SAQDLAPLSR--KMKTYAVAWVHSERKLT-TRVDYSGGVNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADETPLGNP-  568
             ++     D  A + V+IY     R+  VG+ RVL+S+++   +  G  + DE     P 
Sbjct  63   VNEDFLYADTSAVV-VEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPP  121

Query  569  -IQFLTVQVWRPSSRPHGLLNLWV  637
             ++F+ +QV RPS RP G+LN+ V
Sbjct  122  GMRFVALQVRRPSGRPQGILNIGV  145



>ref|XP_009111426.1| PREDICTED: uncharacterized protein LOC103836878 [Brassica rapa]
Length=256

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 74/134 (55%), Gaps = 12/134 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK     L +++TYA  +V+ S  + RTR+D  G  NP+WN     +   
Sbjct  8    LEINLISAQGLKEPTGKLRRLQTYASVWVDSSTKL-RTRIDRIGAENPIWNDKFVFQVSS  66

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                ++  + ++++IYA G++R+  +G+ R L+S+ L      AA++ P       + +Q
Sbjct  67   EFLSSET-SGVSIEIYAVGYLRDHLIGTVRFLVSNFLP----TAAEKVP-----SLVALQ  116

Query  590  VWRPSSRPHGLLNL  631
            + RPS +  G+LN+
Sbjct  117  IRRPSGKFRGVLNI  130



>ref|XP_010556931.1| PREDICTED: uncharacterized protein LOC104826097 [Tarenaya hassleriana]
Length=585

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 77/142 (54%), Gaps = 11/142 (8%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA DL  V    KM+TYA A+V     +A TRVD  GG+NP WN     + ++ 
Sbjct  10   LELNIISAQDLAPVSR--KMKTYAIAWVNSERRLA-TRVDYSGGSNPTWNDKFVFRVNEE  66

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP---I  571
                D  A + ++IYA    R+  VG+ RVL+S+++    + G     +E     P   +
Sbjct  67   FLYADTSAVM-IEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTGNNEYRRSTPPPGM  125

Query  572  QFLTVQVWRPSSRPHGLLNLWV  637
            +F+ +QV R S RP G+LN+ V
Sbjct  126  RFVALQVRRTSGRPQGILNIGV  147



>ref|XP_010025828.1| PREDICTED: uncharacterized protein LOC104416088 [Eucalyptus grandis]
 gb|KCW57326.1| hypothetical protein EUGRSUZ_H00125 [Eucalyptus grandis]
Length=155

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 6/133 (5%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +++ + SA DL +V H   MRTYA A+V      + TRVD  G  NP WN        Q 
Sbjct  12   LKIDIISAQDLASVSH--SMRTYAVAWVHPDRKFS-TRVDTRGQCNPTWNDKFVFCVDQE  68

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
                +  A + V+IYA    R+  +G+ RVL+S+           +  +G  ++ + +QV
Sbjct  69   FLRRETSAVM-VEIYAVHWFRDVLIGTVRVLVSNFAPPSSWPFRRKQLIG--MRVVALQV  125

Query  593  WRPSSRPHGLLNL  631
             RPS RP G+LN+
Sbjct  126  RRPSGRPQGILNV  138



>ref|XP_003590193.1| hypothetical protein MTR_1g045780 [Medicago truncatula]
 gb|AES60444.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=459

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 74/140 (53%), Gaps = 9/140 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V     MRTYA A+V+    ++ TRVD   G NP WN     +
Sbjct  9    QLLELNVI--SAQDLAEVGR--SMRTYAVAWVDPDRKLS-TRVDSQSGTNPAWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADE-TPLGNPIQF  577
              +     D  + + +DIYA    ++  VG+A VL  D++       ++   P G  +QF
Sbjct  64   VDEDF-LYDENSTITIDIYAIHWFKDIHVGTAHVLADDIIPPSRPSHSNNYKPQG--MQF  120

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            + +QV RPS RP G+LN+ V
Sbjct  121  VGLQVHRPSGRPKGILNVGV  140



>ref|XP_010422779.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=252

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 76/139 (55%), Gaps = 12/139 (9%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E+   +E+ L SA  LK     L +++TYA  +V+ S  + RTR+D  G  NP+WN    
Sbjct  3    EETHVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSNKL-RTRIDRIGAENPIWNDKFV  61

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
             +       ++  + ++++IYA G++R+  +G+ R L+S+ L      AA + P      
Sbjct  62   FQVSPDFLSSET-SGVSIEIYAVGYLRDHLIGTVRFLVSNFLP----TAAVKVP-----S  111

Query  575  FLTVQVWRPSSRPHGLLNL  631
             + +Q+ RPS + HG+LN+
Sbjct  112  LVALQIRRPSGKFHGVLNI  130



>ref|XP_004495257.1| PREDICTED: proteoglycan 4-like [Cicer arietinum]
Length=713

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 75/140 (54%), Gaps = 9/140 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL +V     MRTYA A+V     ++ TRVD  G  NP WN     +
Sbjct  9    QLLELNVI--SAQDLASVGR--NMRTYAVAWVHPDRKLS-TRVDTQGHTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGA-ADETPLGNPIQF  577
                   ND  +A  ++IYA    ++  VG+ RVL+ +++         D  P+G  ++F
Sbjct  64   VDDEFLYNDT-SAFMIEIYALHWFKDIHVGTVRVLVGNLITPPSRPFHKDNAPIG--MRF  120

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            + +QV RPS RP G+LN+ V
Sbjct  121  VALQVRRPSGRPQGILNIGV  140



>ref|XP_010469493.1| PREDICTED: uncharacterized protein LOC104749540 [Camelina sativa]
Length=596

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 76/140 (54%), Gaps = 9/140 (6%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA DL  +    KM+TYA A+V     +  TRVD  GG NP WN     + ++ 
Sbjct  10   LELNIISAQDLAPLSR--KMKTYAVAWVHSERKLT-TRVDYTGGVNPTWNDKFVFRVNED  66

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADETPLGNP--IQF  577
                D  A + V+IY     R+  VG+ RVL+S+++   +  G  + DE     P  ++F
Sbjct  67   FLYADTSAVV-VEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRF  125

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            + +QV RPS RP G+LN+ V
Sbjct  126  VALQVRRPSGRPQGILNIGV  145



>ref|XP_010558947.1| PREDICTED: uncharacterized protein LOC104827473 [Tarenaya hassleriana]
Length=396

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 73/136 (54%), Gaps = 4/136 (3%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ + SA DL +V     M+TYA A++    +    TRVD+   ANP+WN+ +  + + 
Sbjct  11   LEINMISAQDLASVSR--NMKTYAVAWINTDPMRKLTTRVDQTNRANPIWNEKLVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
             +   D  +A+ ++IYA    ++  VGS  VLLSD+     G         N ++ +T+Q
Sbjct  69   KILNVDA-SAIVIEIYAAAWAKDALVGSINVLLSDLFAPWSGFNHGGGNGNNNMRLVTLQ  127

Query  590  VWRPSSRPHGLLNLWV  637
            + RPS R  GLL L +
Sbjct  128  IRRPSGRLQGLLRLGI  143



>ref|XP_010509905.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Camelina 
sativa]
Length=596

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 11/144 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  +    KM+TYA A+V     +  TRVD  GG NP WN     +
Sbjct  8    QLLELNII--SAQDLAPLSR--KMKTYAVAWVHSERKLT-TRVDYTGGVNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADETPLGNP-  568
             ++     D  A + V+IY     R+  VG+ RVL+S+++   +  G  + DE     P 
Sbjct  63   VNEDFLYADTSAVV-VEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPP  121

Query  569  -IQFLTVQVWRPSSRPHGLLNLWV  637
             ++F+ +QV RPS RP G+LN+ V
Sbjct  122  GMRFVALQVRRPSGRPQGILNIGV  145



>ref|XP_006396291.1| hypothetical protein EUTSA_v10028892mg [Eutrema salsugineum]
 gb|ESQ37744.1| hypothetical protein EUTSA_v10028892mg [Eutrema salsugineum]
Length=260

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 12/140 (9%)
 Frame = +2

Query  215  QEQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVV  391
            +E+   +E+ L SA  LK     L +++TYA  +V+ S  + RTR+D  G  NP+WN   
Sbjct  8    KEESHVLELNLISAQGLKEPTGKLRRLQTYASVWVDSSNKL-RTRIDRIGAENPIWNDKF  66

Query  392  KLKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI  571
              +       ++  + ++++IYA G++R+  +G+ R L+S+ L      AA + P     
Sbjct  67   VFQVSSDFLSSET-SGVSIEIYAVGYLRDHLIGTVRFLVSNFLP----TAAVKVP-----  116

Query  572  QFLTVQVWRPSSRPHGLLNL  631
              + +Q+ RPS + HG+LN+
Sbjct  117  SLVALQIRRPSGKFHGVLNI  136



>ref|XP_004297932.1| PREDICTED: uncharacterized protein LOC101311957 [Fragaria vesca 
subsp. vesca]
Length=519

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 74/139 (53%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V     MRTYA A+V     ++ TRVD HG  NP WN     +
Sbjct  8    QLLELNVI--SAQDLAPVSR--SMRTYAIAWVHPDRKLS-TRVDTHGHNNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +     D  A + ++IYA    ++  VG+ RVL+ ++++           LG  ++F+
Sbjct  63   VDEDFLHEDTSAVM-IEIYALHWFKDVHVGTIRVLVGNLIQTPAKPHHHHPQLG--MRFV  119

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  120  ALQVRRPSGRPQGILNIGV  138



>ref|XP_004253020.1| PREDICTED: uncharacterized protein LOC101244358 [Solanum lycopersicum]
Length=534

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (55%), Gaps = 6/135 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +EV + SA DL+ +    KM+TYA A+V  +  +  T VD  GG NP WN     +    
Sbjct  14   LEVNIISAQDLEPISK--KMKTYASAWVHPTRKLT-TGVDNDGGNNPTWNDKFVFRVDDE  70

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
              + D  +A+ +DI++    R+  VGS RVL+ +++         +  +G  ++F+ +Q+
Sbjct  71   FLQQDT-SAVQIDIFSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQQHHIG--MRFVALQI  127

Query  593  WRPSSRPHGLLNLWV  637
             RPS RP G+LN+ V
Sbjct  128  RRPSGRPQGILNIGV  142



>dbj|BAJ85055.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 9/140 (6%)
 Frame = +2

Query  230  EIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            ++EV + S   LKNV      +R YA AY++ S   A TR D+ GG  P WN+ + L+  
Sbjct  50   DLEVTVVSGKHLKNVNWRRGDLRAYAVAYLDPSRRTA-TRPDDAGGCKPAWNERIVLQLP  108

Query  407  QGLPENDVMAALNVDIYAHGHVREKP---VGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
              L  +D    L++D++ H    + P   VGSAR  L D+L       + ++P  +PI  
Sbjct  109  PHLSPHDPSLLLSLDVF-HSKPSDSPKPLVGSARSPLRDLLFPASPNPSSDSP-ASPI--  164

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            +T+ + RPS RP G L + V
Sbjct  165  ITLPLLRPSGRPQGKLRIRV  184



>ref|XP_004133823.1| PREDICTED: uncharacterized protein LOC101212280 [Cucumis sativus]
 ref|XP_004155854.1| PREDICTED: uncharacterized protein LOC101225970 [Cucumis sativus]
 gb|KGN56448.1| hypothetical protein Csa_3G119780 [Cucumis sativus]
Length=279

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 68/136 (50%), Gaps = 11/136 (8%)
 Frame = +2

Query  233  IEVLLYSANDLK-NVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DLK    H +   TYA A+V  S H  RTR+D  GG NP WN     +   
Sbjct  20   LEINLISAQDLKIPSNHFNPKHTYAVAWVHPS-HRLRTRLDTIGGENPTWNDKFLFRVSP  78

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                 +  + ++++IY+ G   +  VG+ R L+ +V+          TP      F  VQ
Sbjct  79   EFLARET-SGVSIEIYSLGRFCDTLVGTVRFLIGNVI---APNDCSTTP-----SFTAVQ  129

Query  590  VWRPSSRPHGLLNLWV  637
            V RPS R HG+LN+ V
Sbjct  130  VRRPSGRFHGVLNVAV  145



>gb|EYU43768.1| hypothetical protein MIMGU_mgv1a006114mg [Erythranthe guttata]
Length=456

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 72/139 (52%), Gaps = 6/139 (4%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI ++  SA DL+ V    KMRTYA A++ +S  ++   VD  G  NP WN     +
Sbjct  8    QLLEINII--SAQDLEPVSR--KMRTYATAWMHQSRKLSSC-VDNEGKTNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                    D  +A+ ++IYA    R+  VG+ RVL+ +++                ++F+
Sbjct  63   VDDEFLRQDT-SAIMIEIYATHWFRDVLVGTVRVLVGNLIPPPTRTHQQTNHYTGGMRFV  121

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  122  ALQVRRPSGRPQGILNIGV  140



>ref|XP_006418119.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
 gb|ESQ36472.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
Length=595

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 78/141 (55%), Gaps = 10/141 (7%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA DL  V    KM+TYA A+V     +  TRVD +GGANP WN     + ++ 
Sbjct  11   LELNIISAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYNGGANPTWNDKFVFRVNEE  67

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP--IQ  574
                D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P  ++
Sbjct  68   FLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMR  126

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F+ +QV R S RP G+LN+ V
Sbjct  127  FVALQVRRTSGRPQGILNIGV  147



>ref|XP_007035276.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOY06202.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=480

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 73/139 (53%), Gaps = 5/139 (4%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL+ V    KMRTYA A+V     ++ TR+D  G  NP WN     +
Sbjct  11   QLLELNVI--SAQDLEPVSR-RKMRTYAVAWVHPQRKLS-TRIDNLGHTNPTWNDKFVFR  66

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                    D  A + +++YA    R+  VG+ RV++ +++            +   ++F+
Sbjct  67   VDDEFLHGDTSAVM-IELYAVHWFRDIHVGTVRVIVGNLISPPTSRPRHRHEVQIGMRFV  125

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QVWRPS RP G+LN+ V
Sbjct  126  ALQVWRPSGRPQGILNIGV  144



>ref|XP_008362824.1| PREDICTED: uncharacterized protein LOC103426513 [Malus domestica]
 ref|XP_008362377.1| PREDICTED: uncharacterized protein LOC103426067 [Malus domestica]
Length=270

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 71/134 (53%), Gaps = 13/134 (10%)
 Frame = +2

Query  233  IEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK     L +M+TYA A+V+ S H  R+RVD+ GG NP WN     K   
Sbjct  15   LEINLISAQGLKPPSAALRRMQTYALAWVD-SAHKIRSRVDKIGGENPTWNDRFLFKVPS  73

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                ++  + +++ IYA G   +  VG+ R+L+++ L       A + P      F  +Q
Sbjct  74   AFLSSET-SQVSIQIYAVGCFSDHLVGTVRLLINNFLD-----VASKVP-----SFTAIQ  122

Query  590  VWRPSSRPHGLLNL  631
            + RPS R  G+LN+
Sbjct  123  IRRPSGRFQGVLNV  136



>ref|XP_001782642.1| predicted protein [Physcomitrella patens]
 gb|EDQ52545.1| predicted protein [Physcomitrella patens]
Length=274

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 75/143 (52%), Gaps = 18/143 (13%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLS--KMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            REIE+ + SA DLKNVK LS   M  YA A++  +  V+ T     GG  P WN V++L 
Sbjct  4    REIELTILSAQDLKNVK-LSGGAMTPYAVAWIHPNYKVS-TPEHGQGGVKPCWNSVLRLT  61

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDV----LKGGGGGAADETPLGNP  568
              +   +N   + + ++IY HG    K VG+  V LSD        G  G++++      
Sbjct  62   CDENSFQN---SRITIEIYHHGSFSNKLVGTVTVSLSDFNSQRQASGSEGSSEK------  112

Query  569  IQFLTVQVWRPSSRPHGLLNLWV  637
             +F + QV RPS +  G+LNL V
Sbjct  113  -RFGSYQVRRPSGKYQGVLNLSV  134



>ref|XP_001778275.1| predicted protein [Physcomitrella patens]
 gb|EDQ56942.1| predicted protein [Physcomitrella patens]
Length=221

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 69/138 (50%), Gaps = 17/138 (12%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSK-MRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKF  403
            RE+EV + SA DLKNVK     M  Y  A++   + V+   V+  GG NP WN ++KL  
Sbjct  5    RELEVTVLSAKDLKNVKLTGGVMNPYCVAWIYPHMKVSGA-VNNGGGVNPTWNTIIKLVA  63

Query  404  HQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
             + L +    A + V+IY HG    K +GSA V LSDV +   G               +
Sbjct  64   EESLIQQG-NANITVEIYNHGKFSNKFIGSALVSLSDVKEQSKGS--------------S  108

Query  584  VQVWRPSSRPHGLLNLWV  637
             QV + S +  GL+N+ V
Sbjct  109  YQVRKKSGKVQGLINVAV  126



>emb|CDP04279.1| unnamed protein product [Coffea canephora]
Length=345

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 69/136 (51%), Gaps = 15/136 (11%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            + + L SA DL  +     MRTYA  ++  S  +  T VD+    NP+WN+    +    
Sbjct  29   LNISLISAQDLAPISK--SMRTYAVTWIHPSRKLT-TSVDQQRHTNPLWNERFAFRVDSE  85

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLG-NPIQFLTVQ  589
               +D  AA+ V+IY     R+  VG+ RVL+SD++          TP   N  ++L +Q
Sbjct  86   FLSSD-QAAITVEIYTVSWFRDLLVGTVRVLISDLI----------TPCARNHTRYLALQ  134

Query  590  VWRPSSRPHGLLNLWV  637
            + RPS  P G+LN+ V
Sbjct  135  IRRPSGNPQGMLNMGV  150



>emb|CDY53195.1| BnaAnng12200D [Brassica napus]
Length=593

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 78/141 (55%), Gaps = 10/141 (7%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA DL  V    KM+TYA A+V     +  TRVD +GGANP WN     + ++ 
Sbjct  11   LELNIISAQDLAPVAR--KMKTYAVAWVHSERKLT-TRVDYNGGANPTWNDKFVFRVNEE  67

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP--IQ  574
                D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P  ++
Sbjct  68   FLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMR  126

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F+ +QV R S RP G+LN+ V
Sbjct  127  FVALQVRRTSGRPQGILNIGV  147



>emb|CDY59181.1| BnaC08g50140D [Brassica napus]
Length=593

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 80/145 (55%), Gaps = 12/145 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    KM+TYA A+V     +  TRVD +GGANP WN     +
Sbjct  9    QLLELNII--SAQDLAPVAR--KMKTYAVAWVHSERKLT-TRVDYNGGANPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP  568
             ++     D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P
Sbjct  64   VNEEFLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPP  122

Query  569  --IQFLTVQVWRPSSRPHGLLNLWV  637
              ++F+ +QV R S RP G+LN+ V
Sbjct  123  PGMRFVALQVRRTSGRPQGILNIGV  147



>ref|XP_009604695.1| PREDICTED: uncharacterized protein LOC104099416 [Nicotiana tomentosiformis]
Length=545

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 15/139 (11%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +EV + SA DL+ V    KM+TYA A+V  +  +  T VD  GG NP WN     +  + 
Sbjct  14   LEVNIISAQDLEPVSK--KMKTYATAWVHPTRKLT-TGVDTEGGNNPTWNDKFVFRVDEE  70

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP----IQFL  580
                D  +A+ +DIY+    R+  VGS RVL+ +++          T L +     ++F+
Sbjct  71   FLRQDT-SAVQIDIYSVHWFRDSLVGSVRVLVGNLI-------PPPTRLQHQHHIGMRFV  122

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +Q+ RPS RP G+LN+ V
Sbjct  123  ALQIRRPSGRPQGILNIGV  141



>ref|XP_009118638.1| PREDICTED: uncharacterized protein LOC103843645 [Brassica rapa]
Length=593

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 80/145 (55%), Gaps = 12/145 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    KM+TYA A+V     +  TRVD +GGANP WN     +
Sbjct  9    QLLELNII--SAQDLAPVAR--KMKTYAVAWVHSERKLT-TRVDYNGGANPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP  568
             ++     D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P
Sbjct  64   VNEEFLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPP  122

Query  569  --IQFLTVQVWRPSSRPHGLLNLWV  637
              ++F+ +QV R S RP G+LN+ V
Sbjct  123  PGMRFVALQVRRTSGRPQGILNIGV  147



>ref|XP_004152866.1| PREDICTED: uncharacterized protein LOC101218582 [Cucumis sativus]
 gb|KGN61292.1| hypothetical protein Csa_2G076000 [Cucumis sativus]
Length=360

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 74/135 (55%), Gaps = 12/135 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SANDL +V     MRT+A A++     +  TRVD+ G  NP WN+    K    
Sbjct  9    LELSLLSANDLASVSKT--MRTFAVAWINPDRKLT-TRVDQVGLTNPTWNEKFVFKVDDD  65

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
            L E D  + + ++IY+   +R+  VG+   ++S+++         ++   + ++FLT+QV
Sbjct  66   LLE-DPTSTVTIEIYSSALLRDILVGTVTEVVSNLIP--------QSSSKSNMRFLTLQV  116

Query  593  WRPSSRPHGLLNLWV  637
             RPS RP G + + V
Sbjct  117  RRPSGRPKGTVKVGV  131



>ref|XP_010522448.1| PREDICTED: uncharacterized protein LOC104801063 [Tarenaya hassleriana]
Length=580

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 76/146 (52%), Gaps = 13/146 (9%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL +V    KM+TYA A+V     +  TRVD  GG+NP WN     +
Sbjct  8    QLLELNII--SAQDLAHVSR--KMKTYAIAWVHSERKLT-TRVDYSGGSNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGG-------GGGAADETPL  559
             +      D  A + ++IYA    R+  VG+ RVL+S+++          G      + L
Sbjct  63   VNDEFLYADTSAVM-IEIYALHWFRDVHVGTVRVLISNLIPPSHRPGFRTGNNEYRRSTL  121

Query  560  GNPIQFLTVQVWRPSSRPHGLLNLWV  637
               ++F+ +QV R S RP G+LN+ V
Sbjct  122  PPGMRFVALQVRRTSGRPQGILNIGV  147



>ref|XP_002272904.1| PREDICTED: cytokinesis protein sepA-like [Vitis vinifera]
Length=291

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 10/138 (7%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVE-RSVHVARTRVDEHGGANPVWNQVVKL  397
            + R +E+ + SA DLK+V  +SKM  Y    +   S    +T VD  GG NP WN  +K 
Sbjct  2    EYRTLEINVISAKDLKDVNLISKMDVYVVVSINGDSRSKQKTPVDRDGGTNPTWNFPMKF  61

Query  398  KFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
               +   + + +  L+  +     + +K +G   V + ++L   G           PIQF
Sbjct  62   TVDESAAQQNRLT-LSFKLRCERTLGDKDIGEVNVPIKELLDPAGES--------KPIQF  112

Query  578  LTVQVWRPSSRPHGLLNL  631
            ++ QV +PS +P G LNL
Sbjct  113  VSYQVRKPSGKPKGELNL  130



>ref|XP_004247791.2| PREDICTED: uncharacterized protein LOC101245204 [Solanum lycopersicum]
Length=521

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 73/139 (53%), Gaps = 6/139 (4%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI ++  SA DL+ V    KM+TYA  +V  +  +  T VD  GG NP WN     +
Sbjct  8    QLLEINII--SAQDLEPVS--KKMKTYATVWVHPTRKLT-TAVDIEGGNNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +     D  +A+ ++I+     ++  VGS RVL+ +++        +  P    ++F+
Sbjct  63   VDEEFLRQDT-SAVQIEIHCGHWFKDSLVGSVRVLVGNLIPSPSRTHHNHHPHNLGMRFV  121

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  122  ALQVRRPSGRPQGILNIGV  140



>ref|XP_009143873.1| PREDICTED: uncharacterized protein LOC103867544 [Brassica rapa]
Length=561

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 79/146 (54%), Gaps = 15/146 (10%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA +L  V    KM+TYA A+V     +  TRVD  G ANP WN     +
Sbjct  8    QLLELNII--SAQELAPVSR--KMKTYAVAWVHSQRKLT-TRVDYTGAANPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL---KGGGGGAADE----TPL  559
              +     D  A + V+IY     R+  VG+ RVL+S+++   +  G  + +E     PL
Sbjct  63   VSEDFLYADTSAVV-VEIYTLHWFRDVHVGTIRVLISNLIPPNRRPGYRSNEEYRHTPPL  121

Query  560  GNPIQFLTVQVWRPSSRPHGLLNLWV  637
            G  ++F+ +QV RPS RP G+LN+ V
Sbjct  122  G--MRFVALQVRRPSGRPQGILNIGV  145



>ref|XP_004155136.1| PREDICTED: uncharacterized protein LOC101227028 [Cucumis sativus]
Length=360

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 74/135 (55%), Gaps = 12/135 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SANDL +V     MRT+A A++     +  TRVD+ G  NP WN+    K    
Sbjct  9    LELSLLSANDLASVSKT--MRTFAVAWINPDRKLT-TRVDQVGLTNPTWNEKFVFKVDDD  65

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
            L E D  + + ++IY+   +R+  +G+   ++S+++         ++   + ++FLT+QV
Sbjct  66   LLE-DPTSTVTIEIYSSALLRDILIGTVTEVVSNLIP--------QSSSKSNMRFLTLQV  116

Query  593  WRPSSRPHGLLNLWV  637
             RPS RP G + + V
Sbjct  117  RRPSGRPKGTVKVGV  131



>emb|CDM83573.1| unnamed protein product [Triticum aestivum]
Length=305

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 74/144 (51%), Gaps = 15/144 (10%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVKHLSK-MRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E  R +EV + SA  LK    L + ++ YA A+V+ + H  +T+ D  GG +P W++   
Sbjct  14   EDERLLEVTIISAQGLKPPSGLRRRLQAYAVAWVD-TAHRLQTQPDRSGGPDPAWHERFL  72

Query  395  LKFHQGLPENDVMAALNVDIYAHG----HV-REKPVGSARVLLSDVLKGGGGGAADETPL  559
             + H+     D  AA+ V+IYA      H+  +  +GSAR LL D             P+
Sbjct  73   FRVHEAALAEDSRAAVTVEIYASPNGAWHIGGDSLIGSARFLLGD-------NCLLSRPV  125

Query  560  GNPIQFLTVQVWRPSSRPHGLLNL  631
            G+P  F  V V RPS R HGLLN+
Sbjct  126  GSPAMF-AVGVRRPSGRVHGLLNV  148



>ref|XP_010557577.1| PREDICTED: uncharacterized protein LOC104826528 [Tarenaya hassleriana]
Length=446

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 72/136 (53%), Gaps = 14/136 (10%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA DL  V     M+TYA A+++   H   TRVD  GG NP WN     +  + 
Sbjct  12   LELNIISAQDLAPVARY--MKTYAVAWLDPQ-HKLTTRVDNTGGTNPTWNDKFVFRLDKE  68

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP-IQFLTVQ  589
                   + + ++IYA    ++  +G+ + L++D+L          +P   P ++F+T++
Sbjct  69   ALYYGTSSIMVIEIYALHWFKDIHIGTVQALITDLL----------SPTSLPAMRFVTLE  118

Query  590  VWRPSSRPHGLLNLWV  637
            V R S RPHGLLN+ V
Sbjct  119  VLRASGRPHGLLNIAV  134



>emb|CDY18242.1| BnaC05g02650D [Brassica napus]
Length=410

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 72/139 (52%), Gaps = 17/139 (12%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    KM+TYA A+V     +  TRVD + G NP WN     +
Sbjct  9    QLLELNII--SAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYNAGTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +     D  A + ++IYA    R+  VG+ RVL+S+++           P    ++F+
Sbjct  64   VDEEFLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLI-----------PPSRRMRFV  111

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV R S RP G+LN+ V
Sbjct  112  ALQVRRASGRPQGILNIGV  130



>ref|XP_010090794.1| 16 kDa phloem protein 2 [Morus notabilis]
 gb|EXB40827.1| 16 kDa phloem protein 2 [Morus notabilis]
Length=271

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 69/139 (50%), Gaps = 11/139 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVA-RTRVDEHGGANPVWNQVVKL  397
            Q R +E+ + SA DLK VKHLSKM  Y    +     +  +T VD+  G NP WN  +  
Sbjct  2    QYRPMEITIISAKDLKRVKHLSKMDVYVLVSLSGGPQIEQKTPVDKGSGPNPTWNFPMNF  61

Query  398  KFHQGLPENDVMAALNVDIYAHGHV-REKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
               +   + D +  LN  +  H  +  +K +G A V + ++L  GG G          ++
Sbjct  62   NIDEEDAKKDRL-ILNFKVMCHRRIHSDKEIGEANVPVKELLDNGGDGKF--------VK  112

Query  575  FLTVQVWRPSSRPHGLLNL  631
            ++T Q+ +P+ +  G LNL
Sbjct  113  YVTYQLKKPNGKHRGQLNL  131



>gb|KFK42792.1| hypothetical protein AALP_AA1G039700 [Arabis alpina]
Length=572

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 77/141 (55%), Gaps = 10/141 (7%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA DL  V    KM+TYA A+V     +  TRVD +GG NP WN     + ++ 
Sbjct  10   LELNIISAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYNGGPNPTWNDKFVFRVNEE  66

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP--IQ  574
                D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P  ++
Sbjct  67   FLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPDRRPGYRTSNNEYRRTPPQGMR  125

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F+ +QV R S RP G+LN+ V
Sbjct  126  FVALQVRRTSGRPQGILNIGV  146



>ref|XP_011091348.1| PREDICTED: uncharacterized protein LOC105171810 [Sesamum indicum]
Length=545

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 76/142 (54%), Gaps = 15/142 (11%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI ++  SA DL+ V    KMRTYA A++  +  ++   VD  G  +P WN     K
Sbjct  42   QLLEINII--SAQDLEPVSK--KMRTYATAWLHPNRKLSSC-VDAEGNNSPTWNDKFVFK  96

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGN---PI  571
              +     D  A + ++IYA   +R+  VG+ RVL+ +++       +    LG+    +
Sbjct  97   VEEEFLRRDTSAVM-IEIYAKQWLRDTLVGTVRVLVGNLI------PSSTRTLGHHHFGM  149

Query  572  QFLTVQVWRPSSRPHGLLNLWV  637
            +F+ +QV RPS RP G+LN+ V
Sbjct  150  RFVALQVRRPSGRPQGILNIGV  171



>ref|XP_008437926.1| PREDICTED: uncharacterized protein LOC103483209 [Cucumis melo]
 gb|ADN34173.1| c2 domain-containing protein [Cucumis melo subsp. melo]
Length=279

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 70/141 (50%), Gaps = 21/141 (15%)
 Frame = +2

Query  233  IEVLLYSANDLK------NVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            +E+ L SA DLK      N KH     TYA A++  S H  RTR+D  GG NP WN    
Sbjct  20   LEINLISAQDLKVPSNPFNPKH-----TYAVAWIHPS-HRLRTRLDTIGGENPTWNDKFL  73

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
             +        +  + ++++IY+ G   +  VG+ R L+ +V+      A   TP      
Sbjct  74   FRVSPEFLARET-SGVSIEIYSLGRFCDTLVGTVRFLIGNVVASNDCSA---TP-----A  124

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F  VQV RPS R HG+LN+ V
Sbjct  125  FTAVQVRRPSGRFHGVLNIGV  145



>ref|XP_001756871.1| predicted protein [Physcomitrella patens]
 gb|EDQ78468.1| predicted protein [Physcomitrella patens]
Length=323

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 71/135 (53%), Gaps = 10/135 (7%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            R+++++L SAN LK V H S+   YA A+++  V V  +  D++ G NPVWN  + +   
Sbjct  98   RKLDIVLQSANGLKKV-HKSRSAAYAVAWMDPGVRVP-SPFDKNHGRNPVWNATISVTLD  155

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
            +          LN+++   G V  KP+G  ++ ++D+L  G  GA+   P      FL  
Sbjct  156  ERTLGQQ--KCLNIELLGQGLVSTKPIGFVKIDMTDILLKGSQGASVHVP------FLQH  207

Query  587  QVWRPSSRPHGLLNL  631
             V+R S +  G+LN 
Sbjct  208  PVFRRSGKQRGVLNF  222



>ref|XP_009795412.1| PREDICTED: uncharacterized protein LOC104242110 [Nicotiana sylvestris]
Length=545

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 74/139 (53%), Gaps = 15/139 (11%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +EV + SA DL+ V    +M+TYA A+V  +  +  T VD  GG NP WN     +  + 
Sbjct  14   LEVNIISAQDLEPVSK--RMKTYATAWVHPTRKLT-TGVDTEGGNNPTWNDKFVFRVDEE  70

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP----IQFL  580
                D  +A+ +DIY+    R+  VGS RVL+ +++          T L +     ++F+
Sbjct  71   FLRQDT-SAVQIDIYSVHWFRDSLVGSVRVLVGNLI-------PPPTRLQHQHHIGMRFV  122

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +Q+ RPS RP G+LN+ V
Sbjct  123  ALQIRRPSGRPQGILNIGV  141



>emb|CDY48509.1| BnaA09g00140D [Brassica napus]
Length=1733

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/139 (30%), Positives = 76/139 (55%), Gaps = 12/139 (9%)
 Frame = +2

Query  218   EQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
             E+   +E+ L SA  LK     L +++TYA  +V+ S  + RTR+D  G  NP+WN    
Sbjct  1008  EESHVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSTKL-RTRIDRIGAENPIWNDKFV  1066

Query  395   LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
              +       ++  + ++++IYA G++R+  +G+ R L+S+ L      AA++ P      
Sbjct  1067  FQVSSEFLSSET-SGVSIEIYAVGYLRDHLIGTVRFLVSNFLP----TAAEKVP-----S  1116

Query  575   FLTVQVWRPSSRPHGLLNL  631
              + +Q+ RPS +  G+LN+
Sbjct  1117  LVALQIRRPSGKFRGVLNI  1135



>emb|CDX74290.1| BnaA03g27570D [Brassica napus]
Length=199

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 70/135 (52%), Gaps = 8/135 (6%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYV--ERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            +E+ + SA+DL+NV H++KM  YA   +  ++ +  A+T VD +GG+NP WN  VK   +
Sbjct  6    LELNINSASDLENVNHITKMNVYAVITLSGDKKIQKAKTGVDRYGGSNPNWNHAVKFSVN  65

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
            + L     +  L V +++   +  K +G   V L  +L    G        G+ ++F+T 
Sbjct  66   ERLAREGRL-TLVVGLFSSRLLGNKDIGEVEVPLGYLLPSTNGNGN-----GHEMKFVTY  119

Query  587  QVWRPSSRPHGLLNL  631
            QV  PS +  G L  
Sbjct  120  QVRTPSEKMKGSLTF  134



>gb|KDP46959.1| hypothetical protein JCGZ_07976 [Jatropha curcas]
Length=274

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 71/139 (51%), Gaps = 16/139 (12%)
 Frame = +2

Query  230  EIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            E+EV + SA DLKNV     ++R YA  +V+   H   TRVDE G  NP W+Q + +   
Sbjct  6    EVEVTITSAKDLKNVNWRNGRLRPYAVVWVDPE-HKCSTRVDEEGDMNPFWDQTLVIPLP  64

Query  407  QGLPENDVMAALNVDIYAHGHVRE-KP-VGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
             G  E+     L +DI   G   + KP +GSAR+ L DVL   G G              
Sbjct  65   PGPIEDHT---LYIDIVHAGREEDTKPLIGSARLKLVDVLDDVGFGER---------TVR  112

Query  581  TVQVWRPSSRPHGLLNLWV  637
            ++Q+ RPS RP G L++ V
Sbjct  113  SLQLKRPSGRPQGKLDVAV  131



>ref|XP_002314508.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF00679.1| C2 domain-containing family protein [Populus trichocarpa]
Length=460

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 75/139 (54%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  VK   KM+TYA A+V     ++ TRVD  G  NP WN     +
Sbjct  10   QLLELNVI--SAQDL--VKVSRKMKTYAVAWVHPDRRLS-TRVDSEGCNNPTWNDKFVFR  64

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                    D  A + ++IYA    R+  +G+ RV++ +++        ++  LG  ++F+
Sbjct  65   VDDRFLHGDTSAVM-IEIYALHWFRDIHIGTVRVIVGNLIPPPRPHHHNQFQLG--MRFV  121

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  122  ALQVRRPSGRPQGILNIGV  140



>ref|XP_002325345.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
 gb|EEE99726.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
Length=364

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 14/139 (10%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI V+  S  DL  V     MRTYA A+V     ++ T+VD++G  NP WN+    +
Sbjct  9    QLLEINVI--SGQDLAPVSK--SMRTYAVAWVHPGRKLS-TKVDQNGHINPQWNEKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                   N   +++ ++IYA   +R+  +GS RVL+S++               N ++F+
Sbjct  64   VDDTFI-NAENSSIMIEIYAAAWLRDVQIGSVRVLISNLFP--------SNNNNNKMRFV  114

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  115  ALQVRRPSGRPQGILNMGV  133



>gb|KDO41882.1| hypothetical protein CISIN_1g041258mg [Citrus sinensis]
Length=510

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 75/139 (54%), Gaps = 7/139 (5%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V     MRTYA A+V  +  ++ TRVD HG  NP WN     +
Sbjct  10   QLLELNII--SAQDLAPVSR--SMRTYAVAWVHPNRKLS-TRVDAHGRNNPTWNDKFVFR  64

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +    ND  A + ++I+A    R+  VG+ RVL+ +++      +   +     ++F+
Sbjct  65   VDEDFLHNDTSAVM-IEIFALHWFRDMHVGTVRVLVGNLIP-PPTRSLHHSHRSFGMRFV  122

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  123  ALQVRRPSGRPQGILNIGV  141



>ref|XP_010667096.1| PREDICTED: uncharacterized protein LOC104884184 [Beta vulgaris 
subsp. vulgaris]
Length=464

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 77/139 (55%), Gaps = 9/139 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI ++  S  D+  V     M+TYA A+V     +  TRVD +GG NP WN     +
Sbjct  5    QLLEINII--SGQDIHKVSR--SMKTYAVAWVHPDRKLT-TRVDSNGGTNPTWNDKFVFR  59

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                  ++D  +A+ ++IYA    R+  VG+ RVL+ +++      + ++  +G  ++F+
Sbjct  60   VDNRFLQSDT-SAIMIEIYALHWFRDVHVGTVRVLVGNLIP-PQTRSFNQNHIG--MRFV  115

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  116  ALQVRRPSGRPQGILNVGV  134



>ref|XP_006489752.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
Length=510

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 75/139 (54%), Gaps = 7/139 (5%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V     MRTYA A+V  +  ++ TRVD HG  NP WN     +
Sbjct  10   QLLELNII--SAQDLAPVSR--SMRTYAVAWVHPNRKLS-TRVDAHGRNNPTWNDKFVFR  64

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +    ND  A + ++I+A    R+  VG+ RVL+ +++      +   +     ++F+
Sbjct  65   VDEDFLHNDTSAVM-IEIFALHWFRDMHVGTVRVLVGNLIP-PPTRSLHHSHRSFGMRFV  122

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  123  ALQVRRPSGRPQGILNIGV  141



>gb|KCW57324.1| hypothetical protein EUGRSUZ_H00123 [Eucalyptus grandis]
Length=462

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 73/135 (54%), Gaps = 6/135 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +EV + SA DL++V     MR+YA  +V     ++ TRVD  G  NP WN     +  + 
Sbjct  12   LEVNIISAQDLRSVSR--SMRSYAVVWVHPDRKLS-TRVDTRGRRNPTWNDKFVFRVDEE  68

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
                D  A + ++IYA    R+  VG+ R+L+S++L         +  +G  ++F+ +QV
Sbjct  69   FLRCDTSAVM-IEIYAVHWFRDVLVGTIRLLVSNLLPPPSRPFRHQRHIG--MRFVALQV  125

Query  593  WRPSSRPHGLLNLWV  637
             RPS RP G+LN+ V
Sbjct  126  RRPSGRPQGILNVGV  140



>ref|XP_003590735.1| RNA-binding protein 12B [Medicago truncatula]
 gb|AES60986.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=682

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 77/140 (55%), Gaps = 9/140 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL ++     MRTYA A+V     ++ TRVD  G  NP WN     +
Sbjct  9    QLLELNVI--SAQDLASLGR--NMRTYAVAWVHPDRKLS-TRVDTQGHTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGA-ADETPLGNPIQF  577
              +    +D  +A+ V++YA    ++  VG+ RVL+ +++         D  P+G  ++F
Sbjct  64   VDEEFLYSDT-SAIMVEVYALHWFKDIHVGTVRVLVGNLIPPPTRPFHNDRAPMG--MRF  120

Query  578  LTVQVWRPSSRPHGLLNLWV  637
            + +QV RPS RP G+LN+ V
Sbjct  121  VALQVRRPSGRPQGILNIGV  140



>ref|XP_010025827.1| PREDICTED: uncharacterized protein LOC104416087 [Eucalyptus grandis]
Length=481

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 73/135 (54%), Gaps = 6/135 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +EV + SA DL++V     MR+YA  +V     ++ TRVD  G  NP WN     +  + 
Sbjct  12   LEVNIISAQDLRSVSR--SMRSYAVVWVHPDRKLS-TRVDTRGRRNPTWNDKFVFRVDEE  68

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
                D  A + ++IYA    R+  VG+ R+L+S++L         +  +G  ++F+ +QV
Sbjct  69   FLRCDTSAVM-IEIYAVHWFRDVLVGTIRLLVSNLLPPPSRPFRHQRHIG--MRFVALQV  125

Query  593  WRPSSRPHGLLNLWV  637
             RPS RP G+LN+ V
Sbjct  126  RRPSGRPQGILNVGV  140



>ref|XP_009135963.1| PREDICTED: uncharacterized protein LOC103860112 [Brassica rapa]
Length=199

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 70/135 (52%), Gaps = 8/135 (6%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYV--ERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            +E+ + SA+DL+NV H++KM  YA   +  ++ +  A+T VD +GG+NP WN  VK   +
Sbjct  6    LELNINSASDLENVNHITKMNVYAVVTLSGDKKIQKAKTGVDRYGGSNPNWNHAVKFSVN  65

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
            + L     +  L V +++   +  K +G   V L  +L    G        G+ ++F+T 
Sbjct  66   ERLAGEGRL-TLVVGLFSSRLLGNKDIGEVEVPLGYLLPSTNGNGN-----GHEMKFVTY  119

Query  587  QVWRPSSRPHGLLNL  631
            QV  PS +  G L  
Sbjct  120  QVRTPSEKMKGSLTF  134



>ref|XP_011069440.1| PREDICTED: uncharacterized protein LOC105155266 [Sesamum indicum]
Length=404

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 70/143 (49%), Gaps = 23/143 (16%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVE-RSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  +     M+TYA A++     H   TR D+ G  NP+WN     +   
Sbjct  35   LEISLISAQDLAPISK--SMQTYAMAWINPNKKHT--TRTDQQGNKNPMWNDKFVFRLTN  90

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ-----  574
             L  ++  A + V+IY     R+  VG  RVL+SD++          TPL   +Q     
Sbjct  91   ELLHSET-ATVTVEIYTVSWFRDVLVGMVRVLISDLI----------TPLIRTLQTNTKN  139

Query  575  --FLTVQVWRPSSRPHGLLNLWV  637
              F+ +QV RPS  P G+LN+ +
Sbjct  140  TRFVALQVRRPSGTPQGILNMGI  162



>ref|XP_007147256.1| hypothetical protein PHAVU_006G109100g [Phaseolus vulgaris]
 gb|ESW19250.1| hypothetical protein PHAVU_006G109100g [Phaseolus vulgaris]
Length=249

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKH-LSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK       +++TYA  ++     + RTRVD+ GG NP WN     +   
Sbjct  10   LEINLISAQGLKPPSSPRRRLQTYAVTWIHPDTKL-RTRVDKLGGHNPTWNDKFLFRVSP  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                +D  +++ + IYA G  R+  VG+ R L+S++L      A + TP      F   Q
Sbjct  69   EFLSSDT-SSICIAIYAVGTFRDHLVGTLRFLISNILS---RDADESTPC-----FSAFQ  119

Query  590  VWRPSSRPHGLLNL  631
            + RPS R HG++N+
Sbjct  120  IRRPSGRFHGVMNI  133



>ref|XP_003569491.1| PREDICTED: uncharacterized protein LOC100842238 [Brachypodium 
distachyon]
Length=306

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 74/144 (51%), Gaps = 15/144 (10%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVKHLSK-MRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E  R +EV + SA  LK    L + ++ YA A+V+ + H  +T+ D  GG +P W++   
Sbjct  14   EDERLLEVTIISAQGLKPPSGLRRRLQAYAVAWVD-AAHRLQTQPDCSGGVDPAWHERFL  72

Query  395  LKFHQGLPENDVMAALNVDIYAHG----HV-REKPVGSARVLLSDVLKGGGGGAADETPL  559
             + H+     D  AA+ V+IYA      H+  +  +GSAR LL D             P+
Sbjct  73   FRVHEAALAEDSRAAVTVEIYAAPNGAWHIGGDSLIGSARFLLGD-------NCLLSRPV  125

Query  560  GNPIQFLTVQVWRPSSRPHGLLNL  631
            G+P  F  V V RPS R HGLLN+
Sbjct  126  GSPAMF-AVGVRRPSGRVHGLLNV  148



>ref|XP_009383915.1| PREDICTED: BON1-associated protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=262

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 74/140 (53%), Gaps = 15/140 (11%)
 Frame = +2

Query  224  LREIEVLLYSANDLKNVKHLSKMRTYAEAYVE-RSVHVARTRVDEHGGANPVWNQVVKLK  400
             R +E+ L SA  LK+V  +SKM  YA   +  +      T  D  GG NP WN  ++L 
Sbjct  3    CRTLEITLVSAKGLKDVNLISKMAVYAVVSLSGKRRGRQLTPPDREGGRNPTWNSTIRLT  62

Query  401  FHQGLPENDVMA--ALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
                +P +  +A  ++++ +     +R++ VG  RV LSD+L G  GG         P+Q
Sbjct  63   ----VPVDVDLARHSIHILLRTKRALRDRDVGEVRVPLSDLLSGACGGPP-------PVQ  111

Query  575  FLTVQVWRPSS-RPHGLLNL  631
            F++ QV R +S +P+G+LN 
Sbjct  112  FVSYQVHRVTSGKPNGVLNF  131



>ref|XP_008224037.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103323799 
[Prunus mume]
Length=516

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  +     MRTYA A+V     ++ TRVD  G +NP WN     +
Sbjct  10   QLLELNVI--SAQDLAPISR--SMRTYAIAWVHPDRKLS-TRVDTQGHSNPTWNDKFVFR  64

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +     D  A + ++IYA    ++  VG+ RVL+ +++            LG  ++F+
Sbjct  65   VDEDFLHEDTSAVM-IEIYALHWFKDVHVGTVRVLVGNLIPTPAKPHHHNPQLG--MRFV  121

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  122  ALQVRRPSGRPQGILNIGV  140



>ref|XP_009792812.1| PREDICTED: uncharacterized protein LOC104239795 [Nicotiana sylvestris]
Length=404

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 67/135 (50%), Gaps = 14/135 (10%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL  V     +RTYA  +V  +     TRVD  G +NP WN     +    
Sbjct  42   LEITLISAQDLSPV--CKSLRTYALTWVNPN-RKRTTRVDNQGHSNPTWNDKFSFRVDDE  98

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
               N   +A++V+IY     R+  VG+ +VLL++++           P     +F+ +Q+
Sbjct  99   F-LNSESSAVHVEIYTVSWFRDILVGTVKVLLNNLI----------NPFDRSKKFVALQI  147

Query  593  WRPSSRPHGLLNLWV  637
             RPS  P G+LNL V
Sbjct  148  RRPSGNPQGILNLGV  162



>ref|XP_004304780.1| PREDICTED: uncharacterized protein LOC101296310 [Fragaria vesca 
subsp. vesca]
Length=457

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 16/133 (12%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL        MRT+A A+V     +  TRVD++G  NP WN+    +  + 
Sbjct  42   LEINLISAQDLTAASK--SMRTFAVAWVNPKRKLT-TRVDQNGHTNPTWNEKFVFRVGED  98

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
              ++D  + + ++IYA   +R+  VG+A +++S++               + ++F+ +Q+
Sbjct  99   FLKDDT-SKIMIEIYASAWLRDVLVGTAAIVVSNLQNN------------SKMRFVAIQL  145

Query  593  WRPSSRPHGLLNL  631
             RPS RP G+LN+
Sbjct  146  RRPSGRPQGILNV  158



>ref|XP_006358324.1| PREDICTED: uncharacterized protein LOC102592049 [Solanum tuberosum]
Length=353

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 72/135 (53%), Gaps = 9/135 (7%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL  V     +RTYA  +V  +     TRVD HG  NP WN     +    
Sbjct  38   LEITLISAQDLSPV--CKSLRTYALTWVNPN-RKRTTRVDNHGHNNPNWNDKFSFRVDDE  94

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
               +D  +A++V+IY     R+  VG+ +V+L++++      +++++      +F+ +Q+
Sbjct  95   FLSSD-SSAIHVEIYTVSWFRDILVGTVKVILNNLVNPFENTSSNQSK-----KFVALQI  148

Query  593  WRPSSRPHGLLNLWV  637
             RPS  P G+LN+ V
Sbjct  149  RRPSGNPQGILNMGV  163



>ref|XP_010105208.1| hypothetical protein L484_011265 [Morus notabilis]
 gb|EXC04073.1| hypothetical protein L484_011265 [Morus notabilis]
Length=589

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 77/147 (52%), Gaps = 16/147 (11%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V     MRTYA A+V     ++ TRVD +G  NP WN     +
Sbjct  8    QLLELNVI--SAQDLAPVSR--SMRTYAVAWVHPDRKLS-TRVDTYGHTNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--------GGGGGAADETP  556
              +     D  +A+ ++IYA    ++  VG+ R+L+ +++         G G    +   
Sbjct  63   VDEDFLHTDT-SAIMIEIYALHWFKDVHVGTVRILVGNLIPPPRAGSSFGHGHSHNNYNQ  121

Query  557  LGNPIQFLTVQVWRPSSRPHGLLNLWV  637
            LG  ++F+ +QV RPS RP G+LN+ V
Sbjct  122  LG--MRFVALQVRRPSGRPQGILNIGV  146



>ref|XP_010544424.1| PREDICTED: uncharacterized protein LOC104817045 [Tarenaya hassleriana]
Length=260

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 70/134 (52%), Gaps = 12/134 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +++ L SA  LK     L +M+TYA  +V+ S  + RTR+D  G  NP+WN     +   
Sbjct  12   LQINLISAQGLKEPSGKLRRMQTYAVVWVDPSCKL-RTRIDRIGAENPIWNDKFLFQVSA  70

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                 +  + ++++IY  G++R+  +G+ R L+S+ L            L  P   L +Q
Sbjct  71   DFLSRET-SGVSIEIYTIGYLRDHLIGTVRFLVSNFLP--------TVSLKAP-SLLALQ  120

Query  590  VWRPSSRPHGLLNL  631
            + RPS + HG+LN+
Sbjct  121  IRRPSGKFHGVLNI  134



>ref|XP_011036375.1| PREDICTED: uncharacterized protein LOC105133911 [Populus euphratica]
Length=382

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 72/135 (53%), Gaps = 12/135 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + S  DL  V     MRTYA A+V     ++ T+VD++G  NP WN+    +    
Sbjct  29   LEINVISGQDLAPVSK--SMRTYAVAWVHPGRKLS-TKVDQNGHINPQWNEKFVFRVDDT  85

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
               N   +++ ++IYA   +R+  +GS RVL+S++               N ++F+ +QV
Sbjct  86   FI-NAENSSIMIEIYAAAWLRDVQIGSVRVLISNLFP--------SNNNNNKMRFVALQV  136

Query  593  WRPSSRPHGLLNLWV  637
             RPS RP G+LN+ V
Sbjct  137  RRPSGRPQGILNMGV  151



>ref|XP_011023248.1| PREDICTED: uncharacterized protein LOC105124808 [Populus euphratica]
Length=260

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 75/146 (51%), Gaps = 25/146 (17%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKL  397
            +++ +EV L SA  LK    +L +M+TYA  +++ S  + RTR D  G  NP WN     
Sbjct  2    EMKVLEVNLISAQGLKPPSANLRRMQTYAIVWIDPSTKL-RTRTDRVGSENPTWNDKFLF  60

Query  398  KFHQGLPE--NDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI  571
            K     PE  +   + +++ IYA G +R+  +G+ R L+S++            PL  P 
Sbjct  61   KVT---PEYLSSETSGVSIQIYAIGCIRDALIGTVRFLVSNL------------PLSTPR  105

Query  572  QFLT------VQVWRPSSRPHGLLNL  631
              +T      +Q+ RPS R HG++N+
Sbjct  106  AAITMPSCIALQIRRPSGRFHGVINI  131



>ref|XP_002311697.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE89064.2| C2 domain-containing family protein [Populus trichocarpa]
Length=492

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 74/139 (53%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V    KM+TYA A++     ++ TR+D  G  NP WN     +
Sbjct  10   QLLELNVI--SAQDLAKVSR--KMKTYAVAWIHPDRKLS-TRIDSEGRNNPTWNDKFVFR  64

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                    D  A + ++IYA    R+  VG+ RV++ +++        ++  +G  ++F+
Sbjct  65   VDDRFLHGDTSAVM-IEIYALHWFRDIHVGTVRVIVGNLIPPPDPHHHNQFQIG--MRFV  121

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  122  ALQVRRPSGRPQGILNIGV  140



>gb|KDO53064.1| hypothetical protein CISIN_1g035970mg, partial [Citrus sinensis]
Length=377

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 74/137 (54%), Gaps = 10/137 (7%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            R +E+ + S +DL  V     M+TY+ A+V+    +  TRVD++G  NP WN+    +  
Sbjct  6    RVLEISIVSGHDLALVSK--SMKTYSVAWVDPERKLT-TRVDQNGLNNPSWNEKFVFRVD  62

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
                  D  +A+ ++IYA   +++  +GS RVL+S +       ++  T      +++ +
Sbjct  63   DRF-LTDETSAIMIEIYAAAWLKDALIGSVRVLISHLFGTLTHNSSSST------RYVAL  115

Query  587  QVWRPSSRPHGLLNLWV  637
            QV RPS RP G+LNL +
Sbjct  116  QVRRPSGRPQGILNLGI  132



>ref|XP_006437469.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
 ref|XP_006484674.1| PREDICTED: haze protective factor 1-like [Citrus sinensis]
 gb|ESR50709.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
Length=393

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 74/137 (54%), Gaps = 10/137 (7%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            R +E+ + S +DL  V     M+TY+ A+V+    +  TRVD++G  NP WN+    +  
Sbjct  6    RVLEISIVSGHDLALVSK--SMKTYSVAWVDPERKLT-TRVDQNGLNNPSWNEKFVFRVD  62

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
                  D  +A+ ++IYA   +++  +GS RVL+S +       ++  T      +++ +
Sbjct  63   DRF-LTDETSAIMIEIYAAAWLKDALIGSVRVLISHLFGTLTHNSSSST------RYVAL  115

Query  587  QVWRPSSRPHGLLNLWV  637
            QV RPS RP G+LNL +
Sbjct  116  QVRRPSGRPQGILNLGI  132



>ref|NP_001043768.1| Os01g0659800 [Oryza sativa Japonica Group]
 dbj|BAB85273.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC06299.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05682.1| Os01g0659800 [Oryza sativa Japonica Group]
 dbj|BAG98870.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71214.1| hypothetical protein OsI_03139 [Oryza sativa Indica Group]
Length=296

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 76/145 (52%), Gaps = 16/145 (11%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVKHLSK--MRTYAEAYVERSVHVARTRVDEHGGANPVWNQVV  391
            E  R +EV L SA  LK    L +  ++ YA A+V+ +  + +TR D  GG +P W++ +
Sbjct  16   EGERILEVTLISAQGLKPPSGLRRRLLQAYAVAWVDAARRL-QTRPDRAGGVDPEWHERL  74

Query  392  KLKFHQGLPENDVMAALNVDIYAHG----HV-REKPVGSARVLLSDVLKGGGGGAADETP  556
              + H+    +D  AA+ V+IYA      H+  +  VGSAR LL D             P
Sbjct  75   LFRVHEAALADDSRAAVTVEIYAAPAGGWHIGGDSLVGSARFLLGD-------HGLLSRP  127

Query  557  LGNPIQFLTVQVWRPSSRPHGLLNL  631
            +G+P  F  V V RPS R HGLLN+
Sbjct  128  VGSPSMF-AVGVRRPSGRVHGLLNV  151



>ref|XP_002301388.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
 gb|EEE80661.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
Length=243

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 13/140 (9%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKL  397
            +++ +E+ L SA  LK    +L +M+TYA  +++ S  + RTR D  G  NP WN     
Sbjct  2    EMKVLEINLISAQGLKPPSANLRRMQTYAIVWIDPSTKL-RTRTDRVGSENPTWNDKFLF  60

Query  398  KFHQGLPE--NDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI  571
            K     PE  +   + ++++IYA G +R+  +G+ R L+ + L+     AA   P     
Sbjct  61   KVT---PEYLSSETSGVSIEIYAIGCIRDALIGTVRFLVGN-LRLSTPSAAITMP-----  111

Query  572  QFLTVQVWRPSSRPHGLLNL  631
              + +Q+ RPS R HG++N+
Sbjct  112  SCIALQIRRPSGRFHGVINI  131



>ref|XP_004508275.1| PREDICTED: uncharacterized protein LOC101495376 [Cicer arietinum]
Length=215

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (49%), Gaps = 13/141 (9%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVE-RSVHVARTR--VDEHGGANPVWNQVV  391
            + +  E+ L SA DLKNV   +KM  YA   +    +H   T+  +D+  G NP WN  V
Sbjct  2    EYKTFELNLTSAKDLKNVNLFAKMEVYAVVSISGDPLHTQNTKTPIDKESGTNPAWNFPV  61

Query  392  KLKFHQGLP-ENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP  568
            KL F++ L  +N +   +N+   A     +K +GS ++ L ++    G G +        
Sbjct  62   KLTFNETLARQNRLTLEINLRC-ARNLAADKDIGSVQIPLRELQNHTGDGKS--------  112

Query  569  IQFLTVQVWRPSSRPHGLLNL  631
             Q ++ QV +PS +P G  N 
Sbjct  113  FQHVSYQVRKPSGKPKGAFNF  133



>ref|XP_002872084.1| hypothetical protein ARALYDRAFT_910412 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48343.1| hypothetical protein ARALYDRAFT_910412 [Arabidopsis lyrata subsp. 
lyrata]
Length=239

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 72/140 (51%), Gaps = 16/140 (11%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKF  403
            RE+EV + SA D+KNV       + YA  +V+ + + + TRV+E G   P WN+   +  
Sbjct  6    REVEVTISSAKDIKNVNWRNGPNKPYAVVWVDPT-YKSSTRVEEDGDTCPTWNETFVIPL  64

Query  404  HQGLPENDVMAALNVDI-YAHGHVREKP-VGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
                P ND    + +DI +A G    KP +GSA + L DV+        D+   G P   
Sbjct  65   P---PANDDDDKVYIDIVHAGGEKNTKPLIGSAHLSLRDVI--------DDVGFGVPF-M  112

Query  578  LTVQVWRPSSRPHGLLNLWV  637
             T+++ RPS RPHG L L V
Sbjct  113  KTLKLKRPSGRPHGKLELTV  132



>ref|XP_006577334.1| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=208

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 11/134 (8%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKH-LSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  +K       +++TYA  +++ +  + RTRVD+ GG NP WN        +
Sbjct  11   LEINLISAQGMKPPSSPRRRLQTYAVTWIDPATKL-RTRVDKLGGHNPTWNDKFLFGVTK  69

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                 D  +++ V IYA G  R   VG+ R L+S++       A D TP      F   Q
Sbjct  70   DFLAGDT-SSVCVAIYAVGTFRHHLVGTVRFLISNMFS---PDADDATPC-----FSAFQ  120

Query  590  VWRPSSRPHGLLNL  631
            + RPS R HG++N+
Sbjct  121  IRRPSGRFHGVMNI  134



>ref|XP_010485810.1| PREDICTED: putative lysozyme-like protein [Camelina sativa]
Length=391

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  V     M+TY+ A++    +    TRVD+   ANP+WN+    + + 
Sbjct  11   LEINLISAQDLAPVSR--NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             + + D  +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILDADA-SAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>tpg|DAA55958.1| TPA: hypothetical protein ZEAMMB73_567157 [Zea mays]
Length=321

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 17/139 (12%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYVE---RSVHVARTRVDEHGGANPVWNQVVKL  397
            R +E+ L SA DLK+V  LSKM  YA A +    RS    R + D  GG NP WN  ++ 
Sbjct  5    RPLELTLISAKDLKDVNLLSKMEVYAVASLSGDPRSRQ--RIQADRAGGRNPTWNATLRF  62

Query  398  KFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
                 +P     ++L++ + A   + ++ VG   + LS++L G     A + P+  P +F
Sbjct  63   ----AVPATGASSSLHILLRAERALGDRDVGEVHIPLSELLSG-----APDGPV--PAKF  111

Query  578  LTVQVWRPSS-RPHGLLNL  631
            +  QV + SS +P G+LNL
Sbjct  112  VAYQVRKISSGKPQGVLNL  130



>ref|XP_004494776.1| PREDICTED: uncharacterized protein LOC101496947 [Cicer arietinum]
Length=260

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 11/134 (8%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKH-LSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK       + +TYA  +++ S  + RT+VD+ GG NP WN     +   
Sbjct  11   LEINLISAQGLKPPSSPRRRFQTYALTWIDSSTKL-RTQVDKIGGQNPTWNDKFLFRVTP  69

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                ++  + + V IYA G  R+  VG+ R L S++L   GG   + TP      F   Q
Sbjct  70   EFLASET-SGVCVAIYAVGTFRDHIVGTVRFLTSNILSSDGG---NRTPC-----FSACQ  120

Query  590  VWRPSSRPHGLLNL  631
            + R S R HG++N+
Sbjct  121  IRRESGRFHGVMNI  134



>emb|CDY07180.1| BnaCnng01950D [Brassica napus]
Length=1640

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 42/139 (30%), Positives = 76/139 (55%), Gaps = 12/139 (9%)
 Frame = +2

Query  218   EQLREIEVLLYSANDLKN-VKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
             E+   +E+ L SA  LK     L +++TYA  +V+ S  + RTR+D  G  NP+WN    
Sbjct  1012  EESHVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSDKL-RTRIDRIGAENPIWNDKFV  1070

Query  395   LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
              +       ++  + ++++IYA G++R+  +G+ R L+S+ L      AA++ P      
Sbjct  1071  FQVSSEFLSSET-SGVSIEIYAVGYLRDHLIGTVRFLVSNFLP----TAAEKVP-----S  1120

Query  575   FLTVQVWRPSSRPHGLLNL  631
              + +Q+ RPS +  G+LN+
Sbjct  1121  LVALQIRRPSGKFRGVLNI  1139



>ref|XP_002319115.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
 gb|EEE95038.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
Length=383

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 72/139 (52%), Gaps = 14/139 (10%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI V+  S  DL  V     MRTYA  +V     ++ T+VD++G  NP WN+    +
Sbjct  9    QLLEINVI--SGQDLAPVS--KSMRTYAIVWVHPGRKLS-TKVDQNGHTNPQWNEKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                   N   +++ +++YA   +R+  +GS  VL+S++               N ++F+
Sbjct  64   VDDTFI-NAENSSIMIEVYAAAWLRDVQIGSVNVLISNLFPSHNNN--------NKMRFV  114

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LNL V
Sbjct  115  ALQVRRPSGRPQGILNLGV  133



>ref|XP_010055064.1| PREDICTED: uncharacterized protein LOC104443389 [Eucalyptus grandis]
 gb|KCW71540.1| hypothetical protein EUGRSUZ_E00081 [Eucalyptus grandis]
Length=267

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 74/136 (54%), Gaps = 12/136 (9%)
 Frame = +2

Query  233  IEVLLYSANDLKNV-KHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA +LK    ++ +  TY+  +V+ S  + RTR+D  G  NP WN   K  F  
Sbjct  12   LELHLISAQNLKPPPANMRRTETYSLVWVDPSTKL-RTRLDRVGSDNPTWND--KFFFRV  68

Query  410  GLPE--NDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            G P+  +   +A+ V+IYA G++R+  VGS R+LLS VL         + P      F  
Sbjct  69   G-PDFLSSHTSAVTVEIYAVGYIRDYLVGSVRLLLSTVLSWPDFVGNSKLPY-----FTA  122

Query  584  VQVWRPSSRPHGLLNL  631
            V + RPS + HG+LN+
Sbjct  123  VGIRRPSGKIHGVLNI  138



>gb|KDP27783.1| hypothetical protein JCGZ_18863 [Jatropha curcas]
Length=311

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 66/139 (47%), Gaps = 13/139 (9%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYV----ERSVHVARTRVDEHGGANPVWNQVVK  394
            R +E+ L SA DLK+V   SKM  YA   +    ++     +T VD  GG NP WN   K
Sbjct  4    RTLEINLISAKDLKDVNLFSKMDVYAVVSISGDSQQPKQKIKTPVDHDGGTNPTWNFPAK  63

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQ  574
                +  P       L +++     + +K +G   V + ++L+  G G +        +Q
Sbjct  64   FTILEA-PAQQNRLILVINLRCERALGDKDIGEVNVPIKELLETMGDGKS--------MQ  114

Query  575  FLTVQVWRPSSRPHGLLNL  631
            F++ QV +PS +P G LN 
Sbjct  115  FVSYQVRKPSGKPKGQLNF  133



>ref|XP_010060582.1| PREDICTED: uncharacterized protein LOC104448451 [Eucalyptus grandis]
Length=297

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 72/139 (52%), Gaps = 16/139 (12%)
 Frame = +2

Query  230  EIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            E+EV + SA DLKNV       R YA  +V+ S   + TRVDE    +PVW+Q + +   
Sbjct  6    ELEVTVSSAKDLKNVNWRQGPTRPYAVLWVDPSKKCS-TRVDEENDTSPVWDQTLVIPLP  64

Query  407  QGLPENDVMAALNVDIYAHGHVRE-KP-VGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
             G  E+   A L +D+   G   + KP +GSAR+ L DVL   G G A +  L       
Sbjct  65   PGPIED---ATLYIDVVHAGSEEDTKPLIGSARLKLRDVLDDAGFGEALKRGL-------  114

Query  581  TVQVWRPSSRPHGLLNLWV  637
              Q+ RPS RPHG + + V
Sbjct  115  --QLKRPSGRPHGKVEVKV  131



>ref|XP_011029742.1| PREDICTED: uncharacterized protein LOC105129399 [Populus euphratica]
Length=492

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 74/139 (53%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V    KM+TYA A++     ++ TR+D  G  NP WN     +
Sbjct  10   QLLELNVI--SAQDLAKVSR--KMKTYAVAWIHPDRKLS-TRIDSEGRNNPTWNDKFVFR  64

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                    D  A + ++IYA    R+  VG+ RV++ +++        ++  +G  ++F+
Sbjct  65   VDDRFLHGDTSAVM-IEIYALHWFRDIHVGTVRVIVGNLIPPPDPHHHNQFQIG--MRFV  121

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  122  ALQVRRPSGRPKGILNIGV  140



>ref|XP_009625035.1| PREDICTED: uncharacterized protein LOC104115988 [Nicotiana tomentosiformis]
Length=406

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 67/135 (50%), Gaps = 14/135 (10%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL  V     +RTYA  +V  +     TRVD  G +NP WN     +    
Sbjct  44   LEITLISAQDLSPV--CKSLRTYALTWVNPN-RKRTTRVDNQGHSNPTWNDKFSFRVDDE  100

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
               N   +A++V+IY     R+  VG+ +VLL++++           P     +F+ +Q+
Sbjct  101  F-LNSESSAVHVEIYTVSWFRDILVGTVKVLLNNLIN----------PYDRSKKFVALQI  149

Query  593  WRPSSRPHGLLNLWV  637
             RPS  P G+LNL V
Sbjct  150  RRPSGNPQGILNLGV  164



>ref|XP_010463915.1| PREDICTED: uncharacterized protein LOC104744544 [Camelina sativa]
Length=392

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  V     M+TY+ A++    +    TRVD+   ANP+WN+    + + 
Sbjct  11   LEINLISAQDLAPVSR--NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             + + D  +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILDADA-SAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>ref|XP_011038591.1| PREDICTED: uncharacterized protein LOC105135426 [Populus euphratica]
Length=367

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 73/139 (53%), Gaps = 14/139 (10%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI V+  S  DL  V     MRTYA  +V     ++ T+VD++G  NP WN+    +
Sbjct  9    QLLEINVI--SGQDLAPVSK--SMRTYAIVWVHPGRKLS-TKVDQNGHTNPQWNEKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              + +  N   +++ +++YA   +R+  +GS  VL+S++               N + F+
Sbjct  64   VDE-IFINAENSSIMIEVYAAAWLRDVQIGSVNVLISNLFPSHNNN--------NKMHFV  114

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LNL V
Sbjct  115  ALQVRRPSGRPQGILNLGV  133



>ref|XP_006645033.1| PREDICTED: protein enabled homolog [Oryza brachyantha]
Length=324

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 9/138 (7%)
 Frame = +2

Query  230  EIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            ++EV + S   LKNV      +R Y  AY++ S  V+ TR D+ GG  P WN+ + L   
Sbjct  50   DLEVTVVSGKHLKNVNWRRGDLRAYVIAYLDPSRRVS-TRPDDVGGCKPAWNERIVLPLP  108

Query  407  QGLPENDVMAALNVDIYAHGHVREKP---VGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
              L  +D    L++D++ H    + P   VGSAR  L D+L       + ++P  +    
Sbjct  109  PHLSAHDPSLLLSLDVF-HSKPSDSPKPLVGSARSPLRDLLFSTNPNPSPDSPASS---L  164

Query  578  LTVQVWRPSSRPHGLLNL  631
            +T+ + RPS RP G L +
Sbjct  165  ITLPLLRPSGRPQGKLRI  182



>ref|XP_010550541.1| PREDICTED: uncharacterized protein LOC104821382 [Tarenaya hassleriana]
Length=269

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 13/140 (9%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKF  403
            +E+EV + SA D+KNV       + YA  +V+     + TRVDE G  +P WN+ + +  
Sbjct  5    KEVEVAISSAKDIKNVNWRHGPNKPYAVVWVDPRYKCS-TRVDEEGDTSPHWNETLAIPL  63

Query  404  HQGLPENDVMAALNVDIYAHGHVRE-KP-VGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
                P +D    L +DI   G   + KP +GSAR+ L DVL        +E+ +G P   
Sbjct  64   PPEKPVDDDDNVLCIDIVHAGREEDTKPLIGSARLSLRDVL--------EESGVGVPT-V  114

Query  578  LTVQVWRPSSRPHGLLNLWV  637
             ++++ RPS RPHG L + V
Sbjct  115  KSLKLKRPSGRPHGKLEVTV  134



>ref|XP_004985379.1| PREDICTED: uncharacterized protein LOC101774194 isoform X2 [Setaria 
italica]
Length=292

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 81/156 (52%), Gaps = 24/156 (15%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVKHLSK-MRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E  R +EV L SA  LK    L + ++ YA A+V+ + H  +TR D  GG +P W+  + 
Sbjct  14   EGERLLEVTLISAQGLKPPSGLRRRLQAYAVAWVD-AGHKLQTRPDASGGLDPAWHARLL  72

Query  395  LKFHQGLPENDVMAALNVDIYAHG----HV-REKPVGSARVLLSD--VLKGGGGGAADET  553
             +  +    +D  AA+ V+IYA      H+  +  VGSAR LL D  +L+          
Sbjct  73   FRVREASLADDSRAAVTVEIYAAAAGSWHLGGDSLVGSARFLLGDHRLLR---------R  123

Query  554  PLGNPIQFLTVQVWRPSSRPHGLLNL-----WVPPT  646
            P+G+P  F  V V RPS R HGLLNL      VPP+
Sbjct  124  PVGSPSMF-AVGVRRPSGRVHGLLNLAASLVAVPPS  158



>gb|KCW90655.1| hypothetical protein EUGRSUZ_A02756 [Eucalyptus grandis]
Length=290

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 72/139 (52%), Gaps = 16/139 (12%)
 Frame = +2

Query  230  EIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            E+EV + SA DLKNV       R YA  +V+ S   + TRVDE    +PVW+Q + +   
Sbjct  6    ELEVTVSSAKDLKNVNWRQGPTRPYAVLWVDPSKKCS-TRVDEENDTSPVWDQTLVIPLP  64

Query  407  QGLPENDVMAALNVDIYAHGHVRE-KP-VGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
             G  E+   A L +D+   G   + KP +GSAR+ L DVL   G G A +  L       
Sbjct  65   PGPIED---ATLYIDVVHAGSEEDTKPLIGSARLKLRDVLDDAGFGEALKRGL-------  114

Query  581  TVQVWRPSSRPHGLLNLWV  637
              Q+ RPS RPHG + + V
Sbjct  115  --QLKRPSGRPHGKVEVKV  131



>ref|XP_010025284.1| PREDICTED: uncharacterized protein LOC104415652, partial [Eucalyptus 
grandis]
Length=195

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 73/138 (53%), Gaps = 14/138 (10%)
 Frame = +2

Query  230  EIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            E+EV   SA DLKNV       R YA  + + +   + T VD+ G ANPVWNQ + +  H
Sbjct  7    ELEVTASSAKDLKNVNWRHGPTRPYAVLWADPNNKWS-TLVDDEGDANPVWNQTLVMPLH  65

Query  407  QGLPENDVMAALNVDIYAHGHVREKP-VGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
             G P  D    ++V ++A      +P +GSAR+ L  VL        DE   GNP+   +
Sbjct  66   LG-PIRDATFYIDV-VHAGSEEDTEPLIGSARLNLRHVL--------DEVGFGNPLG-RS  114

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS RPHG + + V
Sbjct  115  LQLKRPSGRPHGKVEVRV  132



>ref|XP_008366882.1| PREDICTED: uncharacterized protein LOC103430513 [Malus domestica]
Length=395

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 71/133 (53%), Gaps = 16/133 (12%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL        MRT+A A+V     +  TRVD++G  NP WN+    +  + 
Sbjct  12   LEINLISAQDLTPASK--AMRTFAVAWVNPQRKLT-TRVDQNGHTNPTWNEKFVFRVDED  68

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
               +D  + + ++IYA   +R+  +G+A V+++++               + ++F+ +Q+
Sbjct  69   FLRDDT-SKIMIEIYASAWLRDVLIGTAAVVVNNLQNK------------SKMRFMAIQL  115

Query  593  WRPSSRPHGLLNL  631
             RPS RP G+LN+
Sbjct  116  RRPSGRPQGILNI  128



>ref|XP_002315561.1| shock protein SRC2 [Populus trichocarpa]
 gb|EEF01732.1| shock protein SRC2 [Populus trichocarpa]
Length=289

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 69/142 (49%), Gaps = 17/142 (12%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYV------ERSVHVARTRVDEHGGANPVWNQV  388
            R +E+ + SA DLK+V ++SKM  YA   +      ++     +T VD  GG NP WN  
Sbjct  4    RTLEINVISARDLKDVNYISKMDVYAVVSISGVDSKQQPKQKTKTPVDRDGGKNPTWNFP  63

Query  389  VKLKF-HQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGN  565
            +K       L EN +  +L   +     + +K +G   V + ++L   G G +       
Sbjct  64   IKFTIPETSLAENHL--SLVFKLKCERALGDKDIGEVNVPIKELLDSAGDGKS-------  114

Query  566  PIQFLTVQVWRPSSRPHGLLNL  631
             ++F++ QV +PS +P G +N 
Sbjct  115  -MKFVSYQVRKPSGKPKGEINF  135



>ref|XP_009804994.1| PREDICTED: uncharacterized protein DDB_G0292186-like [Nicotiana 
sylvestris]
Length=526

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 75/139 (54%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI ++  SA DL+      KM+TYA A+V  +  +  T VD  GG NP WN     +
Sbjct  14   QLLEINII--SAQDLEPTSK--KMKTYATAWVHPTRKLT-TGVDVEGGNNPTWNDKFVFR  68

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +     D  +A++++I++    R+  VG+ RVL+ +++            LG  ++F+
Sbjct  69   VDEEFLRQDT-SAVHIEIFSVHWFRDSLVGTVRVLVRNLIPPIRAHGHHNHHLG--MRFV  125

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +Q+ RPS RP G+LN+ V
Sbjct  126  ALQIRRPSGRPQGILNIGV  144



>ref|XP_006297897.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
 gb|EOA30795.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
Length=382

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  V     M+TY+ A++    +    TRVD+   ANP+WN+    + + 
Sbjct  11   LEINLISAQDLAPVSR--NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             + + D  +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILDFDA-SAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDCGGRNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>ref|XP_007226487.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
 gb|EMJ27686.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
Length=492

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 72/139 (52%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  +     MRTYA A+V     ++ TRVD  G  NP WN     +
Sbjct  10   QLLELNVI--SAQDLAPISR--SMRTYAIAWVHPDRKLS-TRVDTQGHNNPTWNDKFVFR  64

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +     D  A + ++IYA    ++  VG+ RVL+ +++            LG  ++F+
Sbjct  65   VDEDFLHEDTSAVM-IEIYALHWFKDVHVGTVRVLVGNLIPTPAKPHHHNPHLG--MRFV  121

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  122  ALQVRRPSGRPQGILNIGV  140



>ref|XP_009119477.1| PREDICTED: uncharacterized protein LOC103844449 [Brassica rapa]
Length=561

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 10/141 (7%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA DL  V    KM+TYA A+V     +  TRVD + G NP WN     +  + 
Sbjct  11   LELNIISAQDLAPVSR--KMKTYAVAWVHSERKLT-TRVDYNAGTNPTWNDKFVFRVDEE  67

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP--IQ  574
                D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P  ++
Sbjct  68   FLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYHRTPPQGMR  126

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F+ +QV R S RP G+LN+ V
Sbjct  127  FVALQVRRASGRPQGILNIGV  147



>ref|XP_004985378.1| PREDICTED: uncharacterized protein LOC101774194 isoform X1 [Setaria 
italica]
Length=304

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 81/156 (52%), Gaps = 24/156 (15%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVKHLSK-MRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVK  394
            E  R +EV L SA  LK    L + ++ YA A+V+ + H  +TR D  GG +P W+  + 
Sbjct  14   EGERLLEVTLISAQGLKPPSGLRRRLQAYAVAWVD-AGHKLQTRPDASGGLDPAWHARLL  72

Query  395  LKFHQGLPENDVMAALNVDIYAHG----HV-REKPVGSARVLLSD--VLKGGGGGAADET  553
             +  +    +D  AA+ V+IYA      H+  +  VGSAR LL D  +L+          
Sbjct  73   FRVREASLADDSRAAVTVEIYAAAAGSWHLGGDSLVGSARFLLGDHRLLR---------R  123

Query  554  PLGNPIQFLTVQVWRPSSRPHGLLNL-----WVPPT  646
            P+G+P  F  V V RPS R HGLLNL      VPP+
Sbjct  124  PVGSPSMF-AVGVRRPSGRVHGLLNLAASLVAVPPS  158



>ref|XP_006303752.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
 gb|EOA36650.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
Length=600

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 80/147 (54%), Gaps = 16/147 (11%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYV--ERSVHVARTRVDEHGGANPVWNQVVK  394
            QL E+ ++  SA DL  V    K +TYA A+V  ER +    TRVD +GG NP WN    
Sbjct  9    QLLELNII--SAQDLAPVAR--KTKTYAVAWVHPERKL---TTRVDYNGGTNPTWNDKFV  61

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLG  562
             + ++     D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E    
Sbjct  62   FRVNEDFLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRT  120

Query  563  NP--IQFLTVQVWRPSSRPHGLLNLWV  637
             P  ++F+ +QV R S RP G+LN+ V
Sbjct  121  PPPGMRFVALQVRRSSGRPQGILNIGV  147



>ref|XP_010483923.1| PREDICTED: uncharacterized protein LOC104762347 [Camelina sativa]
Length=601

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 78/145 (54%), Gaps = 12/145 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    K +TYA A+V     +  TRVD +GG NP WN     +
Sbjct  9    QLLELNII--SAQDLAPVAR--KTKTYAVAWVHSERKLT-TRVDYNGGTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP  568
             ++     D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P
Sbjct  64   VNEEFLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPP  122

Query  569  --IQFLTVQVWRPSSRPHGLLNLWV  637
              ++F+ +QV R S RP G+LN+ V
Sbjct  123  PGMRFVALQVRRTSGRPQGILNIGV  147



>ref|XP_002889512.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65771.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 78/145 (54%), Gaps = 12/145 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    K +TYA A+V     +  TRVD +GG NP WN     +
Sbjct  9    QLLELNII--SAQDLAPVAR--KTKTYAVAWVHSERKLT-TRVDYNGGTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP  568
             ++     D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P
Sbjct  64   VNEEFLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPP  122

Query  569  --IQFLTVQVWRPSSRPHGLLNLWV  637
              ++F+ +QV R S RP G+LN+ V
Sbjct  123  PGMRFVALQVRRTSGRPQGILNIGV  147



>gb|AAB80639.1| Contains similarity to Glycine SRC2 (gb|AB000130) [Arabidopsis 
thaliana]
Length=578

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 76/141 (54%), Gaps = 10/141 (7%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA DL  V    K +TYA A+V     +  TRVD +GG NP WN     + ++ 
Sbjct  8    LELNIISAQDLAPVAR--KTKTYAVAWVHSERKLT-TRVDYNGGTNPTWNDKFVFRVNEE  64

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP--IQ  574
                D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P  ++
Sbjct  65   FLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMR  123

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F+ +QV R S RP G+LN+ V
Sbjct  124  FVALQVRRTSGRPQGILNIGV  144



>emb|CDO99320.1| unnamed protein product [Coffea canephora]
Length=518

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 76/146 (52%), Gaps = 23/146 (16%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI V+  SA DL+ V    KM+TYA A+V  S  ++ +RVD  G  NP WN     +
Sbjct  9    QLLEINVI--SAQDLEPVSR--KMKTYATAWVNSSRKLS-SRVDSGGHVNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP----  568
              +     D  +A+ ++I+A    ++  VG+ RVL+ +++           PL       
Sbjct  64   VDEDFLRQDT-SAVQIEIHAVHWFKDTLVGTVRVLVGNLI----------PPLLRSRHHN  112

Query  569  ---IQFLTVQVWRPSSRPHGLLNLWV  637
               ++F+ +QV RPS RP G+LN+ V
Sbjct  113  HIGMRFVALQVRRPSGRPQGILNIGV  138



>ref|XP_006420366.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
 gb|ESR33606.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
Length=497

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 74/139 (53%), Gaps = 7/139 (5%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V     MR YA A+V  +  ++ TRVD HG  NP WN     +
Sbjct  10   QLLELNII--SAQDLAPVSR--SMRAYAVAWVHPNRKLS-TRVDAHGRNNPTWNDKFVFR  64

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +    ND  A + ++I+A    R+  VG+ RVL+ +++      +   +     ++F+
Sbjct  65   VDEDFLHNDTSAVM-IEIFALHWFRDMHVGTVRVLVGNLIP-PPTRSLHHSHRSFGMRFV  122

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  123  ALQVRRPSGRPQGILNIGV  141



>emb|CDX81442.1| BnaC09g08530D [Brassica napus]
Length=408

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 21/138 (15%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     KF   
Sbjct  10   LEMNIISAQELAPVARC--MKTYAVAWIDPERKLT-TRVDNTGGTSPTWND----KFVFR  62

Query  413  LPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            L E    D  + + ++IYA    ++  VG+ + L+SD++    G           ++F+T
Sbjct  63   LDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSSG-----------MRFVT  111

Query  584  VQVWRPSSRPHGLLNLWV  637
            ++V R S RPHGLLN+ V
Sbjct  112  LEVLRASGRPHGLLNIAV  129



>ref|NP_171948.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE27711.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=601

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 78/145 (54%), Gaps = 12/145 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    K +TYA A+V     +  TRVD +GG NP WN     +
Sbjct  9    QLLELNII--SAQDLAPVAR--KTKTYAVAWVHSERKLT-TRVDYNGGTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP  568
             ++     D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P
Sbjct  64   VNEEFLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPP  122

Query  569  --IQFLTVQVWRPSSRPHGLLNLWV  637
              ++F+ +QV R S RP G+LN+ V
Sbjct  123  PGMRFVALQVRRTSGRPQGILNIGV  147



>ref|XP_009385178.1| PREDICTED: uncharacterized protein LOC103972545 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 69/145 (48%), Gaps = 31/145 (21%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +EV + SA DL        MRTYA AY  R  H ARTR+D  G  +P WN     +    
Sbjct  41   LEVTVISAQDLYPAAR--SMRTYAVAYF-RPDHRARTRIDASGHTDPTWNDKFVFRVDDA  97

Query  413  LPENDVMAALNVDIYAHGHVREKP---------VGSARVLLSDVLKGGGGGAADETPLGN  565
            +  +D  +A+ +D+YA     ++P         +G+AR LLS +                
Sbjct  98   VLHSDT-SAITIDVYA-----DRPGLLPGPDILLGTARALLSTLRPSSA-----------  140

Query  566  PIQFLTVQVWRPSS-RPHGLLNLWV  637
             I +  +Q+ RP+S RP G+LNL V
Sbjct  141  -IHYAALQIRRPASLRPQGILNLGV  164



>emb|CDY37207.1| BnaA09g08280D [Brassica napus]
Length=407

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 21/138 (15%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     KF   
Sbjct  10   LEMNIISAQELAPVARC--MKTYAVAWIDPERKLT-TRVDNTGGTSPTWND----KFVFR  62

Query  413  LPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            L E    D  + + ++IYA    ++  VG+ + L+SD++    G           ++F+T
Sbjct  63   LDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSSG-----------MRFVT  111

Query  584  VQVWRPSSRPHGLLNLWV  637
            ++V R S RPHGLLN+ V
Sbjct  112  LEVLRASGRPHGLLNIAV  129



>ref|XP_009112245.1| PREDICTED: uncharacterized protein LOC103837642 [Brassica rapa]
Length=407

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 21/138 (15%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     KF   
Sbjct  10   LEMNIISAQELAPVARC--MKTYAVAWIDPERKLT-TRVDNTGGTSPTWND----KFVFR  62

Query  413  LPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            L E    D  + + ++IYA    ++  VG+ + L+SD++    G           ++F+T
Sbjct  63   LDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSSG-----------MRFVT  111

Query  584  VQVWRPSSRPHGLLNLWV  637
            ++V R S RPHGLLN+ V
Sbjct  112  LEVLRASGRPHGLLNIAV  129



>emb|CDY37206.1| BnaA09g08270D [Brassica napus]
Length=407

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 21/138 (15%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     KF   
Sbjct  10   LEMNIISAQELAPVARC--MKTYAVAWIDPERKLT-TRVDNTGGTSPTWND----KFVFR  62

Query  413  LPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            L E    D  + + ++IYA    ++  VG+ + L+SD++    G           ++F+T
Sbjct  63   LDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSSG-----------MRFVT  111

Query  584  VQVWRPSSRPHGLLNLWV  637
            ++V R S RPHGLLN+ V
Sbjct  112  LEVLRASGRPHGLLNIAV  129



>ref|XP_003555498.1| PREDICTED: uncharacterized protein LOC100812185 [Glycine max]
Length=642

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 75/138 (54%), Gaps = 9/138 (7%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  +     MRTYA ++V     ++ TRVD  G  NP WN     +
Sbjct  9    QLLELNVI--SAQDLAPLGR--NMRTYAVSWVHPDRKLS-TRVDSEGHTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGA-ADETPLGNPIQF  577
              +    +D  +A+ ++IYA    ++  VG+ RVL+ ++          + TPLG  ++F
Sbjct  64   VDEEFLYSDT-SAIMIEIYALHWFKDIHVGTVRVLVGNLAPPPSKPFHNNRTPLG--MRF  120

Query  578  LTVQVWRPSSRPHGLLNL  631
            + +QV RPS RP G+LN+
Sbjct  121  IALQVRRPSGRPQGILNI  138



>emb|CDY72474.1| BnaCnng77840D [Brassica napus]
Length=209

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 70/135 (52%), Gaps = 8/135 (6%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYV--ERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            +E+ + SA+DL+ V H++KM  YA   +  ++ +   +T VD HGG+NP WN  VK   +
Sbjct  6    LELNINSASDLEYVNHITKMNVYAVVTLLGDKKIQKVKTAVDRHGGSNPNWNHAVKFAVN  65

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
            + L     +  L V +++   + +K +G   + L  +L    G +      G+ ++F+T 
Sbjct  66   ERLAREGRL-TLVVGLFSGRVLGDKDIGKVEIPLVYLLPSTNGNSN-----GHGMKFVTY  119

Query  587  QVWRPSSRPHGLLNL  631
            QV  PS R  G L  
Sbjct  120  QVRTPSERMKGSLTF  134



>ref|XP_002884443.1| hypothetical protein ARALYDRAFT_477695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60702.1| hypothetical protein ARALYDRAFT_477695 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  V     M+TY+ A++    +    TRVD+   ANP+WN+    + + 
Sbjct  11   LEINLISAQDLAPVSR--NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             + + D  +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILDVDA-SAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>ref|XP_011041447.1| PREDICTED: uncharacterized protein LOC105137420 [Populus euphratica]
Length=459

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  VK   KM+TYA A+V     ++ TRV   G  NP WN     +
Sbjct  10   QLLELNVI--SAQDL--VKVSRKMKTYAVAWVHPDRRLS-TRVTSEGCNNPTWNDKFVFR  64

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                    D  A + ++IYA    R+  +G+ RV++ +++        ++  LG  ++F+
Sbjct  65   VDDRFLHGDTSAVM-IEIYALHWFRDIHIGTVRVIVGNLIPPPRPHHHNQFQLG--MRFV  121

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  122  ALQVRRPSGRPQGILNIGV  140



>ref|XP_008388740.1| PREDICTED: uncharacterized protein LOC103451084 [Malus domestica]
Length=395

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 71/133 (53%), Gaps = 16/133 (12%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL        MRT+A A+V     +  TRVD++G  NP WN+    +  + 
Sbjct  12   LEINLISAQDLTPASK--AMRTFAVAWVNPQRKLT-TRVDQNGHTNPTWNEKFVFRVDED  68

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
               +D  + + ++IYA   +R+  +G+A V+++++               + ++F+ +Q+
Sbjct  69   FLRDDT-SKIMIEIYASAWLRDVLIGTAAVVVNNLQNK------------SKMRFMAIQL  115

Query  593  WRPSSRPHGLLNL  631
             RPS RP G+LN+
Sbjct  116  RRPSGRPXGILNI  128



>ref|XP_010457504.1| PREDICTED: uncharacterized protein LOC104738975 [Camelina sativa]
Length=600

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 78/145 (54%), Gaps = 12/145 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    K +TYA A+V     +  TRVD +GG NP WN     +
Sbjct  9    QLLELNII--SAQDLAPVAR--KTKTYAVAWVHSERKLT-TRVDYNGGTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP  568
             ++     D  A + ++IYA    R+  VG+ RVL+S+++    + G   + +E     P
Sbjct  64   VNEEFLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPP  122

Query  569  --IQFLTVQVWRPSSRPHGLLNLWV  637
              ++F+ +QV R S RP G+LN+ V
Sbjct  123  PGMRFVALQVRRTSGRPQGILNIGV  147



>ref|XP_003564634.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Brachypodium 
distachyon]
Length=326

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 71/139 (51%), Gaps = 12/139 (9%)
 Frame = +2

Query  230  EIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            ++EV++ S   LKNV      +R YA AY++ S   A TR D+ GG  P WN+ + L   
Sbjct  49   DLEVIVVSGKHLKNVNWRRGDLRAYAVAYLDPSRRTA-TRPDDAGGCKPAWNERIVLPLP  107

Query  407  QGLPENDVMAALNVDIYAHGHVREKP---VGSARVLLSDVLKGGGGGAADETPLGNPIQ-  574
              L  +D    L++D++ H    + P   VGSAR  L ++L       A+  P  + +  
Sbjct  108  PHLSPHDPSLLLSIDVF-HSKPSDSPKPLVGSARSPLRELLF-----PANPNPSSDSVSP  161

Query  575  FLTVQVWRPSSRPHGLLNL  631
             +T+ + RPS RP G L +
Sbjct  162  LITLPLLRPSGRPQGKLRI  180



>ref|XP_008798687.1| PREDICTED: uncharacterized protein LOC103713510 [Phoenix dactylifera]
Length=238

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 70/135 (52%), Gaps = 11/135 (8%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA  LK    L +++ YA A+V+ +  V RTRVD  GG NP WN     +   G
Sbjct  6    LEINLISAQGLKPPFGLRRVQAYAVAWVDPAFKV-RTRVDRTGGENPTWNDKFIFRVPAG  64

Query  413  LPENDVMAALNVDIY-AHGHVREKP-VGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
               +D  +A++++IY A G +   P +G+ R+L+ ++       A           F  V
Sbjct  65   FLADDSTSAVSIEIYAAAGWILPDPLLGTVRLLVGNLRLLSRRRACP--------AFDAV  116

Query  587  QVWRPSSRPHGLLNL  631
             + RPS R HG+LN+
Sbjct  117  GIRRPSGRFHGILNV  131



>ref|XP_007030351.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY10853.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=370

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 70/137 (51%), Gaps = 6/137 (4%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            R +E+ L SA DL  V     M+TYA A+V+   H   T +D+ G  +P WN+    +  
Sbjct  9    RILEINLISAEDLAPVSK--NMKTYAVAWVQPD-HKLATGIDQTGRTDPSWNEKFMFRLD  65

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
                 N   AA+ V+IYA   V++  +G   VL+ D+        AD     +  + +T+
Sbjct  66   DKF-LNSEDAAIVVEIYAAAWVKDVLIGYVNVLIKDIFHLRS--IADAKINYSATRTVTL  122

Query  587  QVWRPSSRPHGLLNLWV  637
            Q+ RPS RP G+LN+ V
Sbjct  123  QIRRPSGRPQGILNMEV  139



>gb|AAM67146.1| unknown [Arabidopsis thaliana]
Length=391

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 73/138 (53%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  V     M+TY+ A++    +    TRVD+   ANP+WN+    + + 
Sbjct  11   LEINLISAQDLAPVSR--NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             + + D  +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILDVDA-SAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L +
Sbjct  128  LQIRRPSGRLQGFLRLGI  145



>gb|AAF26778.1|AC016829_2 hypothetical protein [Arabidopsis thaliana]
Length=353

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 72/139 (52%), Gaps = 6/139 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  V     M+TY+ A++    +    TRVD+   ANP+WN+    + + 
Sbjct  11   LEINLISAQDLAPVSR--NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             +   D  +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILYVDA-SAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWVP  640
            +Q+ RPS R  G L L V 
Sbjct  128  LQIRRPSGRLQGFLRLGVA  146



>gb|EAY76529.1| hypothetical protein OsI_04471 [Oryza sativa Indica Group]
Length=327

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 68/138 (49%), Gaps = 9/138 (7%)
 Frame = +2

Query  230  EIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            ++EV + S   LKNV      +R Y  AY++ S   A TR D+ GG  P WN+ V L   
Sbjct  49   DLEVTVVSGKHLKNVNWRRGDLRAYVVAYLDPSRRAA-TRPDDVGGCKPAWNERVVLPLP  107

Query  407  QGLPENDVMAALNVDIYAHGHVREKP---VGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
              L  +D    L++D++ H    + P   VGSAR  L D+L       + ++P       
Sbjct  108  PHLSPHDPSLLLSLDVF-HSKPSDSPKPLVGSARSPLRDLLFSTNPNPSPDSPAS---AL  163

Query  578  LTVQVWRPSSRPHGLLNL  631
            +T+ + RPS RP G L +
Sbjct  164  ITLPLLRPSGRPQGKLRI  181



>ref|NP_001044834.1| Os01g0853800 [Oryza sativa Japonica Group]
 dbj|BAB84404.1| C2 domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF06748.1| Os01g0853800 [Oryza sativa Japonica Group]
 dbj|BAG91284.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97448.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97596.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97625.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55687.1| hypothetical protein OsJ_04108 [Oryza sativa Japonica Group]
Length=327

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 68/138 (49%), Gaps = 9/138 (7%)
 Frame = +2

Query  230  EIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            ++EV + S   LKNV      +R Y  AY++ S   A TR D+ GG  P WN+ V L   
Sbjct  49   DLEVTVVSGKHLKNVNWRRGDLRAYVVAYLDPSRRAA-TRPDDVGGCKPAWNERVVLPLP  107

Query  407  QGLPENDVMAALNVDIYAHGHVREKP---VGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
              L  +D    L++D++ H    + P   VGSAR  L D+L       + ++P       
Sbjct  108  PHLSPHDPSLLLSLDVF-HSKPSDSPKPLVGSARSPLRDLLFSTNPNPSPDSPAS---AL  163

Query  578  LTVQVWRPSSRPHGLLNL  631
            +T+ + RPS RP G L +
Sbjct  164  ITLPLLRPSGRPQGKLRI  181



>ref|XP_006300066.1| hypothetical protein CARUB_v10016294mg [Capsella rubella]
 gb|EOA32964.1| hypothetical protein CARUB_v10016294mg [Capsella rubella]
Length=404

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 15/135 (11%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG  P WN     +  + 
Sbjct  10   LELNIISAQELAPVARC--MKTYAIAWIDPERKLM-TRVDNTGGTTPTWNDKFVFRLDEE  66

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
               +D    + ++IYA    ++  VG+ + L+SD++                ++F+T++V
Sbjct  67   TTYDDTTIVV-IEIYALHWFKDIHVGTVQALISDLVSPSSA-----------MRFVTLEV  114

Query  593  WRPSSRPHGLLNLWV  637
             R S RPHGLLN+ V
Sbjct  115  LRASGRPHGLLNIAV  129



>emb|CDX92066.1| BnaC03g33680D [Brassica napus]
Length=383

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 73/139 (53%), Gaps = 6/139 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  V     M+TY+ A++    +    TRVD+   +NP+WN+    + + 
Sbjct  11   LEINLISAQDLSLVSK--NMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
               + DV +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KTLQADV-SAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWVP  640
            +Q+ RPS R  G L L V 
Sbjct  128  LQIRRPSGRLQGFLRLGVA  146



>ref|XP_008218351.1| PREDICTED: uncharacterized protein LOC103318712 [Prunus mume]
Length=417

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 71/133 (53%), Gaps = 16/133 (12%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL        MRT+A A+V     +  TRVD++G  NP WN+    +    
Sbjct  13   LEINLISAQDLYPASK--SMRTFAVAWVNPKRKLT-TRVDQNGHTNPTWNEKFVFRVDDE  69

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
              ++D  + + ++IYA   +R+  +G+A V+++++               + ++F+ +Q+
Sbjct  70   FLKDDT-SKIMIEIYASAWLRDVLIGTAAVVVNNLQNK------------SKMRFMAIQL  116

Query  593  WRPSSRPHGLLNL  631
             RPS RP G+LN+
Sbjct  117  RRPSGRPQGILNI  129



>ref|XP_009134757.1| PREDICTED: uncharacterized protein LOC103859027 [Brassica rapa]
Length=397

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  V     M+TY+ A++    +    TRVD+   +NP+WN+    + + 
Sbjct  11   LEINLISAQDLSLVSK--NMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
               + DV +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KTLQADV-SAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>emb|CDX87149.1| BnaC09g04640D [Brassica napus]
Length=214

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 72/140 (51%), Gaps = 13/140 (9%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVK-HLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKF  403
            RE+EV + SA D+KNV       + YA  +++     + TRVDE     P WNQ   +  
Sbjct  6    REVEVTISSAKDIKNVNWRNGPNKPYAVVWIDPKYKFS-TRVDEEDDTCPSWNQTFVIPL  64

Query  404  HQGLPENDVMAALNVDI-YAHGHVREKP-VGSARVLLSDVLKGGGGGAADETPLGNPIQF  577
              G  ++     + +D+ +A G    KP +GSA + L DV+        D+   G P++ 
Sbjct  65   PPGNDDDYEDDKVYIDVVHAGGEENTKPLIGSANLSLRDVI--------DDAGFGVPVE-  115

Query  578  LTVQVWRPSSRPHGLLNLWV  637
             T+++ RPS RPHG L++ V
Sbjct  116  KTLKLKRPSGRPHGKLDVTV  135



>ref|XP_002885870.1| hypothetical protein ARALYDRAFT_480303 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62129.1| hypothetical protein ARALYDRAFT_480303 [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 72/138 (52%), Gaps = 21/138 (15%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     KF   
Sbjct  10   LELNIISAQELAPVARC--MKTYAIAWIDPERKLT-TRVDNTGGTSPTWND----KFVFR  62

Query  413  LPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            L E    D  + + ++IYA    ++  VG+ + L+SD++                ++F+T
Sbjct  63   LDEEALYDATSIVVIEIYALHWFKDIHVGTVQTLISDLVSPSSA-----------MRFVT  111

Query  584  VQVWRPSSRPHGLLNLWV  637
            ++V R S RPHGLLN+ V
Sbjct  112  LEVLRASGRPHGLLNIAV  129



>ref|XP_007205372.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
 gb|EMJ06571.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
Length=375

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 71/133 (53%), Gaps = 16/133 (12%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL        MRT+A A+V     +  TRVD++G  NP WN+    +    
Sbjct  13   LEINLISAQDLYPASK--SMRTFAVAWVNPQRKLT-TRVDQNGHTNPTWNEKFVFRVDDE  69

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
              ++D  + + ++IYA   +R+  +G+A V+++++               + ++F+ +Q+
Sbjct  70   FLKDDT-SKIMIEIYASAWLRDVLIGTAAVVVNNLQNK------------SKMRFMAIQL  116

Query  593  WRPSSRPHGLLNL  631
             RPS RP G+LN+
Sbjct  117  RRPSGRPQGILNI  129



>ref|NP_178968.1| C2 domain-containing protein [Arabidopsis thaliana]
 gb|AAD28670.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM15260.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAC43170.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63412.1| At2g13350 [Arabidopsis thaliana]
 gb|AEC06226.1| C2 domain-containing protein [Arabidopsis thaliana]
Length=401

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 72/138 (52%), Gaps = 21/138 (15%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     KF   
Sbjct  10   LELNIISAQELAPVARC--MKTYAIAWIDPERKLT-TRVDNTGGTSPTWND----KFVFR  62

Query  413  LPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            L E    D  + + ++IYA    ++  VG+ + L+SD++                ++F+T
Sbjct  63   LDEEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSSA-----------MRFVT  111

Query  584  VQVWRPSSRPHGLLNLWV  637
            ++V R S RPHGLLN+ V
Sbjct  112  LEVLRASGRPHGLLNIAV  129



>ref|XP_008340669.1| PREDICTED: uncharacterized protein LOC103403599 [Malus domestica]
Length=533

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 73/139 (53%), Gaps = 8/139 (6%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  +     MRTYA A+V     ++ TRVD  G  NP WN     +
Sbjct  10   QLLELNVI--SAQDLAPISR--SMRTYAIAWVHPDRKLS-TRVDTSGHNNPTWNDKFVFR  64

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +    +D  A + ++IY     ++  VG+ RVL+ ++++           +G  ++F+
Sbjct  65   VDEDFLHDDTSAVM-IEIYVLHWFKDVHVGTVRVLVGNLIQTSTRPYHHHPQVG--MRFV  121

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  122  ALQVRRPSGRPQGILNIGV  140



>ref|XP_010269468.1| PREDICTED: abl interactor homolog [Nelumbo nucifera]
Length=278

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 69/140 (49%), Gaps = 14/140 (10%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVE---RSVHVARTRVDEHGGANPVWNQVV  391
            + R +++ + SA DLK+V   SKM  YA   +    RS H  +T +D+ GG +P WN  +
Sbjct  2    EYRTLDITVISAKDLKDVNLFSKMDVYAVVSLSGDSRSKH--KTPIDKDGGTSPSWNFPM  59

Query  392  KLKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI  571
            K    +   + + +  L  ++     + +K +G   V + ++L        D T  G   
Sbjct  60   KFTVDEAAAKQNRLM-LVFELRCDRSLGDKDIGQVHVPVKELL--------DNTGDGKSA  110

Query  572  QFLTVQVWRPSSRPHGLLNL  631
            QF++ QV +PS +P G LN 
Sbjct  111  QFVSYQVRKPSGKPKGTLNF  130



>ref|XP_010475114.1| PREDICTED: uncharacterized protein LOC104754591 [Camelina sativa]
Length=600

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 77/145 (53%), Gaps = 12/145 (8%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ ++  SA DL  V    K +TYA A+V     +  TRVD +GG NP WN     +
Sbjct  9    QLLELNII--SAQDLAPVAR--KTKTYAVAWVHSERKLT-TRVDYNGGTNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVL----KGGGGGAADETPLGNP  568
             ++     D  A + ++IYA    R+  VG+ RVL+S+++    + G     +E     P
Sbjct  64   VNEEFLYADTSAVV-IEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNNNEYRRTPP  122

Query  569  --IQFLTVQVWRPSSRPHGLLNLWV  637
              ++F+ +QV R S RP G+LN+ V
Sbjct  123  PGMRFVALQVRRTSGRPQGILNIGV  147



>ref|XP_009136211.1| PREDICTED: uncharacterized protein LOC103860372 [Brassica rapa]
 emb|CDX93113.1| BnaA03g38350D [Brassica napus]
Length=404

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 74/142 (52%), Gaps = 23/142 (16%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            Q+ E+ V+  SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     K
Sbjct  8    QILELNVI--SAQELAPVARC--MKTYAIAWIDPECKLT-TRVDNTGGTSPTWND----K  58

Query  401  FHQGLPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI  571
            F   L E    D  + + ++IYA    ++  VG+ + L+SD++                +
Sbjct  59   FVFRLDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVDPSSA-----------M  107

Query  572  QFLTVQVWRPSSRPHGLLNLWV  637
            +F+T++V R S RPHGLLN+ V
Sbjct  108  RFVTLEVLRASGRPHGLLNIAV  129



>emb|CDX89605.1| BnaC03g45190D [Brassica napus]
Length=406

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 74/142 (52%), Gaps = 23/142 (16%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            Q+ E+ V+  SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     K
Sbjct  8    QILELNVI--SAQELAPVARC--MKTYAIAWIDPECKLT-TRVDNTGGTSPTWND----K  58

Query  401  FHQGLPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPI  571
            F   L E    D  + + ++IYA    ++  VG+ + L+SD++                +
Sbjct  59   FVFRLDEEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVDPSSA-----------M  107

Query  572  QFLTVQVWRPSSRPHGLLNLWV  637
            +F+T++V R S RPHGLLN+ V
Sbjct  108  RFVTLEVLRASGRPHGLLNIAV  129



>ref|XP_006408192.1| hypothetical protein EUTSA_v10020890mg [Eutrema salsugineum]
 gb|ESQ49645.1| hypothetical protein EUTSA_v10020890mg [Eutrema salsugineum]
Length=392

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 73/138 (53%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  +     M+TY+ A++    +    TRVD+   ANP+WN+    + + 
Sbjct  11   LEINLISAQDLAPISR--NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             + + D  +A+ +++YA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILDVDA-SAIVIEVYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>ref|XP_003553776.1| PREDICTED: uncharacterized protein LOC100793541 [Glycine max]
Length=260

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 11/134 (8%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKH-LSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK       +++TYA  +++ +  + RTRVD+ GG NP WN     +   
Sbjct  11   LEINLISAQGLKPPSSPRRRLQTYAVTWIDPATKL-RTRVDKLGGHNPTWNDKFLFRVTP  69

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                 D  +++ V IYA G  R+  VG+ R L+S++       A   TP      F   Q
Sbjct  70   DFLAGDT-SSVCVAIYAVGTFRDHLVGTVRFLISNMFSPDADYA---TPC-----FSAFQ  120

Query  590  VWRPSSRPHGLLNL  631
            + RPS R HG++N+
Sbjct  121  IRRPSGRFHGVMNI  134



>ref|XP_010467176.1| PREDICTED: uncharacterized protein LOC104747266 [Camelina sativa]
Length=404

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 72/138 (52%), Gaps = 21/138 (15%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     KF   
Sbjct  10   LELNIISAQELAPVARC--MKTYAIAWIDPERKLT-TRVDNTGGTSPTWND----KFVFR  62

Query  413  LPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            L E    D  + + ++IYA    ++  VG+ + L+SD++                ++F+T
Sbjct  63   LDEEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSSA-----------MRFVT  111

Query  584  VQVWRPSSRPHGLLNLWV  637
            ++V R S RPHGLLN+ V
Sbjct  112  LEVLRASGRPHGLLNIAV  129



>ref|XP_010518533.1| PREDICTED: uncharacterized protein LOC104793798 [Camelina sativa]
Length=404

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 72/138 (52%), Gaps = 21/138 (15%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     KF   
Sbjct  10   LELNIISAQELAPVARC--MKTYAIAWIDPERKLT-TRVDNTGGTSPTWND----KFVFR  62

Query  413  LPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            L E    D  + + ++IYA    ++  VG+ + L+SD++                ++F+T
Sbjct  63   LDEEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSSA-----------MRFVT  111

Query  584  VQVWRPSSRPHGLLNLWV  637
            ++V R S RPHGLLN+ V
Sbjct  112  LEVLRASGRPHGLLNIAV  129



>ref|XP_010488836.1| PREDICTED: uncharacterized protein LOC104766620 [Camelina sativa]
Length=403

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 72/138 (52%), Gaps = 21/138 (15%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     KF   
Sbjct  10   LELNIISAQELAPVARC--MKTYAIAWIDPERKLT-TRVDNTGGTSPTWND----KFVFR  62

Query  413  LPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            L E    D  + + ++IYA    ++  VG+ + L+SD++                ++F+T
Sbjct  63   LDEEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSSA-----------MRFVT  111

Query  584  VQVWRPSSRPHGLLNLWV  637
            ++V R S RPHGLLN+ V
Sbjct  112  LEVLRASGRPHGLLNIAV  129



>ref|XP_010519178.1| PREDICTED: uncharacterized protein LOC104798699 [Tarenaya hassleriana]
Length=274

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 72/145 (50%), Gaps = 23/145 (16%)
 Frame = +2

Query  227  REIEVLLYSANDLKNV--KHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            +E+EV + SA D+KNV  +H   M  YA  +V++S   + TRVDE G   P+WN+ + + 
Sbjct  5    KEVEVTIASAKDIKNVNWRHGRNM-PYAVVWVQQSNKFS-TRVDEEGDTCPLWNEKLVIP  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKP---VGSARVLLSDVLKGGGGGAADETPLGNPI  571
                 P +D    L VDI  H    E     +GSAR+ L DV+   G            +
Sbjct  63   LPPEKPVDDDDNVLRVDI-VHADPEEGTKSLIGSARLRLRDVVNDSG------------V  109

Query  572  QFLTVQVW---RPSSRPHGLLNLWV  637
             F T +     RPS RPHG L++ V
Sbjct  110  DFPTAKTLKLKRPSGRPHGKLDVTV  134



>ref|XP_002965668.1| hypothetical protein SELMODRAFT_407234 [Selaginella moellendorffii]
 gb|EFJ33088.1| hypothetical protein SELMODRAFT_407234 [Selaginella moellendorffii]
Length=373

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 66/136 (49%), Gaps = 19/136 (14%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +EV + SA  L++     +M  YA A+++  V    T V  + G+NP W+     K +  
Sbjct  27   LEVTIISAQGLRDTCIFGRMSPYALAWIDPEVKYC-THVAHNAGSNPAWDH----KMYIP  81

Query  413  LPENDVMAALNVDIYAHGHVREKP-VGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
             P +     L V I++ G     P VGS ++ L DV+ GG             +Q++  Q
Sbjct  82   RPGSLRGVELCVQIFSRGSGTNDPIVGSTKIPLGDVIDGG-------------LQYMACQ  128

Query  590  VWRPSSRPHGLLNLWV  637
            + RPS R HGLLN+ V
Sbjct  129  LQRPSGRIHGLLNISV  144



>ref|XP_001773661.1| predicted protein [Physcomitrella patens]
 gb|EDQ61549.1| predicted protein [Physcomitrella patens]
Length=239

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 4/107 (4%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKH-LSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKF  403
            RE+ V + SA++LKN KH   +M  YA  +++ +   A T V E GG NP WN  +++  
Sbjct  5    RELAVTVISAHNLKNAKHGFGRMNPYAVVWIDSNSKAA-THVAEKGGRNPSWNCTIRMLC  63

Query  404  HQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAA  544
             + L      A L V+I+ H   R+K VG A VLLS++  G   G +
Sbjct  64   RENLFGTLAKAKLVVEIFDHD--RKKSVGYAHVLLSELKSGMVWGCS  108



>gb|KFK39933.1| hypothetical protein AALP_AA3G308600 [Arabis alpina]
Length=401

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 75/138 (54%), Gaps = 21/138 (15%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L  V     M+TYA A+++    +  TRVD  GG +P WN     KF   
Sbjct  10   LELNIISAQELAPVARC--MKTYAIAWIDPERKLT-TRVDNTGGTSPTWND----KFVFR  62

Query  413  LPEN---DVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
            L E    D  + + ++IYA    ++  VG+ + L+SD++          TP  + ++F+T
Sbjct  63   LEEEALYDERSIVVIEIYALHWFKDIHVGTVQALISDLV----------TP-SSAMRFVT  111

Query  584  VQVWRPSSRPHGLLNLWV  637
            ++V R S RPHGLLN+ V
Sbjct  112  LEVLRASGRPHGLLNIAV  129



>ref|XP_002970540.1| hypothetical protein SELMODRAFT_441151 [Selaginella moellendorffii]
 gb|EFJ28670.1| hypothetical protein SELMODRAFT_441151 [Selaginella moellendorffii]
Length=270

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 70/139 (50%), Gaps = 13/139 (9%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            +LR +EV   SA DLK+VK + KM+TY  A+V+ S   A T + +  G NP WN+ + L 
Sbjct  4    ELRMLEVTPISAEDLKDVKLVGKMQTYVVAWVDPS-RKASTNLSQLPGKNPRWNEKLMLS  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                L +    A L ++IY  G +    VG A + L ++   G G A            L
Sbjct  63   VEDQLLQQP-GAFLVLEIYHRGFLESTIVGRANIPLQEISAKGSGDAP-----------L  110

Query  581  TVQVWRPSSRPHGLLNLWV  637
            + +V RPS R  G +++ V
Sbjct  111  SFKVRRPSGRLQGTIHVSV  129



>ref|XP_010092894.1| hypothetical protein L484_022489 [Morus notabilis]
 gb|EXB52712.1| hypothetical protein L484_022489 [Morus notabilis]
Length=266

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (51%), Gaps = 13/134 (10%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSK-MRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA  LK     S+ + TYA  +++ +  + RT VD+ GG NP WN     +   
Sbjct  13   LEINLISAQGLKPSSGSSRPVHTYALIWIDSTTKL-RTGVDKVGGENPTWNDRFLFRVTP  71

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQ  589
                 D  + + V+IY  G +R+  +G+ R+L+ + L         +TP      F  +Q
Sbjct  72   EFLSGDT-SGIYVEIYTVGRIRDSLIGTVRLLIGNFLD-----VRAKTP-----SFTALQ  120

Query  590  VWRPSSRPHGLLNL  631
            + RPS R HG+LN+
Sbjct  121  IRRPSGRFHGVLNV  134



>ref|XP_004173200.1| PREDICTED: uncharacterized LOC101215059 [Cucumis sativus]
Length=533

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 10/141 (7%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V     MRTYA A+V     ++ TRVD HG  NP WN     +
Sbjct  8    QLLELNVI--SAQDLAPVSR--SMRTYAVAWVHPDRKLS-TRVDTHGHNNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGG--GAADETPLGNPIQ  574
                   +D  A + ++IYA    ++  VG+ R+L+ +++         + +  +G  ++
Sbjct  63   VDDEFLHSDTSAVM-IEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVG--MR  119

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F+ +QV RPS RP G+LN+ V
Sbjct  120  FVALQVRRPSGRPQGILNIGV  140



>gb|ABK28543.1| unknown [Arabidopsis thaliana]
Length=354

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 72/138 (52%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  V     M+TY+ A++    +    TRVD+   ANP+WN+    + + 
Sbjct  11   LEINLISAQDLAPVSR--NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             +   D  +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILYVDA-SAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>gb|EPS62035.1| hypothetical protein M569_12761, partial [Genlisea aurea]
Length=167

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 72/134 (54%), Gaps = 7/134 (5%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ + SA +L+ V+   KM+TYA A+V     ++ T VD  G  +P WN     K  + 
Sbjct  11   LEINVISAQELEPVR--KKMQTYATAWVHPQRKLS-TSVDNDGNTSPTWNDKFVFKVDED  67

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGG-GGGAADETPLGNPIQFLTVQ  589
               ND  +A++++I A     +  VGS R+++ +++             +G  +QF+ +Q
Sbjct  68   FLRNDT-SAVSIEILAEHWFTDIVVGSVRIIIGNLIPPHVWTDRRHHHRIG--MQFIALQ  124

Query  590  VWRPSSRPHGLLNL  631
            V RPS RP G+LN+
Sbjct  125  VRRPSGRPQGILNI  138



>ref|XP_009590587.1| PREDICTED: ankyrin repeat-containing protein kinase A-like [Nicotiana 
tomentosiformis]
Length=535

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 72/139 (52%), Gaps = 7/139 (5%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI ++  SA DL+ +    KM+TYA  +V  +  +  T VD  GG NP WN     +
Sbjct  8    QLLEINII--SAQDLQPISK--KMKTYATVWVHPTRKLT-TAVDVEGGNNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +     D  +A+ ++I+     ++  VGS RVL+ +++        +       ++F+
Sbjct  63   VDEEFLRQDT-SAVQIEIHCVHWFKDSVVGSVRVLVGNLIPPPPRPHHNHHHHFG-MRFV  120

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  121  ALQVRRPSGRPQGILNIGV  139



>ref|XP_008460692.1| PREDICTED: uncharacterized protein LOC103499460 [Cucumis melo]
Length=561

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 10/141 (7%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V     MRTYA A+V     ++ TRVD HG  NP WN     +
Sbjct  8    QLLELNVI--SAQDLAPVSR--SMRTYAVAWVHPDRKLS-TRVDTHGHNNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGG--GAADETPLGNPIQ  574
                   +D  A + ++IYA    ++  VG+ R+L+ +++         + +  +G  ++
Sbjct  63   VDDEFLHSDTSAVM-IEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVG--MR  119

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F+ +QV RPS RP G+LN+ V
Sbjct  120  FVALQVRRPSGRPQGILNIGV  140



>ref|XP_004147189.1| PREDICTED: uncharacterized protein LOC101215059 [Cucumis sativus]
 gb|KGN61560.1| hypothetical protein Csa_2G171820 [Cucumis sativus]
Length=561

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 10/141 (7%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V     MRTYA A+V     ++ TRVD HG  NP WN     +
Sbjct  8    QLLELNVI--SAQDLAPVSR--SMRTYAVAWVHPDRKLS-TRVDTHGHNNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGG--GAADETPLGNPIQ  574
                   +D  A + ++IYA    ++  VG+ R+L+ +++         + +  +G  ++
Sbjct  63   VDDEFLHSDTSAVM-IEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVG--MR  119

Query  575  FLTVQVWRPSSRPHGLLNLWV  637
            F+ +QV RPS RP G+LN+ V
Sbjct  120  FVALQVRRPSGRPQGILNIGV  140



>ref|XP_003535258.1| PREDICTED: uncharacterized protein LOC100787698 [Glycine max]
Length=657

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 76/140 (54%), Gaps = 13/140 (9%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYV--ERSVHVARTRVDEHGGANPVWNQVVK  394
            QL E+ V+  SA DL  V     MRTYA ++V  ER +    TRVD  G  +P WN    
Sbjct  9    QLLELNVI--SAQDLAPVSR--NMRTYAVSWVHPERKL---STRVDTEGHTHPTWNDKFV  61

Query  395  LKFHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGA-ADETPLGNPI  571
             +  +    +D  +A+ ++IYA    ++  VG+ RVL+ ++          + TPLG  +
Sbjct  62   FRVDEEFLYSDT-SAIMIEIYALHWFKDIHVGTVRVLVGNLAPPPSKPFHNNRTPLG--M  118

Query  572  QFLTVQVWRPSSRPHGLLNL  631
            +F+ +Q+ RPS RP G+LN+
Sbjct  119  RFVALQMRRPSGRPQGILNI  138



>emb|CBI23723.3| unnamed protein product [Vitis vinifera]
Length=447

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 71/138 (51%), Gaps = 7/138 (5%)
 Frame = +2

Query  224  LREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKF  403
            L+ +E+ L SA DL  V     MRTYA A+V     ++ TR+D  G  +P WN     + 
Sbjct  7    LQLLEINLISAQDLAPVGR--SMRTYAIAWVHPDRKLS-TRIDSTGHNSPTWNDKFVFRV  63

Query  404  HQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
                   D  A + +DIY+    R+  VG+ R+L+ +++          T +G  ++F+ 
Sbjct  64   DDEFLRADTSAVM-IDIYSQHWFRDYHVGTVRILVGNLIPPSVR-PGHRTQMG--MRFMA  119

Query  584  VQVWRPSSRPHGLLNLWV  637
            +QV R S RP GLLN+ V
Sbjct  120  LQVRRSSGRPQGLLNIGV  137



>ref|XP_009767920.1| PREDICTED: uncharacterized protein LOC104218993 [Nicotiana sylvestris]
Length=520

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 72/139 (52%), Gaps = 7/139 (5%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI ++  SA DL+ +    KM+TYA  +V  +  +  T VD  GG NP WN     +
Sbjct  8    QLLEINII--SAQDLQPISK--KMKTYATVWVHPTRKLT-TAVDVEGGNNPTWNDKFVFR  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
              +     D  +A+ ++I+     ++  VGS RVL+ +++        +       ++F+
Sbjct  63   VDEEFLRQDT-SAVQIEIHCVHWFKDSLVGSVRVLVGNLIPPPPRPHHNHHHHFG-MRFV  120

Query  581  TVQVWRPSSRPHGLLNLWV  637
             +QV RPS RP G+LN+ V
Sbjct  121  ALQVRRPSGRPQGILNIGV  139



>ref|NP_566225.4| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
 gb|AEE74070.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
Length=391

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 72/138 (52%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  V     M+TY+ A++    +    TRVD+   ANP+WN+    + + 
Sbjct  11   LEINLISAQDLAPVSR--NMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             +   D  +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILYVDA-SAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>ref|XP_011044520.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan-1-like 
[Populus euphratica]
Length=289

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 69/142 (49%), Gaps = 17/142 (12%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYV------ERSVHVARTRVDEHGGANPVWNQV  388
            R +E+ + SA DLK+V ++SKM  YA   +      ++     +T VD  GG NP WN  
Sbjct  4    RTLEINVISARDLKDVNYISKMDVYAVVSISGVDSKQQPKQKTKTPVDRAGGKNPTWNFP  63

Query  389  VKLKF-HQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGN  565
            +K       L EN +  +L   +     + +K +G   V + ++L   G G +       
Sbjct  64   IKFTIPETSLAENRL--SLVFKLKCERALGDKDIGEVNVPIKELLDSAGDGKS-------  114

Query  566  PIQFLTVQVWRPSSRPHGLLNL  631
             ++F++ QV +PS +P G ++ 
Sbjct  115  -MKFVSYQVRKPSGKPKGEISF  135



>ref|XP_002282144.1| PREDICTED: uncharacterized protein LOC100256206 [Vitis vinifera]
Length=494

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 71/138 (51%), Gaps = 7/138 (5%)
 Frame = +2

Query  224  LREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKF  403
            L+ +E+ L SA DL  V     MRTYA A+V     ++ TR+D  G  +P WN     + 
Sbjct  7    LQLLEINLISAQDLAPVGR--SMRTYAIAWVHPDRKLS-TRIDSTGHNSPTWNDKFVFRV  63

Query  404  HQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
                   D  A + +DIY+    R+  VG+ R+L+ +++          T +G  ++F+ 
Sbjct  64   DDEFLRADTSAVM-IDIYSQHWFRDYHVGTVRILVGNLIPPSVR-PGHRTQMG--MRFMA  119

Query  584  VQVWRPSSRPHGLLNLWV  637
            +QV R S RP GLLN+ V
Sbjct  120  LQVRRSSGRPQGLLNIGV  137



>ref|XP_002976843.1| hypothetical protein SELMODRAFT_443351 [Selaginella moellendorffii]
 gb|EFJ21953.1| hypothetical protein SELMODRAFT_443351 [Selaginella moellendorffii]
Length=301

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 66/137 (48%), Gaps = 6/137 (4%)
 Frame = +2

Query  227  REIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFH  406
            R +E+ + SA  LK      K  TYA  ++  S     T VD+ G  NPVWNQ + +   
Sbjct  4    RRVEINIISAEGLKLSPSFGKPHTYAVVWIHPSKKFY-THVDQEGAKNPVWNQKLVISAD  62

Query  407  QGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
                E        ++I+  GH+ +KP+G+  V   ++          ETP  + IQ++  
Sbjct  63   TYSLEQG-SGKFTIEIFHRGHIHDKPIGTVEVPFKELPH--EARFNRETP--SEIQYMAF  117

Query  587  QVWRPSSRPHGLLNLWV  637
            ++ RPS R  G+LNL +
Sbjct  118  EIRRPSGRMKGVLNLSI  134



>ref|XP_009123999.1| PREDICTED: uncharacterized protein LOC103848923 [Brassica rapa]
Length=384

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 72/138 (52%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  +     M+TY+ A++    +    TRVD+   ANP+WN+    +   
Sbjct  11   LEINLISAQDLAPISK--NMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDD  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             + + D  +++ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILDVDA-SSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>ref|XP_007144140.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
 gb|ESW16134.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
Length=736

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 73/138 (53%), Gaps = 9/138 (7%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL E+ V+  SA DL  V     MRTYA ++V     ++ TRVD  G  +P WN     +
Sbjct  9    QLLELNVI--SAQDLAPVSR--NMRTYAVSWVHPDRKLS-TRVDTQGHTHPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGA-ADETPLGNPIQF  577
                   +D  +++ ++IYA    ++  VG+ RVL+ ++         ++ TPLG   +F
Sbjct  64   VDDEFLCSDT-SSIMIEIYALHWFKDIHVGTVRVLIGNLAPPPSRPFHSNRTPLG--TRF  120

Query  578  LTVQVWRPSSRPHGLLNL  631
              VQV RPS RP G+LN+
Sbjct  121  AAVQVRRPSGRPQGILNI  138



>ref|XP_006356117.1| PREDICTED: uncharacterized protein LOC102592369 [Solanum tuberosum]
Length=482

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 77/142 (54%), Gaps = 15/142 (11%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI ++  SA DL+ +    KM+TYA A+V  +  +A T VD  GG NP WN     +
Sbjct  16   QLLEINII--SAQDLEPMS--KKMKTYAAAWVHPTRKLA-TGVDVEGGHNPTWNDKFVFR  70

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGN---PI  571
                   +D  +A++++IY+    R+  VG+ RVL+ +++          T L      +
Sbjct  71   VDDEFLRHD-NSAVHIEIYSVHWFRDTLVGTVRVLVGNLI------PPIRTHLRTHHHGM  123

Query  572  QFLTVQVWRPSSRPHGLLNLWV  637
            +F+ +QV RPS RP G+LN+ V
Sbjct  124  RFIALQVRRPSGRPQGILNIGV  145



>gb|KFK37859.1| hypothetical protein AALP_AA3G038400 [Arabis alpina]
Length=387

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 74/138 (54%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  +     M+TY+ A++    +    TRVD++  ANP+WN+    + + 
Sbjct  11   LEINLISAQDLAPISR--NMKTYSVAWINTDPMRKLTTRVDQNNRANPIWNEKFVFRVND  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             + + D  +A+ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILDVDA-SAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDVGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>emb|CAN83108.1| hypothetical protein VITISV_026570 [Vitis vinifera]
Length=494

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 71/138 (51%), Gaps = 7/138 (5%)
 Frame = +2

Query  224  LREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKF  403
            L+ +E+ L SA DL  V     MRTYA A+V     ++ TR+D  G  +P WN     + 
Sbjct  7    LQLLEINLISAQDLAPVGR--SMRTYAIAWVHPDRKLS-TRIDSTGHNSPTWNDKFVFRV  63

Query  404  HQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLT  583
                   D  A + +DIY+    R+  VG+ R+L+ +++          T +G  ++F+ 
Sbjct  64   DDEFLRADTSAVM-IDIYSQHWFRDYHVGTVRILVGNLIPPSVR-PGHRTQMG--MRFMA  119

Query  584  VQVWRPSSRPHGLLNLWV  637
            +QV R S RP GLLN+ V
Sbjct  120  LQVRRSSGRPQGLLNIGV  137



>ref|XP_011073723.1| PREDICTED: uncharacterized protein LOC105158612 [Sesamum indicum]
Length=505

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 75/143 (52%), Gaps = 15/143 (10%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            QL EI ++  S  DL+ V    KMRTYA+A+V  +  ++   VD+ G  NP WN     +
Sbjct  9    QLLEINII--SGQDLEPVAR--KMRTYAKAWVHPNRKLSSC-VDKEGNNNPTWNDKFVFR  63

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNP----  568
              +     D  A + ++IY+   +R+  VG+ RVL+ +++          T   N     
Sbjct  64   VEEEFLREDSSAVM-IEIYSAHWLRDVLVGTVRVLVGNLIP-----PPVRTHQNNSHYMG  117

Query  569  IQFLTVQVWRPSSRPHGLLNLWV  637
            ++F+ +QV RPS RP G+LN+ V
Sbjct  118  MRFVALQVRRPSGRPQGILNIGV  140



>emb|CDY49343.1| BnaA05g33050D [Brassica napus]
Length=384

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 72/138 (52%), Gaps = 6/138 (4%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERS-VHVARTRVDEHGGANPVWNQVVKLKFHQ  409
            +E+ L SA DL  +     M+TY+ A++    +    TRVD+   ANP+WN+    +   
Sbjct  11   LEINLISAQDLAPISK--NMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDD  68

Query  410  GLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLK--GGGGGAADETPLGNPIQFLT  583
             + + D  +++ ++IYA    ++  VG+  VLLSD+     G G   D     N ++ +T
Sbjct  69   KILDVDA-SSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVT  127

Query  584  VQVWRPSSRPHGLLNLWV  637
            +Q+ RPS R  G L L V
Sbjct  128  LQIRRPSGRLQGFLRLGV  145



>ref|XP_002978619.1| hypothetical protein SELMODRAFT_443918 [Selaginella moellendorffii]
 gb|EFJ20605.1| hypothetical protein SELMODRAFT_443918 [Selaginella moellendorffii]
Length=393

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 70/139 (50%), Gaps = 13/139 (9%)
 Frame = +2

Query  221  QLREIEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLK  400
            +LR +EV   SA DLK+VK + KM+TY  A+V+ S   A T + +  G NP WN+ + L 
Sbjct  4    ELRMLEVTPISAEDLKDVKLVGKMQTYVVAWVDPS-RKASTNLSQLPGKNPRWNEKLMLS  62

Query  401  FHQGLPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFL  580
                L +    A L ++IY  G +    VG A + L ++   G G A            L
Sbjct  63   VEDQLLQQPG-AFLVLEIYHRGFLESTIVGRANIPLQEISTKGSGDAP-----------L  110

Query  581  TVQVWRPSSRPHGLLNLWV  637
            + +V RPS R  G +++ V
Sbjct  111  SFKVRRPSGRLQGTIHVSV  129



>ref|XP_002456081.1| hypothetical protein SORBIDRAFT_03g030080 [Sorghum bicolor]
 gb|EES01201.1| hypothetical protein SORBIDRAFT_03g030080 [Sorghum bicolor]
Length=284

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 74/150 (49%), Gaps = 21/150 (14%)
 Frame = +2

Query  218  EQLREIEVLLYSANDLKNVKH---LSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQV  388
            E  R +EV L SA  LK         ++  YA A+V+   H  +TR D+ GG +P W+  
Sbjct  14   EGERLLEVALISAQGLKQPHSGLPRRRLHAYAVAWVDAG-HKLQTRADDAGGLDPAWHAR  72

Query  389  VKLKFHQGLPENDVMAALNVDIYAHGHVR-----EKPVGSARVLLSD--VLKGGGGGAAD  547
            +  +  +    +D  AA++V+IYA          +  VGSAR LL D  +L         
Sbjct  73   LLFRVREASLADDSRAAVSVEIYAAAAGTWHFGGDSLVGSARFLLGDHRLLS--------  124

Query  548  ETPLGNPIQFLTVQVWRPSSRPHGLLNLWV  637
              P+G+P  F  V V RPS R HGLLN+ V
Sbjct  125  -RPVGSPSMF-AVGVRRPSGRVHGLLNVAV  152



>ref|XP_004242771.1| PREDICTED: formin-J [Solanum lycopersicum]
Length=370

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 10/135 (7%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA DL  V     +RTYA  +V  +     TR+D HG  NP WN     +    
Sbjct  36   LEITLISAQDLSPV--CKSLRTYALTWVNPN-RKRTTRIDNHGHNNPNWNDKFSFRVDDE  92

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
               +D  +A++V+IY     R+  VG+ +V+L++++         E    +  +F+ +Q+
Sbjct  93   FLISD-SSAIHVEIYTVSWFRDILVGTVKVILNNLVN------PFENTSNSSKKFVALQI  145

Query  593  WRPSSRPHGLLNLWV  637
             RPS  P G+LN+ V
Sbjct  146  RRPSGNPQGILNMGV  160



>ref|XP_009379739.1| PREDICTED: uncharacterized protein LOC103968123 [Pyrus x bretschneideri]
Length=395

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 70/133 (53%), Gaps = 16/133 (12%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA +L        MRT+A A+V     +  TRVD++G  NP WN+    +    
Sbjct  12   LEINLISAQELTPASK--AMRTFAVAWVNPQRKLT-TRVDQNGHTNPTWNEKFVFRVDDD  68

Query  413  LPENDVMAALNVDIYAHGHVREKPVGSARVLLSDVLKGGGGGAADETPLGNPIQFLTVQV  592
               +D  + + ++IYA   +R+  +G+A V+++++               + ++F+ +Q+
Sbjct  69   FLRDDT-SKIMIEIYASAWLRDVLIGTAAVVVNNLQNK------------SKMRFMAIQL  115

Query  593  WRPSSRPHGLLNL  631
             RPS RP G+LN+
Sbjct  116  RRPSGRPQGILNI  128



>ref|XP_010914657.1| PREDICTED: uncharacterized protein LOC105039993 [Elaeis guineensis]
Length=251

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 68/135 (50%), Gaps = 11/135 (8%)
 Frame = +2

Query  233  IEVLLYSANDLKNVKHLSKMRTYAEAYVERSVHVARTRVDEHGGANPVWNQVVKLKFHQG  412
            +E+ L SA  LK    L +++ YA A+VE +  V RT VD  GG NP WN     +   G
Sbjct  6    LEINLISAQSLKPPFGLRRVQAYAVAWVEPAFKV-RTLVDRTGGENPTWNDKFIFRVPSG  64

Query  413  LPENDVMAALNVDIY-AHGHVREKP-VGSARVLLSDVLKGGGGGAADETPLGNPIQFLTV  586
               ND  + + V+IY A G +   P +G+ R+L+ ++          + P      F  V
Sbjct  65   FLANDSASTVAVEIYAAAGRILPDPLLGTVRLLVGNLRL---LSRRRDCP-----AFDAV  116

Query  587  QVWRPSSRPHGLLNL  631
             + RPS R HG+LN+
Sbjct  117  GIRRPSGRFHGVLNV  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1364606714424