BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82439_g1_i1 len=1318 path=[1296:0-1317]

Length=1318
                                                                      Score     E

ref|XP_009797415.1|  PREDICTED: uncharacterized protein LOC104243851    345   1e-111   
ref|XP_009624847.1|  PREDICTED: protein notum homolog isoform X2        344   5e-111   
ref|XP_009624845.1|  PREDICTED: protein notum homolog isoform X1        340   3e-109   
ref|XP_009797876.1|  PREDICTED: protein notum homolog isoform X2        339   4e-109   
ref|XP_003628996.1|  Carboxylic ester hydrolase                         339   8e-109   
gb|ACF05806.1|  PAE                                                     337   3e-108   Litchi chinensis [litchi]
ref|XP_006471634.1|  PREDICTED: uncharacterized protein LOC102628021    337   5e-108   
ref|XP_009592441.1|  PREDICTED: uncharacterized protein LOC104089292    336   7e-108   
ref|XP_009589915.1|  PREDICTED: uncharacterized protein LOC104087...    335   2e-107   
ref|XP_009589914.1|  PREDICTED: uncharacterized protein LOC104087...    335   2e-107   
ref|XP_004244682.2|  PREDICTED: uncharacterized protein LOC101248898    335   2e-107   
ref|XP_009797875.1|  PREDICTED: protein notum homolog isoform X1        335   2e-107   
gb|KDO40410.1|  hypothetical protein CISIN_1g013734mg                   335   7e-107   
ref|XP_009803843.1|  PREDICTED: uncharacterized protein LOC104249167    333   1e-106   
ref|XP_010056135.1|  PREDICTED: protein notum homolog                   332   4e-106   
ref|XP_011073252.1|  PREDICTED: protein notum homolog isoform X2        332   6e-106   
ref|XP_011082149.1|  PREDICTED: protein notum homolog isoform X1        330   2e-105   
ref|XP_011073171.1|  PREDICTED: protein notum homolog isoform X1        331   3e-105   
ref|XP_009601364.1|  PREDICTED: protein notum homolog                   330   3e-105   
emb|CDP15690.1|  unnamed protein product                                330   4e-105   
ref|XP_009779347.1|  PREDICTED: protein notum homolog isoform X1        328   6e-105   
ref|XP_009778395.1|  PREDICTED: protein notum homolog                   326   8e-104   
gb|KCW72723.1|  hypothetical protein EUGRSUZ_E01170                     325   2e-103   
ref|XP_004509558.1|  PREDICTED: protein notum homolog                   325   2e-103   
ref|XP_010327577.1|  PREDICTED: uncharacterized protein LOC101244626    325   3e-103   
gb|KCW72721.1|  hypothetical protein EUGRSUZ_E01170                     324   4e-103   
gb|ADR82372.1|  pectin acetylesterase                                   324   5e-103   
gb|KCW72722.1|  hypothetical protein EUGRSUZ_E01170                     323   5e-103   
ref|XP_006385133.1|  pectinacetylesterase family protein                323   9e-103   
ref|XP_010056136.1|  PREDICTED: protein notum homolog                   323   1e-102   
ref|XP_009607289.1|  PREDICTED: protein notum homolog                   323   1e-102   
ref|XP_010644665.1|  PREDICTED: uncharacterized protein LOC100245856    323   2e-102   
gb|KDP28068.1|  hypothetical protein JCGZ_19476                         323   2e-102   
ref|XP_011028476.1|  PREDICTED: protein notum homolog                   322   3e-102   
gb|EYU29131.1|  hypothetical protein MIMGU_mgv1a007782mg                322   3e-102   
ref|XP_009590663.1|  PREDICTED: protein notum homolog isoform X1        321   5e-102   
ref|XP_006361581.1|  PREDICTED: protein notum homolog                   320   9e-102   
ref|XP_009605804.1|  PREDICTED: protein notum homolog                   320   1e-101   
ref|XP_007156330.1|  hypothetical protein PHAVU_003G277500g             320   1e-101   
gb|EYU29129.1|  hypothetical protein MIMGU_mgv1a023759mg                319   2e-101   
ref|XP_010244170.1|  PREDICTED: uncharacterized protein LOC104588061    320   2e-101   
ref|XP_002303225.2|  pectinacetylesterase family protein                319   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_011012520.1|  PREDICTED: protein notum homolog                   319   3e-101   
ref|XP_006359968.1|  PREDICTED: protein notum homolog                   318   3e-101   
ref|XP_010314004.1|  PREDICTED: protein notum homolog isoform X2        319   4e-101   
ref|XP_007156331.1|  hypothetical protein PHAVU_003G277500g             320   4e-101   
ref|XP_010314003.1|  PREDICTED: protein notum homolog isoform X1        319   4e-101   
ref|XP_002519911.1|  pectin acetylesterase, putative                    319   5e-101   Ricinus communis
ref|XP_009784099.1|  PREDICTED: protein notum homolog                   318   5e-101   
ref|XP_004172255.1|  PREDICTED: protein notum homolog                   319   5e-101   
ref|XP_006432880.1|  hypothetical protein CICLE_v10001467mg             318   5e-101   
emb|CDY09289.1|  BnaC03g63190D                                          318   6e-101   
gb|EYU37455.1|  hypothetical protein MIMGU_mgv1a007934mg                318   6e-101   
gb|AAP72959.1|  pectin acetylesterase                                   318   7e-101   Lactuca sativa [cultivated lettuce]
gb|EYU29130.1|  hypothetical protein MIMGU_mgv1a007782mg                318   7e-101   
ref|XP_008451860.1|  PREDICTED: protein notum homolog isoform X1        318   7e-101   
ref|XP_009799834.1|  PREDICTED: protein notum homolog                   318   7e-101   
ref|XP_010529277.1|  PREDICTED: protein notum homolog                   318   8e-101   
ref|XP_009616254.1|  PREDICTED: protein notum homolog                   318   8e-101   
ref|XP_009108427.1|  PREDICTED: protein notum homolog                   318   8e-101   
emb|CAA67728.1|  pectinacetylesterase precursor                         318   8e-101   Vigna radiata var. radiata [golden gram]
ref|XP_009627060.1|  PREDICTED: uncharacterized protein LOC104117690    318   9e-101   
ref|XP_006878664.1|  hypothetical protein AMTR_s00011p00266820          318   1e-100   
ref|XP_008451861.1|  PREDICTED: protein notum homolog isoform X2        318   1e-100   
gb|KCW72726.1|  hypothetical protein EUGRSUZ_E01170                     317   1e-100   
ref|XP_009771151.1|  PREDICTED: uncharacterized protein LOC104221730    318   2e-100   
ref|XP_006494119.1|  PREDICTED: protein notum homolog isoform X1        317   2e-100   
ref|XP_011074200.1|  PREDICTED: protein notum homolog                   317   2e-100   
ref|XP_007158098.1|  hypothetical protein PHAVU_002G123900g             317   3e-100   
gb|KHN27509.1|  Protein notum like                                      317   3e-100   
ref|XP_009132797.1|  PREDICTED: protein notum homolog                   317   4e-100   
ref|XP_007156332.1|  hypothetical protein PHAVU_003G277600g             317   4e-100   
ref|XP_010439718.1|  PREDICTED: protein notum homolog                   317   4e-100   
ref|XP_003547731.1|  PREDICTED: protein notum homolog isoform X1        316   6e-100   
ref|XP_004300392.1|  PREDICTED: protein notum homolog                   316   7e-100   
emb|CDX78933.1|  BnaA01g10000D                                          318   8e-100   
ref|XP_004509522.1|  PREDICTED: uncharacterized protein LOC101493...    316   8e-100   
ref|XP_004300391.1|  PREDICTED: protein notum homolog                   315   1e-99    
ref|XP_002865253.1|  pectin acetylesterase                              315   1e-99    
gb|KCW72720.1|  hypothetical protein EUGRSUZ_E01169                     316   1e-99    
gb|ACJ85294.1|  unknown                                                 315   2e-99    Medicago truncatula
ref|XP_004244443.1|  PREDICTED: uncharacterized protein LOC101251798    315   2e-99    
gb|KEH20327.1|  pectinacetylesterase family protein                     315   2e-99    
ref|XP_003628995.1|  Notum-like protein                                 315   2e-99    
ref|XP_007040900.1|  Pectinacetylesterase family protein                315   2e-99    
ref|NP_193677.2|  putative pectinacetylesterase                         315   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006363875.1|  PREDICTED: protein notum homolog                   315   3e-99    
emb|CDX99377.1|  BnaC01g11750D                                          316   3e-99    
ref|XP_006280604.1|  hypothetical protein CARUB_v10026563mg             314   3e-99    
ref|XP_010449357.1|  PREDICTED: protein notum homolog                   314   3e-99    
ref|XP_010056132.1|  PREDICTED: protein notum homolog isoform X3        316   3e-99    
ref|XP_010434420.1|  PREDICTED: protein notum homolog                   314   3e-99    
ref|XP_010056129.1|  PREDICTED: protein notum homolog isoform X1        316   3e-99    
ref|XP_009794297.1|  PREDICTED: protein notum homolog                   314   4e-99    
ref|XP_010494620.1|  PREDICTED: uncharacterized protein LOC104771742    314   4e-99    
ref|XP_004150551.1|  PREDICTED: protein notum homolog                   318   4e-99    
ref|XP_010056131.1|  PREDICTED: protein notum homolog isoform X2        315   4e-99    
gb|AAM65412.1|  pectin acetylesterase                                   313   6e-99    Arabidopsis thaliana [mouse-ear cress]
gb|AET03471.2|  pectinacetylesterase family protein                     314   8e-99    
ref|XP_006573492.1|  PREDICTED: protein notum homolog isoform X2        313   9e-99    
emb|CDY26383.1|  BnaA02g23870D                                          312   1e-98    
ref|XP_006432881.1|  hypothetical protein CICLE_v10001426mg             312   1e-98    
gb|KHN41756.1|  Protein notum like                                      314   2e-98    
ref|XP_006573491.1|  PREDICTED: protein notum homolog isoform X1        313   2e-98    
gb|KDO40416.1|  hypothetical protein CISIN_1g013734mg                   309   2e-98    
ref|XP_006587657.1|  PREDICTED: protein notum homolog isoform X3        312   3e-98    
ref|XP_010536220.1|  PREDICTED: protein notum homolog isoform X1        311   4e-98    
ref|XP_002519912.1|  pectin acetylesterase, putative                    313   4e-98    Ricinus communis
ref|XP_010676220.1|  PREDICTED: uncharacterized protein LOC104892094    312   5e-98    
ref|XP_011082152.1|  PREDICTED: protein notum homolog isoform X2        310   6e-98    
ref|XP_006587656.1|  PREDICTED: protein notum homolog isoform X2        312   8e-98    
ref|XP_010677538.1|  PREDICTED: protein notum homolog isoform X1        310   8e-98    
ref|XP_006361594.1|  PREDICTED: protein notum homolog                   314   9e-98    
ref|XP_007209211.1|  hypothetical protein PRUPE_ppa006668mg             310   9e-98    
gb|EPS71696.1|  hypothetical protein M569_03061                         310   9e-98    
ref|XP_004244767.2|  PREDICTED: protein notum homolog                   310   1e-97    
ref|XP_010434425.1|  PREDICTED: uncharacterized protein LOC104718...    310   1e-97    
emb|CDX87799.1|  BnaC02g31500D                                          310   1e-97    
ref|XP_009128780.1|  PREDICTED: uncharacterized protein LOC103853624    310   1e-97    
ref|XP_006355154.1|  PREDICTED: protein notum homolog                   310   1e-97    
ref|XP_003547821.1|  PREDICTED: protein notum homolog                   310   1e-97    
ref|XP_010244169.1|  PREDICTED: protein notum homolog                   310   2e-97    
ref|XP_006385138.1|  hypothetical protein POPTR_0004s24220g             310   2e-97    
ref|XP_010434424.1|  PREDICTED: uncharacterized protein LOC104718...    309   2e-97    
ref|XP_006413980.1|  hypothetical protein EUTSA_v10025385mg             309   2e-97    
ref|XP_006432878.1|  hypothetical protein CICLE_v100013712mg            305   2e-97    
ref|XP_006385137.1|  hypothetical protein POPTR_0004s24220g             309   3e-97    
ref|XP_010266384.1|  PREDICTED: uncharacterized protein LOC104603...    309   3e-97    
ref|XP_006368062.1|  PREDICTED: protein notum homolog                   306   3e-97    
ref|XP_006385134.1|  hypothetical protein POPTR_0004s24220g             310   5e-97    
ref|XP_009600038.1|  PREDICTED: protein notum homolog                   307   6e-97    
ref|XP_010318089.1|  PREDICTED: protein notum homolog                   308   7e-97    
ref|XP_007209217.1|  hypothetical protein PRUPE_ppa006718mg             308   7e-97    
ref|XP_011028483.1|  PREDICTED: uncharacterized protein LOC105128...    309   8e-97    
ref|XP_010266383.1|  PREDICTED: uncharacterized protein LOC104603...    309   9e-97    
ref|XP_010677539.1|  PREDICTED: protein notum homolog isoform X2        307   9e-97    
ref|XP_010235850.1|  PREDICTED: protein notum homolog isoform X1        308   1e-96    
ref|XP_008238012.1|  PREDICTED: protein notum homolog isoform X2        308   1e-96    
ref|XP_010449359.1|  PREDICTED: uncharacterized protein LOC104731629    307   1e-96    
ref|XP_010441760.1|  PREDICTED: uncharacterized protein LOC104724893    307   1e-96    
ref|XP_004953590.1|  PREDICTED: protein notum homolog isoform X1        308   1e-96    
ref|XP_006365947.1|  PREDICTED: uncharacterized protein LOC102601254    307   1e-96    
emb|CDX99378.1|  BnaC01g11740D                                          307   2e-96    
ref|XP_002867938.1|  pectinacetylesterase family protein                306   2e-96    
ref|XP_006398195.1|  hypothetical protein EUTSA_v10000914mg             307   2e-96    
ref|NP_199341.1|  pectinacetylesterase family protein                   307   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481611.1|  PREDICTED: uncharacterized protein LOC104760390    306   2e-96    
ref|XP_009350399.1|  PREDICTED: protein notum homolog                   307   2e-96    
ref|XP_006413981.1|  hypothetical protein EUTSA_v10024796mg             312   3e-96    
ref|XP_009132784.1|  PREDICTED: uncharacterized protein LOC103857370    306   3e-96    
ref|XP_010439720.1|  PREDICTED: uncharacterized protein LOC104723107    306   3e-96    
ref|NP_567585.1|  pectinacetylesterase family protein                   306   3e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001047850.1|  Os02g0702400                                       306   4e-96    Oryza sativa Japonica Group [Japonica rice]
emb|CDX78932.1|  BnaA01g09990D                                          306   4e-96    
ref|XP_008373439.1|  PREDICTED: protein notum homolog isoform X2        307   5e-96    
ref|XP_009108426.1|  PREDICTED: protein notum homolog                   305   5e-96    
ref|XP_011028482.1|  PREDICTED: uncharacterized protein LOC105128...    308   6e-96    
ref|XP_010536189.1|  PREDICTED: uncharacterized protein LOC104811...    305   6e-96    
ref|XP_006363883.1|  PREDICTED: uncharacterized protein LOC102589191    308   6e-96    
ref|XP_006283887.1|  hypothetical protein CARUB_v10005004mg             305   6e-96    
ref|XP_002867940.1|  hypothetical protein ARALYDRAFT_492921             305   7e-96    
ref|XP_008808358.1|  PREDICTED: protein notum homolog                   305   7e-96    
ref|XP_006599203.1|  PREDICTED: uncharacterized protein LOC100781...    305   7e-96    
ref|XP_010325632.1|  PREDICTED: protein notum homolog isoform X1        305   8e-96    
gb|KHN27511.1|  Protein notum like                                      305   9e-96    
ref|XP_006587655.1|  PREDICTED: protein notum homolog isoform X1        307   9e-96    
ref|XP_007040902.1|  Pectinacetylesterase family protein                305   1e-95    
ref|XP_011028479.1|  PREDICTED: uncharacterized protein LOC105128...    309   1e-95    
gb|KHG09455.1|  Protein notum                                           305   1e-95    
gb|KHN41567.1|  Protein notum like                                      305   1e-95    
emb|CDY09287.1|  BnaC03g63170D                                          304   2e-95    
ref|XP_008373438.1|  PREDICTED: protein notum homolog isoform X1        306   2e-95    
ref|XP_010536210.1|  PREDICTED: uncharacterized protein LOC104811251    304   2e-95    
ref|XP_008378614.1|  PREDICTED: uncharacterized protein LOC103441693    304   3e-95    
ref|XP_003548585.1|  PREDICTED: protein notum homolog                   304   3e-95    
ref|XP_008347803.1|  PREDICTED: uncharacterized protein LOC103410929    304   4e-95    
ref|NP_001190770.1|  pectinacetylesterase family protein                307   4e-95    
ref|NP_001151183.1|  LOC100284816 precursor                             303   5e-95    Zea mays [maize]
ref|XP_008238011.1|  PREDICTED: protein notum homolog isoform X1        303   6e-95    
ref|XP_008808367.1|  PREDICTED: uncharacterized protein LOC103720...    303   6e-95    
ref|XP_011074219.1|  PREDICTED: protein notum homolog                   303   6e-95    
ref|XP_008808368.1|  PREDICTED: uncharacterized protein LOC103720...    303   6e-95    
ref|XP_004512351.1|  PREDICTED: protein notum homolog isoform X3        304   8e-95    
ref|XP_008808370.1|  PREDICTED: uncharacterized protein LOC103720...    303   9e-95    
gb|ACG39759.1|  carboxylic ester hydrolase                              303   1e-94    Zea mays [maize]
ref|XP_010248193.1|  PREDICTED: uncharacterized protein LOC104591101    302   1e-94    
ref|XP_010942975.1|  PREDICTED: protein notum homolog isoform X1        302   1e-94    
ref|XP_008355284.1|  PREDICTED: uncharacterized protein LOC103418943    302   1e-94    
ref|XP_010054028.1|  PREDICTED: uncharacterized protein LOC104442...    302   1e-94    
ref|XP_003613922.1|  Notum-like protein                                 302   2e-94    
ref|XP_010111521.1|  hypothetical protein L484_021346                   301   3e-94    
ref|XP_004512349.1|  PREDICTED: protein notum homolog isoform X1        304   4e-94    
gb|KHG23648.1|  Notum                                                   300   6e-94    
ref|XP_003547822.1|  PREDICTED: protein notum homolog                   300   1e-93    
ref|XP_009603747.1|  PREDICTED: protein notum homolog isoform X1        299   1e-93    
ref|XP_010942974.1|  PREDICTED: protein notum homolog                   299   2e-93    
gb|AGT16732.1|  carboxylic ester hydrolase                              298   6e-93    
gb|KDO40412.1|  hypothetical protein CISIN_1g013734mg                   297   6e-93    
ref|XP_009619780.1|  PREDICTED: uncharacterized protein LOC104111729    296   2e-92    
ref|XP_011082153.1|  PREDICTED: protein notum homolog                   296   3e-92    
emb|CDY67801.1|  BnaAnng25210D                                          296   3e-92    
gb|AFK45147.1|  unknown                                                 296   4e-92    
gb|AFK37852.1|  unknown                                                 296   5e-92    
ref|XP_009589853.1|  PREDICTED: uncharacterized protein LOC104087...    295   5e-92    
ref|XP_009398466.1|  PREDICTED: protein notum homolog                   295   7e-92    
ref|XP_006385136.1|  hypothetical protein POPTR_0004s24220g             294   1e-91    
gb|EYU37453.1|  hypothetical protein MIMGU_mgv1a007583mg                294   2e-91    
ref|NP_974575.2|  putative pectinacetylesterase                         292   4e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KDO40409.1|  hypothetical protein CISIN_1g016608mg                   292   6e-91    
gb|KDP28067.1|  hypothetical protein JCGZ_19475                         292   8e-91    
ref|XP_009397056.1|  PREDICTED: protein notum homolog                   292   8e-91    
ref|XP_002454426.1|  hypothetical protein SORBIDRAFT_04g030720          292   9e-91    Sorghum bicolor [broomcorn]
ref|XP_009413211.1|  PREDICTED: protein notum homolog                   292   1e-90    
gb|KDP28066.1|  hypothetical protein JCGZ_19474                         292   1e-90    
dbj|BAD94756.1|  putative pectinacetylesterase protein                  288   1e-90    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ97261.1|  predicted protein                                      291   1e-90    
ref|XP_010235852.1|  PREDICTED: protein notum homolog isoform X2        290   1e-90    
ref|XP_009612887.1|  PREDICTED: uncharacterized protein LOC104106115    291   1e-90    
gb|KCW72718.1|  hypothetical protein EUGRSUZ_E01169                     291   2e-90    
ref|XP_006359967.1|  PREDICTED: protein notum homolog                   291   2e-90    
ref|XP_009771487.1|  PREDICTED: protein notum homolog                   291   2e-90    
ref|XP_011074218.1|  PREDICTED: protein notum homolog                   291   3e-90    
ref|XP_010911666.1|  PREDICTED: protein notum homolog                   290   4e-90    
ref|XP_008797987.1|  PREDICTED: protein notum homolog isoform X1        290   4e-90    
gb|EPS71965.1|  hypothetical protein M569_02793                         289   1e-89    
ref|XP_006351092.1|  PREDICTED: protein notum homolog                   286   2e-89    
ref|XP_008365238.1|  PREDICTED: uncharacterized protein LOC103428882    286   2e-89    
emb|CAD41867.2|  OSJNBa0041A02.14                                       288   2e-89    Oryza sativa Japonica Group [Japonica rice]
gb|EYU37448.1|  hypothetical protein MIMGU_mgv1a007102mg                289   3e-89    
ref|XP_009776988.1|  PREDICTED: uncharacterized protein LOC104226...    288   3e-89    
ref|XP_008238015.1|  PREDICTED: protein notum homolog isoform X5        285   4e-89    
ref|XP_010325697.1|  PREDICTED: uncharacterized protein LOC101260962    294   6e-89    
ref|XP_004509524.1|  PREDICTED: uncharacterized protein LOC101493...    284   6e-89    
ref|XP_008238014.1|  PREDICTED: protein notum homolog isoform X4        285   8e-89    
ref|NP_001053773.1|  Os04g0602500                                       289   1e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008238013.1|  PREDICTED: protein notum homolog isoform X3        284   1e-88    
ref|XP_010266386.1|  PREDICTED: uncharacterized protein LOC104603...    285   2e-88    
ref|XP_009407790.1|  PREDICTED: protein notum homolog                   287   2e-88    
ref|XP_006367726.1|  PREDICTED: uncharacterized protein LOC102600035    285   3e-88    
gb|EEC77932.1|  hypothetical protein OsI_17271                          290   4e-88    Oryza sativa Indica Group [Indian rice]
gb|ABK24994.1|  unknown                                                 285   5e-88    Picea sitchensis
gb|ABK24433.1|  unknown                                                 285   5e-88    Picea sitchensis
ref|XP_009763242.1|  PREDICTED: protein notum homolog isoform X1        285   6e-88    
ref|XP_010266381.1|  PREDICTED: uncharacterized protein LOC104603...    285   9e-88    
ref|XP_004958440.1|  PREDICTED: protein notum homolog                   285   1e-87    
gb|KHG23649.1|  Notum                                                   283   1e-87    
ref|NP_851135.1|  pectinacetylesterase family protein                   283   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010054026.1|  PREDICTED: uncharacterized protein LOC104442...    285   1e-87    
ref|XP_009626489.1|  PREDICTED: protein notum homolog isoform X1        284   1e-87    
ref|XP_010266380.1|  PREDICTED: uncharacterized protein LOC104603...    284   2e-87    
ref|XP_009589854.1|  PREDICTED: uncharacterized protein LOC104087...    280   3e-87    
ref|XP_009776987.1|  PREDICTED: uncharacterized protein LOC104226...    282   6e-87    
ref|XP_010240371.1|  PREDICTED: uncharacterized protein LOC100827...    282   7e-87    
ref|XP_002461086.1|  hypothetical protein SORBIDRAFT_02g040470          283   8e-87    Sorghum bicolor [broomcorn]
gb|ADE77373.1|  unknown                                                 282   1e-86    
gb|EEE61621.1|  hypothetical protein OsJ_16047                          290   1e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003580427.1|  PREDICTED: uncharacterized protein LOC100827...    281   1e-86    
ref|XP_009759657.1|  PREDICTED: uncharacterized protein LOC104212153    281   3e-86    
gb|EYU36473.1|  hypothetical protein MIMGU_mgv1a007602mg                281   3e-86    
ref|XP_003562611.1|  PREDICTED: protein notum homolog                   281   3e-86    
gb|EMT14315.1|  hypothetical protein F775_08483                         281   3e-86    
ref|XP_009407792.1|  PREDICTED: protein notum homolog                   281   3e-86    
ref|XP_006652763.1|  PREDICTED: protein notum homolog                   280   5e-86    
ref|NP_001141895.1|  uncharacterized protein LOC100274042 precursor     280   6e-86    Zea mays [maize]
gb|ABR16604.1|  unknown                                                 281   8e-86    Picea sitchensis
ref|XP_006363510.1|  PREDICTED: uncharacterized protein LOC102583822    279   9e-86    
ref|XP_009408703.1|  PREDICTED: protein notum homolog                   278   2e-85    
ref|XP_004953591.1|  PREDICTED: protein notum homolog isoform X2        276   2e-85    
ref|XP_004248530.1|  PREDICTED: protein notum homolog isoform X2        279   2e-85    
ref|XP_004246219.1|  PREDICTED: protein notum homolog                   278   3e-85    
ref|XP_006658006.1|  PREDICTED: protein notum homolog                   278   3e-85    
ref|XP_009590664.1|  PREDICTED: uncharacterized protein LOC104087...    277   4e-85    
ref|XP_003518126.1|  PREDICTED: protein notum homolog                   278   5e-85    
ref|XP_010914803.1|  PREDICTED: protein notum homolog isoform X1        277   8e-85    
ref|XP_009794027.1|  PREDICTED: uncharacterized protein LOC104240572    276   9e-85    
ref|XP_008369575.1|  PREDICTED: protein notum homolog isoform X2        278   9e-85    
ref|NP_001060382.1|  Os07g0634600                                       277   1e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006385140.1|  hypothetical protein POPTR_0004s24220g             274   1e-84    
ref|XP_010327277.1|  PREDICTED: protein notum homolog isoform X1        277   2e-84    
ref|XP_009359821.1|  PREDICTED: protein notum homolog                   277   2e-84    
gb|KHG26188.1|  Protein notum                                           276   2e-84    
ref|XP_010070108.1|  PREDICTED: protein notum homolog                   276   3e-84    
ref|XP_010914805.1|  PREDICTED: protein notum homolog                   275   3e-84    
gb|EYU37449.1|  hypothetical protein MIMGU_mgv1a011392mg                271   4e-84    
ref|XP_010695723.1|  PREDICTED: protein notum homolog                   275   6e-84    
ref|XP_007222071.1|  hypothetical protein PRUPE_ppa007506mg             273   8e-84    
ref|XP_002447050.1|  hypothetical protein SORBIDRAFT_06g027560          274   1e-83    
ref|XP_007145083.1|  hypothetical protein PHAVU_007G208200g             275   1e-83    
ref|XP_010042497.1|  PREDICTED: protein notum homolog isoform X1        275   1e-83    
ref|XP_004251486.1|  PREDICTED: uncharacterized protein LOC101264402    274   1e-83    
gb|AFK38038.1|  unknown                                                 274   2e-83    
gb|KFK37453.1|  hypothetical protein AALP_AA4G259200                    274   2e-83    
ref|XP_006293476.1|  hypothetical protein CARUB_v10023292mg             274   2e-83    
ref|XP_008222318.1|  PREDICTED: protein notum homolog                   274   2e-83    
ref|XP_010325633.1|  PREDICTED: uncharacterized protein LOC101257...    273   3e-83    
gb|EYU19372.1|  hypothetical protein MIMGU_mgv1a006907mg                271   4e-83    
ref|XP_008667853.1|  PREDICTED: hypothetical protein isoform X1         272   4e-83    
ref|XP_006338904.1|  PREDICTED: protein notum homolog isoform X1        273   4e-83    
ref|XP_009626490.1|  PREDICTED: protein notum homolog isoform X2        272   5e-83    
ref|XP_009388128.1|  PREDICTED: protein notum homolog                   272   5e-83    
ref|XP_008360208.1|  PREDICTED: protein notum homolog isoform X3        273   8e-83    
ref|XP_007154511.1|  hypothetical protein PHAVU_003G124700g             273   8e-83    
ref|XP_006423958.1|  hypothetical protein CICLE_v10028674mg             271   8e-83    
ref|XP_009353455.1|  PREDICTED: protein notum homolog                   272   1e-82    
gb|EYU19373.1|  hypothetical protein MIMGU_mgv1a006907mg                272   1e-82    
ref|XP_007051327.1|  Pectinacetylesterase family protein                273   2e-82    
gb|KDP23324.1|  hypothetical protein JCGZ_23157                         271   2e-82    
ref|XP_009610135.1|  PREDICTED: protein notum homolog                   272   2e-82    
emb|CBI37039.3|  unnamed protein product                                270   2e-82    
ref|XP_010544918.1|  PREDICTED: protein notum homolog isoform X2        271   2e-82    
ref|XP_010914807.1|  PREDICTED: protein notum homolog isoform X1        270   3e-82    
ref|XP_003626125.1|  Notum-like protein                                 271   3e-82    
ref|XP_009771153.1|  PREDICTED: uncharacterized protein LOC104221731    274   3e-82    
ref|XP_006480336.1|  PREDICTED: protein notum homolog                   271   3e-82    
ref|XP_004296984.1|  PREDICTED: protein notum homolog                   271   3e-82    
ref|XP_010043350.1|  PREDICTED: protein notum homolog                   270   4e-82    
ref|XP_008807936.1|  PREDICTED: protein notum homolog isoform X2        270   4e-82    
ref|XP_009603755.1|  PREDICTED: protein notum homolog isoform X2        267   4e-82    
ref|XP_002512590.1|  pectin acetylesterase, putative                    271   4e-82    
ref|XP_010544917.1|  PREDICTED: protein notum homolog isoform X1        271   5e-82    
ref|XP_008363956.1|  PREDICTED: protein notum homolog                   270   6e-82    
ref|XP_008450496.1|  PREDICTED: protein notum homolog                   270   6e-82    
ref|XP_004135578.1|  PREDICTED: protein notum homolog                   270   6e-82    
ref|XP_009779872.1|  PREDICTED: protein notum homolog                   270   7e-82    
ref|XP_008810598.1|  PREDICTED: protein notum homolog                   270   7e-82    
gb|KHN14241.1|  Protein notum like                                      270   7e-82    
ref|XP_002280816.3|  PREDICTED: protein notum homolog                   270   8e-82    
ref|XP_003536008.1|  PREDICTED: protein notum homolog isoform X1        270   9e-82    
gb|EMT21027.1|  hypothetical protein F775_18206                         270   1e-81    
gb|KCW85365.1|  hypothetical protein EUGRSUZ_B02195                     270   1e-81    
ref|XP_008363955.1|  PREDICTED: protein notum homolog                   269   1e-81    
ref|XP_008800308.1|  PREDICTED: protein notum homolog isoform X1        269   1e-81    
tpg|DAA36176.1|  TPA: pectinacetylesterase                              272   1e-81    
ref|NP_182216.1|  pectinacetylesterase-like protein                     269   2e-81    
ref|XP_008807935.1|  PREDICTED: protein notum homolog isoform X1        268   2e-81    
ref|XP_009335553.1|  PREDICTED: uncharacterized protein LOC103928...    268   2e-81    
ref|XP_010546781.1|  PREDICTED: protein notum homolog                   269   2e-81    
ref|XP_004494501.1|  PREDICTED: uncharacterized protein LOC101497...    269   2e-81    
ref|XP_004304922.1|  PREDICTED: protein notum homolog                   268   2e-81    
ref|XP_002280865.3|  PREDICTED: protein notum homolog                   268   3e-81    
ref|XP_002880274.1|  hypothetical protein ARALYDRAFT_483863             268   3e-81    
ref|XP_002894676.1|  hypothetical protein ARALYDRAFT_474842             268   3e-81    
emb|CBI39680.3|  unnamed protein product                                266   3e-81    
ref|XP_010674458.1|  PREDICTED: protein notum homolog                   266   4e-81    
gb|KHG13045.1|  Protein notum                                           269   4e-81    
gb|KHG30410.1|  Protein notum                                           268   4e-81    
ref|XP_003609911.1|  Pectin acetylesterase                              268   5e-81    
ref|XP_010511331.1|  PREDICTED: protein notum homolog                   268   5e-81    
ref|XP_003521640.1|  PREDICTED: protein notum homolog                   268   6e-81    
ref|XP_004246220.1|  PREDICTED: uncharacterized protein LOC101249672    274   7e-81    
ref|XP_011039993.1|  PREDICTED: uncharacterized protein LOC105136378    269   7e-81    
gb|KHN14201.1|  Protein notum like                                      267   7e-81    
tpg|DAA36173.1|  TPA: hypothetical protein ZEAMMB73_990456              266   7e-81    
ref|XP_006604776.1|  PREDICTED: protein notum homolog isoform X1        267   7e-81    
ref|XP_002320250.2|  hypothetical protein POPTR_0014s10650g             268   8e-81    
ref|XP_008369574.1|  PREDICTED: protein notum homolog isoform X1        268   9e-81    
gb|AGT17273.1|  hypothetical protein SHCRBa_020_L15_F_100               266   9e-81    
gb|EYU36472.1|  hypothetical protein MIMGU_mgv1a007479mg                266   9e-81    
ref|XP_010240825.1|  PREDICTED: protein notum homolog                   267   9e-81    
ref|XP_008807933.1|  PREDICTED: protein notum homolog                   266   1e-80    
ref|XP_010536228.1|  PREDICTED: protein notum homolog isoform X2        266   1e-80    
emb|CDY41569.1|  BnaC04g00530D                                          266   1e-80    
ref|XP_009142580.1|  PREDICTED: protein notum homolog                   266   1e-80    
emb|CDP15161.1|  unnamed protein product                                265   2e-80    
ref|XP_010942978.1|  PREDICTED: uncharacterized protein LOC105060...    265   2e-80    
ref|XP_007163281.1|  hypothetical protein PHAVU_001G221400g             266   2e-80    
ref|XP_010694126.1|  PREDICTED: protein notum homolog                   266   2e-80    
ref|XP_002279030.1|  PREDICTED: protein notum homolog                   266   2e-80    
emb|CAN62190.1|  hypothetical protein VITISV_020113                     266   2e-80    
ref|XP_002318919.2|  hypothetical protein POPTR_0013s00280g             266   2e-80    
ref|XP_009388076.1|  PREDICTED: protein notum homolog                   266   2e-80    
ref|XP_007145058.1|  hypothetical protein PHAVU_007G206300g             266   2e-80    
ref|XP_009138739.1|  PREDICTED: protein notum homolog isoform X2        266   3e-80    
ref|XP_010253184.1|  PREDICTED: protein notum homolog                   266   3e-80    
gb|EPS69740.1|  hypothetical protein M569_05022                         264   3e-80    
ref|XP_008360206.1|  PREDICTED: protein notum homolog isoform X1        266   3e-80    
ref|XP_007031285.1|  Pectinacetylesterase family protein                266   3e-80    
ref|XP_002515160.1|  pectin acetylesterase, putative                    266   3e-80    
ref|XP_009366012.1|  PREDICTED: protein notum homolog                   265   3e-80    
ref|XP_010506713.1|  PREDICTED: protein notum homolog isoform X1        265   4e-80    
ref|XP_010524828.1|  PREDICTED: protein notum homolog                   265   4e-80    
ref|XP_006302295.1|  hypothetical protein CARUB_v10020343mg             266   4e-80    
ref|XP_011087572.1|  PREDICTED: protein notum homolog isoform X1        266   4e-80    
ref|XP_009805042.1|  PREDICTED: protein notum homolog                   265   4e-80    
ref|XP_007163258.1|  hypothetical protein PHAVU_001G219200g             265   4e-80    
ref|XP_010507953.1|  PREDICTED: protein notum homolog                   265   6e-80    
emb|CDX93989.1|  BnaC04g21480D                                          265   7e-80    
ref|NP_850878.2|  pectinacetylesterase family protein                   265   7e-80    
ref|XP_011092213.1|  PREDICTED: protein notum homolog                   265   8e-80    
ref|XP_006291204.1|  hypothetical protein CARUB_v10017332mg             265   8e-80    
ref|XP_006382250.1|  hypothetical protein POPTR_0005s00330g             265   9e-80    
ref|XP_009138738.1|  PREDICTED: protein notum homolog isoform X1        266   9e-80    
emb|CDY19761.1|  BnaA09g04140D                                          265   9e-80    
emb|CDY58759.1|  BnaA04g27440D                                          266   9e-80    
ref|XP_009401969.1|  PREDICTED: uncharacterized protein LOC103985...    264   1e-79    
ref|XP_011023896.1|  PREDICTED: protein notum homolog                   264   1e-79    
ref|XP_010914804.1|  PREDICTED: protein notum homolog isoform X2        263   1e-79    
ref|XP_006397884.1|  hypothetical protein EUTSA_v10001449mg             265   1e-79    
ref|XP_009335552.1|  PREDICTED: protein notum homolog isoform X1        264   1e-79    
ref|XP_010544127.1|  PREDICTED: protein notum homolog isoform X2        264   1e-79    
ref|XP_010544126.1|  PREDICTED: protein notum homolog isoform X1        264   1e-79    
ref|XP_007163257.1|  hypothetical protein PHAVU_001G219200g             265   1e-79    
ref|XP_006444639.1|  hypothetical protein CICLE_v10020385mg             264   1e-79    
ref|XP_011039058.1|  PREDICTED: protein notum homolog isoform X1        264   1e-79    
emb|CBI37040.3|  unnamed protein product                                266   2e-79    
dbj|BAH19826.1|  AT5G26670                                              264   2e-79    
ref|XP_010512591.1|  PREDICTED: protein notum homolog                   265   2e-79    
ref|XP_010518382.1|  PREDICTED: protein notum homolog isoform X1        264   2e-79    
ref|XP_010455015.1|  PREDICTED: protein notum homolog                   263   2e-79    
gb|KCW85008.1|  hypothetical protein EUGRSUZ_B01829                     261   2e-79    
emb|CDX87039.1|  BnaC09g03540D                                          263   2e-79    
ref|XP_008388414.1|  PREDICTED: protein notum homolog                   263   2e-79    
emb|CBI26039.3|  unnamed protein product                                262   2e-79    
gb|AFK45877.1|  unknown                                                 263   3e-79    
ref|XP_006394896.1|  hypothetical protein EUTSA_v10004301mg             263   3e-79    
ref|XP_010654289.1|  PREDICTED: protein notum homolog                   263   3e-79    
ref|XP_008246334.1|  PREDICTED: protein notum homolog isoform X2        263   3e-79    
ref|NP_191765.2|  pectinacetylesterase family protein                   263   4e-79    
ref|XP_010045528.1|  PREDICTED: protein notum homolog                   263   4e-79    
gb|KDP28360.1|  hypothetical protein JCGZ_14131                         264   4e-79    
ref|XP_006492439.1|  PREDICTED: protein notum homolog                   264   4e-79    
ref|XP_004288665.1|  PREDICTED: protein notum homolog                   265   4e-79    
ref|XP_010468989.1|  PREDICTED: protein notum homolog                   264   5e-79    
ref|XP_010421519.1|  PREDICTED: protein notum homolog                   263   5e-79    
ref|XP_004495849.1|  PREDICTED: protein notum homolog isoform X1        262   5e-79    
ref|XP_003555771.1|  PREDICTED: uncharacterized protein LOC100793403    263   5e-79    
emb|CDX80575.1|  BnaC07g28690D                                          262   6e-79    
ref|XP_010493919.1|  PREDICTED: protein notum homolog                   262   6e-79    
gb|KEH43170.1|  pectinacetylesterase family protein                     262   6e-79    
ref|XP_009600844.1|  PREDICTED: protein notum homolog                   262   6e-79    
ref|XP_009151150.1|  PREDICTED: protein notum homolog                   262   6e-79    
gb|AAG50747.1|AC079733_15  pectinacetylesterase precursor, putative     262   7e-79    
ref|XP_006340065.1|  PREDICTED: protein notum homolog                   260   7e-79    
ref|XP_004508066.1|  PREDICTED: protein notum homolog                   262   8e-79    
gb|ABK26312.1|  unknown                                                 262   9e-79    
gb|AAM74495.1|  At1g57590/T8L23_6                                       262   9e-79    
ref|XP_006286504.1|  hypothetical protein CARUB_v10001019mg             262   1e-78    
ref|XP_007205243.1|  hypothetical protein PRUPE_ppa006114mg             262   1e-78    
gb|KDO40418.1|  hypothetical protein CISIN_1g013734mg                   256   1e-78    
ref|XP_008388417.1|  PREDICTED: uncharacterized protein LOC103450...    261   1e-78    
ref|NP_176072.3|  pectinacetylesterase family protein                   262   1e-78    
ref|XP_009612075.1|  PREDICTED: uncharacterized protein LOC104105...    256   1e-78    
ref|XP_009111712.1|  PREDICTED: protein notum homolog                   261   1e-78    
ref|XP_008366797.1|  PREDICTED: protein notum homolog                   262   1e-78    
ref|XP_002275616.1|  PREDICTED: protein notum homolog isoform X1        261   1e-78    
ref|XP_006392395.1|  hypothetical protein EUTSA_v10023485mg             261   1e-78    
gb|KFK35390.1|  hypothetical protein AALP_AA5G279000                    261   2e-78    
ref|XP_002439150.1|  hypothetical protein SORBIDRAFT_09g001350          261   2e-78    
ref|XP_004304921.1|  PREDICTED: protein notum homolog                   260   2e-78    
ref|XP_002876658.1|  pectinacetylesterase family protein                261   2e-78    
ref|XP_007154510.1|  hypothetical protein PHAVU_003G124700g             261   2e-78    
gb|ABG34280.1|  pectin acetylesterase                                   259   2e-78    
ref|XP_006480809.1|  PREDICTED: protein notum homolog isoform X1        261   2e-78    
ref|XP_003551008.1|  PREDICTED: protein notum homolog                   261   3e-78    
gb|KDO44145.1|  hypothetical protein CISIN_1g014476mg                   261   3e-78    
ref|XP_002872227.1|  hypothetical protein ARALYDRAFT_489494             260   3e-78    
ref|XP_008227765.1|  PREDICTED: protein notum homolog isoform X2        261   3e-78    
gb|EMT15342.1|  hypothetical protein F775_17167                         260   4e-78    
ref|XP_006402417.1|  hypothetical protein EUTSA_v10005997mg             260   4e-78    
ref|XP_009621956.1|  PREDICTED: uncharacterized protein LOC104113...    255   4e-78    
gb|KFK26428.1|  hypothetical protein AALP_AA8G247000                    260   4e-78    
ref|XP_009763243.1|  PREDICTED: protein notum homolog isoform X2        256   5e-78    
ref|XP_006385135.1|  hypothetical protein POPTR_0004s24220g             258   5e-78    
gb|KHN45022.1|  Protein notum like                                      259   5e-78    
ref|XP_004230372.1|  PREDICTED: protein notum homolog                   259   6e-78    
ref|XP_007221559.1|  hypothetical protein PRUPE_ppa006038mg             260   6e-78    
emb|CAA18628.1|  putative pectinacetylesterase protein                  258   8e-78    
ref|XP_008227764.1|  PREDICTED: protein notum homolog isoform X1        261   8e-78    
ref|XP_006358515.1|  PREDICTED: protein notum homolog                   259   9e-78    
ref|XP_006408013.1|  hypothetical protein EUTSA_v10020818mg             259   9e-78    
ref|XP_003536006.1|  PREDICTED: uncharacterized protein LOC100810716    259   9e-78    
gb|ACE86391.1|  pectinacetylesterase family protein                     259   1e-77    
ref|XP_006429076.1|  hypothetical protein CICLE_v10011803mg             259   1e-77    
gb|EMS59699.1|  hypothetical protein TRIUR3_12152                       258   1e-77    
ref|XP_003542396.2|  PREDICTED: protein notum homolog isoform X1        259   1e-77    
ref|XP_003535610.2|  PREDICTED: protein notum homolog isoform X1        258   1e-77    
ref|XP_006378039.1|  hypothetical protein POPTR_0010s00700g             259   1e-77    
gb|AFK37998.1|  unknown                                                 254   1e-77    
ref|XP_006593986.1|  PREDICTED: protein notum homolog isoform X3        258   2e-77    
ref|XP_010489689.1|  PREDICTED: protein notum homolog                   258   2e-77    
ref|XP_006840405.1|  hypothetical protein AMTR_s00045p00148030          259   2e-77    
dbj|BAJ90066.1|  predicted protein                                      257   2e-77    
gb|KFK38001.1|  hypothetical protein AALP_AA3G057300                    258   2e-77    
ref|XP_010094916.1|  hypothetical protein L484_022666                   258   3e-77    
ref|XP_003626089.1|  Pectin acetylesterase                              258   3e-77    
gb|EYU36474.1|  hypothetical protein MIMGU_mgv1a007660mg                257   3e-77    
ref|XP_006593985.1|  PREDICTED: protein notum homolog isoform X2        258   3e-77    
gb|AFK35535.1|  unknown                                                 258   3e-77    
ref|XP_008238076.1|  PREDICTED: uncharacterized protein LOC103336755    253   4e-77    
ref|XP_010999345.1|  PREDICTED: protein notum homolog isoform X2        257   6e-77    
gb|ABG34281.1|  pectin acetylesterase                                   255   6e-77    
emb|CDX95291.1|  BnaC09g15790D                                          257   6e-77    
ref|XP_010433795.1|  PREDICTED: protein notum homolog                   255   6e-77    
ref|XP_003626088.1|  Pectin acetylesterase                              258   6e-77    
ref|XP_008381630.1|  PREDICTED: uncharacterized protein LOC103444483    258   6e-77    
ref|XP_006297778.1|  hypothetical protein CARUB_v10013814mg             257   7e-77    
ref|XP_006349508.1|  PREDICTED: protein notum homolog                   257   8e-77    
gb|KHN26210.1|  Protein notum like                                      254   1e-76    
gb|AFK42918.1|  unknown                                                 256   1e-76    
ref|XP_007222070.1|  hypothetical protein PRUPE_ppa007506mg             254   1e-76    



>ref|XP_009797415.1| PREDICTED: uncharacterized protein LOC104243851 [Nicotiana sylvestris]
Length=388

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 232/369 (63%), Gaps = 13/369 (4%)
 Frame = +2

Query  101   LSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNW  280
             ++  L FF+ LL I R     +N+T+  LESAV+KG VCLDG+ P Y+ D+G G G+DNW
Sbjct  2     VTHCLFFFISLLIICRTESLLVNITI--LESAVAKGGVCLDGTPPAYHLDRGSGTGLDNW  59

Query  281   VIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAY  460
             VI IEGGGWC N  HC  R  SRLGSS  M        ++S+ P  NPEFYNW+RV V Y
Sbjct  60    VISIEGGGWCQNITHCLQRKNSRLGSSAKMGKQVAFSGIMSNDPKFNPEFYNWNRVSVRY  119

Query  461   CDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLH  640
             CDG SFT DV+ VDPAT L YRG RIF+A+M D  A+GM   +NAI +G SAGG+A +LH
Sbjct  120   CDGGSFTGDVEAVDPATGLHYRGARIFEAIMADLLAQGMSTVENAILSGCSAGGLASILH  179

Query  641   CDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKM  820
             CD FRAL P T RVKC +D+ YF+N + + G+   +  F+ +V   GSAK LP  CTSK+
Sbjct  180   CDNFRALLPKTARVKCFSDAGYFVNLKDISGEAYIEEYFNDVVTLHGSAKNLPPSCTSKL  239

Query  821   KASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGL-------TMPIVSC-VTYNNCTLNE  976
               SLCFFPQ     ++TP+F+  +A+D  Q++  L       T    +C     NCTL+E
Sbjct  240   NPSLCFFPQNVAHQIQTPLFIINAAYDHWQVRNILVPSTADPTGAWTNCKADMRNCTLSE  299

Query  977   MKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHS--WYGPKKLRVIGNKTYAEV  1150
             +++ Q  RL+FL +L      S+   ++N+C SH  T     W+GP   R+  NKT AE 
Sbjct  300   LQVLQGFRLNFLKVLEGLGPSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLF-NKTIAEA  358

Query  1151  FADWYFDRN  1177
               DW+++RN
Sbjct  359   TGDWFWERN  367



>ref|XP_009624847.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana tomentosiformis]
Length=388

 Score =   344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 180/385 (47%), Positives = 240/385 (62%), Gaps = 11/385 (3%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKI-------NVTLTTLESAVSKGAVCLDGSAPGYYY  247
             ++ R  Q    F+  LTI      K+       NVT T + SAVSKGAVCLDGS P Y++
Sbjct  3     MVTRSFQLFVLFIFPLTIFITECAKVTQNPDVYNVTKTIVHSAVSKGAVCLDGSPPAYHF  62

Query  248   DKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPE  427
             D G GEGV NW++ + GGGWC N + C  R  S +GSS YM P    G + S + + NP+
Sbjct  63    DPGFGEGVGNWLVQLSGGGWCTNVKDCLNRSKSDVGSSSYMHPQPFKG-IFSKNQSANPD  121

Query  428   FYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAG  607
             FYNW++V V YCDG SFT DV+ VDPATNL +RG RIF A++E+  AKG+KNAKNAI AG
Sbjct  122   FYNWNKVFVRYCDGGSFTGDVEYVDPATNLHFRGARIFTAVLEELLAKGLKNAKNAILAG  181

Query  608   NSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSA  787
             +SAGG   +L+CD FR L PNT+RVKCL DS YF++ +     + F+S +  +    GSA
Sbjct  182   SSAGGYPAILYCDRFRNLLPNTSRVKCLVDSGYFVHFKNPVLGRPFESIYKGVATLQGSA  241

Query  788   KWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCT  967
             K LPK CTSKMK  LC F +   Q +KTPIF++MSAFD I  +Y L   I  C+    CT
Sbjct  242   KTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIMTQYTLGGTIYGCIQNGTCT  301

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYA  1144
              ++ K  QE+R DFLS +PK N+     ++++    H      + + P+K  V+ N    
Sbjct  302   ASQNKTFQEMRSDFLSAIPKGNNPKLRGVFIDVVHHHTSLQKQTRWSPEKPIVVHNLAAP  361

Query  1145  EVFADWYFDRNTSPIRVIEKSNKPL  1219
             + F+DWYFDRN +   +I++ N PL
Sbjct  362   KAFSDWYFDRNYT--YLIDEHNLPL  384



>ref|XP_009624845.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=390

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 180/387 (47%), Positives = 241/387 (62%), Gaps = 13/387 (3%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKI-------NVTLTTLESAVSKGAVCLDGSAPGYYY  247
             ++ R  Q    F+  LTI      K+       NVT T + SAVSKGAVCLDGS P Y++
Sbjct  3     MVTRSFQLFVLFIFPLTIFITECAKVTQNPDVYNVTKTIVHSAVSKGAVCLDGSPPAYHF  62

Query  248   DKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPE  427
             D G GEGV NW++ + GGGWC N + C  R  S +GSS YM P    G + S + + NP+
Sbjct  63    DPGFGEGVGNWLVQLSGGGWCTNVKDCLNRSKSDVGSSSYMHPQPFKG-IFSKNQSANPD  121

Query  428   FYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAG  607
             FYNW++V V YCDG SFT DV+ VDPATNL +RG RIF A++E+  AKG+KNAKNAI AG
Sbjct  122   FYNWNKVFVRYCDGGSFTGDVEYVDPATNLHFRGARIFTAVLEELLAKGLKNAKNAILAG  181

Query  608   NSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYL--VDSMG  781
             +SAGG   +L+CD FR L PNT+RVKCL DS YF++ +     + F+S +  +  +   G
Sbjct  182   SSAGGYPAILYCDRFRNLLPNTSRVKCLVDSGYFVHFKNPVLGRPFESIYKGVATLQLQG  241

Query  782   SAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNN  961
             SAK LPK CTSKMK  LC F +   Q +KTPIF++MSAFD I  +Y L   I  C+    
Sbjct  242   SAKTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIMTQYTLGGTIYGCIQNGT  301

Query  962   CTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKT  1138
             CT ++ K  QE+R DFLS +PK N+     ++++    H      + + P+K  V+ N  
Sbjct  302   CTASQNKTFQEMRSDFLSAIPKGNNPKLRGVFIDVVHHHTSLQKQTRWSPEKPIVVHNLA  361

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               + F+DWYFDRN +   +I++ N PL
Sbjct  362   APKAFSDWYFDRNYT--YLIDEHNLPL  386



>ref|XP_009797876.1| PREDICTED: protein notum homolog isoform X2 [Nicotiana sylvestris]
Length=388

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 177/385 (46%), Positives = 236/385 (61%), Gaps = 11/385 (3%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKI-------NVTLTTLESAVSKGAVCLDGSAPGYYY  247
             ++ R  Q    F+  LTI+     K+       N+T T + SAVSKGAVCLDGS P Y++
Sbjct  3     MVTRSFQLFVLFIFTLTIVITECAKVTQNPDVYNITKTIIHSAVSKGAVCLDGSPPAYHF  62

Query  248   DKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPE  427
             D G G+GV NW++ + GGGWC N + C  R  S LGSS YM P  E     S + + NPE
Sbjct  63    DPGFGDGVGNWLVQLSGGGWCTNVKECLDRAKSDLGSSNYMNPQ-EFQGFFSKNQSANPE  121

Query  428   FYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAG  607
             FYNW++V V YCDG SFT DV+ VDPAT L +RG RIF  ++E+  AKG+KNAKNAI AG
Sbjct  122   FYNWNKVFVRYCDGGSFTGDVEYVDPATKLHFRGARIFTVVLEELLAKGLKNAKNAILAG  181

Query  608   NSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSA  787
             +SAGG   ML+CD FR   PNT+RVKCL DS YF++ +     + F+S +  +    GSA
Sbjct  182   SSAGGYPAMLYCDGFRNSLPNTSRVKCLVDSGYFVHFKNTVLGRPFESIYKGIATLQGSA  241

Query  788   KWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCT  967
             K LPK CTSKMK  LC F +   Q +KTPIF++MSAFD I  +Y L   I  C+    CT
Sbjct  242   KTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIMTQYTLGGGIYGCIQEGTCT  301

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYA  1144
              ++ K  QE+R DFL+ +PK N+     ++++    H      + + P K  V+ N    
Sbjct  302   ASQNKTLQEMRSDFLNAIPKGNNPKLRGVFIDVVHHHTSLQKQTRWSPVKPIVVHNLAAP  361

Query  1145  EVFADWYFDRNTSPIRVIEKSNKPL  1219
             + FADWYFDRN +   +I++ + PL
Sbjct  362   KAFADWYFDRNYT--YLIDERSLPL  384



>ref|XP_003628996.1| Carboxylic ester hydrolase [Medicago truncatula]
 gb|AET03472.1| pectinacetylesterase family protein [Medicago truncatula]
Length=406

 Score =   339 bits (870),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 177/379 (47%), Positives = 238/379 (63%), Gaps = 15/379 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             +R+ +WL   +  L  L K +G+  V LT LESAVSKGAVCLDGS P Y++D+GH EG +
Sbjct  4     SRIIKWLSTLLCALLFL-KTQGQY-VPLTRLESAVSKGAVCLDGSPPAYHFDQGHDEGAN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N  +C YR  SRLGSS  M         LSD+   NP+FYNW+RV+V
Sbjct  62    NWIVHIEGGGWCHNVTYCLYRRDSRLGSSHEMEEQTYFSGYLSDNQQYNPDFYNWNRVKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP T L YRG RIF A+ME+  AKGM +A+NAI +G SAGG+  +
Sbjct  122   RYCDGSSFTGDVEEVDPTTKLYYRGARIFSAVMEELLAKGMDHAENAILSGCSAGGLTTI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRALFPN TRVKC++D+ YF+N   + GD   +  +  +V + GS K LP  CTS
Sbjct  182   LHCDGFRALFPNETRVKCVSDAGYFVNVNDISGDHYIEDYYSQVVATHGSEKSLPSSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTL  970
              +   LCFFPQY    ++TPIF+  +A+D  Q+K  L            SC T  NNC+ 
Sbjct  242   MLSPGLCFFPQYMASSIQTPIFIVNAAYDSWQIKNILAPGDADPDGQWRSCKTNLNNCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
              ++ I Q+ R  FL  L   ++  S  +++++C  H  T    +W+      ++GNKT A
Sbjct  302   EQLNIMQDYRTQFLEALSPISNSPSNGMFIDSCYVHCQTEPQETWFKSDS-PMVGNKTVA  360

Query  1145  EVFADWYFDRNTSPIRVIE  1201
             +   DW+++R  SP R I+
Sbjct  361   KAVGDWFYER--SPSREID  377



>gb|ACF05806.1| PAE [Litchi chinensis]
Length=399

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/381 (45%), Positives = 245/381 (64%), Gaps = 15/381 (4%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             + AR S WL   V  L IL K EG  +V +T +E+AV+KGAVCLDGS P Y+ DKG G G
Sbjct  2     VDARWSPWLSLLVCGL-ILLKTEG-FDVGITYVENAVAKGAVCLDGSPPAYHLDKGFGAG  59

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             ++NW++ IEGGGWC N   C  R  +RLGSSK M  V     +LS+    NP+FYNW+R+
Sbjct  60    INNWLVHIEGGGWCNNVTTCLSRKNTRLGSSKKMVKVVAFSGMLSNKQKFNPDFYNWNRI  119

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDG+SFT DV+ V+PATNL +RG R+F A++ED  AKGMKNAKNA+ +G SAGG+ 
Sbjct  120   KVRYCDGASFTGDVEAVNPATNLHFRGARVFLAIIEDLLAKGMKNAKNAVLSGCSAGGLT  179

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+ L P +T+VKC AD+ YFIN + + G +  ++ ++ +V + GSAK LP  C
Sbjct  180   SILHCDKFQTLLPTSTKVKCFADAGYFINTKDVSGAQHIEAFYNEVVATHGSAKNLPASC  239

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS++K  LCFFPQY  + ++TP+F+  +A+D  Q+K  L   +        SC +  NNC
Sbjct  240   TSRLKPGLCFFPQYMARQIQTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNC  299

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKT  1138
             + N+++  Q  RL FL  L    + +S  +++++C +H  T    +W       V+G  T
Sbjct  300   SPNQLQTMQSFRLQFLDALSGLGNSTSKGLFIDSCYAHCQTEMQETWLRDDS-PVLGKTT  358

Query  1139  YAEVFADWYFDRNTSPIRVIE  1201
              A+   DWY+DR  SP + I+
Sbjct  359   IAKAVGDWYYDR--SPFQKID  377



>ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis]
 gb|KDO40413.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=399

 Score =   337 bits (863),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 238/381 (62%), Gaps = 15/381 (4%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             + AR+ QWL   V  L IL K +G  NV +T +E+AV KGAVCLDGS P Y++DKG G G
Sbjct  2     VAARMGQWLNLLVCAL-ILLKADG-FNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAG  59

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             ++NW++ IEGGGWC N   C  R  +RLGSSK M  V     +LS+    NP+FYNW+R+
Sbjct  60    INNWLVHIEGGGWCNNVTTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRI  119

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDG+SFT DV+ V+PA NL +RG R+F A+MED  AKGMKNA+NA+ +G SAGG+ 
Sbjct  120   KVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMAKGMKNAQNAVLSGCSAGGLT  179

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRALFP  T+VKC AD+ YFIN + + G    +  +  +V + GSAK LP  C
Sbjct  180   SILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGASHIEQFYAQVVATHGSAKHLPASC  239

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS++   LCFFPQY  + + TP+F+  +A+D  Q+K  L   +        SC +  NNC
Sbjct  240   TSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNC  299

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKT  1138
             +  +++  Q  R  FL+ L      SS  ++++ C +H  T    +W       V+G  +
Sbjct  300   SPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDS-PVLGKMS  358

Query  1139  YAEVFADWYFDRNTSPIRVIE  1201
              A+   DWY+DR  SP + I+
Sbjct  359   IAKAVGDWYYDR--SPFQKID  377



>ref|XP_009592441.1| PREDICTED: uncharacterized protein LOC104089292 [Nicotiana tomentosiformis]
Length=394

 Score =   336 bits (862),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 221/346 (64%), Gaps = 11/346 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T LESAV+ GAVCLDG+ P Y+ D+G G G++NWVI IEGGGWC N  HC  R  SR
Sbjct  25    VNITILESAVATGAVCLDGTPPAYHLDRGSGTGLNNWVISIEGGGWCQNITHCLERKNSR  84

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSS  M        ++S+ P  NPEFYNW+RV V YCDG SFT DV+ VDPAT L YRG
Sbjct  85    LGSSAKMGKQVAFSGIMSNDPKFNPEFYNWNRVSVRYCDGGSFTGDVEAVDPATGLHYRG  144

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF A+M D  ++GM  A+NAI +G SAGG+A +LHCD FRAL P + RVKC +D+ YF
Sbjct  145   ARIFKAIMADLLSQGMSTAENAILSGCSAGGLASILHCDNFRALLPKSARVKCFSDAGYF  204

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             +N + + G+   +  F+ +V   GSAK LP  CTSK+K SLCFFPQ     ++TP+F+  
Sbjct  205   VNLKDISGEAYIEEYFNDVVTLHGSAKNLPPSCTSKLKPSLCFFPQNVAHQLQTPLFIIN  264

Query  890   SAFDQIQLKYGL-------TMPIVSC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q++  L       T    +C     NCTL+E+K+ Q  RL+FL +L      S+
Sbjct  265   AAYDHWQVRNILVPSTADPTGAWTNCKADMRNCTLSELKVLQGFRLNFLKVLEGLGPSST  324

Query  1046  IAIWVNNCVSHEFTYHS--WYGPKKLRVIGNKTYAEVFADWYFDRN  1177
                ++N+C SH  T     W+GP   R+  NKT AE   DW+++RN
Sbjct  325   RGYYINSCFSHCQTQQQAYWFGPNSPRLF-NKTIAEATGDWFWERN  369



>ref|XP_009589915.1| PREDICTED: uncharacterized protein LOC104087209 isoform X2 [Nicotiana 
tomentosiformis]
Length=399

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/389 (46%), Positives = 236/389 (61%), Gaps = 20/389 (5%)
 Frame = +2

Query  107   QWLCFFVVLLTILR-KIEGKIN---------VTLTTLESAVSKGAVCLDGSAPGYYYDKG  256
             Q LC  +  L +L  K    +N         V LT LESAVSKGAVCLDGS P +YYDKG
Sbjct  10    QCLCLLIFSLLVLNGKTVLGVNQTSNENLGMVDLTILESAVSKGAVCLDGSPPAFYYDKG  69

Query  257   HGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYN  436
             HGEG +NW+I+  GG WC N   C  R  +  GSSK          +LS++   NP+FYN
Sbjct  70    HGEGANNWIIYFRGGEWCYNVIDCLNRTKTEKGSSKLAPKQRSFYGILSNNKTLNPDFYN  129

Query  437   WHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSA  616
             W+RV V YCDG+SFT DV+ VDP TNL +RG RIF AL+E F AKGMK+AKNAI AG SA
Sbjct  130   WNRVMVIYCDGASFTGDVEIVDPVTNLHFRGARIFHALIEHFLAKGMKDAKNAILAGGSA  189

Query  617   GGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWL  796
             GG+  +LHCD FRAL PN+ RVKCLAD SYF++ + ++         + L+    SAK L
Sbjct  190   GGLPALLHCDRFRALLPNSARVKCLADGSYFLHKKNMKEIPFMDIVNEGLITLHHSAKML  249

Query  797   PKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCTLNE  976
             P  C SKM+ SLC FPQY  Q ++TP F+  S FD  Q+     +     +  N C+   
Sbjct  250   PSSCISKMRPSLCLFPQYFQQEIQTPFFIVNSMFDTFQINKTF-LGYYEDLNNNTCSATL  308

Query  977   MKIAQELRLDFLSLLPKK-NSESSIAIWVNNCVSHE--FTYHSWYGPKKLRVIGNKTYAE  1147
             +K  Q+ + +FLS LPK+ +  SS  +++++C+ H    +   W G      + NKT AE
Sbjct  309   VKTLQDFKQEFLSALPKQSDCSSSRGMFIDSCLIHSQILSGVGWNG----FTVHNKTIAE  364

Query  1148  VFADWYFDRNTSPIRVIEKSNKPLNCSTF  1234
              F+DWYFDR  S +++I+  + PLNC  F
Sbjct  365   AFSDWYFDR--SSVQLIDTPDLPLNCYKF  391



>ref|XP_009589914.1| PREDICTED: uncharacterized protein LOC104087209 isoform X1 [Nicotiana 
tomentosiformis]
Length=400

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/389 (46%), Positives = 236/389 (61%), Gaps = 20/389 (5%)
 Frame = +2

Query  107   QWLCFFVVLLTILR-KIEGKIN---------VTLTTLESAVSKGAVCLDGSAPGYYYDKG  256
             Q LC  +  L +L  K    +N         V LT LESAVSKGAVCLDGS P +YYDKG
Sbjct  11    QCLCLLIFSLLVLNGKTVLGVNQTSNENLGMVDLTILESAVSKGAVCLDGSPPAFYYDKG  70

Query  257   HGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYN  436
             HGEG +NW+I+  GG WC N   C  R  +  GSSK          +LS++   NP+FYN
Sbjct  71    HGEGANNWIIYFRGGEWCYNVIDCLNRTKTEKGSSKLAPKQRSFYGILSNNKTLNPDFYN  130

Query  437   WHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSA  616
             W+RV V YCDG+SFT DV+ VDP TNL +RG RIF AL+E F AKGMK+AKNAI AG SA
Sbjct  131   WNRVMVIYCDGASFTGDVEIVDPVTNLHFRGARIFHALIEHFLAKGMKDAKNAILAGGSA  190

Query  617   GGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWL  796
             GG+  +LHCD FRAL PN+ RVKCLAD SYF++ + ++         + L+    SAK L
Sbjct  191   GGLPALLHCDRFRALLPNSARVKCLADGSYFLHKKNMKEIPFMDIVNEGLITLHHSAKML  250

Query  797   PKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCTLNE  976
             P  C SKM+ SLC FPQY  Q ++TP F+  S FD  Q+     +     +  N C+   
Sbjct  251   PSSCISKMRPSLCLFPQYFQQEIQTPFFIVNSMFDTFQINKTF-LGYYEDLNNNTCSATL  309

Query  977   MKIAQELRLDFLSLLPKK-NSESSIAIWVNNCVSHE--FTYHSWYGPKKLRVIGNKTYAE  1147
             +K  Q+ + +FLS LPK+ +  SS  +++++C+ H    +   W G      + NKT AE
Sbjct  310   VKTLQDFKQEFLSALPKQSDCSSSRGMFIDSCLIHSQILSGVGWNG----FTVHNKTIAE  365

Query  1148  VFADWYFDRNTSPIRVIEKSNKPLNCSTF  1234
              F+DWYFDR  S +++I+  + PLNC  F
Sbjct  366   AFSDWYFDR--SSVQLIDTPDLPLNCYKF  392



>ref|XP_004244682.2| PREDICTED: uncharacterized protein LOC101248898 [Solanum lycopersicum]
Length=390

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 176/386 (46%), Positives = 240/386 (62%), Gaps = 11/386 (3%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKI----EGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGH  259
             + ++ Q LC  +  L +L       EG+  V LT LESAVSKGAVCLDG+ P YYY+KG+
Sbjct  3     ITKILQGLCLVIFCLIMLNDKVVIGEGETMVNLTILESAVSKGAVCLDGTPPAYYYEKGY  62

Query  260   GEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNW  439
             GEG +NW+I+  GG WC N   C  R  +  GSSKY         +LS++   NP+FYNW
Sbjct  63    GEGANNWIIYFRGGEWCYNVIDCVARTTTEKGSSKYALKQRSFYGILSNNKTINPDFYNW  122

Query  440   HRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAG  619
             +RV V YCDGSSFT DV+ VDP   L +RG RIF AL+E+F  KGMKNAKNAI +G SAG
Sbjct  123   NRVMVIYCDGSSFTGDVELVDPINKLHFRGARIFLALIENFLEKGMKNAKNAILSGGSAG  182

Query  620   GVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLP  799
             G+  ++HCD F+AL PN+ RVKCLAD SYF++ E+++      +  + L+    S   LP
Sbjct  183   GLPALIHCDRFKALLPNSARVKCLADGSYFLHREQMKEMAFMDTVNEGLIKLHHSTNMLP  242

Query  800   KECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMP-IVSCVTYNNCTLNE  976
               CTSKM  SLC FPQY  + +KTP F+  S FD  Q+    T P     +  N C+ + 
Sbjct  243   SSCTSKMNPSLCLFPQYFQEGIKTPFFIVNSMFDTFQINK--TFPGYYENLFSNTCSTSL  300

Query  977   MKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTYAEVFA  1156
             +K  Q+ + DF++ LPK+++ SS  +++++C+ H     S  G     V  NKT A+ F+
Sbjct  301   VKTLQDFKQDFINALPKQSNSSSRGMFIDSCLIHS-QITSGVGWNGFSVY-NKTIAKTFS  358

Query  1157  DWYFDRNTSPIRVIEKSNKPLNCSTF  1234
             DWYFD+  S  ++I+K + PLNC  F
Sbjct  359   DWYFDK--SHEQLIDKPDLPLNCYNF  382



>ref|XP_009797875.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=390

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 177/387 (46%), Positives = 237/387 (61%), Gaps = 13/387 (3%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKI-------NVTLTTLESAVSKGAVCLDGSAPGYYY  247
             ++ R  Q    F+  LTI+     K+       N+T T + SAVSKGAVCLDGS P Y++
Sbjct  3     MVTRSFQLFVLFIFTLTIVITECAKVTQNPDVYNITKTIIHSAVSKGAVCLDGSPPAYHF  62

Query  248   DKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPE  427
             D G G+GV NW++ + GGGWC N + C  R  S LGSS YM P  E     S + + NPE
Sbjct  63    DPGFGDGVGNWLVQLSGGGWCTNVKECLDRAKSDLGSSNYMNPQ-EFQGFFSKNQSANPE  121

Query  428   FYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAG  607
             FYNW++V V YCDG SFT DV+ VDPAT L +RG RIF  ++E+  AKG+KNAKNAI AG
Sbjct  122   FYNWNKVFVRYCDGGSFTGDVEYVDPATKLHFRGARIFTVVLEELLAKGLKNAKNAILAG  181

Query  608   NSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYL--VDSMG  781
             +SAGG   ML+CD FR   PNT+RVKCL DS YF++ +     + F+S +  +  +   G
Sbjct  182   SSAGGYPAMLYCDGFRNSLPNTSRVKCLVDSGYFVHFKNTVLGRPFESIYKGIATLQLQG  241

Query  782   SAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNN  961
             SAK LPK CTSKMK  LC F +   Q +KTPIF++MSAFD I  +Y L   I  C+    
Sbjct  242   SAKTLPKSCTSKMKPELCLFAENIQQDIKTPIFISMSAFDNIMTQYTLGGGIYGCIQEGT  301

Query  962   CTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKT  1138
             CT ++ K  QE+R DFL+ +PK N+     ++++    H      + + P K  V+ N  
Sbjct  302   CTASQNKTLQEMRSDFLNAIPKGNNPKLRGVFIDVVHHHTSLQKQTRWSPVKPIVVHNLA  361

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               + FADWYFDRN +   +I++ + PL
Sbjct  362   APKAFADWYFDRNYT--YLIDERSLPL  386



>gb|KDO40410.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=437

 Score =   335 bits (859),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 238/381 (62%), Gaps = 15/381 (4%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             + AR+ QWL   V  L IL K +G  NV +T +E+AV KGAVCLDGS P Y++DKG G G
Sbjct  40    VAARMGQWLNLLVCAL-ILLKADG-FNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAG  97

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             ++NW++ IEGGGWC N   C  R  +RLGSSK M  V     +LS+    NP+FYNW+R+
Sbjct  98    INNWLVHIEGGGWCNNVTTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRI  157

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDG+SFT DV+ V+PA NL +RG R+F A+MED  AKGMKNA+NA+ +G SAGG+ 
Sbjct  158   KVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMAKGMKNAQNAVLSGCSAGGLT  217

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRALFP  T+VKC AD+ YFIN + + G    +  +  +V + GSAK LP  C
Sbjct  218   SILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGASHIEQFYAQVVATHGSAKHLPASC  277

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS++   LCFFPQY  + + TP+F+  +A+D  Q+K  L   +        SC +  NNC
Sbjct  278   TSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNC  337

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKT  1138
             +  +++  Q  R  FL+ L      SS  ++++ C +H  T    +W       V+G  +
Sbjct  338   SPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDS-PVLGKMS  396

Query  1139  YAEVFADWYFDRNTSPIRVIE  1201
              A+   DWY+DR  SP + I+
Sbjct  397   IAKAVGDWYYDR--SPFQKID  415



>ref|XP_009803843.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
 ref|XP_009803844.1| PREDICTED: uncharacterized protein LOC104249167 [Nicotiana sylvestris]
Length=396

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/390 (46%), Positives = 234/390 (60%), Gaps = 22/390 (6%)
 Frame = +2

Query  107   QWLCFFVVLLTILR----------KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKG  256
             Q LC  +  L +L             E    V +T LESAVSKGAVCLDGS P +YYDKG
Sbjct  7     QCLCLLICSLIVLNGKTVLGGNQTSNENLGMVDITILESAVSKGAVCLDGSPPAFYYDKG  66

Query  257   HGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYN  436
             HGEG +NW+I+  GG WC N   C  R  +  GSSK          +L ++  ENP+FYN
Sbjct  67    HGEGANNWIIYFRGGEWCYNVLDCLNRTKTEKGSSKLAPKQRSFYGILGNNKTENPDFYN  126

Query  437   WHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSA  616
             W+RV V YCDGSSFT DV+ VDP TNL +RG R+F AL+E F   GMK+AKNAI +G SA
Sbjct  127   WNRVMVIYCDGSSFTGDVEIVDPVTNLHFRGARVFHALIEHFLVIGMKDAKNAILSGGSA  186

Query  617   GGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWL  796
             GG+  +LHCD FRAL PN+ RVKCLAD SYF++ + ++         + L+    SAK L
Sbjct  187   GGLPALLHCDRFRALLPNSARVKCLADGSYFLHKKNMKEIPFMDIVNEGLITLHHSAKML  246

Query  797   PKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMP-IVSCVTYNNCTLN  973
             P  CTSKM+ SLC FPQY  Q ++TP F+  S FD  Q+    T P     +  N C+  
Sbjct  247   PSSCTSKMRPSLCLFPQYFQQEIQTPFFIVNSMFDTFQINK--TFPGYYEDLNNNTCSAT  304

Query  974   EMKIAQELRLDFLSLLPKK-NSESSIAIWVNNCVSHE--FTYHSWYGPKKLRVIGNKTYA  1144
              +K  Q+ + +FLS LPK+ N  SS  +++++C+ H    +   W G      + NKT A
Sbjct  305   LVKTLQDFKQEFLSALPKQSNCSSSRGMFIDSCLIHSQILSGVGWNG----FTVHNKTIA  360

Query  1145  EVFADWYFDRNTSPIRVIEKSNKPLNCSTF  1234
             E F++WYFD   SP+++I+  + PLNC  F
Sbjct  361   EAFSNWYFD--LSPVQLIDTPDMPLNCYKF  388



>ref|XP_010056135.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
Length=392

 Score =   332 bits (851),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 167/373 (45%), Positives = 240/373 (64%), Gaps = 13/373 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL  WLC  ++ + IL K E  INV++T +++AV+KGAVCLDGS P Y++DKG G G +
Sbjct  4     ARLRTWLCV-ILSIQILLKSEA-INVSITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGAN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW+IF+EGGGWC N   C  R  +R+GSSK M        +LS+    NP+FYNW++++V
Sbjct  62    NWLIFVEGGGWCNNVTTCLARRDTRVGSSKQMVKELSFSGILSNKQKFNPDFYNWNKIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ V+PATNL +RG R F A++ED  +KGM NA+NAI +G SAGG+A +
Sbjct  122   RYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSKGMSNAQNAILSGCSAGGLAAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             L+CD FRAL P  T+VKCLAD+ YFIN + + G    ++ +  +V + GSAK LP  CTS
Sbjct  182   LNCDRFRALMPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             KMK  LCFFPQ  +  ++TP+F+  +A+D  Q+K  L   +        SC +    C+ 
Sbjct  242   KMKPGLCFFPQNVVPQIQTPLFIINAAYDAWQIKNILAPGVADPHGTWNSCKLDIKKCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYA  1144
             N++KI Q+ RL+FL  L    +  S  +++++C +H    T  +W       ++   + A
Sbjct  302   NQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQAGTEATWL-RNDSPIVAKTSIA  360

Query  1145  EVFADWYFDRNTS  1183
             +   DWY++R TS
Sbjct  361   KAVGDWYYERITS  373



>ref|XP_011073252.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=398

 Score =   332 bits (850),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 172/380 (45%), Positives = 238/380 (63%), Gaps = 17/380 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
              RL QW  F V L+ +LR       V +T ++SAV+KGAVCLDGS P Y+ DKG G G++
Sbjct  3     GRLQQWSVFVVCLMIVLR--TESFFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGIN  60

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC N   C  R  +RLGSSK M        + S+ P  NP+FYNW+R++V
Sbjct  61    NWLVHVEGGGWCNNVTTCLARTKTRLGSSKLMAKQIAFSGIFSNKPQFNPDFYNWNRIKV  120

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ VDPAT L YRG R+F A++ED  AKGMKNA+NAI +G SAGG+  +
Sbjct  121   RYCDGASFTGDVEVVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSI  180

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+AL P  T+VKC +D+ +FIN + + G    Q  ++ +V + GSAK LP+ CTS
Sbjct  181   LHCDNFKALLPVGTKVKCFSDAGFFINAKDVSGAPHIQDFYNDVVTTHGSAKNLPQSCTS  240

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTL  970
             +MK SLCFFPQ   Q ++TP+F+  +A+D  Q+K  L   +         C T    C+ 
Sbjct  241   RMKPSLCFFPQNMAQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIVKCST  300

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWY-GPKKLRVIGNKTY  1141
              +++  QE RL FL+ L    S +S   ++N C +H  T    +W+ G   L  + NKT 
Sbjct  301   TQLQTMQEFRLQFLNALSGLGSSTSRGYFINGCYAHCQTEMQETWFRGDSPL--LYNKTI  358

Query  1142  AEVFADWYFDRNTSPIRVIE  1201
             A+   DW++DR  SP + I+
Sbjct  359   AKAVGDWFYDR--SPFQKID  376



>ref|XP_011082149.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082150.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082151.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=398

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/387 (44%), Positives = 243/387 (63%), Gaps = 18/387 (5%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
              RL + L   V ++ +LR       V +T + SAV+KGAVCLDGS P Y+ D+G+G G++
Sbjct  3     GRLLKCLHILVFMMIVLR--TESFYVDITYVRSAVAKGAVCLDGSPPAYHLDRGYGTGIN  60

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N   C  R  +RLGSSKYM        +L++  N NP+FYNW+RV+V
Sbjct  61    NWLVHIEGGGWCNNVTTCLARKNNRLGSSKYMVKQLAFSGILNNKANFNPDFYNWNRVKV  120

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ V+P T L YRG R+F A+MED  AKGMKNA+NA+ +G SAGG+A +
Sbjct  121   RYCDGASFTGDVEAVNPVTKLHYRGARVFLAVMEDLLAKGMKNAENAVLSGCSAGGLAAI  180

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+AL P  T+VKC +D+ YFIN + + G +  ++ +  +V + GSAK LP+ CTS
Sbjct  181   LHCDSFKALLPMGTKVKCFSDAGYFINTKDVSGAQHIEAFYHDVVSTHGSAKNLPRSCTS  240

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTL  970
             +MK SLCFFPQY  + ++TP+F+  +A+D  Q+K  L   +        +C T  N C+ 
Sbjct  241   RMKPSLCFFPQYVAREIRTPLFIINAAYDSWQIKNILAPGVADPHGTWHNCKTDINKCSA  300

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
              +++  Q  RL+F+  L      +S   ++N+C +H  T    +WY     + + NKT A
Sbjct  301   TQLQTMQGFRLEFIRALYGLGVSTSRGYFINSCYAHCQTEMQETWYRSDSPK-LNNKTIA  359

Query  1145  EVFADWYFDRNTSPIRVIEKSNKPLNC  1225
             +   DW++DR  SP    +K + P  C
Sbjct  360   KAVGDWFYDR--SP---FQKGDCPYPC  381



>ref|XP_011073171.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=422

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 172/380 (45%), Positives = 238/380 (63%), Gaps = 17/380 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
              RL QW  F V L+ +LR       V +T ++SAV+KGAVCLDGS P Y+ DKG G G++
Sbjct  27    GRLQQWSVFVVCLMIVLR--TESFFVDITYVQSAVAKGAVCLDGSPPAYHIDKGSGAGIN  84

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC N   C  R  +RLGSSK M        + S+ P  NP+FYNW+R++V
Sbjct  85    NWLVHVEGGGWCNNVTTCLARTKTRLGSSKLMAKQIAFSGIFSNKPQFNPDFYNWNRIKV  144

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ VDPAT L YRG R+F A++ED  AKGMKNA+NAI +G SAGG+  +
Sbjct  145   RYCDGASFTGDVEVVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSI  204

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+AL P  T+VKC +D+ +FIN + + G    Q  ++ +V + GSAK LP+ CTS
Sbjct  205   LHCDNFKALLPVGTKVKCFSDAGFFINAKDVSGAPHIQDFYNDVVTTHGSAKNLPQSCTS  264

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTL  970
             +MK SLCFFPQ   Q ++TP+F+  +A+D  Q+K  L   +         C T    C+ 
Sbjct  265   RMKPSLCFFPQNMAQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIVKCST  324

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWY-GPKKLRVIGNKTY  1141
              +++  QE RL FL+ L    S +S   ++N C +H  T    +W+ G   L  + NKT 
Sbjct  325   TQLQTMQEFRLQFLNALSGLGSSTSRGYFINGCYAHCQTEMQETWFRGDSPL--LYNKTI  382

Query  1142  AEVFADWYFDRNTSPIRVIE  1201
             A+   DW++DR  SP + I+
Sbjct  383   AKAVGDWFYDR--SPFQKID  400



>ref|XP_009601364.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=392

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 171/389 (44%), Positives = 241/389 (62%), Gaps = 12/389 (3%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKIN-VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGE  265
             + +R  QW+ F ++   +  K E   N V  T ++ A SKGAVCLDGS   Y+YDKG+G+
Sbjct  4     VASRWYQWIIFLLICSVMKVKAEVLPNKVAKTLVQDAFSKGAVCLDGSPAAYHYDKGYGD  63

Query  266   GVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHR  445
             GV+NWV+++EGGGWC   + C  R     G S +M      G LLS+S   NPEFYNWHR
Sbjct  64    GVNNWVVWLEGGGWCKRVEDCGRRFNYSNGFSNHMDSKSFYG-LLSNSKTSNPEFYNWHR  122

Query  446   VRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGV  625
             + + YCDGSS+T DV+ VD ATN  YRG RIF A+ME+  AKGMKNAKNAI +G SAGG+
Sbjct  123   IMIRYCDGSSYTGDVELVDKATNQHYRGARIFQAIMEELLAKGMKNAKNAILSGCSAGGL  182

Query  626   AVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKE  805
               M HCD FR+L P+T RVKCL+D +YF+ D   +  K+ +S++  +V+   SAK LP  
Sbjct  183   GTMFHCDRFRSLLPSTVRVKCLSDGAYFLLDNDFKRAKILESTYRGVVNLHNSAKMLPPS  242

Query  806   CTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTY--------NN  961
             CTS+M  + CFFPQ+  Q +KTP+F+  SA+D  Q+     +P      +        + 
Sbjct  243   CTSRMNPTSCFFPQHIQQDIKTPLFILNSAYDSWQI-VDTVIPFADRQDFAENCKKNLSK  301

Query  962   CTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTY  1141
             C+ ++ K+ Q    +FLS LPK  S S   +++N+C+ H  T H W       ++ NKT 
Sbjct  302   CSPDQQKMLQGFGAEFLSALPKSYSPSQRGMYINSCLMHCQTDHDWSWNSNSDLLNNKTI  361

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             A+VF DW+F+R+ S   ++++ + P  CS
Sbjct  362   AKVFGDWFFERDPSR-EMVKQQDLPQICS  389



>emb|CDP15690.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   330 bits (845),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 168/379 (44%), Positives = 242/379 (64%), Gaps = 15/379 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
              RL  W    V +L +LR       V +T +ESAV+KGAVCLDGS P Y+ D+G G G++
Sbjct  4     GRLHLWFHILVNVLILLRT--EAFFVDITYVESAVAKGAVCLDGSPPAYHLDRGFGAGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             +W++ IEGGGWC N   C  R  +RLGSSK M        +L++ P  NP+FYNW+RV+V
Sbjct  62    SWLVHIEGGGWCNNVTTCLDRKNTRLGSSKQMAKQLAFSGILANKPKFNPDFYNWNRVKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ V+PATNL YRG R+F A++ED  AKGM+NA++A+ +G SAGG+  +
Sbjct  122   RYCDGSSFTGDVEAVNPATNLHYRGARVFVAVIEDLLAKGMRNAESAVLSGCSAGGLTSI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+AL P  T+VKC AD+ YFIN + + G +  ++ ++ +V++ GSAK LP  CTS
Sbjct  182   LHCDSFKALLPLGTKVKCFADAGYFINAKDVSGVQHIEAFYNDVVNTHGSAKNLPATCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             +MK  LCFFPQY  Q ++TP+F+T +A+D  Q+K  L   +        +C +    C+ 
Sbjct  242   RMKPGLCFFPQYMAQEIRTPLFITNAAYDSWQIKNILAPGVADPHGLWHNCKLDITRCSA  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
             ++++I Q  RL+FLS +    + SS   ++N C +H  T    +W      R + +KT A
Sbjct  302   SQLQIIQGFRLEFLSAVNGLGTSSSRGYFINGCYAHCQTEMQETWLRDDSPR-LNDKTIA  360

Query  1145  EVFADWYFDRNTSPIRVIE  1201
             +   DW++DR  SP + I+
Sbjct  361   KAVGDWFYDR--SPFQTID  377



>ref|XP_009779347.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=386

 Score =   328 bits (842),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 170/381 (45%), Positives = 232/381 (61%), Gaps = 7/381 (2%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILR----KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKG  256
             + AR     CF V  L I++    K  G  NVT T L++AVSKGAVCLDGS P Y+++ G
Sbjct  1     MAARTLHLFCFLVCSLAIIKSECAKDLGSYNVTKTILKNAVSKGAVCLDGSPPAYHFEPG  60

Query  257   HGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYN  436
              G+GV NW++ + GG WC N   C+ R   +   S      +    + S++P  NP+FYN
Sbjct  61    FGKGVGNWIVQLSGGAWCTNVTECQDRILDKNVGSTNFTDSWTFQGIYSENPTANPDFYN  120

Query  437   WHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSA  616
             W++V V YCDG +FT DV+ VD  TNL +RG RIF+A+MED  AKG+KNAKNAI AG+SA
Sbjct  121   WNKVFVRYCDGGAFTGDVEYVDHVTNLHFRGARIFEAVMEDLLAKGLKNAKNAILAGSSA  180

Query  617   GGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWL  796
             GG   ML+CD+FR+L PNT RVKCL DS YFI+ +       F+  ++ L+   GS K L
Sbjct  181   GGYPTMLYCDHFRSLLPNTPRVKCLVDSGYFIHVKNPMQASGFEKIYNSLLTLHGSTKAL  240

Query  797   PKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCTLNE  976
             PK CTSKM   LCFFP+   Q++KTP+F+ MSAFD  Q+K  +      CV    CT  +
Sbjct  241   PKSCTSKMNPPLCFFPENMQQHIKTPLFIAMSAFDYYQIKTTIDPNADRCVENRTCTECQ  300

Query  977   MKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTYAEVFA  1156
              K  +E R +FLS LP  N+     +++++ + H    + W  P+   +I N +  + FA
Sbjct  301   NKAFREFRSEFLSALPISNNPKLRGVFIDSVIHHSALSYRW-TPENAILINNLSAPKAFA  359

Query  1157  DWYFDRNTSPIRVIEKSNKPL  1219
             DWYFDR      VI+K + P+
Sbjct  360   DWYFDRKY--WYVIDKHDLPI  378



>ref|XP_009778395.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=397

 Score =   326 bits (836),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 162/390 (42%), Positives = 235/390 (60%), Gaps = 16/390 (4%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKIN------------VTLTTLESAVSKGAVCLDGSA  232
             +MA+  Q++C  +  L I+  IE  +             V  T + +AVSKGAVCLDGS 
Sbjct  2     MMAKTFQFVCVLICFLAIIINIEACVKENATSYIDQGYYVEKTVVHNAVSKGAVCLDGSP  61

Query  233   PGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSP  412
             P Y+++ G G+GV  W++ + GG WC   + C  R  S  GSS YM P +  G + S + 
Sbjct  62    PAYHFEPGFGDGVGKWLVHLSGGAWCTTVEECLNRSKSDFGSSNYMKPWWFQG-IYSKTQ  120

Query  413   NENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKN  592
             + NP+FYNW++V V YCDG +FT + + VDPATNL +RG RIF A+MED  AKG+KNA++
Sbjct  121   SVNPDFYNWNKVFVRYCDGGAFTGNAEYVDPATNLHFRGARIFKAVMEDVLAKGLKNAQS  180

Query  593   AIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVD  772
             A+  G+SA G   ML+CD FR L PNT RVKC+ D+ YFI+ +     + F   +  +V+
Sbjct  181   ALLIGSSAAGYPAMLYCDRFRKLLPNTPRVKCMVDAGYFIHVKDPHQARNFTEMYKAIVN  240

Query  773   SMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVT  952
               GSAK LPK CT KMK  +CFFP+     +KTP+++ MSAFD+ Q+   +   I  C+ 
Sbjct  241   LHGSAKTLPKSCTKKMKPEMCFFPENMQHKIKTPLYIAMSAFDKFQINTTIYDGINICIE  300

Query  953   YNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGN  1132
               NCT  E K+ +E RL+FL+ LPK N+      ++ +  +H      W+ PK +  + N
Sbjct  301   GGNCTATENKLFREFRLEFLNALPKANNPKLRGAFI-DARNHHTQVQGWWSPKNVTTVKN  359

Query  1133  KTYAEVFADWYFDRNTSPIRVIEKSNKPLN  1222
                 + FADWY+DRN +   VI++ + P++
Sbjct  360   LNLMKAFADWYYDRNYT--YVIDERDLPIS  387



>gb|KCW72723.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/373 (45%), Positives = 234/373 (63%), Gaps = 13/373 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL  WLC  ++ + IL K E   NV +T +++AV+KGAVCLDGS P Y++DKG G G +
Sbjct  4     ARLRTWLCV-ILSIQILIKSEA-FNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGAN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW+I  EGG WC N   C  R  +RLGSSK M        +LS+    NP+FYNW++++V
Sbjct  62    NWLILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ V+PATNL +RG R F A++ED  +KGM NA+NAI AG SAGG+  +
Sbjct  122   RYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             L+CD FRAL P  T+VKCLAD+ YFIN + + G    ++ +  +V + GSAK LP  CTS
Sbjct  182   LNCDRFRALVPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             KMK  LCFFPQ  +  ++TP+F+  +A+D  Q+K  L   +        SC +    C+ 
Sbjct  242   KMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYA  1144
             N++KI Q+ RL+FL  L    +  S  +++++C +H    T  +W       V+   + A
Sbjct  302   NQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQAGTQETWL-RNDSPVVAKTSIA  360

Query  1145  EVFADWYFDRNTS  1183
             +   DWY++R TS
Sbjct  361   KAVGDWYYERITS  373



>ref|XP_004509558.1| PREDICTED: protein notum homolog [Cicer arietinum]
Length=397

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/373 (46%), Positives = 234/373 (63%), Gaps = 15/373 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+ QWL     LL++    EG   V +T LE+AVSKGAVCLDGS P +++D+GHG+GV+
Sbjct  4     ARIIQWL-VLCALLSL--HAEGNF-VPMTRLENAVSKGAVCLDGSPPTFHFDEGHGDGVN  59

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N Q C  R  SRLGSS +M         LS++   NP+FYNW+RV+V
Sbjct  60    NWIVHIEGGGWCHNVQDCLGRKNSRLGSSDHMKEKSYFSGYLSNNQQFNPDFYNWNRVKV  119

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP T L +RG RIF A+ME+  A+GM +AKNAI +G SAGG+  +
Sbjct  120   RYCDGSSFTGDVEEVDPTTKLHFRGARIFSAVMEELLARGMVHAKNAILSGCSAGGLTSI  179

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+AL PN  RVKC++D+ YF+N + + G++  +  F  +V++ GSAK LP  CTS
Sbjct  180   LHCDGFKALLPNGARVKCVSDAGYFVNVKDISGEQFIEEYFRQVVETHGSAKNLPTSCTS  239

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTL  970
              +   LCFFPQY    +KTPIF+  +A+D  Q+K  L            SC T   NC+ 
Sbjct  240   TLSPGLCFFPQYMASGIKTPIFIVNAAYDSWQIKNILAPGAADPNGQWRSCKTNLINCSP  299

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
              ++ I Q+ R  FL  L    + SS  +++++C  H  T    +W        + NKT A
Sbjct  300   KQLNIMQDYRSQFLKALSVVGNSSSNGMFIDSCYIHCQTEPQETWLQSDS-PTVANKTIA  358

Query  1145  EVFADWYFDRNTS  1183
                ADW+++R+ S
Sbjct  359   GAVADWFYERSAS  371



>ref|XP_010327577.1| PREDICTED: uncharacterized protein LOC101244626 [Solanum lycopersicum]
Length=398

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/369 (45%), Positives = 226/369 (61%), Gaps = 13/369 (4%)
 Frame = +2

Query  101   LSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNW  280
             ++ +L +FV  L I    EG + V +T LESAV+KGAVCLDG+ P Y+ D+G G GV++W
Sbjct  2     VTSFLLYFVCFL-IFVTTEGLL-VNITILESAVAKGAVCLDGTPPAYHLDRGSGSGVNSW  59

Query  281   VIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAY  460
             VI +EGGGWC N   C  R  +RLGSS  M        ++S+ P  NPEF++W+RV V Y
Sbjct  60    VISLEGGGWCQNVTSCLTRKNTRLGSSAKMDHQLPFSGMMSNDPKFNPEFHSWNRVSVRY  119

Query  461   CDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLH  640
             CDG SFT DV+ +DPAT L YRG RIF A+ME+  A+GMK ++NAI +G SAGG+A +LH
Sbjct  120   CDGGSFTGDVEAIDPATRLHYRGARIFKAIMEELLAQGMKKSQNAILSGCSAGGLATILH  179

Query  641   CDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKM  820
             CD FR L PN  +VKC +D+ YFI+   + G    +  F+ +V   GSAK LP  CTSK+
Sbjct  180   CDNFRMLLPNNVKVKCFSDAGYFIHRNDISGKPYIEQYFNDVVTLHGSAKSLPSSCTSKL  239

Query  821   KASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMP-------IVSC-VTYNNCTLNE  976
             K  LCFFP+   Q +KTP+F+  +A+D  Q++  L  P         SC     NCT N+
Sbjct  240   KPGLCFFPENVAQQIKTPLFIINAAYDHWQVRNILVAPGSDPKGAWTSCKANIKNCTPNQ  299

Query  977   MKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHS--WYGPKKLRVIGNKTYAEV  1150
             +KI Q  R DFL  L      S+   ++N+C SH  +     W+G    R+  NKT AE 
Sbjct  300   LKILQGFRKDFLKALDGLGPSSTRGYYINSCFSHCQSQQQAYWFGLNSPRLF-NKTIAEA  358

Query  1151  FADWYFDRN  1177
               DW+ + +
Sbjct  359   VRDWFLETD  367



>gb|KCW72721.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   324 bits (830),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 165/373 (44%), Positives = 235/373 (63%), Gaps = 13/373 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL  WLC  ++ + IL K E   NV +T +++AV+KGAVCLDGS P Y++DKG G G +
Sbjct  4     ARLRTWLCV-ILSIQILIKSEA-FNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGAN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW+I  EGG WC N   C  R  +RLGSSK M        +LS+    NP+FYNW++++V
Sbjct  62    NWLILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ V+PATNL +RG R F A++ED  +KGM NA+NAI +G SAGG+A +
Sbjct  122   RYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSKGMSNAQNAILSGCSAGGLAAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             L+CD FRAL P  T+VKCLAD+ YFIN + + G    ++ +  +V + GSAK LP  CTS
Sbjct  182   LNCDRFRALMPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             KMK  LCFFPQ  +  ++TP+F+  +A+D  Q+K  L   +        SC +    C+ 
Sbjct  242   KMKPGLCFFPQNVVPQIQTPLFIINAAYDAWQIKNILAPGVADPHGTWNSCKLDIKKCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYA  1144
             N++KI Q+ RL+FL  L    +  S  +++++C +H    T  +W       ++   + A
Sbjct  302   NQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQAGTEATWL-RNDSPIVAKTSIA  360

Query  1145  EVFADWYFDRNTS  1183
             +   DWY++R TS
Sbjct  361   KAVGDWYYERITS  373



>gb|ADR82372.1| pectin acetylesterase [Populus trichocarpa]
Length=394

 Score =   324 bits (830),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/388 (42%), Positives = 236/388 (61%), Gaps = 19/388 (5%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             +RL QW C  V +L IL K EG  ++ +T +E+AVS GAVCLDGS PGY++DKG G G+D
Sbjct  4     SRLGQWPCLVVCIL-ILLKAEGA-SIPITIIETAVSSGAVCLDGSQPGYHFDKGSGSGID  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC + + C  R  +  GSS  M        +L      NP+FYNW+R++V
Sbjct  62    NWLVHMEGGGWCESVESCVSRRDTFRGSSSKMEKTMGFSGILGSKQAANPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP T L +RG R++ A++++  AKGM+NA+NAI +G SAGG+A +
Sbjct  122   RYCDGSSFTGDVEAVDPETKLYFRGERVWQAVIDELLAKGMQNARNAILSGCSAGGLAAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F++L P T RVKC++D+ YFI+   + G    +S F  +V + GSAK LP  CTS
Sbjct  182   LHCDKFQSLLPATARVKCVSDAGYFIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSC--------VTYNNCTL  970
             KM   LCFFPQY  Q ++TP+F+  SA+D  Q+K  L    V          +    C+ 
Sbjct  242   KMNPELCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSA  301

Query  971   NEMKIAQELRLDFLSLLPKK-NSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
             ++++  Q+ R  FL  +     S S+  +W+++C +H    +  +W   K   V G+   
Sbjct  302   SQLQTVQDYRTQFLKAVDTGLGSSSTRGLWIDSCYAHCQSGSVSTWLNDKSPEV-GDTKM  360

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNC  1225
              +   DW++DR+      +EK + P +C
Sbjct  361   GKAVGDWFYDRS-----AMEKIDCPYSC  383



>gb|KCW72722.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   323 bits (829),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 165/373 (44%), Positives = 234/373 (63%), Gaps = 13/373 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL  WLC  ++ + IL K E   NV +T +++AV+KGAVCLDGS P Y++DKG G G +
Sbjct  4     ARLRTWLCV-ILSIQILIKSEA-FNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGAN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW+I  EGG WC N   C  R  +RLGSSK M        +LS+    NP+FYNW++++V
Sbjct  62    NWLILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ V+PATNL +RG R F A++ED  +KGM NA+NAI AG SAGG+  +
Sbjct  122   RYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             L+CD FRAL P  T+VKCLAD+ YFIN + + G    ++ +  +V + GSAK LP  CTS
Sbjct  182   LNCDRFRALVPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             KMK  LCFFPQ  +  ++TP+F+  +A+D  Q+K  L   +        SC +    C+ 
Sbjct  242   KMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYA  1144
             N++KI Q+ RL+FL  L    +  S  +++++C +H    T  +W       ++   + A
Sbjct  302   NQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQAGTEATWL-RNDSPIVAKTSIA  360

Query  1145  EVFADWYFDRNTS  1183
             +   DWY++R TS
Sbjct  361   KAVGDWYYERITS  373



>ref|XP_006385133.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62930.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   323 bits (828),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 162/388 (42%), Positives = 236/388 (61%), Gaps = 19/388 (5%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             +RL QW C  V +L IL K EG  ++ +T +E+AVS GAVCLDGS PGY++DKG G G+D
Sbjct  4     SRLGQWPCLVVCIL-ILLKAEGA-SIPITIVETAVSSGAVCLDGSPPGYHFDKGSGSGID  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC + + C  R  +  GSS  M        +L      NP+FYNW+R++V
Sbjct  62    NWLVHMEGGGWCESVESCVSRRDTFRGSSSKMEKTMGFSGILGSKQAANPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP T L +RG R++ A++++  AKGM+NA+NAI +G SAGG+A +
Sbjct  122   RYCDGSSFTGDVEAVDPETKLYFRGERVWQAVIDELLAKGMQNARNAILSGCSAGGLAAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F++L P T RVKC++D+ YFI+   + G    +S F  +V + GSAK LP  CTS
Sbjct  182   LHCDKFQSLLPATARVKCVSDAGYFIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSC--------VTYNNCTL  970
             KM   LCFFPQY  Q ++TP+F+  SA+D  Q+K  L    V          +    C+ 
Sbjct  242   KMNPELCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSA  301

Query  971   NEMKIAQELRLDFLSLLPKK-NSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
             ++++  Q+ R  FL  +     S S+  +W+++C +H    +  +W   K   V G+   
Sbjct  302   SQLQTVQDYRTQFLKAVDTGLGSSSTRGLWIDSCYAHCQSGSVSTWLNDKSPEV-GDTKM  360

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNC  1225
              +   DW++DR+      +EK + P +C
Sbjct  361   GKAVGDWFYDRS-----AMEKIDCPYSC  383



>ref|XP_010056136.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW72724.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
 gb|KCW72725.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=399

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/372 (44%), Positives = 233/372 (63%), Gaps = 13/372 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL  WLC  ++ + IL K E   NV +T +++AV+KGAVCLDGS P Y++DKG G G +
Sbjct  4     ARLRTWLCV-ILSIQILIKSEA-FNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGAN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW+I  EGG WC N   C  R  +RLGSSK M        +LS+    NP+FYNW++++V
Sbjct  62    NWLILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ V+PATNL +RG R F A++ED  +KGM NA+NAI AG SAGG+  +
Sbjct  122   RYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             L+CD FRAL P  T+VKCLAD+ YFIN + + G    ++ +  +V + GSAK LP  CTS
Sbjct  182   LNCDRFRALVPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             KMK  LCFFPQ  +  ++TP+F+  +A+D  Q+K  L   +        SC +    C+ 
Sbjct  242   KMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYA  1144
             N++KI Q+ RL+FL  L    +  S  +++++C +H    T  +W       V+   + A
Sbjct  302   NQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQAGTQETWL-RNDSPVVAKTSIA  360

Query  1145  EVFADWYFDRNT  1180
             +   DWY++R T
Sbjct  361   KAVGDWYYERLT  372



>ref|XP_009607289.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=399

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/390 (41%), Positives = 237/390 (61%), Gaps = 16/390 (4%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKIN------------VTLTTLESAVSKGAVCLDGSA  232
             +MA++ Q++C  +  L I+  I+  +             V  T + +AVSKGAVCLDGS 
Sbjct  2     MMAKIFQFVCVLICFLAIIINIDACVKENATSDIDQGYYVEKTVVHNAVSKGAVCLDGSP  61

Query  233   PGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSP  412
             P Y+++ G G+GV  W++ + GG WC   + C  R  S  GSSKYM P + +G + S + 
Sbjct  62    PAYHFEPGFGDGVGKWLVHLSGGAWCTTVEECLNRSKSDFGSSKYMKPWWFIG-IYSKTQ  120

Query  413   NENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKN  592
             + NP+FYNW++V V YCDG +FT + + VDPATNL +RG RIF A+MED  AKG+KNA++
Sbjct  121   SVNPDFYNWNKVFVRYCDGGAFTGNAEYVDPATNLHFRGARIFKAVMEDVLAKGLKNAQS  180

Query  593   AIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVD  772
             A+  G+SA G   ML+CD F  L PNT RVKC+ D+ YFI+ +     + F   +  +V+
Sbjct  181   ALLIGSSAAGYPAMLYCDRFHKLLPNTPRVKCMVDAGYFIHVKDPHQARNFTQMYKAIVN  240

Query  773   SMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVT  952
               GSAK LPK C SKMK  +CFFP+     +KTP+++ MSAFD+ Q+   +   + +C+ 
Sbjct  241   LHGSAKTLPKSCISKMKPEMCFFPENMQHKIKTPLYIAMSAFDKFQINTTIYDGVNTCIE  300

Query  953   YNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGN  1132
               NCT  E K+ ++ RL+FL+ LPK N+      ++ +  +H      W+ PK +  + N
Sbjct  301   GGNCTATENKLFRDFRLEFLNALPKGNNPKLRGAFI-DARNHHTQVQGWWSPKNVTTVKN  359

Query  1133  KTYAEVFADWYFDRNTSPIRVIEKSNKPLN  1222
                 + F DWY+DRN +   VI++ + P++
Sbjct  360   LNLMKAFGDWYYDRNYT--YVIDERDLPIS  387



>ref|XP_010644665.1| PREDICTED: uncharacterized protein LOC100245856 [Vitis vinifera]
 emb|CBI29219.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/379 (44%), Positives = 233/379 (61%), Gaps = 15/379 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR   WL      L IL K EG   V +T ++SAV+KGAVCLDGS P Y+ DKG G G++
Sbjct  4     ARTGHWLSILAFSL-ILLKTEG-FYVGITYVDSAVAKGAVCLDGSPPAYHMDKGFGAGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC NA  C  R  +RLGSSK M        +LS+    NP+FYNW++++V
Sbjct  62    NWLVHIEGGGWCNNASTCLARRDNRLGSSKQMVKQIAFSGILSNKQKFNPDFYNWNKIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ VDP TNL YRG R+F A++ED  AKGMKNA NA+ +G SAGG+  +
Sbjct  122   RYCDGASFTGDVEAVDPKTNLHYRGARVFLAVIEDLMAKGMKNAANAVLSGCSAGGLTAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRAL P +T+VKC AD+ YFIN + + G    +  +  +V + GSAK LP  CTS
Sbjct  182   LHCDKFRALLPVSTKVKCFADAGYFINAKDVSGAAHIEGFYSEVVATHGSAKNLPPSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS-------C-VTYNNCTL  970
              ++  LCFFPQ   Q +KTP+F+  +A+D  Q+K  L   +         C +   +C+ 
Sbjct  242   SLRPGLCFFPQNMAQQIKTPLFIINAAYDSWQIKNILAPGVADPHGTWHYCKLDIKDCSS  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
             ++++  Q+ R+ FLS +       S  +++N+C +H  T    +W       V+G  T A
Sbjct  302   SQLEAMQDFRVQFLSAIKGLIGSPSKGMFINSCYAHCQTEMQETWLRDDS-PVLGKTTIA  360

Query  1145  EVFADWYFDRNTSPIRVIE  1201
             +   DWY+DR  SP + I+
Sbjct  361   KAVGDWYYDR--SPFQKID  377



>gb|KDP28068.1| hypothetical protein JCGZ_19476 [Jatropha curcas]
Length=400

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/369 (45%), Positives = 237/369 (64%), Gaps = 12/369 (3%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             +LS+WL     LL  + KIEG + V +T + +AV+KGAVCLDGS P Y+ DKG G G++N
Sbjct  5     KLSKWLNLLACLLLFVSKIEG-LYVGITYVRNAVAKGAVCLDGSPPAYHLDKGFGTGINN  63

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++  EGGGWC N   C  R  +RLGSSK M        +L++    NP+FYNW+RV++ 
Sbjct  64    WLVHFEGGGWCNNVTTCLSRKNTRLGSSKQMATQIAFSGILNNRRQFNPDFYNWNRVKIR  123

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV  V+PATNL +RG RI+ A++ED  AKGMKNA+NA+ +G SAGG+A +L
Sbjct  124   YCDGSSFTGDVQKVNPATNLHFRGARIWLAVVEDLLAKGMKNAENALLSGCSAGGLASIL  183

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD F+AL P  T VKCL+D+ YFIN   + G    Q+ F+ +V   GSAK LP  CTS+
Sbjct  184   HCDSFQALLPMGTNVKCLSDAGYFINVRDVSGAPHIQNYFNEVVSLHGSAKNLPLSCTSR  243

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             +K +LCFFPQY +Q ++TP+F+  +A+D  Q+K  L   +         C +  +NC+L 
Sbjct  244   LKPALCFFPQYVVQQIRTPLFILNAAYDSWQIKNILAPGVADPHGAWKGCKLDISNCSLL  303

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAE  1147
             ++K  Q+ RL FL+ L +  + SS  +++++C  H    T  +W+      V+G    A+
Sbjct  304   QLKTMQDFRLQFLNALYRSTTSSSRGLYIDSCYIHCQSETQETWFMADS-PVLGRSKIAK  362

Query  1148  VFADWYFDR  1174
                DW++DR
Sbjct  363   AVGDWFYDR  371



>ref|XP_011028476.1| PREDICTED: protein notum homolog [Populus euphratica]
 ref|XP_011028477.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/388 (42%), Positives = 236/388 (61%), Gaps = 19/388 (5%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             +RL QW C  V +L IL K EG  ++ +T +E+AVS+GAVCLDGS PGY++DKG G G+D
Sbjct  4     SRLGQWPCLVVCIL-ILFKAEGA-SIPITIVETAVSRGAVCLDGSPPGYHFDKGSGSGID  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC + + C  R  +  GSS  M        +L      NP+FYNW+R++V
Sbjct  62    NWLVHMEGGGWCESVESCVSRRDTFRGSSSKMEKTMGFSGILGSKQAANPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP T L +RG R++ A++++  AKGM+NA+NAI +G SAGG+A +
Sbjct  122   RYCDGSSFTGDVEAVDPETKLYFRGERVWQAVIDELLAKGMQNARNAILSGCSAGGLAAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F++L P T RVKC++D+ YFI+   + G    +S F  +V + GSAK LP  CTS
Sbjct  182   LHCDKFQSLLPATARVKCVSDAGYFIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSC--------VTYNNCTL  970
             KM   LCFFPQY  Q ++TP+F+  SA+D  Q+K  L    V          +    C+ 
Sbjct  242   KMNPELCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKDCKLDLKKCSA  301

Query  971   NEMKIAQELRLDFLSLLPKK-NSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
             ++++  Q+ R  FL  +     S S+  +W+++C +H    +  +W   K   V G+   
Sbjct  302   SQLQTVQDYRAQFLKAVNTGLGSSSTRGLWIDSCYAHCQSGSVSTWLNDKSPEV-GDTKM  360

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNC  1225
              +   DW++DR+      +EK + P  C
Sbjct  361   GKAVGDWFYDRS-----AMEKIDCPYPC  383



>gb|EYU29131.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=394

 Score =   322 bits (824),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/372 (45%), Positives = 236/372 (63%), Gaps = 16/372 (4%)
 Frame = +2

Query  125   VVLLTILRKIEGK---INVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIE  295
             ++LL  +  I G+     V +T +ESAV+KGAVCLDGSAP Y++DKG G G++NW++ IE
Sbjct  4     IILLIYMVIIVGRGESFFVDITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIE  63

Query  296   GGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSS  475
             GGGWC NA  C  R   RLGSSK M        + S+ P  NP+FYNW+R++V YCDG+S
Sbjct  64    GGGWCNNATTCLARRNGRLGSSKQMAKQIAFSGIFSNKPQFNPDFYNWNRLKVRYCDGAS  123

Query  476   FTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFR  655
             FT DV+ VDPAT L YRG R+F A++ED  AKGMKNA+NAI +G SAGG+  +L+CD F+
Sbjct  124   FTGDVEAVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILNCDRFK  183

Query  656   ALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLC  835
             +L P +T VKC AD+ +FIN + + G +  +  ++ +V + GSAK L + CTSKMK SLC
Sbjct  184   SLLPISTNVKCFADAGFFINAKDVSGAQHIEQFYNDVVTTHGSAKHLAQSCTSKMKPSLC  243

Query  836   FFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTLNEMKIAQ  991
             FFP+  +Q ++TPIF+  +A+D  Q+K  L   +        +C T    C+  +++  Q
Sbjct  244   FFPENMVQAIQTPIFVVNAAYDSWQIKNILAPGVADPHGLWHNCKTDIKKCSTTQLQTMQ  303

Query  992   ELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWY  1165
             E RL+FL  L    S  S   ++N+C +H    T  +W       ++ NKT A+   DW+
Sbjct  304   EYRLEFLKALSGLMSAKSKGYFINSCYAHCQTETQETW-STNISPMLNNKTIAKAVGDWF  362

Query  1166  FDRNTSPIRVIE  1201
             ++R  SP   I+
Sbjct  363   YER--SPFEKID  372



>ref|XP_009590663.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=401

 Score =   321 bits (823),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 169/391 (43%), Positives = 225/391 (58%), Gaps = 18/391 (5%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKIN--------------VTLTTLESAVSKGAVCLDG  226
             +  R  Q +C  +    I++    K+N              V  T +++A+SKGAVCLDG
Sbjct  1     MATRSVQLVCLLICSQAIIKTASAKVNESFKQEKGIDHAYFVDTTIVQNALSKGAVCLDG  60

Query  227   SAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSD  406
             S P Y+ D+G G GV NW+I + GG WC N   C  R  + LGSSK+M P   +G + S 
Sbjct  61    SPPAYHLDRGFGHGVRNWIILLSGGAWCRNITDCLNRSKTDLGSSKHMTPFIFLG-IFSK  119

Query  407   SPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNA  586
             S +ENP+FYNW++V V YCDG  FT D++ +DPATNL +RG RIFDA++ED  AKG+K+A
Sbjct  120   SKSENPDFYNWNKVFVRYCDGGGFTGDIESIDPATNLHFRGARIFDAVIEDLLAKGLKDA  179

Query  587   KNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYL  766
             KNAI +G SA G   +L+CD F  L     RVKCL D+ YFI+ +      +F+S F  +
Sbjct  180   KNAILSGGSANGYPAVLYCDRFHNLLHKAHRVKCLVDAGYFIHVKNPRLANVFESLFRDV  239

Query  767   VDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSC  946
             V   GS K LPK CTSKMK  LCFFP+   Q +KTP F  MSAFD  Q+   +   I  C
Sbjct  240   VTLHGSTKVLPKSCTSKMKPELCFFPENIQQDIKTPFFTVMSAFDSYQVDNIIGSDIGDC  299

Query  947   VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVI  1126
             +   NCT ++    +ELR +FLS LPK N       ++++   H      W+       I
Sbjct  300   IRARNCTESQNNDFKELRSEFLSALPKPNDPKQRGAFIDSFNRHT-QLELWWNKVNATPI  358

Query  1127  GNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
              N T  EVF DWY+DR  S   VI+  + PL
Sbjct  359   NNLTTIEVFGDWYYDRKYS--YVIDDHDLPL  387



>ref|XP_006361581.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=387

 Score =   320 bits (821),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 162/372 (44%), Positives = 225/372 (60%), Gaps = 13/372 (3%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             +   +  WL     LL +   I     V +T L+SAV+KGAVCLDGS P Y++DKG G G
Sbjct  2     VKGAMQLWLRAIFTLLIVF--ITEGHPVDITYLQSAVAKGAVCLDGSPPAYHFDKGFGAG  59

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW+I +EGG WC NA  C  R  +RLGSSK M        +LS+    NP+FYNW+R+
Sbjct  60    VNNWLIQLEGGAWCNNATTCLARTKTRLGSSKLMLKTVSFSGILSNKAEFNPDFYNWNRI  119

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             R+ YCDGSSFT DV   DP T + YRG RIF A+MEDF AKGMKNA+NAI AG SAG +A
Sbjct  120   RIKYCDGSSFTGDVAAADPKTKVFYRGARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLA  179

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+ L P   +VKCL+D+ +FIN + + G    +  +  +V++ GS K LP+ C
Sbjct  180   AILHCDRFKGLLPPGAKVKCLSDAGFFINTQTISGTSHIEQFYSEVVNTHGSVKNLPQSC  239

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN----  973
             TS++K  LCFFPQ   Q+++TP+FL  +A+D  Q+K+ L   +     T+ NC L+    
Sbjct  240   TSRLKPGLCFFPQNVAQHIQTPLFLVNAAYDSWQIKHILAPEVADPHGTWRNCKLDILNC  299

Query  974   ---EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
                +++  Q  R +FL  L      S+   ++N+C +H    T  +W     L V+   T
Sbjct  300   SSTQLQTMQAFRSEFLKALNSLGPSSTRGYYINSCYAHCQTGTQETWLMDDSL-VLSGTT  358

Query  1139  YAEVFADWYFDR  1174
              A+   DWY++R
Sbjct  359   IAKAVGDWYYER  370



>ref|XP_009605804.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=385

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/382 (44%), Positives = 232/382 (61%), Gaps = 8/382 (2%)
 Frame = +2

Query  89    IMA-RLSQWLCFFVVLLTILR----KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDK  253
             +MA R     C  V  L I++    K  G  NVT T L++AVSKGAVCLDGS P Y+++ 
Sbjct  2     VMATRTLHLFCLLVCSLAIIKSECAKDLGSYNVTKTILKNAVSKGAVCLDGSPPAYHFEP  61

Query  254   GHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFY  433
             G G+G+ NW++ + GG WC N + C+ R   +   S      +    + S++   NP+FY
Sbjct  62    GFGKGIGNWIVQLSGGAWCTNVKECQDRIWDKNVGSTNFTDSWNFQGIYSENSTANPDFY  121

Query  434   NWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNS  613
             NW++V V YCDG +FT DV+ VD  TNL +RG RIF+A ME+  AKG+KNAKNAI AG+S
Sbjct  122   NWNKVFVRYCDGGAFTGDVEYVDHVTNLHFRGARIFEAAMEELLAKGLKNAKNAILAGSS  181

Query  614   AGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKW  793
             AGG   ML+CD+FR+L PNT RVKCL DS YFI+ +     + F+  ++ L+   GS K 
Sbjct  182   AGGYPTMLYCDHFRSLLPNTLRVKCLVDSGYFIHAKNPMQARGFEKIYNSLLTLHGSTKA  241

Query  794   LPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCTLN  973
             LPK CTSKM   LCFFP+   Q++KTP+F+ MSAFD  Q+K  +      CV    CT  
Sbjct  242   LPKSCTSKMNPLLCFFPENMQQHIKTPLFIAMSAFDYYQMKTTIDPNADRCVENRTCTER  301

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTYAEVF  1153
             + K  +E R +FLS LPK N+     +++++ + H    + W     + +I N +  + F
Sbjct  302   QNKAFREFRSEFLSALPKSNNPKLRGVFIDSVIHHSALSYRWTLENAI-MINNLSAPKAF  360

Query  1154  ADWYFDRNTSPIRVIEKSNKPL  1219
             ADWYFDR      VI+K + P+
Sbjct  361   ADWYFDRKY--WYVIDKHDLPI  380



>ref|XP_007156330.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28324.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=397

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/395 (43%), Positives = 233/395 (59%), Gaps = 14/395 (4%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M    QWL   + ++ +L K EG + V +T +E+AV+KGAVCLDGSAP Y++ KG G G+
Sbjct  1     MVSRGQWLSVLICVVLLL-KAEG-VPVGITFVENAVAKGAVCLDGSAPAYHFHKGSGAGI  58

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++  EGGGWC N   C  R  +RLGSSK M          S+S   N +FY+W+R++
Sbjct  59    NNWIVHFEGGGWCNNVTSCLSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNQDFYDWNRIK  118

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV+ VDP TNL +RG R+F A++ED  AKGMKNA+NAI +G SAGG+A 
Sbjct  119   VRYCDGSSFTGDVEAVDPRTNLHFRGARVFAAVVEDLLAKGMKNAQNAIISGCSAGGLAA  178

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +L+CD F+AL P TT+VKCLAD+ YFIN + + G +  +  +  +V + GSAK LP  CT
Sbjct  179   ILNCDRFKALLPRTTKVKCLADAGYFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPSSCT  238

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++K  LCFFPQ  +  + TPIF   +A+D  Q+K  L             C +   NC+
Sbjct  239   SRLKPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCS  298

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              N++ + Q  R DFL       +  S   +++ C +H    T  +W       V+GN T 
Sbjct  299   PNQLSVMQVFRTDFLRAFGAVGNSPSKGHFIDGCYAHCQTGTQETWL-RNDSPVLGNTTI  357

Query  1142  AEVFADWYFDRNT-SPIRVIEKSNKPLNCSTFEQN  1243
             A    DW++DR     I      N   +   F+QN
Sbjct  358   ARAVGDWFYDRRAFHQIDCAYPCNPTCHNRIFDQN  392



>gb|EYU29129.1| hypothetical protein MIMGU_mgv1a023759mg [Erythranthe guttata]
Length=384

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/367 (44%), Positives = 231/367 (63%), Gaps = 15/367 (4%)
 Frame = +2

Query  131   LLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWC  310
             ++ +LR     +++T   +ESAV+KGAVCLDGS P Y+ DKG G+G +NW+I +EGGGWC
Sbjct  1     MIIVLRTESSYVDITY--VESAVAKGAVCLDGSPPAYHLDKGSGDGTNNWLIHLEGGGWC  58

Query  311   MNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDV  490
              N   C  R    LGSSK+M        + ++ P  NP+FYNW+RV V YCDG+SFT D+
Sbjct  59    NNVTTCISRANGHLGSSKHMSNRTMFFGIANNDPQFNPDFYNWNRVVVRYCDGASFTGDI  118

Query  491   DGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPN  670
             + VDPATNL YRG R+F A+MED   KGMKNAKN I  G SAGG+A MLHCD F+ L P 
Sbjct  119   EAVDPATNLYYRGARVFVAVMEDLLDKGMKNAKNVILTGCSAGGLASMLHCDRFKDLLPM  178

Query  671   TTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQY  850
              T VKC+AD+ +F+N + + G++ F+   + +V++ GSAK LP  CTSKMK  LCFFPQ 
Sbjct  179   GTNVKCMADAGFFLNVKDVSGNRRFEDFINDVVETHGSAKNLPLSCTSKMKPGLCFFPQQ  238

Query  851   SLQYVKTPIFLTMSAFDQIQLKYGLTMPIV--SCVTYN------NCTLNEMKIAQELRLD  1006
              +Q ++TP+F+  +A+D  Q+K  L   I   S + YN      NC+  +++     R +
Sbjct  239   VVQEIQTPLFIVNAAYDAWQIKNVLAPAIADPSGIWYNCTTDIRNCSTAQLQTLHGFRKE  298

Query  1007  FLSLLPKKNSESSIAIWVNNCVSHEFTYH--SWYGPKKLRVIGNKTYAEVFADWYFDRNT  1180
             FL+      +  +   ++N+C +H  T    +W+ P   + + NKT A+   DW+FDR  
Sbjct  299   FLNEFSAIGTSITRGYFINSCFAHCQTEMQITWFKPNSPK-LNNKTIAKAVGDWFFDR--  355

Query  1181  SPIRVIE  1201
             SP + I+
Sbjct  356   SPFQTID  362



>ref|XP_010244170.1| PREDICTED: uncharacterized protein LOC104588061 [Nelumbo nucifera]
Length=399

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/380 (43%), Positives = 234/380 (62%), Gaps = 13/380 (3%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             I  R   W+   +  L  L K+ G +NV +T +E+AV+KGAVCLDGS P Y+ DKG G G
Sbjct  2     INVRAVAWINILLCALVAL-KVNG-VNVGITYVETAVAKGAVCLDGSPPAYHLDKGFGSG  59

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             ++NW++ IEGGGWC N   C  R  +RLGSSK M        +LS+    NP+FYNW+RV
Sbjct  60    INNWLVHIEGGGWCNNVTTCLARKNTRLGSSKQMLTEIAFSGILSNKQQFNPDFYNWNRV  119

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDG+SFT DV+ VDP TNL YRG R++ A++ED   KGMKNA+ A+ +G SAGG+ 
Sbjct  120   KVRYCDGASFTGDVEAVDPTTNLHYRGARVWLAVIEDLLEKGMKNAEYALLSGCSAGGLT  179

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRAL P   +VKCLAD+ YFIN + + G +  Q+ +D +V + GS+K LP  C
Sbjct  180   SILHCDSFRALLPMGVKVKCLADAGYFINAKDVSGTEHIQAFYDDVVTTHGSSKNLPASC  239

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTY--------NNC  964
             TS MK S+CFFPQY  Q ++TP+FL  +A+D  Q+K  L   +     Y         NC
Sbjct  240   TSTMKPSMCFFPQYMEQGIRTPLFLLNAAYDSWQIKNILAPGVADPHGYWHNCKLDIKNC  299

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTY  1141
             + ++++  Q  R++FL+ L    + S   +++N+C +H +      +      V+     
Sbjct  300   SPSQIQTMQGFRVEFLNALSGLGNSSPRGMFINSCYAHCQSEMQETWLRDDSPVLDKTPI  359

Query  1142  AEVFADWYFDRNTSPIRVIE  1201
             A+   DWY+DR  SP + I+
Sbjct  360   AKAVGDWYYDR--SPFQKID  377



>ref|XP_002303225.2| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ABK93778.1| unknown [Populus trichocarpa]
 gb|ABK95483.1| unknown [Populus trichocarpa]
 gb|EEE78204.2| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 233/373 (62%), Gaps = 14/373 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             + L +WLC  V +LT+L K EG  ++ +T +++AV++GAVCLDGS PGY+++KG G G++
Sbjct  4     SSLGKWLCLIVYILTLL-KTEGA-SIPMTIVQAAVARGAVCLDGSPPGYHFEKGSGSGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC + + C  R  +  GSS  M        +L      NP+FYNW+R+++
Sbjct  62    NWLVHMEGGGWCESVESCVSRRDTYKGSSLKMEKTMGFSGILGSKQAANPDFYNWNRIKI  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP T L +RG RI+ A+++D  AKGM+NA+NAI +G SAGG+A +
Sbjct  122   RYCDGSSFTGDVEAVDPKTKLYFRGERIWQAVIDDLLAKGMRNARNAILSGCSAGGLAAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F++L P + RVKC++D+ YFI+   + G    +S F  +V + GSAK LP  CTS
Sbjct  182   LHCDKFQSLLPASARVKCVSDAGYFIHGTDISGGSRIESFFGQVVKTHGSAKHLPASCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-SCVTYNNCTLN------  973
             K +  LCFFPQY  Q ++TP+F+  SA+D  Q+K  L    V S   + NC L+      
Sbjct  242   KTRPELCFFPQYVAQAMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKNCKLDLKKCSA  301

Query  974   -EMKIAQELRLDFLSLLP-KKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              +++  Q  R  FL  +     S SS  +W+N+C +H    +  +W   K   V+GN   
Sbjct  302   TQLQTVQNYRTQFLKAVNIGLGSSSSRGLWINSCYAHCQSGSVSTWLADKS-PVVGNVKI  360

Query  1142  AEVFADWYFDRNT  1180
              +   DW++DR+ 
Sbjct  361   GKAVGDWFYDRSA  373



>ref|XP_011012520.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   319 bits (818),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/388 (42%), Positives = 237/388 (61%), Gaps = 19/388 (5%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             + L +WLC  V  LT+L K EG  ++ +T +++AV++GAVCLDGS PGY+++KG G G++
Sbjct  4     SSLGKWLCLIVYTLTLL-KTEGA-SIPMTIVQTAVARGAVCLDGSPPGYHFEKGSGSGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC + + C  R  +  GSS  M        +L      NP+FYNW+R+++
Sbjct  62    NWLVHMEGGGWCESVESCVSRRDTYKGSSLKMEKTMGFSGILGSKQAANPDFYNWNRIKI  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP T L +RG RI+ A+++D  AKGM+NA+NAI +G SAGG+A +
Sbjct  122   RYCDGSSFTGDVEAVDPKTKLYFRGERIWQAVIDDLLAKGMRNARNAILSGCSAGGLAAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F++L P + RVKC++D+ YFI+   + G    +S F  +V + GSAK LP  CTS
Sbjct  182   LHCDKFQSLLPASARVKCVSDAGYFIHGTDISGGSRIESFFGQVVKTHGSAKNLPASCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-SCVTYNNCTLN------  973
             K +  LCFFPQY  Q ++TP+F+  SA+D  Q+K  L    V S   + NC L+      
Sbjct  242   KTRPELCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKNCKLDLKKCSA  301

Query  974   -EMKIAQELRLDFLSLLPKK-NSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              +++  Q  R  FL  +     S SS  +W+N+C +H    +  +W   K   V+GN   
Sbjct  302   TQLQTVQNYRTQFLKAVNTGLGSSSSRGLWINSCYAHCQSGSVSTWLADKS-PVVGNAKI  360

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNC  1225
              +   DW++DR+       EK + P  C
Sbjct  361   GKAVGDWFYDRS-----AFEKIDCPYPC  383



>ref|XP_006359968.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=369

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/346 (47%), Positives = 214/346 (62%), Gaps = 11/346 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V LT L++AV+KGAVCLDGS P Y+ D+G G GV+NWVI +EGGGWC N   C  R  S+
Sbjct  9     VNLTILQTAVAKGAVCLDGSPPAYHLDRGSGTGVNNWVISVEGGGWCQNVAQCLLRKNSK  68

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
              GSS  M        +LS+    NPEFYNW+RV V YCDG SFT DV+ +DP T L YRG
Sbjct  69    YGSSAKMENQVFFSGMLSNEQKFNPEFYNWNRVFVRYCDGGSFTGDVEAIDPGTGLHYRG  128

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF A+ME+  A+GM  ++NAI +G SAGG+  +LHCD FR L P++ +VKC +D+ YF
Sbjct  129   ARIFKAIMEELLAQGMNKSENAILSGCSAGGLTTILHCDNFRILLPSSVKVKCFSDAGYF  188

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             +N E + G    Q  F+ +V   GS + LP  CTSK+K SLCFFPQ   Q ++TP+F+  
Sbjct  189   VNIEDISGKLFIQQFFNDVVTLHGSVRNLPPSCTSKLKPSLCFFPQNVAQQIQTPLFIIN  248

Query  890   SAFDQIQLKYGL----TMPIV---SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             SA+D  Q++  L    T P     SC      CT +++K+ Q  RL+FL  L      S+
Sbjct  249   SAYDSWQVRNILVPRGTDPKGAWNSCGANIKTCTPDQLKVLQGFRLNFLKALEGLGPSST  308

Query  1046  IAIWVNNCVSHEFTYH--SWYGPKKLRVIGNKTYAEVFADWYFDRN  1177
                ++N+C +H  T    SW+GP   R+  NKT AE   DW  +RN
Sbjct  309   RGYYINSCFAHCQTQKQASWFGPNSPRLF-NKTIAEAVGDWVLERN  353



>ref|XP_010314004.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=401

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/350 (46%), Positives = 213/350 (61%), Gaps = 4/350 (1%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T +++AVSKGAVCLDGS P Y+ D G G GV NW+I + GG WC N   C  R  + 
Sbjct  42    VDITIVQNAVSKGAVCLDGSPPAYHLDPGFGHGVRNWIILLSGGAWCRNTTDCLNRSKTD  101

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSS  M P   +G + S S  ENP+FYNW++V V YCDG +FT D++ VDPATNL +RG
Sbjct  102   LGSSTLMLPFIFLG-IFSKSKTENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRG  160

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIFDA++ED  AKG+K+AKNAI +G SA G   ML+CD+F +L P   RVKCL D+ YF
Sbjct  161   ARIFDAIIEDLLAKGLKDAKNAILSGGSANGYPAMLYCDHFHSLLPKAHRVKCLVDAGYF  220

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I  +      +F+S F  +V   GS K LPK CTS+MK  LCFFP+   + +KTP F  M
Sbjct  221   IRVKNPLLTNVFESIFKDVVTLHGSTKVLPKSCTSRMKPELCFFPENIQRDIKTPFFTVM  280

Query  890   SAFDQIQLKYGLTMPIVSCVTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNC  1069
             SAFD  Q+   +   I   +   NCT N+    +ELR +FL  LPK N      +++++ 
Sbjct  281   SAFDSYQVNSIIGFDIGEYIQARNCTENQNNAFKELRSEFLRALPKANDPKQRGVFIDSF  340

Query  1070  VSHEFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               H      W+       + N T  +VF DWY+DR  S   VI++ + PL
Sbjct  341   NRHT-QLELWWNKINATPVNNLTTIKVFGDWYYDRKYS--YVIDEHDLPL  387



>ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28325.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=417

 Score =   320 bits (819),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 168/395 (43%), Positives = 233/395 (59%), Gaps = 14/395 (4%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M    QWL   + ++ +L K EG + V +T +E+AV+KGAVCLDGSAP Y++ KG G G+
Sbjct  21    MVSRGQWLSVLICVVLLL-KAEG-VPVGITFVENAVAKGAVCLDGSAPAYHFHKGSGAGI  78

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++  EGGGWC N   C  R  +RLGSSK M          S+S   N +FY+W+R++
Sbjct  79    NNWIVHFEGGGWCNNVTSCLSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNQDFYDWNRIK  138

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV+ VDP TNL +RG R+F A++ED  AKGMKNA+NAI +G SAGG+A 
Sbjct  139   VRYCDGSSFTGDVEAVDPRTNLHFRGARVFAAVVEDLLAKGMKNAQNAIISGCSAGGLAA  198

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +L+CD F+AL P TT+VKCLAD+ YFIN + + G +  +  +  +V + GSAK LP  CT
Sbjct  199   ILNCDRFKALLPRTTKVKCLADAGYFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPSSCT  258

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++K  LCFFPQ  +  + TPIF   +A+D  Q+K  L             C +   NC+
Sbjct  259   SRLKPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCS  318

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              N++ + Q  R DFL       +  S   +++ C +H    T  +W       V+GN T 
Sbjct  319   PNQLSVMQVFRTDFLRAFGAVGNSPSKGHFIDGCYAHCQTGTQETWL-RNDSPVLGNTTI  377

Query  1142  AEVFADWYFDRNT-SPIRVIEKSNKPLNCSTFEQN  1243
             A    DW++DR     I      N   +   F+QN
Sbjct  378   ARAVGDWFYDRRAFHQIDCAYPCNPTCHNRIFDQN  412



>ref|XP_010314003.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=404

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/350 (46%), Positives = 213/350 (61%), Gaps = 4/350 (1%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T +++AVSKGAVCLDGS P Y+ D G G GV NW+I + GG WC N   C  R  + 
Sbjct  45    VDITIVQNAVSKGAVCLDGSPPAYHLDPGFGHGVRNWIILLSGGAWCRNTTDCLNRSKTD  104

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSS  M P   +G + S S  ENP+FYNW++V V YCDG +FT D++ VDPATNL +RG
Sbjct  105   LGSSTLMLPFIFLG-IFSKSKTENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRG  163

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIFDA++ED  AKG+K+AKNAI +G SA G   ML+CD+F +L P   RVKCL D+ YF
Sbjct  164   ARIFDAIIEDLLAKGLKDAKNAILSGGSANGYPAMLYCDHFHSLLPKAHRVKCLVDAGYF  223

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I  +      +F+S F  +V   GS K LPK CTS+MK  LCFFP+   + +KTP F  M
Sbjct  224   IRVKNPLLTNVFESIFKDVVTLHGSTKVLPKSCTSRMKPELCFFPENIQRDIKTPFFTVM  283

Query  890   SAFDQIQLKYGLTMPIVSCVTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNC  1069
             SAFD  Q+   +   I   +   NCT N+    +ELR +FL  LPK N      +++++ 
Sbjct  284   SAFDSYQVNSIIGFDIGEYIQARNCTENQNNAFKELRSEFLRALPKANDPKQRGVFIDSF  343

Query  1070  VSHEFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               H      W+       + N T  +VF DWY+DR  S   VI++ + PL
Sbjct  344   NRHT-QLELWWNKINATPVNNLTTIKVFGDWYYDRKYS--YVIDEHDLPL  390



>ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis]
Length=399

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 174/399 (44%), Positives = 250/399 (63%), Gaps = 18/399 (5%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             + +RL QWL   +  + +L   EG + V +T +++AV+KGAVCLDGS P Y+ DKG G G
Sbjct  2     VDSRLGQWL-ILLACVLLLTNTEG-LFVEITYVKNAVAKGAVCLDGSPPAYHLDKGFGTG  59

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             +++W++  EGGGWC N   C  R  +RLGSSK M P      ++S+    NP+FYNW+RV
Sbjct  60    INSWLVHFEGGGWCNNITTCLSRKNTRLGSSKQMGPQIAFSGIMSNRRRYNPDFYNWNRV  119

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             ++ YCDGSSFT DV  V+PATNL +RG RI+ A++E+  AKGMKNA+NA+ +G SAGG+A
Sbjct  120   KIRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVIEELLAKGMKNAENALLSGCSAGGLA  179

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRAL P  T VKCL+D+ YFIN   + G    Q+ F+ +V   GSAK LP  C
Sbjct  180   SILHCDGFRALLPMGTNVKCLSDAGYFINARDVSGAAHIQTYFNEVVSLHGSAKNLPLSC  239

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS++K +LCFFPQY +Q ++TP+F+  +A+D  Q+K  L   +        SC +  NNC
Sbjct  240   TSRLKPALCFFPQYLVQQIRTPLFILNAAYDSWQIKNILAPGVADPRGSWNSCKLDINNC  299

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             +  ++K  Q+ R+ FLS L +  + SS  +++++C +H    T  +W+      V+    
Sbjct  300   SPIQLKTMQDFRMRFLSALYRSANSSSKGLYIDSCYAHCQTETQETWFMADS-PVLSKTK  358

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLN--CSTFEQNPR  1249
              A+   DW++DR   P + I+    P N  CS    NPR
Sbjct  359   IAKAVGDWFYDR--IPFQKID-CPYPCNPTCSNNGLNPR  394



>ref|XP_009784099.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=392

 Score =   318 bits (816),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 163/391 (42%), Positives = 243/391 (62%), Gaps = 16/391 (4%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKI---NVTLTTLESAVSKGAVCLDGSAPGYYYDKGH  259
             + +R  QW+   V+L+  + K++ ++    V  T ++ A SKGAVCLDGS   Y+YD+G 
Sbjct  4     VDSRWYQWI--IVLLICSVMKVKAEVIPNKVAKTLVQDAFSKGAVCLDGSPAAYHYDQGS  61

Query  260   GEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNW  439
             G+GV+NW++++EGGGWC + + C  R     GSS ++      G LLS+S   NP+FYNW
Sbjct  62    GDGVNNWIVWLEGGGWCRSVEDCGQRFNYSNGSSNHIDSKSFYG-LLSNSKTSNPDFYNW  120

Query  440   HRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAG  619
             HR+ + YCDGSS+T DV+ VD  TN  YRG RIF A+M++  AKGMKNA NAI +G SAG
Sbjct  121   HRIMIRYCDGSSYTGDVELVDKVTNQHYRGARIFQAIMDELLAKGMKNATNAILSGCSAG  180

Query  620   GVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLP  799
             G+  M HCD FR+L P+T RVKCL+D +YF+ D   +   + +S++D +V+   SAK LP
Sbjct  181   GLGTMFHCDRFRSLLPSTARVKCLSDGAYFLLDNDFKRVNILESTYDGVVNLHNSAKVLP  240

Query  800   KECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTY--------  955
               CTS+M  + CFFPQ+  + +KTP+F+  SA+D  Q+     +P      +        
Sbjct  241   PSCTSRMNPASCFFPQHIQEDIKTPLFILNSAYDSWQI-VDTVIPFADRQDFAENCKKNL  299

Query  956   NNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNK  1135
             + C+ ++ K+ Q    +FLS LPK  S S   +++N+C+ H  T H W       ++ NK
Sbjct  300   SKCSPHQQKLLQGFGAEFLSALPKSYSPSQRGMYINSCLMHCQTDHDWSWNSNSDLLNNK  359

Query  1136  TYAEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             T A+VF DW+F+R+ S   ++++ + P  CS
Sbjct  360   TIAKVFGDWFFERDPSQ-EMVKQHDLPQICS  389



>ref|XP_004172255.1| PREDICTED: protein notum homolog [Cucumis sativus]
 gb|KGN53459.1| hypothetical protein Csa_4G056500 [Cucumis sativus]
Length=398

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 166/378 (44%), Positives = 236/378 (62%), Gaps = 15/378 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             +   WL FFV  +    K +  INV +T ++ AV KGAVCLDGS P Y++  G G G++N
Sbjct  5     KFGLWL-FFVASVQFFLKAQC-INVGITYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINN  62

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W+I +EGGGWC N   C  R  +RLGSSK M        +LS+ P  NP+FYNW+R++V 
Sbjct  63    WLIQLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVR  122

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VD ATNL +RG R+F A++++  AKGMKNAKNAI +G SAGG++ +L
Sbjct  123   YCDGSSFTGDVEAVDSATNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSIL  182

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD F++L P TT+VKCL+D+ YFIN + + G +  +  +  +V + GSAK LP  CTSK
Sbjct  183   HCDNFKSLLPPTTKVKCLSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSK  242

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             MK  +CFFPQ  +Q ++TPIFL  +A+D  Q+K  L   +         C +   NC+  
Sbjct  243   MKPEMCFFPQNVVQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPI  302

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             +++  Q+ R+ FLS L    S  S  +++++C +H  T    +W       V+   T A+
Sbjct  303   QLRTMQDFRVQFLSALNGVGSSLSRGLFIDSCYAHCQTEMQETWLRTDS-PVLSKTTIAK  361

Query  1148  VFADWYFDRNTSPIRVIE  1201
                DW+FDR  +P + I+
Sbjct  362   AVGDWFFDR--APFQKID  377



>ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 ref|XP_006471635.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006471636.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
 gb|ESR46120.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 gb|KDO40407.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
 gb|KDO40408.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=386

 Score =   318 bits (816),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 163/376 (43%), Positives = 229/376 (61%), Gaps = 12/376 (3%)
 Frame = +2

Query  101   LSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNW  280
             + QW    V  L +L K +   NV++T +E+AV+KGAVCLDGS P Y++DKG G G++NW
Sbjct  1     MGQWFNLLVCALIVL-KAQAGFNVSITYVENAVAKGAVCLDGSPPAYHFDKGFGAGINNW  59

Query  281   VIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAY  460
             ++ I+GG WC N + C  R  S  GSSK+M        +LS+    NP+FY+W+RVRV Y
Sbjct  60    LVHIDGGAWCNNVEDCSKRRDSSYGSSKHMVKEANFTGILSNEQKFNPDFYDWNRVRVRY  119

Query  461   CDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLH  640
             CDG+SFT DV+ V+P TNL +RG R+F+A+MED  AKGMKNA+NAI  G SAGG+  +LH
Sbjct  120   CDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGGLTSILH  179

Query  641   CDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKM  820
             CD FRALFP  TRVKC AD+ YF+N + + G+   +  +  +V   GSAK LP  CTS++
Sbjct  180   CDNFRALFPVDTRVKCFADAGYFVNAKDVSGESHIEEFYKQVVALHGSAKHLPASCTSRL  239

Query  821   KASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNE  976
                LCFFP+     +KTP+F+  SA+D  Q+   L            SC V    C+  +
Sbjct  240   SPGLCFFPENVAGQIKTPLFIINSAYDSWQISNILVPEDADPKGAWSSCKVDIKTCSSTQ  299

Query  977   MKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT-YHSWYGPKKLRVIGNKTYAEVF  1153
             ++  Q  R+ FL+ L    + SS  ++V++C +H  T Y   +      V+     A+  
Sbjct  300   LQTMQGFRVQFLNALAGLGNSSSRGMFVDSCYTHCRTDYQETWFSADSPVLDKTPIAKAV  359

Query  1154  ADWYFDRNTSPIRVIE  1201
              DWY+DR  SP + I+
Sbjct  360   GDWYYDR--SPFQKID  373



>emb|CDY09289.1| BnaC03g63190D [Brassica napus]
Length=397

 Score =   318 bits (816),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 163/389 (42%), Positives = 244/389 (63%), Gaps = 18/389 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M   +QWL   V  L IL K EG + V +T + +AV+KGAVCLDGS P Y+ D+G G G+
Sbjct  1     MINFNQWLVLVVCSLAIL-KAEGLL-VNITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGI  58

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             ++W+I +EGGGWC N  +C  R  ++LGSSK M        +LS+    NP+FYNW+RV+
Sbjct  59    NSWLIQLEGGGWCHNVTNCISRMHTKLGSSKKMVENLAFSAILSNKEQRNPDFYNWNRVK  118

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV  V+PATNL +RG R++ A+M +  AKGM+NA+NA+ +G SAGG+A 
Sbjct  119   VRYCDGSSFTGDVKTVNPATNLHFRGARVWLAVMRELLAKGMRNAENAVLSGCSAGGLAS  178

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             ++HCD FRAL P  T VKCL+D+ +F+N   + G +  +S F+ +V   GSAK LP+ CT
Sbjct  179   LMHCDSFRALLPMGTNVKCLSDAGFFLNTRDVSGAQYIKSYFNDVVTLHGSAKNLPRSCT  238

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L            SC +   NC 
Sbjct  239   SRLTPAMCFFPQYVARQIRTPVFVLNAAYDSWQIKNILAPRAADPDGKWQSCQLDIKNCQ  298

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              +++K+ Q+ RL+FLS +      +S  +++++C +H    T  SW+  +   ++   T 
Sbjct  299   RSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTI  357

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             A+   DW +DRN     + +K + P  C+
Sbjct  358   AKAVGDWVYDRN-----LFQKIDCPYPCN  381



>gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Erythranthe guttata]
Length=390

 Score =   318 bits (816),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 166/370 (45%), Positives = 234/370 (63%), Gaps = 21/370 (6%)
 Frame = +2

Query  107   QWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVI  286
             +WL   + L+ +LR  EG + V +T +++AV+KGAVCLDGS P Y+ D+G G GV+NW++
Sbjct  2     EWLRITLCLVILLR-TEG-LYVNITYVQTAVAKGAVCLDGSPPAYHLDRGFGAGVNNWLV  59

Query  287   FIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCD  466
              IEGGGWC N   C  R  +RLGSSK M        +LSD P  NP+FYNW+RV++ YCD
Sbjct  60    QIEGGGWCNNVTTCLARKTNRLGSSKQMIKQLAFSAILSDKPQFNPDFYNWNRVKIRYCD  119

Query  467   GSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCD  646
             GSSFT DV+ VDP T L YRG R+F A+ME+  AKGMKNA+NA+ +G SAGG+A +LHCD
Sbjct  120   GSSFTGDVEAVDPVTKLYYRGARVFVAVMEELLAKGMKNAQNAVLSGCSAGGLASILHCD  179

Query  647   YFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKA  826
              F+AL P  T+VKC +D+ YFIN + +      ++ F+ +V + GSAK LP  CTSKMK 
Sbjct  180   SFKALLPVRTKVKCFSDAGYFINTKDISAADHIEAYFNDVVTTHGSAKNLPISCTSKMKP  239

Query  827   SLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTLNEMK  982
             SLCFFPQY  + ++TP+F+  +A+D  Q+K  L   +         C T    C+ ++++
Sbjct  240   SLCFFPQYVSKEIRTPLFVINAAYDSWQIKNILAPGVADPHGIWHDCKTDITKCSTDQLR  299

Query  983   IAQELRLDFL-----SLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTY  1141
               Q  RL+FL      L P  N+      ++N+C +H  T    +W+     + + NKT 
Sbjct  300   TMQGFRLEFLKAISSGLGPLINTR---GYFINSCYAHCQTEMQENWFAIDSPK-LNNKTI  355

Query  1142  AEVFADWYFD  1171
             A+   DW++D
Sbjct  356   AKAVGDWFYD  365



>gb|AAP72959.1| pectin acetylesterase [Lactuca sativa]
Length=395

 Score =   318 bits (816),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 168/373 (45%), Positives = 228/373 (61%), Gaps = 14/373 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             R  +WLC F+V    L   E   +V LT L SAV+KGAVCLDGSAP Y+ DKG G G+DN
Sbjct  5     RGDRWLCIFLVCTLSLLCTEA-YDVGLTFLNSAVAKGAVCLDGSAPAYHIDKGFGAGIDN  63

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++F EGGGWC NA +C  R  +RLGSSK M        +  +    NP+FY+W+R++V 
Sbjct  64    WLVFFEGGGWCNNATNCLTRRDTRLGSSKKMLTTETFSGMFHNKAKYNPDFYDWNRIKVR  123

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDG+SFT DV+ VDP T L YRG RIF A+++D  AKGMKNAKNAI AG SAGG+  +L
Sbjct  124   YCDGASFTGDVEAVDPNTKLYYRGARIFRAVVDDLLAKGMKNAKNAILAGCSAGGLTSIL  183

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
              CD FR+  P TT+VKCL+D+ +FIN + + G    +  +  +V + GSAK L   C +K
Sbjct  184   QCDNFRSQLPATTKVKCLSDAGFFINAKTIIGQSHIEGFYADVVRTHGSAKVLSPACLAK  243

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             M   LCFFPQ  +Q++KTPIFL  +A+D  Q+K  L   +         C +    C+  
Sbjct  244   MSPGLCFFPQNMVQFIKTPIFLINAAYDSWQVKNILAPGVADRKGTWRECKLDITKCSSA  303

Query  974   EMKIAQELRLDFLSLLP--KKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTY  1141
             ++ + Q  RL+FL  L      +  S  +++N+C SH  T    +W       ++GN T 
Sbjct  304   QLNVLQGYRLEFLKALNGFGNGNSPSRGMFINSCYSHCQTGIQETWL-RNDSPLLGNTTI  362

Query  1142  AEVFADWYFDRNT  1180
             A+   DWY++RNT
Sbjct  363   AKAVGDWYYERNT  375



>gb|EYU29130.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=395

 Score =   318 bits (816),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 164/372 (44%), Positives = 233/372 (63%), Gaps = 15/372 (4%)
 Frame = +2

Query  125   VVLLTILRKIEGK---INVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIE  295
             ++LL  +  I G+     V +T +ESAV+KGAVCLDGSAP Y++DKG G G++NW++ IE
Sbjct  4     IILLIYMVIIVGRGESFFVDITYVESAVAKGAVCLDGSAPAYHFDKGSGAGINNWLVHIE  63

Query  296   GGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSS  475
             GGGWC NA  C  R   RLGSSK M        + S+ P  NP+FYNW+R++V YCDG+S
Sbjct  64    GGGWCNNATTCLARRNGRLGSSKQMAKQIAFSGIFSNKPQFNPDFYNWNRLKVRYCDGAS  123

Query  476   FTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFR  655
             FT DV+ VDPAT L YRG R+F A++ED  AKGMKNA+NAI +G SAGG+  +L+CD F+
Sbjct  124   FTGDVEAVDPATKLYYRGARVFVAVIEDLLAKGMKNAENAILSGCSAGGLTSILNCDRFK  183

Query  656   ALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLC  835
             +L P +T VKC AD+ +FIN + + G +  +  ++ +V + GSAK L + CTSKMK SLC
Sbjct  184   SLLPISTNVKCFADAGFFINAKDVSGAQHIEQFYNDVVTTHGSAKHLAQSCTSKMKPSLC  243

Query  836   FFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTLNEMKIAQ  991
             FFP+  +Q ++TPIF+  +A+D  Q+K  L   +        +C T    C+  +++  Q
Sbjct  244   FFPENMVQAIQTPIFVVNAAYDSWQIKNILAPGVADPHGLWHNCKTDIKKCSTTQLQTMQ  303

Query  992   ELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWY  1165
             E RL+FL  L    S  S   ++N+C +H    T  +W       +    T A+   DW+
Sbjct  304   EYRLEFLKALSGLMSAKSKGYFINSCYAHCQTETQETWSTNISPMLNNKVTIAKAVGDWF  363

Query  1166  FDRNTSPIRVIE  1201
             ++R  SP   I+
Sbjct  364   YER--SPFEKID  373



>ref|XP_008451860.1| PREDICTED: protein notum homolog isoform X1 [Cucumis melo]
Length=401

 Score =   318 bits (816),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 165/378 (44%), Positives = 236/378 (62%), Gaps = 15/378 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             +   WL FFV  +    K +  INV +T ++ A  KGAVCLDGS P Y++  G G G++N
Sbjct  8     KFGLWL-FFVASVQFFLKAQC-INVGITYVQDAGIKGAVCLDGSPPAYHFSDGFGSGINN  65

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W+I +EGGGWC N   C  R  +RLGSSK M        +LS+ P  NP+FYNW+R++V 
Sbjct  66    WLIQLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVR  125

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VDPATNL +RG R+F A++++  AKGMKNAKNAI +G SAGG++ +L
Sbjct  126   YCDGSSFTGDVEAVDPATNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSIL  185

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD F++L P TT+VKCL+D+ YFIN + + G +  +  +  +V + GSAK LP  CTSK
Sbjct  186   HCDNFKSLLPPTTKVKCLSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSK  245

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             MK  +CFFPQ  +Q ++TPIFL  +A+D  Q+K  L   +         C +   NC+  
Sbjct  246   MKPEMCFFPQNVVQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPI  305

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             +++I Q+ R+ FLS L    S  S  +++++C +H  T    +W       ++     A+
Sbjct  306   QLRIMQDFRVQFLSALTGVGSSLSRGLFIDSCYAHCQTEMQETWLRSDS-PMLSKTPIAK  364

Query  1148  VFADWYFDRNTSPIRVIE  1201
                DW+FDR  +P + I+
Sbjct  365   AVGDWFFDR--APFQKID  380



>ref|XP_009799834.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=392

 Score =   318 bits (815),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 162/368 (44%), Positives = 229/368 (62%), Gaps = 8/368 (2%)
 Frame = +2

Query  89    IMA-RLSQWLCFFVVLLTILRKIEGK----INVTLTTLESAVSKGAVCLDGSAPGYYYDK  253
             +MA R  Q  C  V  L I++           V  T +++AVSKGAVCLDGS P Y+++ 
Sbjct  2     VMATRCLQLFCLIVCSLAIIKTESATDLDFYEVKKTIVKNAVSKGAVCLDGSPPAYHFEP  61

Query  254   GHGEGVDNWVIFIEGGGWCMNAQHCKYR-GPSRLGSSKYMWPVFEMGDLLSDSPNENPEF  430
             G GEGV NW + + GG WC + + CK R   +++GS+  M P F    + S + + NP+F
Sbjct  62    GFGEGVGNWFVQLAGGAWCTSVETCKERIRDNKVGSTTIMGP-FTFQGIYSKNQSANPDF  120

Query  431   YNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGN  610
             YNW++V V YCDG +FT DV+ VDPATNL +RG RIF+A++ED  AKG+KNAKNAI AG+
Sbjct  121   YNWNKVLVRYCDGGAFTGDVEYVDPATNLHFRGARIFEAVVEDVLAKGLKNAKNAILAGS  180

Query  611   SAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAK  790
             SAGG   ML+CD+FR+L PNT RVKC  D  YFI+ +  +  + F+  ++ LV   GS K
Sbjct  181   SAGGYPAMLYCDHFRSLLPNTPRVKCFVDGGYFIHAKNQKQARGFEEIYNGLVTLHGSGK  240

Query  791   WLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCTL  970
              LPK CTSKMK  LC FP+   Q +K P+F+ MSAFD  Q+   +   +   +    CT 
Sbjct  241   TLPKSCTSKMKPLLCLFPENMQQNIKIPLFIAMSAFDIFQINTTVEPNLHDVIENGTCTT  300

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTYAEV  1150
             ++ K  +E R +FLS LPK N+     +++++ V+H  +  + + P+   +I N +  + 
Sbjct  301   SQNKAFREFRSEFLSTLPKPNNPKMRGVFIDS-VNHHTSLLTRWSPENATMINNLSLPKA  359

Query  1151  FADWYFDR  1174
             F DWYFDR
Sbjct  360   FGDWYFDR  367



>ref|XP_010529277.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=401

 Score =   318 bits (816),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 170/392 (43%), Positives = 237/392 (60%), Gaps = 18/392 (5%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             R  Q L   VV   +L + EG + V +T +++A++KGAVCLDGS P Y+ DKG G G++N
Sbjct  5     RFKQCL-ILVVCSVVLLRTEG-LFVNITYVKTAMAKGAVCLDGSPPAYHLDKGSGTGINN  62

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W+I +EGGGWC N  +C  R  +RLGSSK M        +LS+    NP+FYNW+RV++ 
Sbjct  63    WLIQLEGGGWCNNVTNCIARMHTRLGSSKQMAKQIAFSAILSNRKQYNPDFYNWNRVKIR  122

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV  VDPATNL +RG R++ A+MED  AKGM NA+NA+ +G SAGG+A ML
Sbjct  123   YCDGSSFTGDVQTVDPATNLHFRGARVWLAVMEDLLAKGMINAENAVLSGCSAGGLASML  182

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD FRAL P  T+VKCL+D+ +F+N   + G +  +  F  +V   GSAK LP  CTSK
Sbjct  183   HCDSFRALLPMGTKVKCLSDAGFFVNTRDVSGVQYIRQYFKDVVTLHGSAKNLPPSCTSK  242

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             +  +LCFFPQY  + ++TP+FL  +A+D  Q+K  L            SC +   NC  N
Sbjct  243   LNPALCFFPQYVARRIRTPLFLLNAAYDSWQIKNILAPRAADPNGKWQSCELDIKNCQPN  302

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAE  1147
             ++K+ Q+ RL FLS +       S  +++ +C +H    T  SW+     R +   T A 
Sbjct  303   QIKVMQDFRLQFLSAVTGLGKSPSRGMFIVSCYTHCQTETQTSWFWTDSPR-LNRTTIAR  361

Query  1148  VFADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
                DW +DR     ++ +K + P  C+    N
Sbjct  362   AVGDWVYDR-----KLFQKIDCPYPCNPTCHN  388



>ref|XP_009616254.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=404

 Score =   318 bits (816),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 234/371 (63%), Gaps = 13/371 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             ++ QW+ + ++ L+++ + EG + V +T L S ++KGAVCLDGS+P Y++DKG G GV++
Sbjct  7     KVKQWI-YSLLTLSMIFRTEG-LFVNITYLLSGMAKGAVCLDGSSPAYHHDKGFGTGVNS  64

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W+I +EGGGWC N   C  R  +RLGSSK M        +LS+ P  NP+FYNW+RV+V 
Sbjct  65    WLIQMEGGGWCNNVTTCLSRKNTRLGSSKQMVKQLAFSGILSNKPQFNPDFYNWNRVKVR  124

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV  V+P TNL +RG R+F A+MED  AKGMKNA+NAI +G SAGG+  +L
Sbjct  125   YCDGSSFTGDVQAVNPITNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGGLTSIL  184

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD F+AL P   +VKC +D+ YFIN + + G    +  F  +V   GSAK LP  CTS+
Sbjct  185   HCDSFKALLPMGAKVKCFSDAGYFINVKDISGAPHIEEFFGDVVRLHGSAKNLPPSCTSR  244

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN-------  973
             +K +LCFFPQ   Q+V+TP+FL  +A+D  Q+K  L   +      + NC L+       
Sbjct  245   LKPNLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPSVADPRGVWRNCKLDILRCSSR  304

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             +++  Q  RL FL  L      SS   ++N+C +H  T    +W+     + + NKT A 
Sbjct  305   QLQTMQGFRLGFLRALITLGPSSSRGYFINSCYAHCQTEVQETWFRADSPK-LANKTIAI  363

Query  1148  VFADWYFDRNT  1180
                DW+FD+N+
Sbjct  364   ALGDWFFDKNS  374



>ref|XP_009108427.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   318 bits (815),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 163/389 (42%), Positives = 244/389 (63%), Gaps = 18/389 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M    QWL   V  L IL K EG + V +T + +AV+KGAVCLDGS P Y+ D+G G G+
Sbjct  1     MFNFKQWLVLVVCSLAIL-KAEGLL-VNITFVRNAVAKGAVCLDGSPPAYHIDRGSGTGI  58

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             ++W+I +EGGGWC N  +C  R  ++LGSSK M        +LS+    NP+FYNW+RV+
Sbjct  59    NSWLIQLEGGGWCHNVTNCISRMHTKLGSSKKMVENLAFSAILSNKEQRNPDFYNWNRVK  118

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV  V+PATNL +RG R++ A+M++  AKGM+NA+NA+ +G SAGG+A 
Sbjct  119   VRYCDGSSFTGDVKTVNPATNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLAS  178

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             ++HCD FRAL P  T VKCL+D+ +F+N   + G +  +S F+ +V   GSAK LP+ CT
Sbjct  179   LMHCDSFRALLPMGTNVKCLSDAGFFLNTRDVSGAQYIKSYFNDVVTLHGSAKNLPRSCT  238

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L            SC +   NC 
Sbjct  239   SRLNPAMCFFPQYVARQIRTPVFVLNAAYDSWQIKNILAPRAADPEGKWQSCQLDIKNCQ  298

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              +++K+ Q+ RL+FLS +      +S  +++++C +H    T  SW+  +   ++   T 
Sbjct  299   RSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTI  357

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             A+   DW +DRN     + +K + P  C+
Sbjct  358   AKAVGDWVYDRN-----LFQKIDCPYPCN  381



>emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata var. radiata]
Length=399

 Score =   318 bits (815),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 167/398 (42%), Positives = 239/398 (60%), Gaps = 18/398 (5%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             +R  QWL   + ++ +L K EG + V +T +E+AV+KGAVCLDGS P Y++ KG G G++
Sbjct  4     SRKGQWLSVLICVVLLL-KAEG-VPVGITFVENAVAKGAVCLDGSPPAYHFHKGSGAGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++  EGGGWC N   C  R  +RLGSSK M          S+S   NP+FY+W+R++V
Sbjct  62    NWIVHFEGGGWCNNVTSCLSRRDTRLGSSKKMDTQLSFSGFFSNSKKFNPDFYDWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDPATNL +RG R+F A+++D  AKGMKNA+NAI +G SAGG+A +
Sbjct  122   RYCDGSSFTGDVEAVDPATNLHFRGSRVFAAVVDDLLAKGMKNAQNAIISGCSAGGLAAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             L+CD F++L P TT+VKCLAD+ YFIN + + G +  +  +  +V + GSAK LP  CTS
Sbjct  182   LNCDRFKSLLPRTTKVKCLADAGYFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPASCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             +++  LCFFPQ  +  + TPIF   +A+D  Q+K  L             C +    C+ 
Sbjct  242   RLRPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPHGTWRECKLDIKKCSS  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYA  1144
             N++   Q  R DFL       +  S   +++ C +H    T  +W       V+G+ T A
Sbjct  302   NQLSAMQVFRTDFLRAFGAVGNSPSKGHFIDGCYAHCQTGTQETWL-RNDSPVLGSTTIA  360

Query  1145  EVFADWYFDRNTSPIRVIEKS---NKPLNCSTFEQNPR  1249
             +   DWY+DR   P + I+ +   N   +   F+QN R
Sbjct  361   KAVGDWYYDRK--PFKQIDCAYPCNPTCHNRIFDQNER  396



>ref|XP_009627060.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
 ref|XP_009627061.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
Length=402

 Score =   318 bits (815),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 218/346 (63%), Gaps = 11/346 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T L+SAV+KGAVCLDGS P Y++DKG G GV+NW I +EGG WC NA  C  R  +R
Sbjct  27    VDITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLSRTKTR  86

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +LS+    NP+FYNW+R+R+ YCDGSSFT DV+ VDP T + YRG
Sbjct  87    LGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVEAVDPKTKVYYRG  146

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF A+MEDF AKGMKNA+NAI AG SAG +A +LHCD F+ L P   +VKCL+D+ +F
Sbjct  147   ARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKCLSDAGFF  206

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN + + G    +  +  +V++ GSAK LP+ CTS++K  LCFFPQ   Q +KTP+FL  
Sbjct  207   INAKTISGAPHIEQFYSDVVNTHGSAKNLPQSCTSRLKPGLCFFPQNVAQQIKTPLFLVN  266

Query  890   SAFDQIQLKYGLTMPIVSCV-TYNNCTLNEMKIA-------QELRLDFLSLLPKKNSESS  1045
             +A+D  Q+K  L   +     T+ NC L+ +K +       Q  R +FL  L      S+
Sbjct  267   AAYDSWQIKNILAPGVADPRGTWRNCKLDILKCSSAQLETMQGYRTEFLKALNGLGPSST  326

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRN  1177
                ++N+C +H    T  +W      R + + T A+   DW++DRN
Sbjct  327   RGYYINSCYAHCQTGTQETWLRDDSPR-LASTTIAKAVGDWFYDRN  371



>ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
 gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
Length=398

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/370 (45%), Positives = 231/370 (62%), Gaps = 14/370 (4%)
 Frame = +2

Query  122   FVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGG  301
              +V L I  K +G   V +T + +AV+KGAVCLDGS P Y+ DKG G G++NW++ +EGG
Sbjct  11    LLVFLVISLKADGFF-VDITYVTTAVAKGAVCLDGSPPAYHLDKGSGSGINNWLVHVEGG  69

Query  302   GWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFT  481
             GWC N   C  R  +RLGSS  M        LL +  + NP+FYNW+RV+V YCDG+SFT
Sbjct  70    GWCSNVTTCFSRKNTRLGSSNQMVKQLAFSGLLGNKASMNPDFYNWNRVKVRYCDGASFT  129

Query  482   SDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRAL  661
              DV+ VDPAT L +RG RI+ A++ED  AKGM+NA+NAI +G SAGG+  +LHCD FRAL
Sbjct  130   GDVEEVDPATKLHFRGGRIWLAVIEDLLAKGMRNAENAILSGCSAGGLTSILHCDSFRAL  189

Query  662   FPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFF  841
              P   +VKC+AD+ YFIN + +      QS FD +V    SAK LP+ CTS++K SLCFF
Sbjct  190   LPIGAKVKCVADAGYFINAKDVSQADHIQSFFDDVVTLHDSAKNLPQSCTSRLKPSLCFF  249

Query  842   PQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQEL  997
             PQY  Q ++TP FL  +A+D  Q+K  L   +        +C +    CT ++++  Q+ 
Sbjct  250   PQYMAQGIRTPFFLLNAAYDSWQVKNTLAPGVADPHGTWHNCKLDIKKCTASQLQTLQDF  309

Query  998   RLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFD  1171
             RL+FLS L    S  SI +++N+C +H       +W       V+G  + A+   DW++D
Sbjct  310   RLEFLSALKGVGSSPSIGMFINSCYAHCQSEVQETWLRDDS-PVLGGTSIAKAVGDWFYD  368

Query  1172  RNTSPIRVIE  1201
             R  SP + I+
Sbjct  369   R--SPFQKID  376



>ref|XP_008451861.1| PREDICTED: protein notum homolog isoform X2 [Cucumis melo]
Length=398

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/378 (44%), Positives = 236/378 (62%), Gaps = 15/378 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             +   WL FFV  +    K +  INV +T ++ A  KGAVCLDGS P Y++  G G G++N
Sbjct  5     KFGLWL-FFVASVQFFLKAQC-INVGITYVQDAGIKGAVCLDGSPPAYHFSDGFGSGINN  62

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W+I +EGGGWC N   C  R  +RLGSSK M        +LS+ P  NP+FYNW+R++V 
Sbjct  63    WLIQLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVR  122

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VDPATNL +RG R+F A++++  AKGMKNAKNAI +G SAGG++ +L
Sbjct  123   YCDGSSFTGDVEAVDPATNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSIL  182

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD F++L P TT+VKCL+D+ YFIN + + G +  +  +  +V + GSAK LP  CTSK
Sbjct  183   HCDNFKSLLPPTTKVKCLSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSK  242

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             MK  +CFFPQ  +Q ++TPIFL  +A+D  Q+K  L   +         C +   NC+  
Sbjct  243   MKPEMCFFPQNVVQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPI  302

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             +++I Q+ R+ FLS L    S  S  +++++C +H  T    +W       ++     A+
Sbjct  303   QLRIMQDFRVQFLSALTGVGSSLSRGLFIDSCYAHCQTEMQETWLRSDS-PMLSKTPIAK  361

Query  1148  VFADWYFDRNTSPIRVIE  1201
                DW+FDR  +P + I+
Sbjct  362   AVGDWFFDR--APFQKID  377



>gb|KCW72726.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=373

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/374 (44%), Positives = 231/374 (62%), Gaps = 14/374 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL  WLC  ++ + IL K E   NV +T +++AV+KGAVCLDGS P Y++DKG G G +
Sbjct  4     ARLRTWLCV-ILSIQILIKSEA-FNVGITYVQNAVAKGAVCLDGSPPAYHFDKGVGAGAN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW+I  EGG WC N   C  R  +RLGSSK M        +LS+    NP+FYNW++++V
Sbjct  62    NWLILFEGGAWCNNVTTCLARRDTRLGSSKQMVKELSFSGILSNKQKFNPDFYNWNKIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ V+PATNL +RG R F A++ED  +KGM NA+NAI AG SAGG+  +
Sbjct  122   RYCDGASFTGDVEAVNPATNLHFRGARAFVAIVEDLMSKGMSNAQNAILAGCSAGGLTAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             L+CD FRAL P  T+VKCLAD+ YFIN + + G    ++ +  +V + GSAK LP  CTS
Sbjct  182   LNCDRFRALVPARTKVKCLADAGYFINAKDVSGASHIENFYSEVVATHGSAKNLPTSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             KMK  LCFFPQ  +  ++TP+F+  +A+D  Q+K  L   +        SC +    C+ 
Sbjct  242   KMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIKKCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYA  1144
             N++KI Q+ RL+FL  L    +  S  +++++C +H    T  +W   +    +  KT  
Sbjct  302   NQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQAGTQETWL--RNDSPVVAKTVM  359

Query  1145  EVFADWYFDRNTSP  1186
               F + + D  T P
Sbjct  360   TTFFNIFHDTVTGP  373



>ref|XP_009771151.1| PREDICTED: uncharacterized protein LOC104221730 [Nicotiana sylvestris]
Length=402

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 218/346 (63%), Gaps = 11/346 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T L+SAV+KGAVCLDGS P Y++DKG G GV+NW I +EGG WC NA  C  R  +R
Sbjct  27    VDITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFIQLEGGAWCNNATTCLSRTKTR  86

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +LS+    NP+FYNW+R+R+ YCDGSSFT DV+ VDP T + YRG
Sbjct  87    LGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCDGSSFTGDVEAVDPRTKVYYRG  146

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF A+MEDF AKGMKNA+NAI AG SAG +A +LHCD F+ L P   +VKCL+D+ +F
Sbjct  147   ARIFSAVMEDFLAKGMKNAQNAILAGCSAGSLAAILHCDRFKGLLPPGAKVKCLSDAGFF  206

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN + + G    +  +  +V++ GSAK LP+ CTS++K  LCFFPQ   Q +KTP+FL  
Sbjct  207   INAKTISGASHIEQFYSDVVNTHGSAKNLPQSCTSRLKPGLCFFPQNVAQQIKTPLFLVN  266

Query  890   SAFDQIQLKYGLTMPIVSCV-TYNNCTLNEMKIA-------QELRLDFLSLLPKKNSESS  1045
             +A+D  Q+K  L   +     T+ NC L+ +K +       Q  R +FL  L      S+
Sbjct  267   AAYDSWQIKNILAPGVADPRGTWRNCKLDILKCSSAQLETMQGYRNEFLKALNGLGPSST  326

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRN  1177
                ++N+C +H    T  +W      R + + T A+   DW++DRN
Sbjct  327   RGYYINSCYAHCQTGTQETWLRDDSPR-LASTTIAKAVGDWFYDRN  371



>ref|XP_006494119.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006494120.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
Length=392

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/382 (44%), Positives = 230/382 (60%), Gaps = 14/382 (4%)
 Frame = +2

Query  89    IMAR--LSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHG  262
             ++AR  + QW    V  L IL K +   NV++T +E AV+KGAVCLDGS P Y++DKG G
Sbjct  1     MIARTTMGQWFNLLVCALLIL-KAQACFNVSITYVEDAVAKGAVCLDGSPPAYHFDKGFG  59

Query  263   EGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWH  442
              G++NW++ I+GG WC N   C  R  S  GSSKYM        +LS+  N NP+FY+W+
Sbjct  60    AGINNWLVHIDGGAWCNNVADCSNRRDSSYGSSKYMVKEANFTGILSNEQNFNPDFYDWN  119

Query  443   RVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGG  622
             RV+V YCDG+SFT DV+ V+P TNL +RG R+F+A+MED  AKGMKNA+NAI  G SAGG
Sbjct  120   RVKVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGG  179

Query  623   VAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPK  802
             +  +LHCD FRALFP  TRVKC AD+ YF+N + + G       +  +V   GSAK LP 
Sbjct  180   LTSILHCDNFRALFPVDTRVKCFADAGYFVNVKDVSGASHIVEFYKQVVALHGSAKHLPA  239

Query  803   ECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYN  958
              CTS++   LCFFPQ     VKTP+F+  SA+D  Q+   L            SC V   
Sbjct  240   SCTSRLSPGLCFFPQNVAGQVKTPLFIINSAYDSWQITNILVPDDADPKGTWSSCKVDIK  299

Query  959   NCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT-YHSWYGPKKLRVIGNK  1135
              C+  +++  Q  R+ FL+ L +  + SS  + +++C +H  T Y   +      V+   
Sbjct  300   TCSSTQLQTMQGFRVQFLNALAELGNSSSRGMLIDSCYTHCRTEYQEAWLSADSPVLDKT  359

Query  1136  TYAEVFADWYFDRNTSPIRVIE  1201
               A+   DWY+DR  SP + I+
Sbjct  360   PIAKAVGDWYYDR--SPFQKID  379



>ref|XP_011074200.1| PREDICTED: protein notum homolog [Sesamum indicum]
Length=398

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 177/396 (45%), Positives = 235/396 (59%), Gaps = 25/396 (6%)
 Frame = +2

Query  86    YIMARLSQWLCFFVV-LLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHG  262
             +I      W+   V+ L+ I + + G  N+T+T LESAVSKGAVCLDGS P Y+YDKG+G
Sbjct  4     HIQTMADHWIKLLVLSLVMITQVVHGSKNITITILESAVSKGAVCLDGSPPAYFYDKGYG  63

Query  263   EGVDNWVIFIEGGGWCMNAQHCK--YRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYN  436
             EG DNW++++EGGGWC N   C       S     K M    +   +L+   N NP+FYN
Sbjct  64    EGADNWLVYLEGGGWCANTDFCHEWISTKSTFRREKQM----QFRHILAPEQNINPDFYN  119

Query  437   WHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSA  616
             W+RV VAYCDGSSF  DV+   P +NL  RG RIFDA+MED  AKGMKNAKNAI AG SA
Sbjct  120   WNRVFVAYCDGSSFMGDVEEAAPGSNLCRRGARIFDAVMEDLVAKGMKNAKNAILAGGSA  179

Query  617   GGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLE--GDKLFQSSFDYLVDSMGSAK  790
             GG+A + HCD FRAL P  TR KC+ADS  F   +K E  G +     FD L+   G+ K
Sbjct  180   GGMATIYHCDGFRALIPGATRYKCIADSGLFTPADKKELIGYEKRVHRFDKLIAFHGTDK  239

Query  791   WLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPI-------VSCV  949
             +LPK CTSKM  +LC FP+  ++ ++TP+F+  S++D  Q+  GL   +         C 
Sbjct  240   FLPKSCTSKMSVNLCHFPENVVRDIQTPLFIIESSYDSFQIYTGLDPGLPYNETTWSDCA  299

Query  950   T-YNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNC--VSHEFTYHSWYGPKKLR  1120
                N CT  +++  ++ R +FL  L      SSI ++V++C    H   +H W  P  L 
Sbjct  300   NDLNFCTCPQLQSMKDFRAEFLKTLQAIAKSSSIGMFVHSCHIHGHFLNFHGW-DPSPL-  357

Query  1121  VIGNKTYAEVFADWYFDRNTSPIRVIEKSN-KPLNC  1225
              + NKT A+V  DWYFDR     +VI+  +  P NC
Sbjct  358   -LQNKTIAKVIGDWYFDR--CFFQVIDTEDVGPKNC  390



>ref|XP_007158098.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
 gb|ESW30092.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
Length=400

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/373 (43%), Positives = 230/373 (62%), Gaps = 15/373 (4%)
 Frame = +2

Query  95    ARLSQWLCFFV-VLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
              R+ QWL   V  LL+++ +      V +T L++AV+KGAVCLDGS PGY++D+G G G+
Sbjct  4     GRIRQWLNLLVCALLSLMAEAS---YVPITYLQNAVAKGAVCLDGSPPGYHFDRGSGTGI  60

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++  EGGGWC N   C  R  + LGSSK M        ++S+ P  NP+FYNW+R++
Sbjct  61    NNWLVAFEGGGWCNNVTTCLSRKTNHLGSSKQMAKQIAFSGIMSNRPMFNPDFYNWNRIK  120

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV+ V+P T L +RG RIF A+MED  AKGMKNA+NAI +G SAGG+  
Sbjct  121   VRYCDGSSFTGDVEAVNPVTKLHFRGARIFAAVMEDLLAKGMKNARNAIISGCSAGGLTA  180

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +LHCD F+AL P   RVKC++D+ YFIN   + G    Q  F  +V + GSA+ LP+ CT
Sbjct  181   VLHCDRFKALLPREARVKCVSDAGYFINARDVTGAYHIQQYFSQVVATHGSARNLPQSCT  240

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++   LCFFPQY + ++ TPIF   +A+D  Q+K  L   +        SC +  NNC+
Sbjct  241   SRLTPKLCFFPQYLVSHITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCS  300

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTY  1141
              +++ + Q  R +FL  L    + S   +++++C +H  T    +W        +   T 
Sbjct  301   PDQLDLMQGFRTEFLRALTVLGNSSYKGMFIDSCYAHCQTEMQETWLRNDSPE-LEKTTI  359

Query  1142  AEVFADWYFDRNT  1180
             A+  ADW+++R T
Sbjct  360   AKAVADWFYERRT  372



>gb|KHN27509.1| Protein notum like [Glycine soja]
Length=398

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 236/372 (63%), Gaps = 14/372 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+SQWL   +V + +L K EG  +V LT +E+A SKGAVCLDGS P Y++DKG GEG+D
Sbjct  4     ARISQWL-NLLVCVLLLLKAEGS-SVPLTLVENAESKGAVCLDGSPPAYHFDKGFGEGID  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N + C  R  +RLGSSK M  ++    +LS+    NP+FYNW+RV+V
Sbjct  62    NWIVHIEGGGWCNNVESCLERKNTRLGSSKQMKDIY-FSAILSNEQQFNPDFYNWNRVKV  120

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP TNL +RG RIF A+ME+  AKGMKN KNAI +G SAGG+  +
Sbjct  121   RYCDGSSFTGDVEEVDPTTNLHFRGARIFSAVMEELLAKGMKNVKNAILSGCSAGGLTTI  180

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+AL P+   VKC+ D+ YF+N E + G    Q  +  +V   GSAK LP  CTS
Sbjct  181   LHCDSFKALLPSGANVKCVPDAGYFVNVEDISGAHSIQEFYSEVVSIHGSAKNLPTSCTS  240

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKY----GLTMPI---VSC-VTYNNCTL  970
             K+  +LCFFPQY   ++ TPIF+  SA+D+ Q++     G   P     SC +  +NC+ 
Sbjct  241   KLNPALCFFPQYVASHISTPIFVVNSAYDRWQIRNIFIPGSADPSNSWHSCKINISNCST  300

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
             +++   Q  + +F   L +     S  +++++C +H  T    +W      + + N T A
Sbjct  301   DQLSKIQGFKSEFERALSEVGDSPSKGVFIDSCYAHCQTELQETWLKSDSPQ-LANTTIA  359

Query  1145  EVFADWYFDRNT  1180
             +   DW++ R++
Sbjct  360   KAVGDWFYGRSS  371



>ref|XP_009132797.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   317 bits (811),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/389 (42%), Positives = 243/389 (62%), Gaps = 18/389 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M    QWL   V  L IL K EG + V +T + +AV++GAVCLDGS P Y+  +G G G+
Sbjct  1     MFNFKQWLVLVVCSLAIL-KAEG-LFVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGI  58

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             ++W+I +EGGGWC N  +C  R  +RLGSSK M        +LS+    NP+FYNW+RV+
Sbjct  59    NSWLIQLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVK  118

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV  V+PATNL +RG R++ A+M++  AKGM+NA+NA+ +G SAGG+A 
Sbjct  119   VRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLAS  178

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             ++HCD FRAL P  T+VKCL+D+ +F+N   + G +  +S F  +V   GSAK LP+ CT
Sbjct  179   LMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGAQYIKSYFKDVVALHGSAKNLPRTCT  238

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L            SC +   NC 
Sbjct  239   SRLTPAMCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCQ  298

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              N++K+ Q+ RL+FLS +      SS  +++++C +H    T  SW+  +   ++   T 
Sbjct  299   PNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTI  357

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             A+   DW +DR     ++ +K + P  C+
Sbjct  358   AKAVGDWVYDR-----KLFQKIDCPYPCN  381



>ref|XP_007156332.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
 gb|ESW28326.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
Length=399

 Score =   317 bits (811),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/384 (42%), Positives = 232/384 (60%), Gaps = 14/384 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             R+ QWL     +L +L K EG + V LT +E+A+SKGAVCLDGS P Y++DKG GEG++N
Sbjct  5     RIIQWLNLVACVLLLL-KAEGSL-VPLTLVENALSKGAVCLDGSPPAYHFDKGDGEGINN  62

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++ +EGGGWC +A  C  R  +RLGSSK M        +LS+    NP+FYNW RV++ 
Sbjct  63    WIVHMEGGGWCKDADDCLGRKDTRLGSSKQMVEDLYFSGILSNEREYNPDFYNWDRVKIR  122

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VDP  NL +RG RIF A+MED  AKGM+ A+NAI +G SAGG+  +L
Sbjct  123   YCDGSSFTGDVEEVDPTNNLYFRGARIFSAVMEDLLAKGMEKAENAILSGCSAGGLTTIL  182

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD F+AL P+   VKC+ D+ YFIN E + G +  +  +  +V + GSAK LP  CTSK
Sbjct  183   HCDNFKALLPSKATVKCVPDAGYFINVEDISGARFIEDYYSKVVSTHGSAKNLPTSCTSK  242

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             + + LCFFPQY   ++ TPIF+  SA+D  Q++  L            SC +    C+ +
Sbjct  243   LSSGLCFFPQYVASHISTPIFIVNSAYDSWQIRNILAPGAADPSDNWHSCKLDLAKCSPD  302

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAEV  1150
             ++ I Q  + +F   +      SS  +++N+C  H +      +       + N T ++ 
Sbjct  303   QLSIVQGFKKEFEKAVSVVGDSSSNGMFINSCYDHCQTESQETWSKSDSPHLANTTISKA  362

Query  1151  FADWYFDRNTSPIRVIEKSNKPLN  1222
               +W++DR  SP   ++  N P N
Sbjct  363   VGNWFYDR--SPFHHVD-CNYPCN  383



>ref|XP_010439718.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   317 bits (811),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 164/389 (42%), Positives = 242/389 (62%), Gaps = 18/389 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M    QWL   V  L I+ K EG + V +T + +AV+KGAVCLDGS P Y+ D+G G GV
Sbjct  1     MFNFKQWLVLLVCSLVIM-KTEG-LFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGV  58

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             ++W+I +EGGGWC N  +C  R  +RLGSSK M        +LS+    NP+FYNW+RV+
Sbjct  59    NSWLIQLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVK  118

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV  V+PATNL +RG RI+ A+M++  AKGM+NA+NA+ +G SAGG+A 
Sbjct  119   VRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLAKGMRNAENAVLSGCSAGGLAS  178

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             ++HCD FRAL P  +RVKCL+D+ +F+N   + G +  +  F  +V   GSAK LP+ CT
Sbjct  179   LMHCDSFRALLPMGSRVKCLSDAGFFLNTRDVSGVQYIKQYFQDVVTLHGSAKNLPRSCT  238

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L            SC +   NC 
Sbjct  239   SRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCH  298

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              +++K+ Q+ RL+FLS +      SS  +++++C +H    T  SW+  +   ++   T 
Sbjct  299   PSQLKVMQDFRLEFLSAVISLGRSSSRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTI  357

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             A+   DW +DR      + +K + P  C+
Sbjct  358   AKAVGDWVYDRT-----LFQKIDCPYPCN  381



>ref|XP_003547731.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
 ref|XP_006599118.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=398

 Score =   316 bits (810),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 236/372 (63%), Gaps = 14/372 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+SQWL   +V + +L K EG  +V LT +E+A SKGAVCLDGS P Y++DKG GEG+D
Sbjct  4     ARISQWL-NLLVCVLLLLKAEGS-SVPLTLVENAESKGAVCLDGSPPAYHFDKGFGEGID  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N + C  R  +RLGSSK M  ++    +LS+    NP+FYNW+RV+V
Sbjct  62    NWIVHIEGGGWCNNVESCLERKNTRLGSSKQMKDIY-FSAILSNEQQFNPDFYNWNRVKV  120

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP TNL +RG RIF A+ME+  AKGMKN KNAI +G SAGG+  +
Sbjct  121   RYCDGSSFTGDVEEVDPTTNLHFRGARIFSAVMEELLAKGMKNVKNAILSGCSAGGLTTI  180

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+AL P+   VKC+ D+ YF+N E + G    Q  +  +V   GSAK LP  CTS
Sbjct  181   LHCDSFKALLPSGANVKCVPDAGYFVNVEDISGAHSIQEFYSEVVSIHGSAKNLPTSCTS  240

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKY----GLTMPI---VSC-VTYNNCTL  970
             K+  +LCFFPQY   ++ TPIF+  SA+D+ Q++     G   P     SC +  +NC+ 
Sbjct  241   KLNPALCFFPQYVASHISTPIFVVNSAYDRWQIRNIFIPGSADPSNSWHSCKINISNCST  300

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
             +++   Q  + +F   L +     S  +++++C +H  T    +W      + + N T A
Sbjct  301   DQLSKIQGFKSEFERALSEVGDSPSKGMFIDSCYAHCQTELQETWLKSDSPQ-LANTTIA  359

Query  1145  EVFADWYFDRNT  1180
             +   DW++ R++
Sbjct  360   KAVGDWFYGRSS  371



>ref|XP_004300392.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=394

 Score =   316 bits (809),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 160/373 (43%), Positives = 231/373 (62%), Gaps = 13/373 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+ QWL   V LL +L+     + +TL  ++SAV+KGAVCLDGS P Y++DKG G G++
Sbjct  4     ARIGQWLSPLVCLLILLKAESHPVELTL--VQSAVAKGAVCLDGSPPAYHFDKGFGAGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC + + C  R  +  GSSK+M        +L      NP+FYNW+R++V
Sbjct  62    NWLVHIEGGGWCKDVESCVERTKNFRGSSKHMEKTISFSGVLGKKETLNPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ V+PATNL +RG R+F A+++D  AKGM NAKNA+ +G SAGG+A +
Sbjct  122   RYCDGSSFTGDVEAVNPATNLHFRGGRVFLAVIDDLLAKGMMNAKNALLSGCSAGGLASI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             L CD FR+L P  T VKCLAD+ YFIN + + G +  ++ +  +V   GSAK LP  CTS
Sbjct  182   LQCDNFRSLLPAGTNVKCLADAGYFINAKSISGSQQIEAFYSQVVALHGSAKHLPASCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             ++   LCFFPQ  +  ++TPIFL  +A+D  Q+K  L            SC +   NC+ 
Sbjct  242   RLNPGLCFFPQNVVPTLRTPIFLVNAAYDSWQIKNILAPSAADPKGSWKSCKMGIKNCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYA  1144
              +++  Q+ R  FL++L    +  S   ++++C +H    T  +W       V+G  T A
Sbjct  302   AQIQTMQDYRTTFLNVLNGGLTSPSHGAFIDSCYAHCQIGTQETWLAADS-PVVGKTTIA  360

Query  1145  EVFADWYFDRNTS  1183
             +   DWY++R+ S
Sbjct  361   KAVGDWYYNRSPS  373



>emb|CDX78933.1| BnaA01g10000D [Brassica napus]
Length=452

 Score =   318 bits (814),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 163/389 (42%), Positives = 243/389 (62%), Gaps = 18/389 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M    QWL   V  L IL K EG + V +T + +AV++GAVCLDGS P Y+  +G G G+
Sbjct  56    MFNFKQWLVLVVCSLAIL-KAEG-LFVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGI  113

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             ++W+I +EGGGWC N  +C  R  +RLGSSK M        +LS+    NP+FYNW+RV+
Sbjct  114   NSWLIQLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVK  173

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV  V+PATNL +RG R++ A+M++  AKGM+NA+NA+ +G SAGG+A 
Sbjct  174   VRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLAS  233

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             ++HCD FRAL P  T+VKCL+D+ +F+N   + G +  +S F  +V   GSAK LP+ CT
Sbjct  234   LMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGAQYIKSYFKDVVALHGSAKNLPRTCT  293

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L            SC +   NC 
Sbjct  294   SRLTPAMCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCQ  353

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              N++K+ Q+ RL+FLS +      SS  +++++C +H    T  SW+  +   ++   T 
Sbjct  354   PNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTI  412

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             A+   DW +DR     ++ +K + P  C+
Sbjct  413   AKAVGDWVYDR-----KLFQKIDCPYPCN  436



>ref|XP_004509522.1| PREDICTED: uncharacterized protein LOC101493258 isoform X1 [Cicer 
arietinum]
 ref|XP_004509523.1| PREDICTED: uncharacterized protein LOC101493258 isoform X2 [Cicer 
arietinum]
Length=400

 Score =   316 bits (809),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 166/393 (42%), Positives = 233/393 (59%), Gaps = 13/393 (3%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             R+ Q L   +  L +L K EG + V +T ++SAV+KGAVCLDGS P Y++DKG G G+DN
Sbjct  5     RMDQLLSLVICTLLLLLKAEG-VAVPITYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDN  63

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++  EGGGWC N   C  R  +RLGSSK M          S+    NP+FY+W+R++V 
Sbjct  64    WIVHFEGGGWCNNVSTCLDRRDTRLGSSKKMDKQLSFSGFFSNGKKFNPDFYDWNRIKVR  123

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDG+SFT DV+ VDPATNL +RG RIF A++ED  AKGMKNAKNAI +G SAGG+  +L
Sbjct  124   YCDGASFTGDVEAVDPATNLHFRGARIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSIL  183

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
              CD F+ L P   +VKC++D+ YFIN + + G +  +  +  +V + GSAK LP+ CTS+
Sbjct  184   QCDRFKTLLPAAAKVKCVSDAGYFINVKAVSGAQHIEQFYSQVVQTHGSAKNLPQSCTSR  243

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             +   LCFFPQ     +KTPIF   +A+D  Q+K  L   +        +C +  NNC+ N
Sbjct  244   LSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDINNCSPN  303

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             ++   Q  R  FL  +   ++  S  ++++ C +H  T    +W       V+ N T A+
Sbjct  304   QLTTMQGFRTQFLQAISGLSNSPSKGLFIDGCYAHCQTGMQETWMRSDS-PVLANTTIAK  362

Query  1148  VFADWYFDRNT-SPIRVIEKSNKPLNCSTFEQN  1243
                DWY+DR T   I      N   +   F+QN
Sbjct  363   AVGDWYYDRKTFHQIDCPYPCNPTCHNRVFDQN  395



>ref|XP_004300391.1| PREDICTED: protein notum homolog [Fragaria vesca subsp. vesca]
Length=399

 Score =   315 bits (808),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/395 (42%), Positives = 238/395 (60%), Gaps = 21/395 (5%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             RL QWL   V    +L+     + V +T L++AV+KGAVCLDGS P Y++DKG G G++N
Sbjct  5     RLGQWLNLLVCSALLLKAT--GVPVGITILQTAVAKGAVCLDGSPPAYHWDKGFGSGLNN  62

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++ IEGGGWC N  +C  R  +RLGSSK M        +LS+  + NP FYNW+R++V 
Sbjct  63    WLVHIEGGGWCHNVTNCLGRKNTRLGSSKKMLKEIPFSGILSNRQSLNPGFYNWNRIKVR  122

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV  VDPAT L +RG R+F A+M D  AKGM  A NA+ +G SAGG+  +L
Sbjct  123   YCDGSSFTGDVAAVDPATGLYFRGARVFRAVMADLLAKGMGKAVNAVLSGCSAGGLTSIL  182

Query  638   HCDYFRALF-PNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             HCD FRALF P+ T+VKC++D+ YFIN + + G +  Q  F  +V + GSAK LP  CTS
Sbjct  183   HCDNFRALFLPSGTKVKCVSDAGYFINVKDISGAQHVQEYFTDIVTTHGSAKNLPPSCTS  242

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS--------C-VTYNNCT  967
             K++  LCFFPQY +  ++TPIF   +A+D  Q+K  + +P V+        C +   NC+
Sbjct  243   KLRPDLCFFPQYVVPQIRTPIFYVNAAYDSWQIK-NIVVPGVADPHGTWRNCKLDIKNCS  301

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTY  1141
               ++K  Q  RL FLS +   ++ +   +++++C  H  T    +W  P    ++   T 
Sbjct  302   PTQLKTMQNFRLQFLSAIGGVSNSAVKGMFIDSCYLHCQTELQETWSMPNS-PLLNKTTI  360

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNP  1246
             A    DW++DR +      +K + P  C+     P
Sbjct  361   ARAVGDWFYDRTS-----FQKIDCPYPCNPTCHAP  390



>ref|XP_002865253.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41512.1| pectin acetylesterase [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/399 (40%), Positives = 238/399 (60%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             MARL Q W  F V+ + ++    G   V +T LESAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MARLKQLWSSFLVLAVVVI----GARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
              +NW++ +EGGGWC +   C  R  +  GSSK M   F    +L    + NP+FYNW+R+
Sbjct  57    ANNWIVHMEGGGWCTDIATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT D++ VDP   L +RG R++ A+++D  AKGM NA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+++ P T +VKC++D+ YFI+ + + G    QS +  +V + GSAK LP  C
Sbjct  177   AILHCDQFKSILPKTAKVKCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPVSC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS MK  LCFFPQY  Q ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSSMKPELCFFPQYVAQTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             T  +++  Q  R   L+ L    S+++  +++++C +H    +  +W G      + N  
Sbjct  297   TAAQLQTVQGYRDQVLAALAPVRSDTTSGLFLDSCHAHCQGGSAATWSGDGG-PTVANTK  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              A+   DW+F+R+T          + ++CS+   NP  P
Sbjct  356   MAKAVGDWFFERSTF---------QNIDCSSLNCNPTCP  385



>gb|KCW72720.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=420

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/369 (43%), Positives = 237/369 (64%), Gaps = 11/369 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL  WL + V+ + IL K E   NV++T +++AV+KGAVCLDGS P Y+++KG G G +
Sbjct  13    ARLRTWL-WVVLSIQILLKSEAT-NVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGAN  70

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++  EGGGWC N   C  R  +RLGSSK M        +LS++ + NP+FYNW+R++V
Sbjct  71    NWLVQFEGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKV  130

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ VDPAT L +RG R F A++ED  +KGM +A+NAI +G SAGG+  +
Sbjct  131   RYCDGASFTGDVEAVDPATKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSI  190

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRAL P +  VKC+AD+ YFIN + + G +  ++ +  +V + GSAK LP  CTS
Sbjct  191   LHCDRFRALMPTSATVKCVADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTS  250

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             +++  LCFFPQ  ++ ++TP+F+  +A+D  Q+K  L   +        SC +  NNC+L
Sbjct  251   RLRPGLCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSL  310

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAE  1147
             ++++I Q+ R  FL  L +  +  S  I++++C +H +      +      V+   + A+
Sbjct  311   DQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSIAK  370

Query  1148  VFADWYFDR  1174
                DWY+DR
Sbjct  371   AVGDWYYDR  379



>gb|ACJ85294.1| unknown [Medicago truncatula]
 gb|AFK37076.1| unknown [Medicago truncatula]
Length=393

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 219/371 (59%), Gaps = 12/371 (3%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             R+ Q     +  L +L+  EG + V +T ++SAV+KGAVCLDGS P Y++DKG   G+DN
Sbjct  5     RMDQLFSLVICTLLLLKATEG-VTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDN  63

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++  EGGGWC NA  C  R  +RLG SK M          S     NP+FYNW+R++V 
Sbjct  64    WIVHFEGGGWCNNATTCLDRIDTRLGPSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVR  123

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VDP TNL YRG RIF A++ED  AKGMKNAKNAI +G SAGG+  +L
Sbjct  124   YCDGSSFTGDVEAVDPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSIL  183

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
              CD FR L P   +VKC++D+ YFIN + + G    +  +  +V + GSAK LP  CTS+
Sbjct  184   QCDRFRTLLPAAAKVKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSR  243

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTL-------N  973
             +   LCFFPQ     +KTPIF   +A+D  Q+K  L   +     T+ NC L       N
Sbjct  244   LSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSAN  303

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             ++   Q  R +FL  +   ++  S  ++++ C SH  T    +W       V+   T A+
Sbjct  304   QLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHRQTGMQETWM-RTDFPVLAKTTIAK  362

Query  1148  VFADWYFDRNT  1180
                DWY+DR+T
Sbjct  363   AVGDWYYDRST  373



>ref|XP_004244443.1| PREDICTED: uncharacterized protein LOC101251798 [Solanum lycopersicum]
Length=392

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 223/366 (61%), Gaps = 12/366 (3%)
 Frame = +2

Query  107   QWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVI  286
             Q L   +  L I+   EG   V +T L+SAV+KGAVCLDGS P Y++DKG G GV+NW I
Sbjct  7     QLLLRAIFTLLIVLISEGH-PVEITYLQSAVAKGAVCLDGSPPAYHFDKGFGAGVNNWFI  65

Query  287   FIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCD  466
              +EGG WC NA  C  R  +RLGSSK M        +LS+    NP+FYNW+R+R+ YCD
Sbjct  66    QLEGGAWCNNATTCLERTKTRLGSSKLMVKTVSFSGILSNKAKFNPDFYNWNRIRIRYCD  125

Query  467   GSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCD  646
             GSSFT DV   DP T + YRG RIF A+M+DF AKGMKNA+NAI AG SAG +A +LHCD
Sbjct  126   GSSFTGDVAAADPRTKVFYRGARIFSAVMDDFLAKGMKNAQNAILAGCSAGSLAAILHCD  185

Query  647   YFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKA  826
              F+ L P+  +VKCL+D+ +FIN + + G    +  +  +V++ GSAK LP+ CTS++K 
Sbjct  186   RFKGLLPSGAKVKCLSDAGFFINTQTISGTSHIEKFYSEVVNTHGSAKNLPQSCTSRLKP  245

Query  827   SLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN-------EMK  982
              LCFFPQ   Q ++TP+FL  +A+D  Q+K  L   +     T+ NC L+       +++
Sbjct  246   GLCFFPQNVAQQIQTPLFLVNAAYDSWQIKNILAPGVADPHGTWRNCKLDILKCSSAQLQ  305

Query  983   IAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFA  1156
               Q  R +FL  L      S+   ++N+C +H    T  +W       V+   T A+   
Sbjct  306   TMQAFRSEFLKALNSLGPSSTRGYYINSCYAHCQTGTQETWLRDDS-PVLSGTTIAKAVG  364

Query  1157  DWYFDR  1174
             DWY++R
Sbjct  365   DWYYER  370



>gb|KEH20327.1| pectinacetylesterase family protein [Medicago truncatula]
Length=393

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/371 (44%), Positives = 220/371 (59%), Gaps = 12/371 (3%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             R+ Q     +  L +L+  EG + V +T ++SAV+KGAVCLDGS P Y++DKG   G+DN
Sbjct  5     RMDQLFSLVICTLLLLKAAEG-VTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDN  63

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++  EGGGWC NA  C  R  +RLGSSK M          S     NP+FYNW+R++V 
Sbjct  64    WIVHFEGGGWCNNATTCLDRIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVR  123

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VDP TNL YRG RIF A++ED  AKGMKNAKNAI +G SAGG+  +L
Sbjct  124   YCDGSSFTGDVEAVDPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSIL  183

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
              CD FR L P   +VKC++D+ YFIN + + G    +  +  +V + GSAK LP  CTS+
Sbjct  184   QCDRFRTLLPAAAKVKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSR  243

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTL-------N  973
             +   LCFFPQ     +KTPIF   +A+D  Q+K  L   +     T+ NC L       N
Sbjct  244   LSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSAN  303

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             ++   Q  R +FL  +   ++  S  ++++ C SH  T    +W       V+   T A+
Sbjct  304   QLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHCQTGMQETWMRTDS-PVLAKTTIAK  362

Query  1148  VFADWYFDRNT  1180
                DWY+DR+T
Sbjct  363   AVGDWYYDRST  373



>ref|XP_003628995.1| Notum-like protein [Medicago truncatula]
Length=396

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/371 (44%), Positives = 220/371 (59%), Gaps = 12/371 (3%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             R+ Q     +  L +L+  EG + V +T ++SAV+KGAVCLDGS P Y++DKG   G+DN
Sbjct  8     RMDQLFSLVICTLLLLKAAEG-VTVPITFVQSAVAKGAVCLDGSPPAYHFDKGFEAGIDN  66

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++  EGGGWC NA  C  R  +RLGSSK M          S     NP+FYNW+R++V 
Sbjct  67    WIVHFEGGGWCNNATTCLDRIDTRLGSSKKMDKTLSFSGFFSSGKKFNPDFYNWNRIKVR  126

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VDP TNL YRG RIF A++ED  AKGMKNAKNAI +G SAGG+  +L
Sbjct  127   YCDGSSFTGDVEAVDPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSIL  186

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
              CD FR L P   +VKC++D+ YFIN + + G    +  +  +V + GSAK LP  CTS+
Sbjct  187   QCDRFRTLLPAAAKVKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSAKNLPSSCTSR  246

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTL-------N  973
             +   LCFFPQ     +KTPIF   +A+D  Q+K  L   +     T+ NC L       N
Sbjct  247   LSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIKSCSAN  306

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             ++   Q  R +FL  +   ++  S  ++++ C SH  T    +W       V+   T A+
Sbjct  307   QLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHCQTGMQETWMRTDS-PVLAKTTIAK  365

Query  1148  VFADWYFDRNT  1180
                DWY+DR+T
Sbjct  366   AVGDWYYDRST  376



>ref|XP_007040900.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25401.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=399

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 175/398 (44%), Positives = 244/398 (61%), Gaps = 27/398 (7%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL QWL   V  L IL K EG  +V +T L+SAV+KGAVCLDGS P Y++D G G GV+
Sbjct  4     ARLGQWLSLLVCCLLILLKAEGG-SVGITYLQSAVAKGAVCLDGSPPAYHFDPGSGAGVN  62

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC + + C  R  + LGSS+ M   F    LLS     NP+FYNW+R++V
Sbjct  63    NWLVHMEGGGWCEDVERCLSRRNTDLGSSEQMVKQFGFSGLLSSQQKSNPDFYNWNRIKV  122

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+   P  NL +RG RI++A++ED  AKGM+NAKNAI +G SAGG+A +
Sbjct  123   RYCDGSSFTGDVEA--PVNNLFFRGNRIWEAIIEDLLAKGMRNAKNAILSGCSAGGLASI  180

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRAL P  T+VKC++D+ +FI+ + + G +  ++ +  +    GS K LP  CTS
Sbjct  181   LHCDRFRALLPAATKVKCISDAGFFIHAKDVSGGQHIENFYSQVAKLHGSVKSLPASCTS  240

Query  815   K--MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             +  MK  LCFFPQY +Q ++TPIF   +A+D  Q+K  L            SC +    C
Sbjct  241   RMSMKPELCFFPQYVVQTMQTPIFFINAAYDSWQIKNILAPTAADSGKAWKSCKLDLKKC  300

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-----EFTYHSWYGPKKLRVIG  1129
             T  ++KI Q+ R  FLS L    + SS  +++++C +H     + T+ S   P     +G
Sbjct  301   TPGQLKIIQDFRAQFLSALTGAGNSSSRGMFIDSCYAHCQAGKQITWSSNNSP----AVG  356

Query  1130  NKTYAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
             N   A+   DWY++R  SP++ I+    P  C+   QN
Sbjct  357   NTKIAKAVGDWYYER--SPVQKID---CPYPCNPTCQN  389



>ref|NP_193677.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AAT70429.1| At4g19420 [Arabidopsis thaliana]
 gb|AAU45212.1| At4g19420 [Arabidopsis thaliana]
 gb|AEE84180.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=397

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/389 (41%), Positives = 246/389 (63%), Gaps = 18/389 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M +L QWL + V  L I+   EG + V +T + +AV+KGAVCLDGS P Y+ D+G G G+
Sbjct  1     MFKLKQWLIYLVCSLVIM-NTEG-LFVNITFVRNAVAKGAVCLDGSPPAYHLDRGSGTGI  58

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             ++W+I +EGGGWC N  +C  R  +RLGSSK M        +LS+    NP+FYNW+RV+
Sbjct  59    NSWLIQLEGGGWCNNVTNCVSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVK  118

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDG+SFT DV+ V+PATNL +RG R++ A+M++  AKGM NA+NA+ +G SAGG+A 
Sbjct  119   VRYCDGASFTGDVEAVNPATNLHFRGARVWLAVMQELLAKGMINAENAVLSGCSAGGLAS  178

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             ++HCD FRAL P  T+VKCL+D+ +F+N   + G +  ++ F+ +V   GSAK LP+ CT
Sbjct  179   LMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGVQYIKTYFEDVVTLHGSAKNLPRSCT  238

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L            SC +   NC 
Sbjct  239   SRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCH  298

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              +++K+ Q+ RL+FLS +      SS  +++++C +H    T  SW+  +   ++   T 
Sbjct  299   PSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTI  357

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             A+   DW +DR      + +K + P  C+
Sbjct  358   AKAVGDWVYDRT-----LFQKIDCPYPCN  381



>ref|XP_006363875.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=402

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/377 (45%), Positives = 235/377 (62%), Gaps = 15/377 (4%)
 Frame = +2

Query  101   LSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNW  280
             + QW+  FV L +I+ + EG + V +T + S V+KGAVCLDGS P Y++DKG G GV++W
Sbjct  6     VQQWIYSFVTL-SIVFRTEG-LFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTGVNSW  63

Query  281   VIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAY  460
             +I +EGGGWC N   C  R  +RLGSSK M        +LS+ P  NP+FYNW+RV+V Y
Sbjct  64    LIQMEGGGWCNNISTCLSRKNTRLGSSKQMVENLAFSGILSNLPQFNPDFYNWNRVKVGY  123

Query  461   CDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLH  640
             CDGSSFT DV  V+P TNL +RG R+F A+MED  AKGMKNA+NAI +G SAGG+  +LH
Sbjct  124   CDGSSFTGDVQAVNPITNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGGLTSILH  183

Query  641   CDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKM  820
             CD F+AL P   +VKC +D+ YFI+ + + G    +  F  +V   GSAK LP  CTS++
Sbjct  184   CDSFKALLPMGAKVKCFSDAGYFIDAKDISGAPHIEEYFRDVVSLHGSAKNLPPVCTSRL  243

Query  821   KASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPI-------VSC-VTYNNCTLNE  976
             K  LCFFPQ   Q+V+TP+FL  +A+D  Q+K  L   +       ++C +    C+  +
Sbjct  244   KPDLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPGVADPYGFWLNCKLDILKCSSRQ  303

Query  977   MKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAEV  1150
             ++I    RL FL  L      SS   ++N+C +H  T    +WY     + + NKT A+ 
Sbjct  304   LQIMHGYRLLFLRALNALGPSSSRGYFINSCFAHCQTEVQETWYRADSPK-LANKTIAKA  362

Query  1151  FADWYFDRNTSPIRVIE  1201
               DW++D+N  P + I+
Sbjct  363   LGDWFYDKN--PFQKID  377



>emb|CDX99377.1| BnaC01g11750D [Brassica napus]
Length=452

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/389 (42%), Positives = 243/389 (62%), Gaps = 18/389 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M    QW+   V  L IL K EG + V +T + +AV++GAVCLDGS P Y+  +G G G+
Sbjct  56    MFNFKQWVILVVCSLAIL-KAEG-LFVNITFVRNAVARGAVCLDGSPPAYHLHRGSGTGI  113

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             ++W+I +EGGGWC N  +C  R  +RLGSSK M        +LS+    NP+FYNW+RV+
Sbjct  114   NSWLIQLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVK  173

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV  V+PATNL +RG R++ A+M++  AKGM+NA+NA+ +G SAGG+A 
Sbjct  174   VRYCDGSSFTGDVQAVNPATNLHFRGARVWLAVMQELLAKGMRNAENAVLSGCSAGGLAS  233

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             ++HCD FRAL P  T+VKCL+D+ +F+N   + G +  +S F  +V   GSAK LP+ CT
Sbjct  234   LMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGAQYIKSYFKDVVALHGSAKNLPRTCT  293

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L            SC +   NC 
Sbjct  294   SRLTPAMCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCQ  353

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              N++K+ Q+ RL+FLS +      SS  +++++C +H    T  SW+  +   ++   T 
Sbjct  354   PNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTI  412

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             A+   DW +DR     ++ +K + P  C+
Sbjct  413   AKAVGDWVYDR-----KLFQKIDCPYPCN  436



>ref|XP_006280604.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
 gb|EOA13502.1| hypothetical protein CARUB_v10026563mg [Capsella rubella]
Length=391

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/399 (40%), Positives = 239/399 (60%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T LESAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MVRLKQLWSSLLVLAVVVI----GARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDIATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT D++ VDP   L +RG R++ A+++D  AKGM NA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+++ P T +VKC++D+ YFI+ + + G    QS +  +V + GSAK LP  C
Sbjct  177   AILHCDQFKSILPKTAKVKCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS MK  LCFFPQY  + ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSTMKPELCFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             T ++++  Q  R   L+ L    ++++  +++++C +H    +  +W G K    + N  
Sbjct  297   TASQLQTVQGYRDQVLAALAPVRADTTSGLFLDSCHAHCQGGSAATWSGDKG-PTVANTK  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              A+   DW+F+R+T          + ++CS+   NP  P
Sbjct  356   MAKAVGDWFFERSTF---------QNIDCSSLNCNPTCP  385



>ref|XP_010449357.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/389 (42%), Positives = 242/389 (62%), Gaps = 18/389 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M    QWL   V  L I+ K EG + V +T + +AV+KGAVCLDGS P Y+  +G G GV
Sbjct  1     MFNFKQWLVLLVCSLVIM-KTEG-LFVNITYVRNAVAKGAVCLDGSPPAYHLHRGSGTGV  58

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             ++W+I +EGGGWC N  +C  R  +RLGSSK M        +LS+    NP+FYNW+RV+
Sbjct  59    NSWLIQLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVK  118

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV  V+PATNL +RG RI+ A+M++  AKGM+NA+NA+ +G SAGG+A 
Sbjct  119   VRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLAKGMRNAENAVLSGCSAGGLAS  178

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             ++HCD FRAL P  +RVKCL+D+ +F+N   + G +  +  F  +V   GSAK LP+ CT
Sbjct  179   LMHCDSFRALLPMGSRVKCLSDAGFFLNTRDVSGVQYIKQYFQDVVTLHGSAKNLPRSCT  238

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L            SC +   NC 
Sbjct  239   SRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCH  298

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              +++K+ Q+ RL+FLS +      SS  +++++C +H    T  SW+  +   ++   T 
Sbjct  299   PSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTI  357

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             A+   DW +DR     ++ +K + P  C+
Sbjct  358   AKAVGDWVYDR-----KLFQKIDCPYPCN  381



>ref|XP_010056132.1| PREDICTED: protein notum homolog isoform X3 [Eucalyptus grandis]
 gb|KCW72716.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72717.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=439

 Score =   316 bits (809),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/369 (43%), Positives = 237/369 (64%), Gaps = 11/369 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL  WL + V+ + IL K E   NV++T +++AV+KGAVCLDGS P Y+++KG G G +
Sbjct  4     ARLRTWL-WVVLSIQILLKSEA-TNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGAN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++  EGGGWC N   C  R  +RLGSSK M        +LS++ + NP+FYNW+R++V
Sbjct  62    NWLVQFEGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ VDPAT L +RG R F A++ED  +KGM +A+NAI +G SAGG+  +
Sbjct  122   RYCDGASFTGDVEAVDPATKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRAL P +  VKC+AD+ YFIN + + G +  ++ +  +V + GSAK LP  CTS
Sbjct  182   LHCDRFRALMPTSATVKCVADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             +++  LCFFPQ  ++ ++TP+F+  +A+D  Q+K  L   +        SC +  NNC+L
Sbjct  242   RLRPGLCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSL  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAE  1147
             ++++I Q+ R  FL  L +  +  S  I++++C +H +      +      V+   + A+
Sbjct  302   DQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSIAK  361

Query  1148  VFADWYFDR  1174
                DWY+DR
Sbjct  362   AVGDWYYDR  370



>ref|XP_010434420.1| PREDICTED: protein notum homolog [Camelina sativa]
 ref|XP_010434421.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/389 (42%), Positives = 242/389 (62%), Gaps = 18/389 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M    QWL   V  L ++ K EG + V +T + +AV+KGAVCLDGS P Y+ D+G G G+
Sbjct  1     MFNFKQWLVLLVCSL-VMMKTEG-LFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGI  58

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             ++W+I +EGGGWC N  +C  R  +RLGSSK M        +LS+    NP+FYNW+RV+
Sbjct  59    NSWLIQLEGGGWCNNVTNCLSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVK  118

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV  V+PATNL +RG RI+ A+M++  AKGM+NA+NA+ +G SAGG+A 
Sbjct  119   VRYCDGSSFTGDVQAVNPATNLHFRGARIWLAVMQELLAKGMRNAENAVLSGCSAGGLAS  178

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             ++HCD FRAL P  +RVKCL+D+ +F+N   + G +  +  F  +V   GSAK LP+ CT
Sbjct  179   LMHCDSFRALLPMGSRVKCLSDAGFFLNTRDVSGVQYIKQYFQDVVTLHGSAKNLPRSCT  238

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L            SC +   NC 
Sbjct  239   SRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCH  298

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              +++K+ Q+ RL+FLS +      SS  +++++C +H    T  SW+  +   ++   T 
Sbjct  299   PSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTI  357

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
             A+   DW +DR      + +K + P  C+
Sbjct  358   AKAVGDWVYDRT-----LFQKIDCPYPCN  381



>ref|XP_010056129.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
 ref|XP_010056130.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
Length=445

 Score =   316 bits (809),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/369 (43%), Positives = 237/369 (64%), Gaps = 11/369 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL  WL + V+ + IL K E   NV++T +++AV+KGAVCLDGS P Y+++KG G G +
Sbjct  10    ARLRTWL-WVVLSIQILLKSEA-TNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGAN  67

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++  EGGGWC N   C  R  +RLGSSK M        +LS++ + NP+FYNW+R++V
Sbjct  68    NWLVQFEGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKV  127

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ VDPAT L +RG R F A++ED  +KGM +A+NAI +G SAGG+  +
Sbjct  128   RYCDGASFTGDVEAVDPATKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSI  187

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRAL P +  VKC+AD+ YFIN + + G +  ++ +  +V + GSAK LP  CTS
Sbjct  188   LHCDRFRALMPTSATVKCVADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTS  247

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             +++  LCFFPQ  ++ ++TP+F+  +A+D  Q+K  L   +        SC +  NNC+L
Sbjct  248   RLRPGLCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSL  307

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAE  1147
             ++++I Q+ R  FL  L +  +  S  I++++C +H +      +      V+   + A+
Sbjct  308   DQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSIAK  367

Query  1148  VFADWYFDR  1174
                DWY+DR
Sbjct  368   AVGDWYYDR  376



>ref|XP_009794297.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=402

 Score =   314 bits (805),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 166/373 (45%), Positives = 228/373 (61%), Gaps = 13/373 (3%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             +   + QW+   + +  I R  EG + V +T L S V+K AVCLDGS P Y++DKG G G
Sbjct  2     VNGSVRQWIYSLLTMSMIFRN-EG-LFVNITYLLSGVAKEAVCLDGSPPAYHHDKGFGTG  59

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V++W+I +EGGGWC N   C  R  +RLGSSK M        +LS+ P  NP+FYNW+RV
Sbjct  60    VNSWLIQMEGGGWCNNVTTCLSRKNTRLGSSKQMVKQLAFSGILSNKPQFNPDFYNWNRV  119

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT DV  V+P TNL +RG R+F A+MED  AKGMKNA+NAI +G SAGG+ 
Sbjct  120   KVRYCDGSSFTGDVQAVNPITNLHFRGARVFLAVMEDLLAKGMKNAENAILSGCSAGGLT  179

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+AL P   +VKC +D+ YFIN + + G    +  F  +V   GSAK LP  C
Sbjct  180   SILHCDSFKALLPMGAKVKCFSDAGYFINVKDISGAPHIEEFFGDVVRLHGSAKNLPPSC  239

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN----  973
             TS++K +LCFFPQ   Q+V+TP+FL  +A+D  Q+K  L   +      + NC L+    
Sbjct  240   TSRLKPNLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPSVADPRGVWRNCKLDILRC  299

Query  974   ---EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKT  1138
                +++  Q  RL FL  L      SS   ++N+C +H  T    +W+     + + NKT
Sbjct  300   SSRQLQTMQGFRLGFLRALYALGPSSSRGYFINSCYAHCQTEVQETWFRADSPK-LANKT  358

Query  1139  YAEVFADWYFDRN  1177
              A+   DW+FD+N
Sbjct  359   IAKALGDWFFDKN  371



>ref|XP_010494620.1| PREDICTED: uncharacterized protein LOC104771742 [Camelina sativa]
Length=391

 Score =   314 bits (804),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 159/399 (40%), Positives = 239/399 (60%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M +L Q W  F V+ + ++    G   V +T LESAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MTKLKQLWSSFLVLAVVVI----GARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDIATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT D++ VDPA  L +RG R++ A+++D  AKGM NA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGDIEAVDPANKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+++ P T +VKC++D+ YFI+ + + G    QS +  +V + GSAK LP  C
Sbjct  177   AILHCDQFKSILPKTAKVKCVSDAGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS MK  LCFFPQY  + ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSTMKPELCFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             T  +++  Q  R   L+ L    + ++  +++++C +H    +  +W G K    + N  
Sbjct  297   TAAQLQTVQGYRDQVLAALAPVRAATTSGLFLDSCHAHCQGGSAATWSGDKG-PTVANTK  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              A+   DW+++R+T          + ++CS+   NP  P
Sbjct  356   MAKAVGDWFYERSTF---------QNIDCSSLNCNPTCP  385



>ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus]
Length=539

 Score =   318 bits (816),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 166/378 (44%), Positives = 236/378 (62%), Gaps = 15/378 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             +   WL FFV  +    K +  INV +T ++ AV KGAVCLDGS P Y++  G G G++N
Sbjct  5     KFGLWL-FFVASVQFFLKAQC-INVGITYVQDAVIKGAVCLDGSPPAYHFSDGFGSGINN  62

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W+I +EGGGWC N   C  R  +RLGSSK M        +LS+ P  NP+FYNW+R++V 
Sbjct  63    WLIQLEGGGWCNNVTTCLQRRDTRLGSSKKMVTQLAFSGILSNKPQFNPDFYNWNRIKVR  122

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VD ATNL +RG R+F A++++  AKGMKNAKNAI +G SAGG++ +L
Sbjct  123   YCDGSSFTGDVEAVDSATNLHFRGARVFRAIIDNLLAKGMKNAKNAILSGCSAGGLSSIL  182

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD F++L P TT+VKCL+D+ YFIN + + G +  +  +  +V + GSAK LP  CTSK
Sbjct  183   HCDNFKSLLPPTTKVKCLSDAGYFINAKDVSGAQHIEGFYSDVVTTHGSAKNLPISCTSK  242

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             MK  +CFFPQ  +Q ++TPIFL  +A+D  Q+K  L   +         C +   NC+  
Sbjct  243   MKPEMCFFPQNVVQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSPI  302

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             +++  Q+ R+ FLS L    S  S  +++++C +H  T    +W       V+   T A+
Sbjct  303   QLRTMQDFRVQFLSALNGVGSSLSRGLFIDSCYAHCQTEMQETWLRTDS-PVLSKTTIAK  361

Query  1148  VFADWYFDRNTSPIRVIE  1201
                DW+FDR  +P + I+
Sbjct  362   AVGDWFFDR--APFQKID  377



>ref|XP_010056131.1| PREDICTED: protein notum homolog isoform X2 [Eucalyptus grandis]
Length=448

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/369 (43%), Positives = 237/369 (64%), Gaps = 11/369 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL  WL + V+ + IL K E   NV++T +++AV+KGAVCLDGS P Y+++KG G G +
Sbjct  13    ARLRTWL-WVVLSIQILLKSEA-TNVSITYVQNAVAKGAVCLDGSPPAYHFNKGLGTGAN  70

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++  EGGGWC N   C  R  +RLGSSK M        +LS++ + NP+FYNW+R++V
Sbjct  71    NWLVQFEGGGWCNNVTTCLARRDTRLGSSKEMVKEVAFSGILSNNHSFNPDFYNWNRIKV  130

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV+ VDPAT L +RG R F A++ED  +KGM +A+NAI +G SAGG+  +
Sbjct  131   RYCDGASFTGDVEAVDPATKLHFRGARAFVAIIEDLLSKGMSDAENAILSGCSAGGLTSI  190

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRAL P +  VKC+AD+ YFIN + + G +  ++ +  +V + GSAK LP  CTS
Sbjct  191   LHCDRFRALMPTSATVKCVADAGYFINAKDISGAQHIETFYSEVVATHGSAKNLPTSCTS  250

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             +++  LCFFPQ  ++ ++TP+F+  +A+D  Q+K  L   +        SC +  NNC+L
Sbjct  251   RLRPGLCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDINNCSL  310

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAE  1147
             ++++I Q+ R  FL  L +  +  S  I++++C +H +      +      V+   + A+
Sbjct  311   DQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIETSIAK  370

Query  1148  VFADWYFDR  1174
                DWY+DR
Sbjct  371   AVGDWYYDR  379



>gb|AAM65412.1| pectin acetylesterase [Arabidopsis thaliana]
Length=391

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 161/399 (40%), Positives = 237/399 (59%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T LESAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MTRLKQMWSSILVLAVVVI----GARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDIATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT D++ VDPA  L +RG R++ A+++D  AKGM NA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGDIEAVDPANKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F++  P T +VKC++D+ YFI+ + + G    QS +  +V + GSAK LP  C
Sbjct  177   AILHCDQFKSTLPKTAKVKCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPASC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS MK  LCFFPQY  + ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSSMKPELCFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             T  +++  Q  R   L+ L    S ++  +++++C +H    +  +W G K    + N  
Sbjct  297   TAAQLQTVQGYRDQVLAALAPVQSATTNGLFLDSCHAHCQGGSAATWSGDKG-PTVANTK  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              A+   DW+F+R+T          + ++CS+   NP  P
Sbjct  356   MAKAVGDWFFERSTF---------QNVDCSSLNCNPTCP  385



>gb|AET03471.2| pectinacetylesterase family protein [Medicago truncatula]
Length=424

 Score =   314 bits (804),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 225/381 (59%), Gaps = 14/381 (4%)
 Frame = +2

Query  74    VI*TYIMA--RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYY  247
             +I T +M   R+ Q     +  L +L+  EG + V +T ++SAV+KGAVCLDGS P Y++
Sbjct  26    IIKTMLMKFIRMDQLFSLVICTLLLLKAAEG-VTVPITFVQSAVAKGAVCLDGSPPAYHF  84

Query  248   DKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPE  427
             DKG   G+DNW++  EGGGWC NA  C  R  +RLGSSK M          S     NP+
Sbjct  85    DKGFEAGIDNWIVHFEGGGWCNNATTCLDRIDTRLGSSKKMDKTLSFSGFFSSGKKFNPD  144

Query  428   FYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAG  607
             FYNW+R++V YCDGSSFT DV+ VDP TNL YRG RIF A++ED  AKGMKNAKNAI +G
Sbjct  145   FYNWNRIKVRYCDGSSFTGDVEAVDPKTNLHYRGGRIFVAVIEDLLAKGMKNAKNAILSG  204

Query  608   NSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSA  787
              SAGG+  +L CD FR L P   +VKC++D+ YFIN + + G    +  +  +V + GSA
Sbjct  205   CSAGGLTSILQCDRFRTLLPAAAKVKCVSDAGYFINVKAVSGASHIEQFYSQVVQTHGSA  264

Query  788   KWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNC  964
             K LP  CTS++   LCFFPQ     +KTPIF   +A+D  Q+K  L   +     T+ NC
Sbjct  265   KNLPSSCTSRLSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNC  324

Query  965   TL-------NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKL  1117
              L       N++   Q  R +FL  +   ++  S  ++++ C SH  T    +W      
Sbjct  325   KLDIKSCSANQLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHCQTGMQETWMRTDS-  383

Query  1118  RVIGNKTYAEVFADWYFDRNT  1180
              V+   T A+   DWY+DR+T
Sbjct  384   PVLAKTTIAKAVGDWYYDRST  404



>ref|XP_006573492.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=400

 Score =   313 bits (802),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 221/345 (64%), Gaps = 11/345 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T +++AV+KGAVCLDGS P Y++DKG G G++NW++  EGGGWC N   C  R  +R
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLARKTNR  86

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +L++    NP+FYNW+R++V YCDGSSFT DV+ V+P T L +RG
Sbjct  87    LGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRG  146

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF+A+MED  AKGMKNA+NAI +G SAGG+  +LHCD FRAL P   RVKCL+D+ YF
Sbjct  147   ARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGARVKCLSDAGYF  206

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN + + G++  +  F  +V + GSA+ LP+ CTS++ A LCFFPQY +  + TPIF   
Sbjct  207   INAKDVLGEQHIEQYFSQVVVTHGSARSLPQSCTSRLSAKLCFFPQYLVSRITTPIFFVN  266

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q+K  L   +        SC +  NNC+ +++ + Q  R +FL  +    + SS
Sbjct  267   AAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNSSS  326

Query  1046  IAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
               +++++C +H  T    +W        +   T A+  ADW+++R
Sbjct  327   KGMFIDSCYAHCQTEMQETWLRSDSPE-LKKTTIAKAVADWFYER  370



>emb|CDY26383.1| BnaA02g23870D [Brassica napus]
Length=391

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/399 (39%), Positives = 240/399 (60%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T LESAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MVRLKQVWSSVMVLAVVVI----GAGAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDIATCVKRKTTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT D++ VDP   L +RG R++ A+++D  AKGM NA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMAKGMNNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+++ P T +VKC++D+ +FI+ + + G    +S +  +V + GSAK LP  C
Sbjct  177   AILHCDQFKSILPTTAKVKCVSDAGFFIHGKDISGGSYIESYYSKVVSTHGSAKSLPASC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS MK  LCFFPQY ++ ++TP+F+  +AFD  Q+K  L    V        C +    C
Sbjct  237   TSSMKPELCFFPQYVVKTMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             T  +++  QE R   L+ L    + ++  +++++C +H    +  +W G +  +V GN  
Sbjct  297   TAAQLQTVQEYRDQMLAALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQV-GNTK  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              A+   DW+++R+T          + ++C +   NP  P
Sbjct  356   MAKAVGDWFYERSTF---------QNIDCPSLNCNPTCP  385



>ref|XP_006432881.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
 gb|ESR46121.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
Length=392

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/383 (43%), Positives = 228/383 (60%), Gaps = 16/383 (4%)
 Frame = +2

Query  89    IMAR--LSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHG  262
             ++AR  + QW    V  L IL K +   NV++T +E AV+KGAVCLDGS P Y++DKG G
Sbjct  1     MIARTTMGQWFNLLVCALLIL-KAQACFNVSITYVEDAVAKGAVCLDGSPPAYHFDKGFG  59

Query  263   EGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWH  442
              G++NW++ I+GG WC N   C  R  S  GSSKYM        +LS+    NP+FY+W+
Sbjct  60    AGINNWLVHIDGGAWCNNVADCSNRRDSSHGSSKYMVKEANFTGILSNEQKFNPDFYDWN  119

Query  443   RVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGG  622
             RV+V YCDG+SFT DV+ V+P TNL +RG R+F+A+MED  AKGMKNA+NAI  G SAGG
Sbjct  120   RVKVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLAKGMKNAQNAILTGCSAGG  179

Query  623   VAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPK  802
             +  +LHCD FRALFP  TRVKC AD+ YF+N + + G    +  +  +V   GSAK LP 
Sbjct  180   LTSILHCDNFRALFPVNTRVKCFADAGYFVNVKDVSGASHIEEFYKQVVALHGSAKHLPA  239

Query  803   ECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS-------CVT-YN  958
              CTS++   LCFFPQ     VKTP+F+  SA+D  Q++  L             C     
Sbjct  240   SCTSRLSPGLCFFPQNVAGQVKTPLFIINSAYDSWQIRNILVPDNADPKGTWRRCKKDIK  299

Query  959   NCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTY--HSWYGPKKLRVIGN  1132
              C+  +++  Q  R+ FL+ L    + SS  + +++C +H  T    +W       V+  
Sbjct  300   TCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMLIDSCYTHCRTVFQEAWLSADS-PVLDK  358

Query  1133  KTYAEVFADWYFDRNTSPIRVIE  1201
                A+   DWY+DRN  P + I+
Sbjct  359   TPIAKAVGDWYYDRN--PFQKID  379



>gb|KHN41756.1| Protein notum like [Glycine soja]
Length=449

 Score =   314 bits (804),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 221/345 (64%), Gaps = 11/345 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T +++AV+KGAVCLDGS P Y++DKG G G++NW++  EGGGWC N   C  R  +R
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLARKTNR  86

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +L++    NP+FYNW+R++V YCDGSSFT DV+ V+P T L +RG
Sbjct  87    LGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRG  146

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF+A+MED  AKGMKNA+NAI +G SAGG+  +LHCD FRAL P   RVKCL+D+ YF
Sbjct  147   ARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGARVKCLSDAGYF  206

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN + + G++  +  F  +V + GSA+ LP+ CTS++ A LCFFPQY +  + TPIF   
Sbjct  207   INAKDVLGEQHIEQYFSQVVVTHGSARSLPQSCTSRLSAKLCFFPQYLVSRITTPIFFVN  266

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q+K  L   +        SC +  NNC+ +++ + Q  R +FL  +    + SS
Sbjct  267   AAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNSSS  326

Query  1046  IAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
               +++++C +H  T    +W        +   T A+  ADW+++R
Sbjct  327   KGMFIDSCYAHCQTEMQETWLRSDSPE-LKKTTIAKAVADWFYER  370



>ref|XP_006573491.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=447

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 221/345 (64%), Gaps = 11/345 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T +++AV+KGAVCLDGS P Y++DKG G G++NW++  EGGGWC N   C  R  +R
Sbjct  27    VPITIVQNAVAKGAVCLDGSPPAYHFDKGFGSGINNWLVAFEGGGWCNNVTTCLARKTNR  86

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +L++    NP+FYNW+R++V YCDGSSFT DV+ V+P T L +RG
Sbjct  87    LGSSKQMAKQIAFSGILNNRAMFNPDFYNWNRIKVRYCDGSSFTGDVEAVNPVTKLHFRG  146

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF+A+MED  AKGMKNA+NAI +G SAGG+  +LHCD FRAL P   RVKCL+D+ YF
Sbjct  147   ARIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSVLHCDRFRALLPRGARVKCLSDAGYF  206

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN + + G++  +  F  +V + GSA+ LP+ CTS++ A LCFFPQY +  + TPIF   
Sbjct  207   INAKDVLGEQHIEQYFSQVVVTHGSARSLPQSCTSRLSAKLCFFPQYLVSRITTPIFFVN  266

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q+K  L   +        SC +  NNC+ +++ + Q  R +FL  +    + SS
Sbjct  267   AAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSPDQLDLMQGFRTEFLRAITVLGNSSS  326

Query  1046  IAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
               +++++C +H  T    +W        +   T A+  ADW+++R
Sbjct  327   KGMFIDSCYAHCQTEMQETWLRSDSPE-LKKTTIAKAVADWFYER  370



>gb|KDO40416.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
 gb|KDO40417.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=324

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 204/310 (66%), Gaps = 10/310 (3%)
 Frame = +2

Query  89   IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
            + AR+ QWL   V  L IL K +G  NV +T +E+AV KGAVCLDGS P Y++DKG G G
Sbjct  2    VAARMGQWLNLLVCAL-ILLKADG-FNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAG  59

Query  269  VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
            ++NW++ IEGGGWC N   C  R  +RLGSSK M  V     +LS+    NP+FYNW+R+
Sbjct  60   INNWLVHIEGGGWCNNVTTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRI  119

Query  449  RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
            +V YCDG+SFT DV+ V+PA NL +RG R+F A+MED  AKGMKNA+NA+ +G SAGG+ 
Sbjct  120  KVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMAKGMKNAQNAVLSGCSAGGLT  179

Query  629  VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
             +LHCD FRALFP  T+VKC AD+ YFIN + + G    +  +  +V + GSAK LP  C
Sbjct  180  SILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGASHIEQFYAQVVATHGSAKHLPASC  239

Query  809  TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
            TS++   LCFFPQY  + + TP+F+  +A+D  Q+K  L   +        SC +  NNC
Sbjct  240  TSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDINNC  299

Query  965  TLNEMKIAQE  994
            +  +++  Q 
Sbjct  300  SPTQLQTMQS  309



>ref|XP_006587657.1| PREDICTED: protein notum homolog isoform X3 [Glycine max]
 gb|KHN11801.1| Protein notum like [Glycine soja]
Length=400

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/370 (43%), Positives = 234/370 (63%), Gaps = 13/370 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+SQWL   +++  +L  I     V +T +++AV+KGAVCLDGS P Y++D+G G G++
Sbjct  4     ARISQWL--ILLVCALLLLISEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++  EGGGWC N   C  R  +RLGSSK M  +     +L++    NP+FYNW+R++V
Sbjct  62    NWLVAFEGGGWCNNVTTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ V+P T L +RG RIF+A+MED  AKGMKNA+NAI +G SAGG+  +
Sbjct  122   RYCDGSSFTGDVEAVNPVTKLHFRGGRIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSV  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRAL P   RVKCL+D+ YFIN + + G++  +  F  +V + GSA+ LP+ CTS
Sbjct  182   LHCDRFRALLPRGARVKCLSDAGYFINGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             ++   LCFFPQY +  + TPIF   +A+D  Q+K  L   +        SC +  NNC+ 
Sbjct  242   RLSPRLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
             +++ + Q  R +FL  +    + SS  +++++C +H  T    +W        +   T A
Sbjct  302   DQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPE-LKKTTIA  360

Query  1145  EVFADWYFDR  1174
             +  ADW+++R
Sbjct  361   KAVADWFYER  370



>ref|XP_010536220.1| PREDICTED: protein notum homolog isoform X1 [Tarenaya hassleriana]
Length=399

 Score =   311 bits (797),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 229/368 (62%), Gaps = 16/368 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T ++ AV+KGAVCLDGS P Y+ D+G G G++NW+I +EGGGWC N  +C  R  + 
Sbjct  27    VDITYVQKAVAKGAVCLDGSPPAYHLDRGSGTGINNWLIQLEGGGWCNNVTNCVARMRTH  86

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +LS+    NP+FYNW+RV++ YCDGSSFT DV  VDP TNL +RG
Sbjct  87    LGSSKQMAKQIAFSAILSNRRQYNPDFYNWNRVKIRYCDGSSFTGDVQTVDPDTNLHFRG  146

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              R++ A+MED  AKGM+NA+NA+ +G SAGG+A MLHCD FRAL P  ++VKC++D+ +F
Sbjct  147   GRVWLAVMEDLLAKGMRNAENAVLSGCSAGGLASMLHCDSFRALLPMGSKVKCISDAGFF  206

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             +N   + G +  +  F  +V   GSAK LP  CTS++  +LCFFPQY  Q+++TP+F+  
Sbjct  207   VNTRDVSGAEYIREYFKDVVTLHGSAKNLPLSCTSRLNPALCFFPQYVAQHIRTPLFVLN  266

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q+K  L            SC +   NC  N++K+ Q+ RL+FLS +      SS
Sbjct  267   AAYDSWQIKNILAPRAADPNGKWQSCQLDIKNCQPNQLKVMQDFRLEFLSAVIGLGKSSS  326

Query  1046  IAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               +++++C +H  T    SW+ P   R +   T A+   DW +DR      + +K + P 
Sbjct  327   RGMFIDSCYAHCQTESQTSWFWPDSPR-LDRVTIAKAVGDWVYDRT-----LFQKIDCPY  380

Query  1220  NCSTFEQN  1243
              C+    N
Sbjct  381   PCNPTCHN  388



>ref|XP_002519912.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42516.1| pectin acetylesterase, putative [Ricinus communis]
Length=452

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 234/374 (63%), Gaps = 14/374 (4%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             ++R  QW C+F+V + +L KIEG  ++ +T +E+A ++GAVCLDGS P Y+YDKG+G G 
Sbjct  61    LSRFGQW-CYFLVYMLLLLKIEGA-SIPITIVETAKARGAVCLDGSPPAYHYDKGYGTGA  118

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++ +EGGGWC + + C  R  +  GSS  M        +L    + NP+FYNW+R++
Sbjct  119   NNWIVHMEGGGWCDDLESCSQRKDTYKGSSLKMEKTMGFSGILGGKQSANPDFYNWNRIK  178

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             + YCDGSSFT DV+ VD  TNL +RG RI+ A+++D  AKGM+NA+NAI +G SAGG+A 
Sbjct  179   IKYCDGSSFTGDVEVVDAKTNLHFRGERIWQAVIDDLLAKGMRNAQNAILSGCSAGGLAA  238

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +LHCD FR+L P + RVKC++D+ +FI+ + + G +  ++ F  +V   GSAK LP  CT
Sbjct  239   ILHCDKFRSLLPASARVKCVSDAGFFIHGKDVAGGRHIENFFGSVVRLHGSAKSLPASCT  298

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             +KM+  LCFFPQY  Q ++TP+FL  SA+D  Q+K  L    V       SC +    C+
Sbjct  299   AKMRPELCFFPQYVAQTMRTPLFLINSAYDSWQIKNVLAPSAVDKKGSWKSCKLDLKKCS  358

Query  968   LNEMKIAQELRLDFLSLLPKK-NSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
               +++  Q+ R  F+  L     ++ +   ++N+C +H    +  +W   K   V+ N  
Sbjct  359   AAQLQTVQDFRTQFIGALSGGVTNKPANGYFINSCYAHCQSGSLATWLADKS-PVVSNTK  417

Query  1139  YAEVFADWYFDRNT  1180
               +   DW++DR T
Sbjct  418   IGKAVGDWFYDRAT  431



>ref|XP_010676220.1| PREDICTED: uncharacterized protein LOC104892094 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   312 bits (800),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 234/372 (63%), Gaps = 21/372 (6%)
 Frame = +2

Query  101   LSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNW  280
             + QW+   +V + + +K EG + V +T + SAV+KGAVCLDGSAP Y+  +GHG G+++W
Sbjct  6     IQQWM-KLLVFMVVFQKSEG-LYVGITKVRSAVAKGAVCLDGSAPAYHLHRGHGTGINSW  63

Query  281   VIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAY  460
             ++ +EGGGWC N   C  R  S LGSS  M        +LS++P  NP+FYNW+RV++ Y
Sbjct  64    LVHVEGGGWCNNITTCLERKYSHLGSSWKMDKQLAFSGILSNNPMFNPDFYNWNRVKIRY  123

Query  461   CDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLH  640
             CDG+SFT +V+ V+P T L +RG RI+ A++ED   KGM+NAKNAI +G SAGG+  +LH
Sbjct  124   CDGASFTGNVEAVNPITKLHFRGARIWHAVIEDLLLKGMRNAKNAILSGCSAGGLTSILH  183

Query  641   CDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKM  820
             CD FRAL P   RVKCL+D+ YFIN + + G     S F+ +V+  GSAK LP  CT  +
Sbjct  184   CDSFRALLPVGARVKCLSDAGYFINVKDVSGASHVASYFNQIVNLHGSAKSLPASCTRSL  243

Query  821   KASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS--------C-VTYNNCTLN  973
             K  +CFFPQY  +  +TP+F+  +A+D  Q+K  +  P+V+        C +   NC+ N
Sbjct  244   KPVMCFFPQYMAKRTRTPLFILNAAYDSWQIK-NILAPVVADPRGLWSDCKIDIKNCSTN  302

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-----EFTYHSWYGPKKLRVIGNKT  1138
             ++ + Q+ R +FL+ + K     S  +++N+C +H     + T+ S + P    V+   T
Sbjct  303   QLSVMQDFRSEFLNAISKLGKSPSRGLFINSCYAHCQTEMQETWFSHHSP----VLHKTT  358

Query  1139  YAEVFADWYFDR  1174
              A+   DW+++R
Sbjct  359   IAKAVGDWFYNR  370



>ref|XP_011082152.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=378

 Score =   310 bits (795),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/348 (45%), Positives = 222/348 (64%), Gaps = 16/348 (5%)
 Frame = +2

Query  212   VCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMG  391
             VCLDGS P Y+ D+G+G G++NW++ IEGGGWC N   C  R  +RLGSSKYM       
Sbjct  20    VCLDGSPPAYHLDRGYGTGINNWLVHIEGGGWCNNVTTCLARKNNRLGSSKYMVKQLAFS  79

Query  392   DLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAK  571
              +L++  N NP+FYNW+RV+V YCDG+SFT DV+ V+P T L YRG R+F A+MED  AK
Sbjct  80    GILNNKANFNPDFYNWNRVKVRYCDGASFTGDVEAVNPVTKLHYRGARVFLAVMEDLLAK  139

Query  572   GMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQS  751
             GMKNA+NA+ +G SAGG+A +LHCD F+AL P  T+VKC +D+ YFIN + + G +  ++
Sbjct  140   GMKNAENAVLSGCSAGGLAAILHCDSFKALLPMGTKVKCFSDAGYFINTKDVSGAQHIEA  199

Query  752   SFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTM  931
              +  +V + GSAK LP+ CTS+MK SLCFFPQY  + ++TP+F+  +A+D  Q+K  L  
Sbjct  200   FYHDVVSTHGSAKNLPRSCTSRMKPSLCFFPQYVAREIRTPLFIINAAYDSWQIKNILAP  259

Query  932   PIV-------SCVT-YNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT  1087
              +        +C T  N C+  +++  Q  RL+F+  L      +S   ++N+C +H  T
Sbjct  260   GVADPHGTWHNCKTDINKCSATQLQTMQGFRLEFIRALYGLGVSTSRGYFINSCYAHCQT  319

Query  1088  --YHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPLNC  1225
                 +WY     + + NKT A+   DW++DR  SP    +K + P  C
Sbjct  320   EMQETWYRSDSPK-LNNKTIAKAVGDWFYDR--SP---FQKGDCPYPC  361



>ref|XP_006587656.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=450

 Score =   312 bits (800),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 159/370 (43%), Positives = 234/370 (63%), Gaps = 13/370 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+SQWL   +++  +L  I     V +T +++AV+KGAVCLDGS P Y++D+G G G++
Sbjct  4     ARISQWL--ILLVCALLLLISEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++  EGGGWC N   C  R  +RLGSSK M  +     +L++    NP+FYNW+R++V
Sbjct  62    NWLVAFEGGGWCNNVTTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ V+P T L +RG RIF+A+MED  AKGMKNA+NAI +G SAGG+  +
Sbjct  122   RYCDGSSFTGDVEAVNPVTKLHFRGGRIFNAVMEDLLAKGMKNARNAIISGCSAGGLTSV  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRAL P   RVKCL+D+ YFIN + + G++  +  F  +V + GSA+ LP+ CTS
Sbjct  182   LHCDRFRALLPRGARVKCLSDAGYFINGKDVLGEQHIEQYFSQVVATHGSARNLPQSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             ++   LCFFPQY +  + TPIF   +A+D  Q+K  L   +        SC +  NNC+ 
Sbjct  242   RLSPRLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINNCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
             +++ + Q  R +FL  +    + SS  +++++C +H  T    +W        +   T A
Sbjct  302   DQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPE-LKKTTIA  360

Query  1145  EVFADWYFDR  1174
             +  ADW+++R
Sbjct  361   KAVADWFYER  370



>ref|XP_010677538.1| PREDICTED: protein notum homolog isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score =   310 bits (795),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 164/391 (42%), Positives = 233/391 (60%), Gaps = 18/391 (5%)
 Frame = +2

Query  104   SQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWV  283
             SQWL F V +L +L  I     V +T ++ AV+KG VCLDGS P Y++DKG G G+ NW+
Sbjct  4     SQWLQFLVSVLMLL--IVNGFQVPITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHNWL  61

Query  284   IFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYC  463
             I +EGG WC NA  C  R  +RLGSSK M   +    +LS+    +P+FYNW+R++V YC
Sbjct  62    IHMEGGAWCNNATTCLERTKTRLGSSKLMTKQYTFSGILSNQAKYSPDFYNWNRIKVRYC  121

Query  464   DGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHC  643
             DGSSFT DV+ VDP   + YRG R++ A+M+D  AKGMKNA+NAI AG SAGG+  +L C
Sbjct  122   DGSSFTGDVEAVDPKAKVYYRGARLWRAIMDDLLAKGMKNAENAILAGCSAGGLGAILQC  181

Query  644   DYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMK  823
             D FRAL P+  +VKCL+D+ +FIN + + G    Q  F  +V + GSAK LP  CTSK  
Sbjct  182   DNFRALLPSGAKVKCLSDAGFFINAKDISGVSHIQEVFADVVTTHGSAKNLPPSCTSKFD  241

Query  824   ASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTLNEM  979
               LCFFP+Y+ + ++TP+FL  +A+D  Q+K  L   +         C +    C+ +++
Sbjct  242   PKLCFFPEYAARGIQTPLFLLNAAYDAWQIKNTLAPGVADRHGTWHDCKSDIIKCSNSQI  301

Query  980   KIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVF  1153
             +I    R DFL+ L    + +S   ++N+C SH    T  +W       ++ N T  +  
Sbjct  302   QIMHGFRQDFLAALSSLGNSNSRGFYINSCYSHCQSGTQETWLRDDS-PLLDNTTICKAV  360

Query  1154  ADWYFDRNTSPIRVIE---KSNKPLNCSTFE  1237
              DW++DR   P + I+     NK  +   FE
Sbjct  361   GDWFYDRK--PFQKIDCPYPCNKTCHNRVFE  389



>ref|XP_006361594.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=518

 Score =   314 bits (805),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 217/347 (63%), Gaps = 11/347 (3%)
 Frame = +2

Query  203   KGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVF  382
             +  VCLDG+ P YYY+KGHGEG +NW+I+  GG WC N   C  R  +  GSSKY     
Sbjct  172   RALVCLDGTPPAYYYEKGHGEGANNWIIYFRGGEWCYNVMDCLARATTERGSSKYAPKQR  231

Query  383   EMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDF  562
                 +LS++   NP+FYNW+RV V YCDGSSFT DV+ VDP TNL +RG RIF AL+E+F
Sbjct  232   SFYGILSNNKTINPDFYNWNRVMVIYCDGSSFTGDVEIVDPITNLHFRGARIFLALIENF  291

Query  563   QAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKL  742
               KGMKNAKNAI +G SAGG+  ++HCD F+AL PN+ RVKCLAD SYF++ +  +    
Sbjct  292   LEKGMKNAKNAILSGGSAGGLPALIHCDRFKALLPNSARVKCLADGSYFLHRKHKKEMSF  351

Query  743   FQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYG  922
               +  + L+    SA  LP  CTSKM  SLC FPQY  Q +KTP F+  S FD  Q+   
Sbjct  352   MDTVNEGLIKLHHSANMLPSSCTSKMNPSLCLFPQYFQQGIKTPFFIVNSMFDTFQINK-  410

Query  923   LTMP-IVSCVTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYH--  1093
              T P     +  N C+ + +K  Q+ + DFL+ LPK+++ SS  +++++C+ H       
Sbjct  411   -TFPGYYEDLFSNTCSASLVKTLQDFKQDFLNALPKQSNSSSRGMFIDSCLIHSQITSGV  469

Query  1094  SWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPLNCSTF  1234
              W G      + NK+ A+ F+DWYFDR+    ++I+K + PLNC  F
Sbjct  470   GWNG----FSVHNKSIAKAFSDWYFDRSHE--QLIDKPDLPLNCYKF  510



>ref|XP_007209211.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 ref|XP_007209212.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10410.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10411.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
Length=400

 Score =   310 bits (795),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 158/379 (42%), Positives = 229/379 (60%), Gaps = 15/379 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL QWL      +T+L+     + V +T + SA++KGAVCLDGS P Y++DKG G G++
Sbjct  4     ARLGQWLFLLACAVTLLK--AAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N  +C  R  +RLGSSK M        +LS+    NP+FYNW+R++V
Sbjct  62    NWLVHIEGGGWCNNVTNCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV  V+PAT L +RG RIF A++ED  AKGM NA+NAI +G SAGG+  +
Sbjct  122   RYCDGASFTGDVAAVNPATGLYFRGARIFRAVIEDLLAKGMGNAQNAILSGCSAGGLTSI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F AL P  T VKC++D+ YFIN + + G +  +  F  +V++ GSA+ LP  CTS
Sbjct  182   LHCDNFHALLPAGTNVKCVSDAGYFINVKDVSGAQHIEELFSQVVETHGSARNLPPSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             K++  LCFFPQY    ++T IF   +A+D  Q+K  L   +         C +   NC+ 
Sbjct  242   KLRPGLCFFPQYMASQIQTRIFFVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
              ++K  Q+ R+ FLS +          +++++C +H  T    +W       V+   T A
Sbjct  302   TQLKAMQDFRVQFLSAVGGMTGCPLKGMFIDSCYAHCQTEMQETWLMADS-PVLNKTTIA  360

Query  1145  EVFADWYFDRNTSPIRVIE  1201
             +   DW++ R  +P + I+
Sbjct  361   QAVGDWFYGR--TPFQKID  377



>gb|EPS71696.1| hypothetical protein M569_03061, partial [Genlisea aurea]
Length=395

 Score =   310 bits (795),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 158/370 (43%), Positives = 225/370 (61%), Gaps = 18/370 (5%)
 Frame = +2

Query  119   FFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEG  298
              F+VL+T+  K EG   V +T ++ AV KGAVCLDGS P Y+ D G G G ++W++ +EG
Sbjct  2     LFLVLITVSGKSEGSF-VGITYVDGAVEKGAVCLDGSPPAYHLDLGSGAGANSWLVHVEG  60

Query  299   GGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSF  478
             GGWC N   C  R  +RLGSS+ M        + S+ P  NP+FYNW+RV+V YCDG+SF
Sbjct  61    GGWCNNVTTCLARRDTRLGSSRRMATQIAFSGIFSNRPQFNPDFYNWNRVKVRYCDGASF  120

Query  479   TSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRA  658
             T DV+ VDPAT L YRG R+  A++ED  AKGMKNA+NA+ +G SAGG+  +LHCD F+A
Sbjct  121   TGDVEAVDPATKLYYRGARVLGAVIEDLLAKGMKNAENAVLSGCSAGGLTSILHCDAFKA  180

Query  659   LFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCF  838
             L P  TRVKC AD+ +FIN   + G       ++ +  + GSAK LP+ CTS++K  LCF
Sbjct  181   LLPVGTRVKCFADAGFFINARDVSGAAHINDFYNDVATTHGSAKNLPQGCTSRLKPGLCF  240

Query  839   FPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTLNEMKIAQE  994
             FPQ   Q ++TP+F+  +A+D  Q+K  L   +         C T    C+ ++++  Q+
Sbjct  241   FPQNVAQEIRTPLFIVNAAYDSWQIKNILAPGVADPHGTWHDCKTDITKCSKSQLQTMQD  300

Query  995   LRLDFLSLLPK------KNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAEV  1150
              R  FL  L         ++ SS   ++N+C +H  T    +W+      ++ +KT AE 
Sbjct  301   FRTQFLKSLNDGVGSSLTSTPSSKGYFINSCYAHCQTEMQETWFRSDS-PLLNDKTIAEA  359

Query  1151  FADWYFDRNT  1180
               DW+FDRN+
Sbjct  360   IGDWFFDRNS  369



>ref|XP_004244767.2| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=387

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/351 (46%), Positives = 225/351 (64%), Gaps = 6/351 (2%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V  T +++AVSKGAVCLDGS P YY D+G GEG  +W+I + GGGWC + + C+ R  + 
Sbjct  41    VGKTIVKNAVSKGAVCLDGSPPAYYMDRGFGEGAQSWMIHLSGGGWCRDVRDCQNRSTTS  100

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
              GSSKYM P F+     S++   NP+ +NW++V VAYCDG +FT DV+ VDP TNL +RG
Sbjct  101   FGSSKYMVP-FKFRGHFSNNKIANPDLFNWNKVMVAYCDGGAFTGDVETVDPGTNLHFRG  159

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF A+MED  ++G+ +AKNA+  G+SAG    ML+CD F  L PNT R+KCL DS YF
Sbjct  160   ARIFSAVMEDLLSRGLNDAKNALLIGSSAGAYPAMLYCDRFSKLLPNTPRLKCLTDSGYF  219

Query  710   IN-DEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLT  886
             I+ ++ L+  K F+S +  LV   GSAK LPK CTS+MK  LCFFPQ   QY+KTP++  
Sbjct  220   IDVNKNLQKGKGFESIYKELVTLHGSAKALPKSCTSRMKPELCFFPQNVQQYIKTPLYTI  279

Query  887   MSAFDQIQLKYGLTMPIVSCVTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNN  1066
             MS FD +Q+   L     + +  NNC+ N+ K  +ELRL+ LS LP  +   S   ++++
Sbjct  280   MSPFDIVQVGTSLG-DYYNAIKQNNCSANQKKNLRELRLELLSKLPNASDTKSRGAFIDS  338

Query  1067  CVSHEFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
                H     S++ P+ + V+ N T  + F DWYFDR      +I+K + P+
Sbjct  339   QFHHT-RLQSYWNPQNVSVVNNVTMIKAFGDWYFDRQY--YYLIDKHDLPI  386



>ref|XP_010434425.1| PREDICTED: uncharacterized protein LOC104718381 isoform X2 [Camelina 
sativa]
Length=379

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/374 (43%), Positives = 229/374 (61%), Gaps = 16/374 (4%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGRLKQCWSSLLVLAVVVI----GAGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V  V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVAAVNPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T RVKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTARVKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-SCVTYNNCTLN----  973
             TSKMK  LCFFPQY + +++TP+F+  +AFD  Q+K  L    V     + NC L+    
Sbjct  237   TSKMKPELCFFPQYVVPFMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKC  296

Query  974   ---EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
                ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLKTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQV-ANTR  355

Query  1139  YAEVFADWYFDRNT  1180
              A+   +W++ R+ 
Sbjct  356   IAKAVGNWFYGRSA  369



>emb|CDX87799.1| BnaC02g31500D [Brassica napus]
Length=391

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/399 (39%), Positives = 239/399 (60%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T LESAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MVRLKQLWSSIMVLAIVVI----GAGAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDIATCVKRKTTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT D++ VDP   L +RG R++ A+++D  AKGM NA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+++ P T +VKC++D+ +FI+ + + G    +S +  +V + GSAK LP  C
Sbjct  177   AILHCDEFKSILPTTAKVKCVSDAGFFIHGKDISGGSYIESYYSKVVSTHGSAKSLPASC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS MK  LCFFPQY ++ ++TP+F+  +AFD  Q+K  L    V        C +    C
Sbjct  237   TSSMKPELCFFPQYVVKTMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             T  +++  Q  R   L+ L    + ++  +++++C +H    +  +W G +  +V GN  
Sbjct  297   TAAQLQTVQGYRDQMLAALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQV-GNTK  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              A+   DW+++R+T          + ++C +   NP  P
Sbjct  356   MAKAVGDWFYERSTF---------QNIDCPSLNCNPTCP  385



>ref|XP_009128780.1| PREDICTED: uncharacterized protein LOC103853624 [Brassica rapa]
Length=391

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/399 (39%), Positives = 239/399 (60%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T LESAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MVRLKQVWSSVMVLAVVVI----GAGAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDIATCVKRKTTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT D++ VDP   L +RG R++ A+++D  AKGM NA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+++ P T +VKC++D+ +FI+ + + G    +S +  +V + GSAK LP  C
Sbjct  177   AILHCDQFKSILPTTAKVKCVSDAGFFIHGKDISGGSYIESYYSKVVSTHGSAKSLPASC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS MK  LCFFPQY ++ ++TP+F+  +AFD  Q+K  L    V        C +    C
Sbjct  237   TSSMKPELCFFPQYVVKTMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKDCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             T  +++  Q  R   L+ L    + ++  +++++C +H    +  +W G +  +V GN  
Sbjct  297   TAAQLQTVQGYRDQMLAALAPVQATTTRGLFLDSCHAHCQGGSAATWSGAQGPQV-GNTK  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              A+   DW+++R+T          + ++C +   NP  P
Sbjct  356   MAKAVGDWFYERSTF---------QNIDCPSLNCNPTCP  385



>ref|XP_006355154.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=409

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/384 (42%), Positives = 228/384 (59%), Gaps = 18/384 (5%)
 Frame = +2

Query  107   QWLCFFVVLLTILRKIEG-KINVT----------LTTLESAVSKGAVCLDGSAPGYYYDK  253
             Q LC F+  L I+  +   K NVT           T +++AVSKGAVCLDGS P Y+++ 
Sbjct  7     QVLCLFICSLAIINTVSSTKENVTPYLDEAYHVSKTIVKNAVSKGAVCLDGSPPAYHFEP  66

Query  254   GHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFY  433
             G G+G   W++ + GG WC   + C  R  S  GSS  M   +  G + S + + NPEFY
Sbjct  67    GFGDGAQTWLVQLSGGEWCRTVEACLERSKSEFGSSNLMNSWWFTG-MFSKNQSGNPEFY  125

Query  434   NWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNS  613
             NW++V + YCDG  FT DV+ VDPAT L +RG RIF A+M++   KG+K AK+A+  G+S
Sbjct  126   NWNKVFIRYCDGGGFTGDVEYVDPATKLHFRGARIFKAVMDELLEKGLKTAKSALLGGSS  185

Query  614   AGGVAVMLHCDYFRALFPNTTRVKCLADSSYFIN-DEKLEGDKLFQSSFDYLVDSMGSAK  790
             AGG   ML+CDYFR L PNT RVKC+ D+ YFIN  E    +  F   +  LV   GSAK
Sbjct  186   AGGFPAMLYCDYFRTLLPNTPRVKCMNDAGYFINAKEPFRAN--FTELYTALVTLHGSAK  243

Query  791   WLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCTL  970
              LPKECTSKM   LCFFP+   QYVKTP+F+  SA+D+ Q+   + + I +C+  +NCT 
Sbjct  244   ALPKECTSKMSPELCFFPENMQQYVKTPLFIASSAYDKYQINNSIAVGINTCIGSSNCTA  303

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTYAEV  1150
                +   E R  FL+ LPK  +     +++++  +H      W+ P  +  I N T ++ 
Sbjct  304   TTNQTFLEFRSRFLNALPKPTNPKLKGVFIDS-FNHHSQVQFWWSPFNITTINNLTLSKA  362

Query  1151  FADWYFDRNTSPIRVIEKSNKPLN  1222
             FADW++DRN +   VI +   P++
Sbjct  363   FADWFYDRNYT--YVIHEHELPIS  384



>ref|XP_003547821.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26083.1| Protein notum like [Glycine soja]
Length=398

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 163/372 (44%), Positives = 237/372 (64%), Gaps = 14/372 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+SQWL   +V + +L K EG + V L  +E+A SKGAVCLDGS P Y++DKG GEG++
Sbjct  4     ARISQWL-NLLVCVLLLLKAEGSL-VPLILVENAESKGAVCLDGSPPAYHFDKGFGEGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             +W++ IEGGGWC N + C  R  +RLGSSK M  ++  G +LS+    NP+FYNW+RV+V
Sbjct  62    SWIVHIEGGGWCNNIESCLDRKDTRLGSSKQMEDIYFSG-ILSNEQQFNPDFYNWNRVKV  120

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP TNL +RG RIF A++E+  AKG++ A+NAI +G SAGG+  +
Sbjct  121   RYCDGSSFTGDVEEVDPTTNLHFRGARIFSAVIEELLAKGLERAENAILSGCSAGGLTTI  180

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+   P+   VKC+ D+ YF+N E + G    Q  +  +V + GSAK LP  CTS
Sbjct  181   LHCDSFKTFLPSRANVKCVPDAGYFVNVEDISGAHFIQQYYSEVVSTHGSAKNLPTSCTS  240

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKY----GLTMPI---VSC-VTYNNCTL  970
             K+  +LCFFPQY   ++ TPIF+  SA+D  Q++Y    G   P     SC V  +NC+ 
Sbjct  241   KLSPTLCFFPQYVASHISTPIFVVNSAYDSWQIRYIFVPGSADPSDSWNSCKVNMSNCSP  300

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
             +++   Q  + +F   L +     S  +++++C +H  T    +W+     + + N T A
Sbjct  301   DQLSKLQGFKSEFERALSEVGDSPSKGMFIDSCYAHCQTEPQETWFKTDSPK-LANTTIA  359

Query  1145  EVFADWYFDRNT  1180
             +  ADW++ R++
Sbjct  360   KAVADWFYGRSS  371



>ref|XP_010244169.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=401

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/372 (42%), Positives = 227/372 (61%), Gaps = 11/372 (3%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M      +  + ++ T++       NV +T L+SAV+KGAVCLDGS P Y+   G G GV
Sbjct  4     MGNKGSGVSLYFLIWTLVTLGANGFNVGITYLQSAVAKGAVCLDGSPPAYHMSPGFGAGV  63

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++F EGG WC N   C  R  +RLGSSK M        +LS+    NP+FYNW++++
Sbjct  64    NNWLVFFEGGSWCNNVTSCLARKNTRLGSSKQMTKEVSFSGILSNKEKFNPDFYNWNKIK  123

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV+ V+PATNL +RG RIF A++ED  AKGMKNAKNA+  G SAGG+  
Sbjct  124   VRYCDGSSFTGDVEAVNPATNLHFRGQRIFLAVIEDLLAKGMKNAKNALLTGCSAGGLTA  183

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +LHCD FR L P +T+VKC+AD+ +FIN + + G    Q+ ++ +V +  SAK LP  CT
Sbjct  184   ILHCDRFRTLLPASTKVKCMADAGFFINAKSVAGTSHIQAFYNDVVATHQSAKNLPASCT  243

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN-----  973
             S+    LCFFPQY    + TP+F+  +A+D  Q+K  L   +     T+++C L+     
Sbjct  244   SRFNPGLCFFPQYVAPQISTPLFILNAAYDSWQVKNILAPGVADPHGTWHDCKLDITKCS  303

Query  974   --EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
               +++I Q  R++FLS L +     + A+++N+C SH    T  +W       V+   + 
Sbjct  304   SSQLQIMQGFRMEFLSTLTRLMGSPTKALFINSCYSHCQTGTQETWLRDDS-PVLDKTSI  362

Query  1142  AEVFADWYFDRN  1177
             ++   DWYFDR+
Sbjct  363   SKAVGDWYFDRS  374



>ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62935.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=402

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/368 (44%), Positives = 230/368 (63%), Gaps = 16/368 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T ++SAV+KGAVCLDGS P Y++DKG G G+++W+I  EGGGWC N   C  R  + 
Sbjct  30    VGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCLSRKKTH  89

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        ++++    NP+FYNW+RV++ YCDGSSFT DV  V+PATNL +RG
Sbjct  90    LGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  149

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RI+ A++ED   KG+KNA+NA+ +G SAGG+A +LHCD FRAL    T+VKCL+D+ YF
Sbjct  150   ARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGYF  209

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I  + + G    Q+ F+ +V   GSAK LP  CTS +K S CFFPQY    V+TP+F+  
Sbjct  210   IKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYVAPQVRTPLFILN  269

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q++  L   I        SC +  NNC+  ++K  Q+ RL FL+ L K  + SS
Sbjct  270   AAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNSSS  329

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               +++++C +H    T   W+  +   V+G K  A+   DW++DRN       +K + P 
Sbjct  330   RGLYIDSCYAHCQTETQEKWFM-EDSPVLGKKKIAKAVGDWFYDRNP-----FQKIDCPY  383

Query  1220  NCSTFEQN  1243
              C+   QN
Sbjct  384   PCNPSCQN  391



>ref|XP_010434424.1| PREDICTED: uncharacterized protein LOC104718381 isoform X1 [Camelina 
sativa]
Length=391

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/399 (41%), Positives = 238/399 (60%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGRLKQCWSSLLVLAVVVI----GAGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V  V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVAAVNPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T RVKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTARVKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-SCVTYNNCTLN----  973
             TSKMK  LCFFPQY + +++TP+F+  +AFD  Q+K  L    V     + NC L+    
Sbjct  237   TSKMKPELCFFPQYVVPFMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKC  296

Query  974   ---EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
                ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLKTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQV-ANTR  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              A+   +W++ R+         + + ++C +   NP  P
Sbjct  356   IAKAVGNWFYGRS---------AFQKIDCPSPTCNPTCP  385



>ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
 gb|ESQ55433.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
Length=397

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/384 (41%), Positives = 237/384 (62%), Gaps = 18/384 (5%)
 Frame = +2

Query  107   QWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVI  286
             +W+   V  L IL      +N+T   + +AV+KGAVCLDGS P Y+ D+G G G+++W+I
Sbjct  6     KWVFLLVCSLVILETEALYVNITF--VRNAVAKGAVCLDGSPPAYHLDRGFGTGINSWLI  63

Query  287   FIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCD  466
              +EGGGWC N  +C  R  +RLGSSK M        +LS+    NP+FYNW+RV+V YCD
Sbjct  64    QLEGGGWCNNVTNCVSRMHTRLGSSKRMVEKLAFSAILSNKRQYNPDFYNWNRVKVRYCD  123

Query  467   GSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCD  646
             GSSFT DV  V+PATNL +RG R++ A+M++  AKGM NA+NA+ +G SAGG+A ++HCD
Sbjct  124   GSSFTGDVQAVNPATNLHFRGARVWLAVMQELLAKGMINAENAVLSGCSAGGLATLMHCD  183

Query  647   YFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKA  826
              FRAL P   +VKCL+D+ +F+N   + G +  +S F+ +V   GSAK LP+ CTS++  
Sbjct  184   SFRALLPMGAKVKCLSDAGFFLNTRDVAGAQYIKSYFNDVVTLHGSAKNLPRSCTSRLTP  243

Query  827   SLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMK  982
             ++CFFPQY  + ++TP+F+  +A+D  Q+K  L            SC +   NC  N++K
Sbjct  244   AMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCQPNQLK  303

Query  983   IAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFA  1156
             + Q+ RL+FL  +      SS  +++++C +H    T  SW+  +   ++   T A+   
Sbjct  304   VMQDFRLEFLRAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTIAKAVG  362

Query  1157  DWYFDRNTSPIRVIEKSNKPLNCS  1228
             DW +DR      + +K + P  C+
Sbjct  363   DWVYDRT-----LFQKIDCPYPCN  381



>ref|XP_006432878.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina]
 gb|ESR46118.1| hypothetical protein CICLE_v100013712mg, partial [Citrus clementina]
Length=276

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/274 (52%), Positives = 189/274 (69%), Gaps = 2/274 (1%)
 Frame = +2

Query  89   IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
            + AR+ QWL   V  L IL K +G  NV +T +E+AV KGAVCLDGS P Y++DKG G G
Sbjct  2    VAARMGQWLNLLVCAL-ILLKADG-FNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAG  59

Query  269  VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
            ++NW++ IEGGGWC N   C  R  +RLGSSK M  V     +LS+    NP+FYNW+R+
Sbjct  60   INNWLVHIEGGGWCNNVTTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRI  119

Query  449  RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
            +V YCDG+SFT DV+ V+PA NL +RG R+F A+MED  AKGMKNA+NA+ +G SAGG+ 
Sbjct  120  KVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMAKGMKNAQNAVLSGCSAGGLT  179

Query  629  VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
             +LHCD FRALFP  T+VKC AD+ YFIN + + G    +  +  +V + GSAK LP  C
Sbjct  180  SILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGASHIEQFYAQVVATHGSAKHLPASC  239

Query  809  TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQ  910
            TS++   LCFFPQY  + + TP+F+  +A+D  Q
Sbjct  240  TSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQ  273



>ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 ref|XP_006385139.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62934.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62936.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=399

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 162/368 (44%), Positives = 230/368 (63%), Gaps = 16/368 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T ++SAV+KGAVCLDGS P Y++DKG G G+++W+I  EGGGWC N   C  R  + 
Sbjct  27    VGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCLSRKKTH  86

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        ++++    NP+FYNW+RV++ YCDGSSFT DV  V+PATNL +RG
Sbjct  87    LGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  146

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RI+ A++ED   KG+KNA+NA+ +G SAGG+A +LHCD FRAL    T+VKCL+D+ YF
Sbjct  147   ARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGYF  206

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I  + + G    Q+ F+ +V   GSAK LP  CTS +K S CFFPQY    V+TP+F+  
Sbjct  207   IKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYVAPQVRTPLFILN  266

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q++  L   I        SC +  NNC+  ++K  Q+ RL FL+ L K  + SS
Sbjct  267   AAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNSSS  326

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               +++++C +H    T   W+  +   V+G K  A+   DW++DRN       +K + P 
Sbjct  327   RGLYIDSCYAHCQTETQEKWFM-EDSPVLGKKKIAKAVGDWFYDRNP-----FQKIDCPY  380

Query  1220  NCSTFEQN  1243
              C+   QN
Sbjct  381   PCNPSCQN  388



>ref|XP_010266384.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010266385.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
Length=391

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 160/377 (42%), Positives = 237/377 (63%), Gaps = 16/377 (4%)
 Frame = +2

Query  122   FVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGG  301
              ++ + I  K+ G + V +T ++S+V+KGAVCLDGS P Y+ DKG G G++NW++ IEGG
Sbjct  10    LIICILITLKVNG-LYVQITYIKSSVAKGAVCLDGSPPAYHLDKGFGSGINNWLVHIEGG  68

Query  302   GWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFT  481
             GWC N   C +R  + LGSSK M        +LS++   NP+FYNW+R++V YCDG+SFT
Sbjct  69    GWCTNVTTCLFRKNTHLGSSKKMVTEIAFSGILSNNKQFNPDFYNWNRIKVRYCDGASFT  128

Query  482   SDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRAL  661
              D++ VDP TNL YRG RI+ A++ED   KGMKNA+ A+ +G SAGG+A +LHCD F AL
Sbjct  129   GDLEKVDPVTNLHYRGARIWLAVIEDLLKKGMKNAEYALLSGCSAGGLASILHCDSFHAL  188

Query  662   FPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFF  841
                 T+VKCLAD+ YF+N +++ G +  +S F+ +V + GS K LP  CTS MK S+CFF
Sbjct  189   LSIGTKVKCLADAGYFVNLKEISGREHIKSYFNDVVTTHGSVKNLPTYCTSTMKPSMCFF  248

Query  842   PQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPI-------VSC-VTYNNCTLNEMKIAQEL  997
             PQY +  ++TP+FL  +A+D  Q++  L   +       +SC +   NC+  +++  Q  
Sbjct  249   PQYIVHGIRTPLFLLNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKNCSSIQLQTMQGF  308

Query  998   RLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
             R++FLS L  + S SS  +++N+C +H +      +      V+ N   A+   DWY+DR
Sbjct  309   RMEFLSALLGQRS-SSRGMFINSCYAHCQSEMQETWLQDDSPVLDNTPIAKAVGDWYYDR  367

Query  1175  NTSPIRVIEKSNKPLNC  1225
                  R  +K + P  C
Sbjct  368   -----RSFQKIDCPYPC  379



>ref|XP_006368062.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=329

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 205/330 (62%), Gaps = 10/330 (3%)
 Frame = +2

Query  101   LSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNW  280
             ++ +L FFV LL  +R     +N+T+  LESAV+KGAVCLDG+ P Y+ D+G G GV+NW
Sbjct  2     VTSFLLFFVCLLIFVRTESLLVNITI--LESAVAKGAVCLDGTPPAYHLDRGSGPGVNNW  59

Query  281   VIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAY  460
             VI +EGGGWC N   C  R  +RLGSS  M        ++S+ PN NPEFYNW+RV V Y
Sbjct  60    VISLEGGGWCQNVTLCLTRKNTRLGSSAKMDHQLPFSGMMSNDPNFNPEFYNWNRVSVRY  119

Query  461   CDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLH  640
             CDG SFT DV+ +DP T L YRG RIF A+ME+  A+GM  ++NAI +G SAGG+A +LH
Sbjct  120   CDGGSFTGDVEAIDPGTGLHYRGARIFKAIMEELLAQGMNTSQNAILSGCSAGGLATILH  179

Query  641   CDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKM  820
             CD FR L PN  +VKC +D+ YFI+   + G    +  F+ +V   GSAK LP  CTSK+
Sbjct  180   CDNFRTLLPNNAKVKCFSDAGYFIHLNDISGKPYIEHYFNDVVTLHGSAKNLPPSCTSKL  239

Query  821   KASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPI-------VSC-VTYNNCTLNE  976
             K  LCFFP+   Q +KTP+F+  +A+D  Q++  L  P         SC     NCT  +
Sbjct  240   KPGLCFFPENVAQQIKTPLFIINAAYDHWQVRNILVAPGTDPKGAWTSCKANIKNCTPYQ  299

Query  977   MKIAQELRLDFLSLLPKKNSESSIAIWVNN  1066
             + + Q  R DFL  L      S+   ++N+
Sbjct  300   LTVLQGFREDFLKALEGIGRSSTRGYYINS  329



>ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62931.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=430

 Score =   310 bits (793),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 162/368 (44%), Positives = 230/368 (63%), Gaps = 16/368 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T ++SAV+KGAVCLDGS P Y++DKG G G+++W+I  EGGGWC N   C  R  + 
Sbjct  30    VGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCLSRKKTH  89

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        ++++    NP+FYNW+RV++ YCDGSSFT DV  V+PATNL +RG
Sbjct  90    LGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  149

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RI+ A++ED   KG+KNA+NA+ +G SAGG+A +LHCD FRAL    T+VKCL+D+ YF
Sbjct  150   ARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGYF  209

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I  + + G    Q+ F+ +V   GSAK LP  CTS +K S CFFPQY    V+TP+F+  
Sbjct  210   IKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYVAPQVRTPLFILN  269

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q++  L   I        SC +  NNC+  ++K  Q+ RL FL+ L K  + SS
Sbjct  270   AAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNSSS  329

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               +++++C +H    T   W+  +   V+G K  A+   DW++DRN       +K + P 
Sbjct  330   RGLYIDSCYAHCQTETQEKWFM-EDSPVLGKKKIAKAVGDWFYDRNP-----FQKIDCPY  383

Query  1220  NCSTFEQN  1243
              C+   QN
Sbjct  384   PCNPSCQN  391



>ref|XP_009600038.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=370

 Score =   307 bits (787),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 159/361 (44%), Positives = 225/361 (62%), Gaps = 8/361 (2%)
 Frame = +2

Query  89    IMA-RLSQWLCFFVVLLTILRKIEGK----INVTLTTLESAVSKGAVCLDGSAPGYYYDK  253
             +MA R  Q  C  V  L I++           V  T +++AVSKGAVCLDGS P Y+++ 
Sbjct  2     VMATRSLQLFCLIVCSLAIIKTESATDLDFYEVKKTIVKNAVSKGAVCLDGSPPAYHFEP  61

Query  254   GHGEGVDNWVIFIEGGGWCMNAQHCKYRG-PSRLGSSKYMWPVFEMGDLLSDSPNENPEF  430
             G GEGV+NW + + GG WC + + CK R   +++GS+  M P +    + S + + NP+F
Sbjct  62    GFGEGVENWFVQLSGGAWCTSVEACKDRSRDNKVGSTTTMGP-YTFQGIYSKNQSANPDF  120

Query  431   YNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGN  610
             YNW++V V YCDG +FT DV+ VDPATNL +RG RIF+A+MED  AKG+KNAKNAI AG+
Sbjct  121   YNWNKVLVRYCDGGAFTGDVEYVDPATNLHFRGARIFEAVMEDVLAKGLKNAKNAILAGS  180

Query  611   SAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAK  790
             SAGG   ML+CD FR+L PNT RVKC  D+ YFI+ +  +  + F+  ++ LV   GSAK
Sbjct  181   SAGGYPAMLYCDRFRSLLPNTPRVKCFVDAGYFIHAKNQKQARGFEDIYNTLVTLHGSAK  240

Query  791   WLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCTL  970
              LPK CTSKMK  LCFFP+   Q +KTP+F+ MSAFD  Q+   +   +   +    CT 
Sbjct  241   TLPKSCTSKMKPLLCFFPESMQQNIKTPLFIAMSAFDIFQINTTVEPHLHDVIENGTCTT  300

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTYAEV  1150
             ++ K  +E R +FLS LPK N+     +++++ V+H  +    + P+   +I N     +
Sbjct  301   SQNKAFREFRSEFLSTLPKPNNPKLRGVFIDS-VNHHTSLLIRWSPENATMINNLVRDNL  359

Query  1151  F  1153
             F
Sbjct  360   F  360



>ref|XP_010318089.1| PREDICTED: protein notum homolog [Solanum lycopersicum]
Length=407

 Score =   308 bits (790),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/379 (42%), Positives = 227/379 (60%), Gaps = 13/379 (3%)
 Frame = +2

Query  107   QWLCFFVVLLTILRKIEGK--------INVTLTTLESAVSKGAVCLDGSAPGYYYDKGHG  262
             Q LC  +  L I+  +            +V+ T +++AV+KGAVCLDGS P Y+++ G G
Sbjct  9     QVLCLSICSLAIINTVSSANENYLPEAYHVSKTIVKNAVAKGAVCLDGSPPAYHFEPGFG  68

Query  263   EGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWH  442
             +G + W++ + GG WC + + C  R  S LGSS  M   +  G + S + + NPEFYNW+
Sbjct  69    DGAETWLVQLSGGEWCRDVEACLDRSKSDLGSSNVMGSWWFTG-MFSKNQSGNPEFYNWN  127

Query  443   RVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGG  622
             +V + YCDG  FT DV+ VDPAT L +RG RIF A++++   KG+K AK+A+ +G+SAGG
Sbjct  128   KVFIRYCDGGGFTGDVEYVDPATKLHFRGARIFKAVLDELLEKGLKTAKSALLSGSSAGG  187

Query  623   VAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPK  802
                MLHCDYFR L PNT RVKC+ D+ YFIN ++      F   +  LV   GSAK LPK
Sbjct  188   FPAMLHCDYFRTLLPNTPRVKCMNDAGYFINPKEPFLTN-FTELYTSLVTLHGSAKALPK  246

Query  803   ECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCTLNEMK  982
             ECTSKM   LCFFP+   QYVKTP+F+  SA+D+ Q+   +   I +C+ Y NCT    +
Sbjct  247   ECTSKMSPELCFFPENMQQYVKTPLFIASSAYDKYQINSSIANGINTCIGYANCTAATNQ  306

Query  983   IAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTYAEVFADW  1162
                E R  FL+ LPK  +     +++++  +H      W+ P  +  I N T ++  ADW
Sbjct  307   TFLEFRSRFLNALPKPTNPKLKGVFIDS-FNHHSQVQYWWSPINITTINNLTISKALADW  365

Query  1163  YFDRNTSPIRVIEKSNKPL  1219
             ++DRN +   VI +   P+
Sbjct  366   FYDRNYT--YVIHEHELPI  382



>ref|XP_007209217.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|EMJ10416.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|AIA21744.1| pectin acetylesterase [Prunus persica]
Length=398

 Score =   308 bits (789),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 163/379 (43%), Positives = 236/379 (62%), Gaps = 15/379 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL QWL   V LL +L+     + +TL  +E+AV+KGAVCLDGSAP Y++DKG G G++
Sbjct  4     ARLGQWLSLLVCLLILLKAESHPVGITL--VENAVAKGAVCLDGSAPAYHFDKGFGAGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC + + C  R  +  GSS  M        +L +    NP+FYNW+R++V
Sbjct  62    NWLVHVEGGGWCNSVETCLDRKNTYRGSSNKMEKSMSFSGVLGNKQKFNPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ V+PATNL +RG R+F A+++D  AKGMKNA++A+ +G SAGG+A +
Sbjct  122   RYCDGSSFTGDVEAVNPATNLHFRGARVFRAIIDDLLAKGMKNAQSALLSGCSAGGLASI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             L+CD FR+L P  T+VKCLAD+ YFIN + + G +  Q+ +  +V   GSAK LP  CTS
Sbjct  182   LNCDNFRSLLPVGTKVKCLADAGYFINAKTVSGSQQIQAFYSEVVALHGSAKNLPASCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             K+   LCFFPQ  +   +TPIFL  +A+D  Q+K  L   I         C +   NC+ 
Sbjct  242   KLSPGLCFFPQNVVPVTRTPIFLVNAAYDSWQIKNILAPGIADPKGAWKKCKLDIKNCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYA  1144
             ++++  QE RL FL  L   +S ++  +++++C +H    T  +W       V+   T  
Sbjct  302   SQLQTMQEYRLQFLGALSHASSSTTHGLFIDSCYAHCQIGTQETWLAADS-PVLSKTTIG  360

Query  1145  EVFADWYFDRNTSPIRVIE  1201
             +   DWY DR  +P + I+
Sbjct  361   KAVGDWYTDR--TPFQKID  377



>ref|XP_011028483.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
 ref|XP_011028484.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
Length=427

 Score =   309 bits (791),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 161/368 (44%), Positives = 229/368 (62%), Gaps = 16/368 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T ++SAV+KGAVCLDGS P Y++DKG G G+++W+I  EGGGWC N   C  R  + 
Sbjct  27    VGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCLSRKKTH  86

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        ++++    NP+FYNW+RV++ YCDGSSFT DV  V+PATNL +RG
Sbjct  87    LGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  146

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RI+ A++ED   KG+KNA+NA+ +G SAGG+A +LHCD FRAL    T+VKCL+D+ YF
Sbjct  147   ARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGYF  206

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I  + + G    Q+ F+ +V   GSAK LP  CTS +K S CFFPQY    V+TP+F+  
Sbjct  207   IKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSFCFFPQYVAPQVRTPLFILN  266

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q++  L   I        SC +  NNC+  ++K  Q+ RL FL+ L    + SS
Sbjct  267   AAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALKTSTNSSS  326

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               +++++C +H    T   W+  +   V+G K  A+   DW++DRN       +K + P 
Sbjct  327   RGLYIDSCYAHCQTETQEKWFM-EDSPVLGKKKIAKAVGDWFYDRNP-----FQKIDCPY  380

Query  1220  NCSTFEQN  1243
              C+   QN
Sbjct  381   PCNPSCQN  388



>ref|XP_010266383.1| PREDICTED: uncharacterized protein LOC104603916 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   309 bits (791),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 165/395 (42%), Positives = 243/395 (62%), Gaps = 17/395 (4%)
 Frame = +2

Query  68    LSVI*TYIMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYY  247
             L+ I  + M     W    + +L  L K+ G + V +T ++S+V+KGAVCLDGS P Y+ 
Sbjct  36    LTSIGMHRMVYARSWRKLIICILITL-KVNG-LYVQITYIKSSVAKGAVCLDGSPPAYHL  93

Query  248   DKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPE  427
             DKG G G++NW++ IEGGGWC N   C +R  + LGSSK M        +LS++   NP+
Sbjct  94    DKGFGSGINNWLVHIEGGGWCTNVTTCLFRKNTHLGSSKKMVTEIAFSGILSNNKQFNPD  153

Query  428   FYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAG  607
             FYNW+R++V YCDG+SFT D++ VDP TNL YRG RI+ A++ED   KGMKNA+ A+ +G
Sbjct  154   FYNWNRIKVRYCDGASFTGDLEKVDPVTNLHYRGARIWLAVIEDLLKKGMKNAEYALLSG  213

Query  608   NSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSA  787
              SAGG+A +LHCD F AL    T+VKCLAD+ YF+N +++ G +  +S F+ +V + GS 
Sbjct  214   CSAGGLASILHCDSFHALLSIGTKVKCLADAGYFVNLKEISGREHIKSYFNDVVTTHGSV  273

Query  788   KWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPI-------VSC  946
             K LP  CTS MK S+CFFPQY +  ++TP+FL  +A+D  Q++  L   +       +SC
Sbjct  274   KNLPTYCTSTMKPSMCFFPQYIVHGIRTPLFLLNAAYDSWQIRNILVPGVADPHGYWLSC  333

Query  947   -VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLR  1120
              +   NC+  +++  Q  R++FLS L  + S SS  +++N+C +H +      +      
Sbjct  334   KLDIKNCSSIQLQTMQGFRMEFLSALLGQRS-SSRGMFINSCYAHCQSEMQETWLQDDSP  392

Query  1121  VIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPLNC  1225
             V+ N   A+   DWY+DR     R  +K + P  C
Sbjct  393   VLDNTPIAKAVGDWYYDR-----RSFQKIDCPYPC  422



>ref|XP_010677539.1| PREDICTED: protein notum homolog isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score =   307 bits (787),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 165/391 (42%), Positives = 234/391 (60%), Gaps = 19/391 (5%)
 Frame = +2

Query  104   SQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWV  283
             SQWL F V +L +L  I     V +T ++ AV+KG VCLDGS P Y++DKG G G+ NW+
Sbjct  4     SQWLQFLVSVLMLL--IVNGFQVPITYVQDAVAKGGVCLDGSPPAYHFDKGFGAGIHNWL  61

Query  284   IFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYC  463
             I +EGG WC NA  C  R  +RLGSSK M   +    +LS+    +P+FYNW+R++V YC
Sbjct  62    IHMEGGAWCNNATTCLERTKTRLGSSKLMTKQYTFSGILSNQAKYSPDFYNWNRIKVRYC  121

Query  464   DGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHC  643
             DGSSFT DV+ VDPA  + YRG R++ A+M+D  AKGMKNA+NAI AG SAGG+  +L C
Sbjct  122   DGSSFTGDVEAVDPA-KVYYRGARLWRAIMDDLLAKGMKNAENAILAGCSAGGLGAILQC  180

Query  644   DYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMK  823
             D FRAL P+  +VKCL+D+ +FIN + + G    Q  F  +V + GSAK LP  CTSK  
Sbjct  181   DNFRALLPSGAKVKCLSDAGFFINAKDISGVSHIQEVFADVVTTHGSAKNLPPSCTSKFD  240

Query  824   ASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTLNEM  979
               LCFFP+Y+ + ++TP+FL  +A+D  Q+K  L   +         C +    C+ +++
Sbjct  241   PKLCFFPEYAARGIQTPLFLLNAAYDAWQIKNTLAPGVADRHGTWHDCKSDIIKCSNSQI  300

Query  980   KIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVF  1153
             +I    R DFL+ L    + +S   ++N+C SH    T  +W       ++ N T  +  
Sbjct  301   QIMHGFRQDFLAALSSLGNSNSRGFYINSCYSHCQSGTQETWLRDDS-PLLDNTTICKAV  359

Query  1154  ADWYFDRNTSPIRVIE---KSNKPLNCSTFE  1237
              DW++DR   P + I+     NK  +   FE
Sbjct  360   GDWFYDRK--PFQKIDCPYPCNKTCHNRVFE  388



>ref|XP_010235850.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
 ref|XP_010235851.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
Length=395

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/377 (42%), Positives = 227/377 (60%), Gaps = 13/377 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ++L  W   F   L  L        V +T ++SAV+KGAVCLDGSAP Y+  +G G GVD
Sbjct  6     SKLRLWCSAFACALAFLGA--DGFFVDITYVDSAVAKGAVCLDGSAPAYHLARGFGSGVD  63

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             +W++  EGGGWC N   C  R  +RLGSSK M        +LS++P+ NP+FYNW++VRV
Sbjct  64    SWLVHFEGGGWCSNVTTCLERKNTRLGSSKEMAKQVAFSGILSNTPDHNPDFYNWNKVRV  123

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT D + VDP T L YRG R++ A+MED  AKGM  A+NA+ +G SAGG+  +
Sbjct  124   RYCDGSSFTGDKEEVDPTTKLHYRGARVWQAVMEDLLAKGMDRAENALISGCSAGGLTSV  183

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FR   P    VKCL+D+ +FI+ + + G+K     F+ +V + GSAK LP  CTS
Sbjct  184   LHCDRFRDRMPVEANVKCLSDAGFFIDVKDIAGEKHAADFFNDVVTTHGSAKNLPSSCTS  243

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKY----GLTMPIVSCVTY--NNCTLNE  976
             K+   +C FPQ  ++ ++TP+F+  +A+D  Q++     G + P      +  N C+  +
Sbjct  244   KLPPGMCLFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGGSDPHWRSCKHDINQCSEKQ  303

Query  977   MKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEV  1150
             +K  Q  R DFL  L ++ S SS  +++N+C +H        W+ P    V+GNK  A  
Sbjct  304   LKTLQGFRDDFLKALEEQGSSSSRGLFINSCFAHCQSEIQEIWFAPDS-PVLGNKKIANA  362

Query  1151  FADWYFDRNTSPIRVIE  1201
               DW++DR  SP + I+
Sbjct  363   IGDWFYDR--SPFQEID  377



>ref|XP_008238012.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=400

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/379 (41%), Positives = 228/379 (60%), Gaps = 15/379 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             A+L QWL      +T+L+     + V +T + SA++KGAVCLDGS P Y++DKG G G++
Sbjct  4     AKLGQWLFLLACAVTLLK--AAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N   C  R  +RLGSSK M        +LS+    NP+FYNW+R++V
Sbjct  62    NWLVHIEGGGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV  V+PAT L +RG RIF A++ED  AKGM NA+NAI +G SAGG+  +
Sbjct  122   RYCDGASFTGDVAAVNPATGLYFRGARIFRAVIEDLLAKGMGNAQNAILSGCSAGGLTSI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F AL P  T VKC++D+ YFIN + + G +  +  F  +V++ GSA+ LP  CTS
Sbjct  182   LHCDNFHALLPVGTNVKCVSDAGYFINVKDVSGAQHIEEFFSQVVETHGSARNLPPSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             K++  LCFFPQY    ++T IF   +A+D  Q+K  L   +         C +   NC+ 
Sbjct  242   KLRPGLCFFPQYMASQIRTRIFFVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
              ++K  Q+ R+ FLS +          +++++C +H  T    +W       V+   T A
Sbjct  302   TQLKAMQDFRVQFLSAIGGMTGCPLKGMFIDSCYAHCQTELQETWLMADS-PVLNKTTIA  360

Query  1145  EVFADWYFDRNTSPIRVIE  1201
             +   DW++ R  +P + I+
Sbjct  361   QAVGDWFYGR--TPFQKID  377



>ref|XP_010449359.1| PREDICTED: uncharacterized protein LOC104731629 [Camelina sativa]
Length=391

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 161/399 (40%), Positives = 238/399 (60%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGRLKQCWSSLLVLAVVVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V  V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVAAVNPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T RVKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTARVKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TSKMK  LCFFPQY + +++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSKMKPELCFFPQYVVPFMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             +  ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLKTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQV-ANTR  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              ++   +W++ R+         + + ++C +   NP  P
Sbjct  356   ISKAVGNWFYGRS---------AFQKIDCPSPTCNPTCP  385



>ref|XP_010441760.1| PREDICTED: uncharacterized protein LOC104724893 [Camelina sativa]
Length=391

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/376 (41%), Positives = 228/376 (61%), Gaps = 20/376 (5%)
 Frame = +2

Query  158   GKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYR  337
             G   V +T LESAV+KGAVCLDGSAP Y++DKG G GV+NW++ +EGGGWC +   C  R
Sbjct  20    GARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQR  79

Query  338   GPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNL  517
               +  GSSK M   F    +L    + NP+FYNW+R++V YCDGSSFT D++ VDPA  L
Sbjct  80    KSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKL  139

Query  518   TYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLAD  697
              +RG R++ A+++D  AKGM NA+NAI +G SAG +A +LHCD F+++ P T +VKC++D
Sbjct  140   FFRGARVWRAVIDDLMAKGMNNAQNAILSGCSAGALAAILHCDQFKSILPKTAKVKCVSD  199

Query  698   SSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPI  877
             + YFI+ + + G    QS +  +V + GSAK LP  CTS MK  LCFFPQY  + ++TP+
Sbjct  200   AGYFIHGKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMKPELCFFPQYVAKALQTPL  259

Query  878   FLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKN  1033
             F+  +AFD  Q+K  L    V       +C +    CT  +++  Q  R   L+ L    
Sbjct  260   FVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAALAPVR  319

Query  1034  SESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKS  1207
             + ++  +++++C +H    +  +W G K    + N   A+   DW+++R+T         
Sbjct  320   AATTSGLFLDSCHAHCQGGSAATWSGDKG-PTVANTKMAKAVGDWFYERSTF--------  370

Query  1208  NKPLNCSTFEQNPRKP  1255
              + ++CS+   NP  P
Sbjct  371   -QNIDCSSLNCNPTCP  385



>ref|XP_004953590.1| PREDICTED: protein notum homolog isoform X1 [Setaria italica]
Length=401

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/373 (42%), Positives = 229/373 (61%), Gaps = 12/373 (3%)
 Frame = +2

Query  110   WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIF  289
             W C     L+ L K++  + V +T +ESAV+KGAVCLDGSAP Y+  +G G GV++W++ 
Sbjct  12    WCCALASALSALVKVDALL-VDITYVESAVAKGAVCLDGSAPAYHLARGSGSGVNSWLVH  70

Query  290   IEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDG  469
              EGGGWC N   C  R  +RLGSSK M        +LSD+P+ NP+FYNW++V+V YCDG
Sbjct  71    FEGGGWCSNVTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDYNPDFYNWNKVKVRYCDG  130

Query  470   SSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDY  649
             SSFT DV+ VDP T L YRG RI+ A+MED  AKGM  A+NA+ +G SAGG+  +LHCD 
Sbjct  131   SSFTGDVEEVDPTTKLHYRGARIWQAVMEDLLAKGMDKAENALISGCSAGGLTSILHCDR  190

Query  650   FRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKAS  829
             F  L P   RVKCL+D+ +FIN++ + G     + F+ +V + GSAK LP  CTS +   
Sbjct  191   FHDLLPLGARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPSSCTSILPPG  250

Query  830   LCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCV-TYNNCTLNEMKI  985
             +CFFP   ++ ++TP+F+  +A+D  Q++  L   +        SC    + C+  ++++
Sbjct  251   VCFFPSNEVKQIQTPLFILNAAYDYWQVRNILVPGVADRRGTWHSCKHDIDQCSAAQLRV  310

Query  986   AQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAEVFADW  1162
              Q  R DFL  + ++ + +S  +++N+C  H +      +      ++GN T A    DW
Sbjct  311   LQGFRDDFLKAVAEQGNSTSRGLFINSCFVHCQSEIQELWFSSDSPMLGNTTIAAAVGDW  370

Query  1163  YFDRNTSPIRVIE  1201
             +FDR  SP + I+
Sbjct  371   FFDR--SPFQKID  381



>ref|XP_006365947.1| PREDICTED: uncharacterized protein LOC102601254 [Solanum tuberosum]
Length=401

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/389 (42%), Positives = 222/389 (57%), Gaps = 18/389 (5%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTL--------------TTLESAVSKGAVCLDGSA  232
              R  Q +C  +  L I +    K N +L              T ++++VSKGAVCLDGS 
Sbjct  3     TRSVQLVCLLICSLAISKTDSTKANESLKQEKGADHAYFVDKTIVQNSVSKGAVCLDGSP  62

Query  233   PGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSP  412
             P Y+ D+G G G+ NW+I + GG WC N   C  R  + LGSS  M P   +G + S S 
Sbjct  63    PAYHLDRGFGHGLRNWIILLSGGAWCRNTTDCLNRSKTDLGSSTLMLPFIFLG-IFSKSK  121

Query  413   NENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKN  592
              ENP+FYNW++V V YCDG +FT D++ VDPATNL +RG RIFDA++ED  AKG+K+AKN
Sbjct  122   RENPDFYNWNKVFVRYCDGGAFTGDIENVDPATNLHFRGARIFDAIIEDLLAKGLKDAKN  181

Query  593   AIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVD  772
             AI +G SA G   ML+CD+FR+L     RVKCL D+ YFI  +      +F+S F  +V 
Sbjct  182   AILSGGSANGYPAMLYCDHFRSLLHKAHRVKCLVDAGYFIRVKNPLLANVFESIFRDVVT  241

Query  773   SMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVT  952
               GS K LPK CTS+MK  LCFF +   + +KTP F  MSAFD  Q+   +   I   + 
Sbjct  242   LHGSTKVLPKSCTSRMKPELCFFLENIQRDIKTPFFTVMSAFDSYQVNSIIGSDIGEYIQ  301

Query  953   YNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGN  1132
               NCT ++    +ELR +FL  LPK N       ++++   H      W+       + N
Sbjct  302   ARNCTESQNNAFKELRSEFLRALPKANDPKQRGAFIDSFNRHT-QLELWWNKINATPVYN  360

Query  1133  KTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
              T  +VF DWY+DR  S   VI++ + PL
Sbjct  361   LTTIKVFGDWYYDRKYS--YVIDEHDLPL  387



>emb|CDX99378.1| BnaC01g11740D [Brassica napus]
Length=391

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 229/374 (61%), Gaps = 16/374 (4%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M +L Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGKLKQCWSSVLVLSMVVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    N NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V+ V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T RVKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTARVKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPVSC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TSKMK  LCFFPQY +  ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSKMKPELCFFPQYVVPSMRTPLFVINAAFDSWQIKNVLAPTGVDKRKEWANCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             +  ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLKTVQGFRDQMMRALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQV-ANTK  355

Query  1139  YAEVFADWYFDRNT  1180
              ++   +W++ R+ 
Sbjct  356   ISKAVGNWFYGRSA  369



>ref|XP_002867938.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44197.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/370 (42%), Positives = 235/370 (64%), Gaps = 17/370 (5%)
 Frame = +2

Query  149   KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHC  328
             K EG + V +T + +AV+KGAVCLDGS P Y+ D+G G G+++W+I +EGGGWC N  +C
Sbjct  2     KTEG-LFVNITYVRNAVAKGAVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNC  60

Query  329   KYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPA  508
               R  +RLGSSK M        +LS+    NP+FYNW+RV+V YCDGSSFT DV  V+PA
Sbjct  61    VSRMHTRLGSSKKMVENLAFSAILSNKKQYNPDFYNWNRVKVRYCDGSSFTGDVQAVNPA  120

Query  509   TNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKC  688
             TNL +RG R++ A+M++  AKGM NA+NA+ +G SAGG+A ++HCD FRAL P  T+VKC
Sbjct  121   TNLHFRGARVWLAVMQELLAKGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKC  180

Query  689   LADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVK  868
             L+D+ +F+N   + G +  +S F+ +V   GSAK LP+ CTS++  ++CFFPQY  + ++
Sbjct  181   LSDAGFFLNTRDVSGVQYIKSYFEDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIR  240

Query  869   TPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLP  1024
             TP+F+  +A+D  Q+K  L            SC +   NC  +++K+ Q+ RL+FLS + 
Sbjct  241   TPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVI  300

Query  1025  KKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVI  1198
                  SS  +++++C +H    T  SW+  +   ++   T A+   DW +DR      + 
Sbjct  301   GLGRSSSRGMFIDSCYTHCQTETQTSWFW-QDSPILNRTTIAKAVGDWVYDRT-----LF  354

Query  1199  EKSNKPLNCS  1228
             +K + P  C+
Sbjct  355   QKIDCPYPCN  364



>ref|XP_006398195.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
 gb|ESQ39648.1| hypothetical protein EUTSA_v10000914mg [Eutrema salsugineum]
Length=391

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 240/399 (60%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T LESAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGRLRQLWSSLMVLAVVVI----GTGAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDIATCVKRKSTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT D++ VDP   L +RG R++ A+++D  AKGM NA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGDIEAVDPTNKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+++ P T +VKC++D+ +FI+ + + G    +S +  +V + GSAK LP  C
Sbjct  177   AILHCDEFKSIIPKTAKVKCVSDAGFFIHGKDISGGSYIESYYGKVVATHGSAKSLPVSC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS MK  LCFFPQY ++ ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSSMKPELCFFPQYVVKTMQTPLFVINAAFDSWQIKNVLAPTSVDKRKEWKTCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             T  +++  Q  R   L+ L    + ++  +++++C +H    +  +W G +  +V G+  
Sbjct  297   TAAQLQTVQGYRDQMLAALAPVRATTTRGLFLDSCHAHCQGGSAATWSGAQGPQV-GDTK  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              A+   DW+++R+T          + ++C +   NP  P
Sbjct  356   MAKAVGDWFYERSTF---------QNVDCPSLNCNPTCP  385



>ref|NP_199341.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 dbj|BAB10249.1| pectin acetylesterase [Arabidopsis thaliana]
 gb|AAL15296.1| AT5g45280/K9E15_6 [Arabidopsis thaliana]
 gb|AED95226.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/385 (40%), Positives = 230/385 (60%), Gaps = 20/385 (5%)
 Frame = +2

Query  131   LLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWC  310
             +L +   + G   V +T LESAV+KGAVCLDGSAP Y++DKG G GV+NW++ +EGGGWC
Sbjct  11    ILVLAVVVIGARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWC  70

Query  311   MNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDV  490
              +   C  R  +  GSSK M   F    +L    + NP+FYNW+R++V YCDGSSFT D+
Sbjct  71    TDIATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDI  130

Query  491   DGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPN  670
             + VDP   L +RG R++ A+++D  AKGM NA+NAI +G SAG +A +LHCD F++  P 
Sbjct  131   EAVDPTHKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQFKSTLPK  190

Query  671   TTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQY  850
             T +VKC++D+ YFI+ + + G    QS +  +V + GSAK LP  CTS MK  LCFFPQY
Sbjct  191   TAKVKCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPASCTSSMKPDLCFFPQY  250

Query  851   SLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLD  1006
               + ++TP+F+  +AFD  Q+K  L    V       +C +    CT  +++  Q  R  
Sbjct  251   VAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQ  310

Query  1007  FLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNT  1180
              L+ L    S ++  +++++C +H    +  +W G K    + N   A+   DW+F+R+T
Sbjct  311   VLAALAPVRSATTNGLFLDSCHAHCQGGSAATWSGDKG-PTVANTKMAKAVGDWFFERST  369

Query  1181  SPIRVIEKSNKPLNCSTFEQNPRKP  1255
                       + ++CS+   NP  P
Sbjct  370   F---------QNVDCSSLNCNPTCP  385



>ref|XP_010481611.1| PREDICTED: uncharacterized protein LOC104760390 [Camelina sativa]
Length=391

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/370 (41%), Positives = 227/370 (61%), Gaps = 20/370 (5%)
 Frame = +2

Query  176   LTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLG  355
             +T LESAV+KGAVCLDGSAP Y++DKG G GV+NW++ +EGGGWC +   C  R  +  G
Sbjct  26    ITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVHMEGGGWCTDIATCVQRKSTMKG  85

Query  356   SSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVR  535
             SSK M   F    +L    + NP+FYNW+R++V YCDGSSFT D++ VDPA  L +RG R
Sbjct  86    SSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDGSSFTGDIEAVDPANKLFFRGAR  145

Query  536   IFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFIN  715
             ++ A+++D  AKGM+NA+NAI +G SAG +A +LHCD F+++ P T +VKC++D+ YFI+
Sbjct  146   VWRAVIDDLMAKGMRNAQNAILSGCSAGALAAILHCDQFKSILPKTAKVKCVSDAGYFIH  205

Query  716   DEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSA  895
              + + G    QS +  +V + GSAK LP  CTS MK  LCFFPQY  + ++TP+F+  +A
Sbjct  206   GKDISGGSYIQSYYGKVVATHGSAKSLPASCTSTMKPELCFFPQYVAKTLQTPLFVINAA  265

Query  896   FDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIA  1051
             FD  Q+K  L    V       +C +    CT  +++  Q  R   L+ L    + ++  
Sbjct  266   FDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQTVQGYRDQVLAALAPVRAATTSG  325

Query  1052  IWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPLNC  1225
             +++++C +H    +  +W G K    + N   A+   DW+++R+T          + ++C
Sbjct  326   LFLDSCHAHCQGGSAATWSGDKG-PTVANTKMAKAVGDWFYERSTF---------QNIDC  375

Query  1226  STFEQNPRKP  1255
             S+   NP  P
Sbjct  376   SSLNCNPTCP  385



>ref|XP_009350399.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=398

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 236/378 (62%), Gaps = 15/378 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             RL QWL   V LL +L+     + +TL  +E+AV+KGAVCLDGSAP Y++DKG G G++N
Sbjct  5     RLGQWLTLLVCLLILLKAESHPVGITL--VENAVAKGAVCLDGSAPAYHFDKGFGAGINN  62

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++ IEGGGWC +   C  R  +  GSS  M        +L +    NP+FYNW+R++V 
Sbjct  63    WLVHIEGGGWCNSVATCLDRKNNYRGSSTKMEKTMSFSGVLGNKQQTNPDFYNWNRIKVR  122

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VDPATNL +RG R+F A+++D  AKGMKNA+ A+ +G SAGG+A +L
Sbjct  123   YCDGSSFTGDVEAVDPATNLHFRGARVFRAIIDDLLAKGMKNAQTALLSGCSAGGLASIL  182

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD F +L P  T+VKCLAD+ YFIN + L G +  Q+ +  +V   GSAK LP  CTS+
Sbjct  183   HCDNFHSLLPVGTKVKCLADAGYFINAKTLSGSQYIQTFYSEVVALHGSAKNLPASCTSR  242

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             M   LCFFPQ  +   +TPIF   +A+D  Q+K  L   +        +C ++  NC+ +
Sbjct  243   MSPGLCFFPQNVVPQTRTPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPS  302

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAE  1147
             +++  QE RL FL+ +   +S SS  +++++C +H    T  +W       ++   T A+
Sbjct  303   QLQTMQEYRLQFLNAIAGASSSSSNGLFIDSCYAHCQIGTQETWLATDS-PMLSKTTIAK  361

Query  1148  VFADWYFDRNTSPIRVIE  1201
                DWY+DR  +P + I+
Sbjct  362   AVGDWYYDR--TPFKNID  377



>ref|XP_006413981.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
 gb|ESQ55434.1| hypothetical protein EUTSA_v10024796mg [Eutrema salsugineum]
Length=564

 Score =   312 bits (799),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/371 (42%), Positives = 228/371 (61%), Gaps = 14/371 (4%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M RL Q     +VL  +   + G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G+
Sbjct  1     MGRLKQCWSSLLVLAAM---VIGTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSGI  57

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    N NP+FYNW+R++
Sbjct  58    NNWIVHMEGGGWCTDVASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRIK  117

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT +V+ V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A 
Sbjct  118   VRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALAA  177

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +LHCD FRA+ P T RVKC++D+ YFI+ + + G    QS +  +V   GSAK LP  CT
Sbjct  178   ILHCDTFRAILPRTARVKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPLSCT  237

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             SKM+  LCFFPQY + +++TP+F+  +AFD  Q+K  L    V       +C +    C+
Sbjct  238   SKMRPELCFFPQYVVPFMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKTCKLDLKKCS  297

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
               ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N   
Sbjct  298   AAQLKTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQV-ANTKI  356

Query  1142  AEVFADWYFDR  1174
             A+   +W++ R
Sbjct  357   AKAVGNWFYGR  367



>ref|XP_009132784.1| PREDICTED: uncharacterized protein LOC103857370 [Brassica rapa]
Length=391

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 229/374 (61%), Gaps = 16/374 (4%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M +L Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGKLKQCWSSVLVLSMVVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    N NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V+ V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T RVKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTARVKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TSKMK  LCFFPQY +  ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSKMKPELCFFPQYVVPSMRTPLFVINAAFDSWQIKNVLAPTGVDKRKEWANCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             +  +++  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLRTVQGFRDQMMRALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQV-ANTK  355

Query  1139  YAEVFADWYFDRNT  1180
              ++   +W++ R+ 
Sbjct  356   ISKAVGNWFYGRSA  369



>ref|XP_010439720.1| PREDICTED: uncharacterized protein LOC104723107 [Camelina sativa]
Length=391

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 162/399 (41%), Positives = 237/399 (59%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGRLKQCWSSLLVLAVVVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCIERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V  V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVAAVNPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T RVKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTARVKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-SCVTYNNCTLN----  973
             TSKMK  LCFFPQY +  ++TP+F+  +AFD  Q+K  L    V     + NC L+    
Sbjct  237   TSKMKPELCFFPQYVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKC  296

Query  974   ---EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
                ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLKTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQV-ANTR  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              ++   +W++ R+         + + ++C +   NP  P
Sbjct  356   ISKAVGNWFYGRS---------AFQKIDCPSPTCNPTCP  385



>ref|NP_567585.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AAK96722.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAL47339.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AAM64921.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 dbj|BAF00825.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
 gb|AEE84177.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=391

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 228/374 (61%), Gaps = 16/374 (4%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGRLKQCWSSLLVLAVLVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V+ V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T  VKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTASVKCVSDAGYFIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TSKMK  LCFFPQY +  ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSKMKPELCFFPQYVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKGKEWKNCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             +  ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLKTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQV-ANTR  355

Query  1139  YAEVFADWYFDRNT  1180
              A+   +W++ R+ 
Sbjct  356   IAKAVGNWFYGRSA  369



>ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAD07550.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAD08059.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAF09764.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAG91018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57637.1| hypothetical protein OsJ_08062 [Oryza sativa Japonica Group]
Length=397

 Score =   306 bits (784),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/386 (40%), Positives = 235/386 (61%), Gaps = 17/386 (4%)
 Frame = +2

Query  116   CFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIE  295
             C  +V   +   ++G   V +T + SAV+KGAVCLDGS P Y+  +G G GV++W++  E
Sbjct  10    CSALVCALVFLTVDGDF-VDITYVASAVAKGAVCLDGSPPAYHLARGFGSGVNSWLVHFE  68

Query  296   GGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSS  475
             GGGWC N   C  R  +RLGSSK M        +LS++P+ NP+FYNW++V+V YCDGSS
Sbjct  69    GGGWCSNVTTCLQRKRTRLGSSKQMAKQIAFSGILSNTPDYNPDFYNWNKVKVRYCDGSS  128

Query  476   FTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFR  655
             FT DV+ VDPAT L YRG R++ A+M+D  AKGM +A NA+ +G SAGG+  +LHCD FR
Sbjct  129   FTGDVEKVDPATKLHYRGARVWQAVMDDLLAKGMNSANNALISGCSAGGLTSILHCDRFR  188

Query  656   ALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLC  835
              LFP  T+VKCL+D+ +FIN++ + G +   + F+ +  + GSAK LP  CTS++   +C
Sbjct  189   DLFPVDTKVKCLSDAGFFINEKDIAGVEYIVAFFNGVATTHGSAKNLPSACTSRLSPGMC  248

Query  836   FFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCV-TYNNCTLNEMKIAQ  991
             FFPQ  ++ ++TP+F+  +A+D  Q++  L            SC    + C  ++++I Q
Sbjct  249   FFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGFADPHGKWHSCKHDIDQCPASQLQILQ  308

Query  992   ELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWY  1165
               R DFL  L ++ + S+  +++N+C  H    T  +W+      ++  KT A+   DW+
Sbjct  309   GFRDDFLKALKEQGTPSTRGLFINSCFVHCQSETQETWFASGS-PMLETKTIADAVGDWF  367

Query  1166  FDRNTSPIRVIEKSNKPLNCSTFEQN  1243
             +DRN       +K + P  C +   N
Sbjct  368   YDRNP-----FQKIDCPYPCDSTCHN  388



>emb|CDX78932.1| BnaA01g09990D [Brassica napus]
Length=391

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 229/374 (61%), Gaps = 16/374 (4%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M +L Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGKLKQCWSSVLVLSMVVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    N NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCIKRKGTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V+ V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T RVKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTARVKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPISC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TSKMK  LCFFPQY +  ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSKMKPELCFFPQYVVPSMRTPLFVINAAFDSWQIKNVLVPTGVDKRKEWANCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             +  +++  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLRTVQGFRDQMMRALSPIHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQV-ANTK  355

Query  1139  YAEVFADWYFDRNT  1180
              ++   +W++ R+ 
Sbjct  356   ISKAVGNWFYGRSA  369



>ref|XP_008373439.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
 ref|XP_008373440.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
Length=438

 Score =   307 bits (787),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 162/379 (43%), Positives = 229/379 (60%), Gaps = 15/379 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL QWL   V  + +L+     + V +T + SAV+KGAVCLDGS P Y+ DKG+G G++
Sbjct  4     ARLGQWLSVLVCAVMLLK--AAALPVGITYVHSAVAKGAVCLDGSPPAYHLDKGYGSGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N   C  R  +RLGSSK M        +L+     NP+FYNW+RV+V
Sbjct  62    NWLVHIEGGGWCNNITTCLVRKNNRLGSSKKMLKEIAFSGILNSRHIFNPDFYNWNRVKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV  V+ AT L +RG RIF A++E+  AKGM  AKNAI +G SAGG+A +
Sbjct  122   RYCDGASFTGDVAAVNLATGLFFRGARIFRAVIEELLAKGMGKAKNAILSGCSAGGLASI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F AL P   +VKC++D+ YFIN + + G +  +  F  +V + GSAK LP  CTS
Sbjct  182   LHCDNFHALLPVGAKVKCVSDAGYFINAKDVSGARHVEQFFSQVVATHGSAKNLPPSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN------  973
             K+   LCFFPQY    ++TP+F   +A+D  Q+K  L   +     T+ NC L+      
Sbjct  242   KLSPGLCFFPQYFASQIRTPMFYVNAAYDSWQIKNILAPGVADPHGTWQNCKLDITHCKP  301

Query  974   -EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
              ++K  Q+ R  FLS +   +   S  +++++C +H  T    +W  P    V+   T A
Sbjct  302   TQLKTMQDFRAQFLSAIGGVSGSRSKGMFIDSCYAHCQTELQETWLMPDS-PVLNKTTIA  360

Query  1145  EVFADWYFDRNTSPIRVIE  1201
             +   DW++DR  +P + I+
Sbjct  361   KAVGDWFYDR--TPFQKID  377



>ref|XP_009108426.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDX76482.1| BnaA08g09180D [Brassica napus]
Length=391

 Score =   305 bits (782),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 227/374 (61%), Gaps = 16/374 (4%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M +L Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MEKLKQCWSSLLVLAVVVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    N NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCSARKNTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V+ V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T RVKC++D+ YFI+   + G    Q+ +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPPTARVKCVSDAGYFIHGTDISGGSYIQTYYSKVVALHGSAKSLPVSC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TSKMK  LCFFPQ  +  ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSKMKPELCFFPQNVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             T  ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   TAAQLKTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQV-ANSK  355

Query  1139  YAEVFADWYFDRNT  1180
              ++   +W++ R+ 
Sbjct  356   ISQAVGNWFYGRSA  369



>ref|XP_011028482.1| PREDICTED: uncharacterized protein LOC105128479 isoform X2 [Populus 
euphratica]
Length=481

 Score =   308 bits (790),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 161/368 (44%), Positives = 229/368 (62%), Gaps = 16/368 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T ++SAV+KGAVCLDGS P Y++DKG G G+++W+I  EGGGWC N   C  R  + 
Sbjct  109   VGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCLSRKKTH  168

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        ++++    NP+FYNW+RV++ YCDGSSFT DV  V+PATNL +RG
Sbjct  169   LGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  228

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RI+ A++ED   KG+KNA+NA+ +G SAGG+A +LHCD FRAL    T+VKCL+D+ YF
Sbjct  229   ARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGYF  288

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I  + + G    Q+ F+ +V   GSAK LP  CTS +K S CFFPQY    V+TP+F+  
Sbjct  289   IKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSFCFFPQYVAPQVRTPLFILN  348

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q++  L   I        SC +  NNC+  ++K  Q+ RL FL+ L    + SS
Sbjct  349   AAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALKTSTNSSS  408

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               +++++C +H    T   W+  +   V+G K  A+   DW++DRN       +K + P 
Sbjct  409   RGLYIDSCYAHCQTETQEKWFM-EDSPVLGKKKIAKAVGDWFYDRNP-----FQKIDCPY  462

Query  1220  NCSTFEQN  1243
              C+   QN
Sbjct  463   PCNPSCQN  470



>ref|XP_010536189.1| PREDICTED: uncharacterized protein LOC104811235 isoform X1 [Tarenaya 
hassleriana]
Length=391

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 161/398 (40%), Positives = 232/398 (58%), Gaps = 23/398 (6%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M R +QW    +VL  +     G   V +T L SAV++GAVCLDGS P Y++DKG G GV
Sbjct  1     MGRQNQWWASVIVLALV---AIGAGAVPITYLNSAVARGAVCLDGSPPAYHFDKGFGSGV  57

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++ +EGGGWC +   C  R  +  GSSK M   F    +L    + NP+FYNW+R++
Sbjct  58    NNWIVHMEGGGWCNDIASCSERKNTMKGSSKLMNKDFGFSGILGSQQSTNPDFYNWNRIK  117

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV+ V+P+  L +RG R++ A+++D  AKGM  A+NAI +G SAG +A 
Sbjct  118   VRYCDGSSFTGDVEAVNPSNKLFFRGARVWRAVIDDLMAKGMNKAQNAILSGCSAGALAA  177

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +LHCD F A+ P T +VKC++D+ YFI+ + + G    +S +  +V   GSAK LP  CT
Sbjct  178   ILHCDQFHAILPRTAKVKCVSDAGYFIHGKDITGGSYIESYYSKVVALHGSAKTLPVSCT  237

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S+MK  LCFFPQY +  ++TP+F+  +AFD  Q+K  L    V        C +    CT
Sbjct  238   SRMKPELCFFPQYVVPSMRTPLFVVNAAFDSWQIKNVLAPSAVDKRKEWKDCKLDLKKCT  297

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
               +++  Q  R   L  L   +S +S  +++++C +H    +  SW G K   V GN   
Sbjct  298   PAQLRTVQGFRDQILRALAPVHSTTSRGLFLDSCHAHCQGGSAASWSGSKGPSV-GNTKI  356

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
             A+   DW++DR  SP +  +       C T+  NP  P
Sbjct  357   AKAVGDWFYDR--SPFQKTD-------CPTYPCNPTCP  385



>ref|XP_006363883.1| PREDICTED: uncharacterized protein LOC102589191 [Solanum tuberosum]
Length=476

 Score =   308 bits (790),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 153/347 (44%), Positives = 217/347 (63%), Gaps = 11/347 (3%)
 Frame = +2

Query  164   INVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGP  343
             +NV +T LESA ++GAVCLDGS P Y+  +GHG G+DNW+I+++GGGWC +   C YR  
Sbjct  6     LNVNITILESATAQGAVCLDGSPPAYHLHRGHGTGLDNWIIYLDGGGWCESIPECLYRTT  65

Query  344   SRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTY  523
             + LGS+K M        +L ++  +NPEF+NW+RVRV YCDGSSFT DV+ V P   L +
Sbjct  66    TYLGSTKKMGQQAFFSGILHNTSKQNPEFHNWNRVRVKYCDGSSFTGDVEQVHPENKLYF  125

Query  524   RGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSS  703
             RG RIF A+MED  +KGMKNA+NAI +G SAGG+A +L+CD F+ L P   RVKC+AD+S
Sbjct  126   RGARIFKAIMEDLSSKGMKNAENAILSGTSAGGLATILNCDKFKCLLPENARVKCVADAS  185

Query  704   YFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFL  883
             +FIN + + G    Q  +  +V+   SAK LP  CTS M+ SLCFFP+  + YV+TP+F+
Sbjct  186   FFINGKSIYGTSFTQEMYQNIVNLHESAKNLPPACTSAMEPSLCFFPENVMPYVQTPLFI  245

Query  884   TMSAFDQIQLKYGLTMPIV-------SCV-TYNNCTLNEMKIAQELRLDFLSLLPKKNSE  1039
               S +D  Q+   L  P +       +C+ + ++CT +++ I Q   ++F          
Sbjct  246   INSIYDSWQINNTLVPPYLDKQHAWKACIKSISSCTSSQLIIIQAFGVEFSKTFEGLPPC  305

Query  1040  SSIAIWVNNCVSHEFTYHS--WYGPKKLRVIGNKTYAEVFADWYFDR  1174
             S+   ++ +C SH     +  W     L +  NKT AE  ADWYF+R
Sbjct  306   STRGYFLTSCYSHGGIRLTPYWLKTSSLTLF-NKTIAEAVADWYFER  351



>ref|XP_006283887.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
 gb|EOA16785.1| hypothetical protein CARUB_v10005004mg [Capsella rubella]
Length=391

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 161/399 (40%), Positives = 237/399 (59%), Gaps = 25/399 (6%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL+Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGRLTQCWSSLLVLAVVVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCLARKNTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V  V+P+  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVAAVNPSNKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T RVKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTARVKCVSDAGYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPLSC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-SCVTYNNCTLN----  973
             TSKMK  LCFFPQY +  ++TP+F+  +AFD  Q+K  L    V     + NC L+    
Sbjct  237   TSKMKPELCFFPQYVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKC  296

Query  974   ---EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
                +++  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLRTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQV-ANTR  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
              A    +W++ R+         + + ++C +   NP  P
Sbjct  356   IATAVGNWFYGRS---------AFQKIDCPSPTCNPTCP  385



>ref|XP_002867940.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44199.1| hypothetical protein ARALYDRAFT_492921 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   305 bits (782),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 228/374 (61%), Gaps = 16/374 (4%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGRLKQCWSSLLVLAVVVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V+ V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T  VKC++D+ YFI+ + + G    +S +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTASVKCVSDAGYFIHGKDITGGSYIESYYSKVVALHGSAKSLPVSC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TSKMK  LCFFPQY +  ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSKMKPELCFFPQYVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKGKQWKNCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             +  ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLKTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQV-ANTR  355

Query  1139  YAEVFADWYFDRNT  1180
              A+   +W++ R+ 
Sbjct  356   IAKAVGNWFYGRSA  369



>ref|XP_008808358.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=397

 Score =   305 bits (782),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 235/374 (63%), Gaps = 21/374 (6%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             A+L  W+ + ++ L I  K EG   V +T +ESAV+KGAVCLDGS P Y+   G G GV+
Sbjct  4     AKLRTWI-YALICLLIFLKAEGYF-VDITYVESAVAKGAVCLDGSPPAYHLSPGFGSGVN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N   C  R  +RLGSS+ M        +L++    NP+FYNW++V+V
Sbjct  62    NWLVHIEGGGWCNNVTTCLARKSTRLGSSRQMVKQIAFSGILNNRQTFNPDFYNWNKVKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV  V+P TNL YRG R++ A+MED  A+GM  A+NA  +G SAGG+  +
Sbjct  122   RYCDGSSFTGDVKRVNPTTNLHYRGARVWLAVMEDLLARGMSKAENAFLSGCSAGGLTSI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRAL P  TRVKCL+D+ YFIN + + G +  ++ F+ +V + GSA+ LP  CTS
Sbjct  182   LHCDNFRALLPLGTRVKCLSDAGYFINLKDITGTEHIKAFFNDVVTTHGSAQNLPSSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS--CVTYNNCTLN-----  973
             ++  S+CFFPQ  +Q ++TP+F+  +A+D  Q+K  + +P V+    T+++C L+     
Sbjct  242   RLTPSMCFFPQNMVQKIRTPLFILNAAYDSWQIK-NILVPGVADPHGTWHDCKLDIQQCS  300

Query  974   --EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-----EFTYHSWYGPKKLRVIGN  1132
               +++I Q  R  FL+ L    S SS  +++N+C +H     + T+ S   P    V+  
Sbjct  301   SSQLQIMQGFRTQFLNALAGFGSSSSTGMFINSCYAHCQSEMQETWLSSNSP----VLEK  356

Query  1133  KTYAEVFADWYFDR  1174
                A+   DW++DR
Sbjct  357   IPIAKAVGDWFYDR  370



>ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781246 isoform X1 [Glycine 
max]
 ref|XP_006599204.1| PREDICTED: uncharacterized protein LOC100781246 isoform X2 [Glycine 
max]
 ref|XP_006599205.1| PREDICTED: uncharacterized protein LOC100781246 isoform X3 [Glycine 
max]
Length=399

 Score =   305 bits (782),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 163/399 (41%), Positives = 238/399 (60%), Gaps = 18/399 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             + R+ QWL   ++ + +L + EG + V +T +E+AV+KGAVCLDGS P Y++ KG G G+
Sbjct  3     ITRIGQWL-SLLICVLLLLQTEG-VPVGITFVENAVAKGAVCLDGSPPAYHFHKGSGAGI  60

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++  EGGGWC N   C  R  +RLGSSK M          S+S   NP+FY+W+R++
Sbjct  61    NNWIVHFEGGGWCNNVTTCLSRRDTRLGSSKKMDTSLSFSGFFSNSKKFNPDFYDWNRIK  120

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV+ VDP TNL +RG R+F  ++ED  AKGMKNA+NAI +G SAGG+A 
Sbjct  121   VRYCDGSSFTGDVEAVDPKTNLHFRGARVFAVVVEDLLAKGMKNAQNAIISGCSAGGLAS  180

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +L+CD F++L P TT+VKCLAD+ +FIN + + G +  +  +  +V + GSAK LP  CT
Sbjct  181   ILNCDRFKSLLPATTKVKCLADAGFFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPTSCT  240

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S+++  LCFFPQ  +  + TPIF   +A+D  Q+K  L             C +   NC+
Sbjct  241   SRLRPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPRGQWRECKLDIKNCS  300

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTY  1141
              N++ + Q  R DFL       + +S   +++ C +H  T    +W       V+   + 
Sbjct  301   PNQLSVMQGFRTDFLRAFSVVGNAASKGHFIDGCYAHCQTGIQETWL-RNDSPVVAKTSI  359

Query  1142  AEVFADWYFDRNTSPIRVIE---KSNKPLNCSTFEQNPR  1249
             A+   DW++DR   P R I+     N   +   F+QN R
Sbjct  360   AKAVGDWFYDRR--PFREIDCAYPCNPTCHNRIFDQNER  396



>ref|XP_010325632.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=402

 Score =   305 bits (782),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 162/373 (43%), Positives = 228/373 (61%), Gaps = 13/373 (3%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             +   + QW+ + +V  +I+   E  + V +T + S V+KGAVCLDGS P Y++DKG G G
Sbjct  2     VNGTVQQWI-YSLVTFSIIFGTEA-LFVNITYVLSGVAKGAVCLDGSPPAYHHDKGFGTG  59

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V++W+I +EGGGWC N   C  R  +RLGSSK M        +LS+ P  NP+FYNW+RV
Sbjct  60    VNSWLIQMEGGGWCNNVTTCLSRKNTRLGSSKQMVENLAFSGILSNKPQFNPDFYNWNRV  119

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT DV  V+P T L +RG R+F A+ME+  AKGMKNA+NAI +G SAGG+ 
Sbjct  120   KVGYCDGSSFTGDVQEVNPITKLHFRGARVFLAVMEELLAKGMKNAENAILSGCSAGGLT  179

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F+AL P   +VKC +D+ YFI+ + + G    +  F  +V   GSAK LP  C
Sbjct  180   SILHCDSFKALLPMGAKVKCFSDAGYFIDVKDISGAPHIEEYFRDVVSLHGSAKNLPPVC  239

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN----  973
             TS++K  LCFFPQ   Q+V+TP+FL  +A+D  Q+K  L   +      + NC L+    
Sbjct  240   TSRLKPDLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPDVADPYGVWLNCKLDILKC  299

Query  974   ---EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKT  1138
                +++I    RL FL  L      SS   ++N+C +H  T    +WY     + + NKT
Sbjct  300   SSRQLQIMHGYRLLFLRALNALGPSSSRGYFINSCYAHCQTEVQETWYRADSPK-LANKT  358

Query  1139  YAEVFADWYFDRN  1177
              A+   DW++D+N
Sbjct  359   IAKALGDWFYDKN  371



>gb|KHN27511.1| Protein notum like [Glycine soja]
Length=398

 Score =   305 bits (782),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 241/387 (62%), Gaps = 19/387 (5%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+S WL   +V + +L K EG  +V LT ++++ +KGAVCLDGS P Y++DKG G+G++
Sbjct  4     ARISHWL-NLLVCVLLLLKAEGS-SVPLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N   C  R  + LGSS +M  +     +LS+    NP+FYNW+RV+V
Sbjct  62    NWIVHIEGGGWCNNVTSCLDRKNTTLGSSNHMSDI-SFYAILSNQQQFNPDFYNWNRVKV  120

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP TNL +RG RIF A+ME+  AKGMKNAKNAI +G SAGG+  +
Sbjct  121   RYCDGSSFTGDVEEVDPTTNLHFRGARIFSAVMEELLAKGMKNAKNAILSGCSAGGLTTI  180

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+AL P+   VKC+ D+ YF+N E + G   FQ  +  +V   GSAK LP  CTS
Sbjct  181   LHCDSFKALLPSRANVKCVPDAGYFVNVEDISGAHSFQEFYSEVVSIHGSAKNLPTSCTS  240

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV--------SC-VTYNNCT  967
             K+  +LCFFPQY   ++ TPIF+  SA+D  Q+   + +P          SC +  +NC+
Sbjct  241   KLNPALCFFPQYVASHISTPIFVVNSAYDWWQIG-NIFVPSSADPSNSWHSCKLNLSNCS  299

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              +++   Q  + +F   L +     S  +++++C +H    T  +W+     +++ NKT 
Sbjct  300   PDQLSKLQGFKSEFQRALSEVGDSPSKGMFIDSCYAHCQTETQETWFKSGS-QLLANKTI  358

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLN  1222
             A+   DW++ R  SP   I+  N P N
Sbjct  359   AKAVGDWFYGR--SPFHHID-CNFPCN  382



>ref|XP_006587655.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=453

 Score =   307 bits (786),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 159/373 (43%), Positives = 234/373 (63%), Gaps = 16/373 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+SQWL   +++  +L  I     V +T +++AV+KGAVCLDGS P Y++D+G G G++
Sbjct  4     ARISQWL--ILLVCALLLLISEASYVPITIVQNAVAKGAVCLDGSPPAYHFDRGFGSGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++  EGGGWC N   C  R  +RLGSSK M  +     +L++    NP+FYNW+R++V
Sbjct  62    NWLVAFEGGGWCNNVTTCLARKTNRLGSSKQMAKLIAFSGILNNREMFNPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKN---AIFAGNSAGGV  625
              YCDGSSFT DV+ V+P T L +RG RIF+A+MED  AKGMKNA+N   AI +G SAGG+
Sbjct  122   RYCDGSSFTGDVEAVNPVTKLHFRGGRIFNAVMEDLLAKGMKNARNVREAIISGCSAGGL  181

Query  626   AVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKE  805
               +LHCD FRAL P   RVKCL+D+ YFIN + + G++  +  F  +V + GSA+ LP+ 
Sbjct  182   TSVLHCDRFRALLPRGARVKCLSDAGYFINGKDVLGEQHIEQYFSQVVATHGSARNLPQS  241

Query  806   CTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNN  961
             CTS++   LCFFPQY +  + TPIF   +A+D  Q+K  L   +        SC +  NN
Sbjct  242   CTSRLSPRLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDINN  301

Query  962   CTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNK  1135
             C+ +++ + Q  R +FL  +    + SS  +++++C +H  T    +W        +   
Sbjct  302   CSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPE-LKKT  360

Query  1136  TYAEVFADWYFDR  1174
             T A+  ADW+++R
Sbjct  361   TIAKAVADWFYER  373



>ref|XP_007040902.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25403.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=401

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/353 (44%), Positives = 225/353 (64%), Gaps = 12/353 (3%)
 Frame = +2

Query  149   KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHC  328
             K +G + V +T ++SAV+KGAVCLDGS P Y++D+G+G G+++W+I +EGGGWC N   C
Sbjct  21    KTQG-VYVPITYVQSAVAKGAVCLDGSPPAYHWDRGYGTGINSWLIQLEGGGWCNNVTSC  79

Query  329   KYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPA  508
               R  + LGSSK M        +L++    NP+FYNW+RV+V YCDGSSFT DV  V+P 
Sbjct  80    LVRKNTHLGSSKRMVKQIPFSGILNNKHQFNPDFYNWNRVKVRYCDGSSFTGDVAAVNPV  139

Query  509   TNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKC  688
             TNL +RG R++ A+MED  AKGM+NA+NA+ +G SAGG+A +LHCD F AL P  T+VKC
Sbjct  140   TNLHFRGARVWLAVMEDLLAKGMRNAENAVLSGCSAGGLASILHCDSFPALLPMGTKVKC  199

Query  689   LADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVK  868
             L+D+ YFIN + + G    ++ F+ LV + GSAK L   CTS+M+  LCFFP+Y  Q ++
Sbjct  200   LSDAGYFINAKDVSGGHYIEAFFNQLVATHGSAKNLLPSCTSRMRPGLCFFPEYMAQQIQ  259

Query  869   TPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLP  1024
             TP+F   +A+D  Q++  L   I        SC +   NC  +++K  Q+ RL FL  L 
Sbjct  260   TPLFFINAAYDSWQIRNILAPGIADPRGYWESCKLDIKNCLPSQIKTMQDFRLQFLVALL  319

Query  1025  KKNSESSIAIWVNNCVSHEFTYHS--WYGPKKLRVIGNKTYAEVFADWYFDRN  1177
             +    SS  +++++C +H  T     W  P    ++   + A+   DW++DRN
Sbjct  320   RLGKSSSRGMFIDSCYAHCQTEMQGLWLMPDS-PLLNKTSIAKAVGDWFYDRN  371



>ref|XP_011028479.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028480.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028481.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
Length=509

 Score =   309 bits (791),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/368 (44%), Positives = 228/368 (62%), Gaps = 16/368 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T ++SAV+KGAVCLDGS P Y++DKG G G+++W+I  EGGGWC N   C  R  + 
Sbjct  109   VGITYVKSAVAKGAVCLDGSPPAYHWDKGSGTGINSWLIHFEGGGWCNNVTSCLSRKKTH  168

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        ++++    NP+FYNW+RV++ YCDGSSFT DV  V+PATNL +RG
Sbjct  169   LGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  228

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RI+ A++ED   KG+KNA+NA+ +G SAGG+A +LHCD FRAL    T+VKCL+D+ YF
Sbjct  229   ARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGYF  288

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I  + + G    Q+ F+ +V   GSAK LP  CTS +K S CFFPQY    V+TP+F+  
Sbjct  289   IKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSMLKPSFCFFPQYVAPQVRTPLFILN  348

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q++  L   I        SC +  NNC+  ++K  Q+ RL FL+ L    + SS
Sbjct  349   AAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALKTSTNSSS  408

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               +++++C +H    T   W+      V+G K  A+   DW++DRN       +K + P 
Sbjct  409   RGLYIDSCYAHCQTETQEKWFMEDS-PVLGKKKIAKAVGDWFYDRNP-----FQKIDCPY  462

Query  1220  NCSTFEQN  1243
              C+   QN
Sbjct  463   PCNPSCQN  470



>gb|KHG09455.1| Protein notum [Gossypium arboreum]
Length=397

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/385 (43%), Positives = 232/385 (60%), Gaps = 19/385 (5%)
 Frame = +2

Query  89    IMARLSQWLCFFV-VLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGE  265
             I   L QWL   V VL  IL K EG  +V +T L+ AV+KGAVCLDGS P Y++DKG G 
Sbjct  2     ISGMLRQWLSLLVCVLAVILLKSEGA-SVGITYLQDAVAKGAVCLDGSPPAYHFDKGSGT  60

Query  266   GVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHR  445
             GVDNW++ +EGGGWC +   C  R  + LGSSK M   F    LLS     NP+FYNW+R
Sbjct  61    GVDNWIVHMEGGGWCEDVPTCLSRKNTDLGSSKQMVKQFGFSGLLSGQQKSNPDFYNWNR  120

Query  446   VRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGV  625
             ++V YCDGSSFT D   VD A NL ++G  I++ ++ D  AKGM+NAKNAI +G SAGG+
Sbjct  121   IKVRYCDGSSFTGDA--VDRANNLFFKGNSIWEFIIADLLAKGMRNAKNAILSGCSAGGL  178

Query  626   AVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKE  805
             A +LHCD FRAL P +T+VKC++D+ +F++ + + G K  +  +  +    GS K LP  
Sbjct  179   ASILHCDRFRALLPASTKVKCISDAGFFLHAQDVSGGKHIEEFYGKVARLHGSVKNLPAS  238

Query  806   CTSKMKA--SLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTY  955
             CTS+M A   LCFFPQY +Q ++TPIF   SA+D  Q+K  L            SC +  
Sbjct  239   CTSRMGARPELCFFPQYVVQTMQTPIFFVNSAYDSWQIKNILAPSAADKSKEWKSCKLDL  298

Query  956   NNCTLNEMKIAQELRLDFLSLLPKKN--SESSIAIWVNNCVSH-EFTYHSWYGPKKLRVI  1126
               CT  ++KI Q+ R  FLS L +    +  S  +++++C +H +      +      V+
Sbjct  299   KKCTETQLKIIQDFRTQFLSALNRAGVINSPSKGMFIDSCYAHCQVGKQIQWSSDSSPVV  358

Query  1127  GNKTYAEVFADWYFDRNTSPIRVIE  1201
              N   A+   DWY++R  SPI+ ++
Sbjct  359   SNMKIAKAVGDWYYER--SPIKKLD  381



>gb|KHN41567.1| Protein notum like [Glycine soja]
Length=399

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/399 (41%), Positives = 239/399 (60%), Gaps = 18/399 (5%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             + R+ QWL   ++ + +L + EG + V +T +E+AV+KGAVCLDGS P Y+++KG G G+
Sbjct  3     ITRICQWL-SLLICVLLLLQTEG-VPVGITFVENAVAKGAVCLDGSPPAYHFNKGSGAGI  60

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++  EGGGWC N   C  R  +RLGSSK M          S+S   NP+FY+W+R++
Sbjct  61    NNWIVHFEGGGWCNNVTTCLSRRDTRLGSSKKMDTSLSFSGFFSNSKKFNPDFYDWNRIK  120

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV+ VDP TNL +RG R+F  ++ED  AKGMKNA+NAI +G SAGG+A 
Sbjct  121   VRYCDGSSFTGDVEAVDPKTNLHFRGARVFAVVVEDLLAKGMKNAQNAIISGCSAGGLAS  180

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +L+CD F++L P TT+VKCLAD+ +FIN + + G +  +  +  +V + GSAK LP  CT
Sbjct  181   ILNCDRFKSLLPATTKVKCLADAGFFINVKDVSGAQRIEEFYSQVVQTHGSAKNLPTSCT  240

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S+++  LCFFPQ  +  + TPIF   +A+D  Q+K  L             C +   NC+
Sbjct  241   SRLRPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIKNCS  300

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTY  1141
              N++ + Q  R DFL       + +S   +++ C +H  T    +W       V+   + 
Sbjct  301   PNQLSVMQGFRTDFLRAFSVVGNGASKGHFIDGCYAHCQTGIQETWL-RNDSPVVAKTSI  359

Query  1142  AEVFADWYFDRNTSPIRVIE---KSNKPLNCSTFEQNPR  1249
             A+   DW++DR   P R I+     N   +   F+QN R
Sbjct  360   AKAVGDWFYDRR--PFREIDCAYPCNPTCHNRIFDQNER  396



>emb|CDY09287.1| BnaC03g63170D [Brassica napus]
Length=391

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 226/374 (60%), Gaps = 16/374 (4%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M +L Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MEKLKQCWSSLLVLAVVVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    N NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCSARKNTMKGSSKFMNKDFGFSGILGGKQNTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V+ V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVIDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T RVKC++D+ YFI+   + G    Q+ +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPPTARVKCVSDAGYFIHGTDISGGSYIQTYYSKVVALHGSAKSLPVSC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCV-TYNNC  964
             TSKMK  LCFFPQ  +  ++TP+F+  +AFD  Q+K  L    V       +C      C
Sbjct  237   TSKMKPELCFFPQNVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKRKEWKNCKHDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             T  ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   TAAQLKTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGAKGPQV-ANSK  355

Query  1139  YAEVFADWYFDRNT  1180
              ++   +W++ R+ 
Sbjct  356   ISQAVGNWFYGRSA  369



>ref|XP_008373438.1| PREDICTED: protein notum homolog isoform X1 [Malus domestica]
Length=466

 Score =   306 bits (785),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/379 (43%), Positives = 229/379 (60%), Gaps = 15/379 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             ARL QWL   V  + +L+     + V +T + SAV+KGAVCLDGS P Y+ DKG+G G++
Sbjct  32    ARLGQWLSVLVCAVMLLK--AAALPVGITYVHSAVAKGAVCLDGSPPAYHLDKGYGSGIN  89

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N   C  R  +RLGSSK M        +L+     NP+FYNW+RV+V
Sbjct  90    NWLVHIEGGGWCNNITTCLVRKNNRLGSSKKMLKEIAFSGILNSRHIFNPDFYNWNRVKV  149

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT DV  V+ AT L +RG RIF A++E+  AKGM  AKNAI +G SAGG+A +
Sbjct  150   RYCDGASFTGDVAAVNLATGLFFRGARIFRAVIEELLAKGMGKAKNAILSGCSAGGLASI  209

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F AL P   +VKC++D+ YFIN + + G +  +  F  +V + GSAK LP  CTS
Sbjct  210   LHCDNFHALLPVGAKVKCVSDAGYFINAKDVSGARHVEQFFSQVVATHGSAKNLPPSCTS  269

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN------  973
             K+   LCFFPQY    ++TP+F   +A+D  Q+K  L   +     T+ NC L+      
Sbjct  270   KLSPGLCFFPQYFASQIRTPMFYVNAAYDSWQIKNILAPGVADPHGTWQNCKLDITHCKP  329

Query  974   -EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
              ++K  Q+ R  FLS +   +   S  +++++C +H  T    +W  P    V+   T A
Sbjct  330   TQLKTMQDFRAQFLSAIGGVSGSRSKGMFIDSCYAHCQTELQETWLMPDS-PVLNKTTIA  388

Query  1145  EVFADWYFDRNTSPIRVIE  1201
             +   DW++DR  +P + I+
Sbjct  389   KAVGDWFYDR--TPFQKID  405



>ref|XP_010536210.1| PREDICTED: uncharacterized protein LOC104811251 [Tarenaya hassleriana]
Length=391

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/398 (40%), Positives = 233/398 (59%), Gaps = 23/398 (6%)
 Frame = +2

Query  92    MARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             M R  QW    VVL  ++    G   V +T L+SAV+KGAVCLDGS P Y++DKG G GV
Sbjct  1     MGRQQQWRSIVVVLALLMI---GAGAVPITYLDSAVAKGAVCLDGSPPAYHFDKGSGSGV  57

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R++
Sbjct  58    NNWIVHMEGGGWCNDIASCSERKNTMKGSSKFMNKDFGFSGILGSKQSSNPDFYNWNRIK  117

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             V YCDGSSFT DV+ V+P+  L +RG R++ A+++D  AKGM  A+NAI +G SAG +A 
Sbjct  118   VRYCDGSSFTGDVEAVNPSNKLFFRGARVWRAVIDDLMAKGMNKAQNAILSGCSAGALAA  177

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +LHCD FRA+ P++  VKC++D+ YFI+ + + G    +S +  +V   GSAK LP+ CT
Sbjct  178   ILHCDQFRAILPSSANVKCVSDAGYFIHGKDISGGSYIESYYSKVVALHGSAKGLPESCT  237

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             S  K  LCFFPQY    ++TP+F+  +AFD  Q+K  L    V       +C +    CT
Sbjct  238   STTKPELCFFPQYVAPSMRTPLFVVNAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCT  297

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
               +++  Q  R   L+ L    S +S  +++++C +H    +  SW G +   V   K  
Sbjct  298   AAQLQTVQGFRDQMLNALAPVQSMASGGLFLDSCHAHCQGGSAASWSGSQGPSVDDTKI-  356

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQNPRKP  1255
             A+   DW+ DR  SP        K ++C T+  NP  P
Sbjct  357   AKAVGDWFNDR--SPF-------KKMDCPTYPCNPTCP  385



>ref|XP_008378614.1| PREDICTED: uncharacterized protein LOC103441693 [Malus domestica]
 ref|XP_008347801.1| PREDICTED: uncharacterized protein LOC103410927 [Malus domestica]
Length=393

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/378 (42%), Positives = 229/378 (61%), Gaps = 13/378 (3%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             +RL QWL   V LL +L+     + +TL  +E+AV+KGAVCLDGSAP Y++DKG G G++
Sbjct  4     SRLGQWLTLLVCLLILLKAEXHPVGITL--VENAVAKGAVCLDGSAPAYHFDKGFGAGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW+++ EGGGWC     C  R    LGSS  M        +LS+    NP+FYNW+R++V
Sbjct  62    NWLVYFEGGGWCNTVATCLDRSNYSLGSSTKMEKTMLFSGVLSNKQKTNPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDPATNL +RG R+F A+M+D  AKGMKNA++A+ +G SAGG+A +
Sbjct  122   RYCDGSSFTGDVEAVDPATNLHFRGARVFRAIMDDLLAKGMKNAQSALLSGCSAGGLASI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FR+L P   +VKC+ D+ YFIN   + G    Q+ +  +V   GSAK LP  CTS
Sbjct  182   LHCDNFRSLLPVDAKVKCVPDAGYFINARTVSGSPYIQAFYSEVVALHGSAKNLPASCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
             +M   LCFFPQ  +   +TPIF   +A+D  Q++  L   +         C +   NC+ 
Sbjct  242   RMSPGLCFFPQNVVPLTRTPIFFVNAAYDWWQIQNILAPDVADPEGAWKKCKLNIKNCSP  301

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAE  1147
             ++++  QE RL FL  +   ++ SS   ++++C +H +      +      ++   T AE
Sbjct  302   SQLQTMQEFRLQFLKTITGASNSSSHGWFIHSCYAHCQIEMQETWLAADSPMLCKTTIAE  361

Query  1148  VFADWYFDRNTSPIRVIE  1201
                DWY+D   +P R I+
Sbjct  362   AVGDWYYD--LTPFRKID  377



>ref|XP_003548585.1| PREDICTED: protein notum homolog [Glycine max]
Length=398

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 240/387 (62%), Gaps = 19/387 (5%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+S WL   +V + +L K EG  +V LT ++++ +KGAVCLDGS P Y++DKG G+G++
Sbjct  4     ARISHWL-NLLVCVLLLLKAEGS-SVPLTLVKNSETKGAVCLDGSPPAYHFDKGFGKGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N   C  R  + LGSS +M  +     +LS+    NP+FYNW+RV+V
Sbjct  62    NWIVHIEGGGWCNNVTSCLDRKNTTLGSSNHMSDI-SFYAILSNQQQFNPDFYNWNRVKV  120

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP TNL +RG RIF A+ME+  AKGMKNAKNAI +G SAGG+  +
Sbjct  121   RYCDGSSFTGDVEEVDPTTNLHFRGARIFSAVMEELLAKGMKNAKNAILSGCSAGGLTTI  180

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+AL P+   VKC+ D+ YF+N E + G   FQ  +  +V   GSAK LP  CTS
Sbjct  181   LHCDSFKALLPSRANVKCVPDAGYFVNVEDISGAHSFQEFYSEVVSIHGSAKNLPTSCTS  240

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV--------SC-VTYNNCT  967
             K   +LCFFPQY   ++ TPIF+  SA+D  Q+   + +P          SC +  +NC+
Sbjct  241   KHNPALCFFPQYVASHISTPIFVVNSAYDWWQIG-NIFVPSSADPSNSWHSCKLNLSNCS  299

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
              +++   Q  + +F   L +     S  +++++C +H    T  +W+     +++ NKT 
Sbjct  300   PDQLSKLQGFKSEFQRALSEVGDSPSKGMFIDSCYAHCQTETQETWFKSGS-QLLANKTI  358

Query  1142  AEVFADWYFDRNTSPIRVIEKSNKPLN  1222
             A+   DW++ R  SP   I+  N P N
Sbjct  359   AKAVGDWFYGR--SPFHHID-CNFPCN  382



>ref|XP_008347803.1| PREDICTED: uncharacterized protein LOC103410929 [Malus domestica]
Length=401

 Score =   304 bits (778),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 213/345 (62%), Gaps = 11/345 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V LT +E+AV+KGAVCLDGSA  Y++DKG G G++NW++ +EGGGWC   + C  R  + 
Sbjct  30    VALTLVENAVAKGAVCLDGSAXAYHFDKGFGAGINNWLVHVEGGGWCNTVEDCLDRKSNY  89

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
              GSS  M        +L + P  NP+FYNW+R++V YCDGSSFT DV+ VDPATNL +RG
Sbjct  90    RGSSTKMEKTMSFSGVLGNKPKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRG  149

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              R+F A+++   AKGMKNA+NA+ +G SAGG+  +LHCD FR+L P  T+VKCLAD+ YF
Sbjct  150   ARVFRAIIDXLLAKGMKNAQNALLSGCSAGGLTSILHCDNFRSLLPVGTKVKCLADAGYF  209

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN + L G +  Q  +  +V   GSAK LP  CTS+M   LCFFPQ  +    TPIFL  
Sbjct  210   INAKSLSGSZHIQGFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVPQTXTPIFLVN  269

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q+K  L   +         C +   NC+ ++++  QE RL FL  +   ++ SS
Sbjct  270   AAYDSWQIKNILAPGVADPKGAWKKCKLNIKNCSPSQLQTLQEYRLQFLKTIAXSSTSSS  329

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
                ++++C +H    T  +W       ++   T A    DWY+DR
Sbjct  330   HGAFIDSCFAHCQIGTQETWLAADS-PMLSKTTIANAVGDWYYDR  373



>ref|NP_001190770.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AEE84178.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=517

 Score =   307 bits (787),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 157/383 (41%), Positives = 232/383 (61%), Gaps = 16/383 (4%)
 Frame = +2

Query  92    MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             M RL Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1     MGRLKQCWSSLLVLAVLVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57    VNNWIVHMEGGGWCTDVASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT +V+ V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117   KVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRA+ P T  VKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177   AILHCDTFRAILPRTASVKCVSDAGYFIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSC  236

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TSKMK  LCFFPQY +  ++TP+F+  +AFD  Q+K  L    V       +C +    C
Sbjct  237   TSKMKPELCFFPQYVVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKGKEWKNCKLDLKKC  296

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             +  ++K  Q  R   +  L   +S  S  +++++C +H    +  SW G K  +V  N  
Sbjct  297   SAAQLKTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGDKGPQV-ANTR  355

Query  1139  YAEVFADWYFDRNTSPIRVIEKS  1207
              A+   +W++ R +     ++++
Sbjct  356   IAKAVGNWFYGRTSMDSAFVDRA  378



>ref|NP_001151183.1| LOC100284816 precursor [Zea mays]
 gb|ACG41900.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   303 bits (777),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 157/390 (40%), Positives = 232/390 (59%), Gaps = 15/390 (4%)
 Frame = +2

Query  101   LSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNW  280
             L  W C  +     L   +G + V +T +ESAV+KGAVCLDGSAP Y+  +G G G ++W
Sbjct  6     LYAWWCCALGWALALVAADGFL-VDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSW  64

Query  281   VIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAY  460
             ++  EGGGWC N   C  R  +RLGSSK M        +LSD+P++NP+FYNW++V+V Y
Sbjct  65    LVHFEGGGWCNNVTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDDNPDFYNWNKVKVRY  124

Query  461   CDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLH  640
             CDGSSFT DV+ VDPAT L YRG RI+ A+M+D  AKGM  A+NA+ +G SAGG+  +LH
Sbjct  125   CDGSSFTGDVEEVDPATKLHYRGARIWQAVMDDLLAKGMDKAENALISGCSAGGLTSILH  184

Query  641   CDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKM  820
             CD F  L P   RVKCL+D+ +FIN++ + G     + F+ +V + GSAK LP  CTS +
Sbjct  185   CDRFHDLLPPAARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPPSCTSTL  244

Query  821   KASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCV-TYNNCTLNE  976
                 CFFPQ  ++ ++TP+F+  +A+D  Q++  L   +        SC    + C+ ++
Sbjct  245   PPGTCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIDQCSASQ  304

Query  977   MKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAEVF  1153
             +++ Q  R DFL  + +  +  S  +++N+C  H +      +      V+GN T A   
Sbjct  305   LRVLQGFRGDFLKEVAELGNSDSRGLFINSCFVHCQSEIQELWFSSDSPVLGNTTVANAV  364

Query  1154  ADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
              DW+FDR++      +K + P  C +   N
Sbjct  365   GDWFFDRSS-----FQKIDCPYPCDSTCHN  389



>ref|XP_008238011.1| PREDICTED: protein notum homolog isoform X1 [Prunus mume]
Length=401

 Score =   303 bits (776),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 228/380 (60%), Gaps = 16/380 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             A+L QWL      +T+L+     + V +T + SA++KGAVCLDGS P Y++DKG G G++
Sbjct  4     AKLGQWLFLLACAVTLLK--AAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N   C  R  +RLGSSK M        +LS+    NP+FYNW+R++V
Sbjct  62    NWLVHIEGGGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRIKV  121

Query  455   AYCDGSSFTSDVDGVDP-ATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
              YCDG+SFT DV  V+P AT L +RG RIF A++ED  AKGM NA+NAI +G SAGG+  
Sbjct  122   RYCDGASFTGDVAAVNPQATGLYFRGARIFRAVIEDLLAKGMGNAQNAILSGCSAGGLTS  181

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +LHCD F AL P  T VKC++D+ YFIN + + G +  +  F  +V++ GSA+ LP  CT
Sbjct  182   ILHCDNFHALLPVGTNVKCVSDAGYFINVKDVSGAQHIEEFFSQVVETHGSARNLPPSCT  241

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
             SK++  LCFFPQY    ++T IF   +A+D  Q+K  L   +         C +   NC+
Sbjct  242   SKLRPGLCFFPQYMASQIRTRIFFVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCS  301

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTY  1141
               ++K  Q+ R+ FLS +          +++++C +H  T    +W       V+   T 
Sbjct  302   PTQLKAMQDFRVQFLSAIGGMTGCPLKGMFIDSCYAHCQTELQETWLMADS-PVLNKTTI  360

Query  1142  AEVFADWYFDRNTSPIRVIE  1201
             A+   DW++ R  +P + I+
Sbjct  361   AQAVGDWFYGR--TPFQKID  378



>ref|XP_008808367.1| PREDICTED: uncharacterized protein LOC103720446 isoform X1 [Phoenix 
dactylifera]
Length=399

 Score =   303 bits (776),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 160/395 (41%), Positives = 238/395 (60%), Gaps = 23/395 (6%)
 Frame = +2

Query  95    ARLSQWLCFFVVL-LTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             A+   W+  F++L L I  K+EG  +V LT ++SAV+KGAVCLDGS P Y++  G G GV
Sbjct  7     AKPGGWIYLFILLELLISMKVEG-FDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGV  65

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++ +EGGGWC N + CK R  +  GSSKYM        +L    N NP+FYNW++V+
Sbjct  66    NNWLVHMEGGGWCRNVEECKERTKNFRGSSKYM-KQLSFSGILGKKQNLNPDFYNWNKVK  124

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             + YCDGSSFT D++ V+PATNL +RG R++ A+++D  AK M  A+NA+ +G SAGG+A 
Sbjct  125   IRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIIDDLLAKRMNKAQNALLSGCSAGGLAS  184

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +LHCD FR L P   RVKC +D+ YFIN + + G +  +  ++ +  + GSAK LP  CT
Sbjct  185   ILHCDSFRDLVPAGARVKCFSDAGYFINGKDVSGKESIKDFYNQVATTHGSAKNLPSSCT  244

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS--------C-VTYNNC  964
             S+   S+CFFPQY +Q ++TP+F+  +A+D  Q+K  +  P  S        C +    C
Sbjct  245   SRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIK-NILAPSPSDPRKVWGECKLDIKKC  303

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             + N++++ Q  R +F+  LP   + SSI +++++C SH       +W       VI    
Sbjct  304   SSNQLQVMQGFRSEFMRALPA--NSSSIGMFIDSCYSHCQSGAQETWLRSDS-PVIDKMP  360

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
              A+   DWYF R +     + K + P  C +   N
Sbjct  361   IAKAVGDWYFGRTS-----MRKIDCPYPCDSTCHN  390



>ref|XP_011074219.1| PREDICTED: protein notum homolog [Sesamum indicum]
Length=387

 Score =   303 bits (775),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 173/388 (45%), Positives = 227/388 (59%), Gaps = 14/388 (4%)
 Frame = +2

Query  86    YIMARLSQWLC--FFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGH  259
             +I      W+      +L+ +  ++ G    T+T L SA+SKGAVCLDGS P YY+ KG 
Sbjct  4     HIQTMADHWIIRPLICILIVMATQVHGSDWTTITFLPSAISKGAVCLDGSPPAYYFRKGF  63

Query  260   GEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNW  439
             G+G+DNWVIF+EGGGWC + + C  R     GS+K         D+LS +   NP FYNW
Sbjct  64    GDGIDNWVIFLEGGGWCASNKGCLDRTNMSTGSTKLKEKRHYFKDILSSNHTINPNFYNW  123

Query  440   HRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAG  619
             +RV V YCDGSS+T DV+     T  T RG +IFD +MED  A+GMKNAKNAI +G SAG
Sbjct  124   NRVYVGYCDGSSYTGDVE---ENTYPTRRGAKIFDVVMEDMLAQGMKNAKNAILSGGSAG  180

Query  620   GVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLP  799
                 +LHCD FR L P  +RVKC++DS +FI+ + L G K  +  F  L+    S K+LP
Sbjct  181   AWGAILHCDGFRKLIPKASRVKCISDSGFFIHAKNLYGAKKREEYFADLIAYHRSNKFLP  240

Query  800   KECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLK--YGLTMPIVSCVTYN--NCT  967
               CTSKM ASLC FP+  ++ +KTPIF   SAFD  QLK  Y    P       N   CT
Sbjct  241   ASCTSKMNASLCLFPENIIKDIKTPIFFLESAFDYYQLKEHYFSDDPTWKICVDNLKVCT  300

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTYAE  1147
               +++I ++ R  F+  L    S SS  I+V++C  H    H   G  K   +GNKT AE
Sbjct  301   PTQLQIMKDYRATFIKELQGVKS-SSTGIFVHSCYRHGH-LHEREGWDKSPKLGNKTVAE  358

Query  1148  VFADWYFDRNTSPIRVIEKSNK-PLNCS  1228
               +DWYFDR  S  + I+  N+ P NC+
Sbjct  359   AISDWYFDR--SSFQEIDTQNELPRNCA  384



>ref|XP_008808368.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008808369.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
Length=396

 Score =   303 bits (776),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 160/395 (41%), Positives = 238/395 (60%), Gaps = 23/395 (6%)
 Frame = +2

Query  95    ARLSQWLCFFVVL-LTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             A+   W+  F++L L I  K+EG  +V LT ++SAV+KGAVCLDGS P Y++  G G GV
Sbjct  4     AKPGGWIYLFILLELLISMKVEG-FDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGV  62

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++ +EGGGWC N + CK R  +  GSSKYM        +L    N NP+FYNW++V+
Sbjct  63    NNWLVHMEGGGWCRNVEECKERTKNFRGSSKYM-KQLSFSGILGKKQNLNPDFYNWNKVK  121

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             + YCDGSSFT D++ V+PATNL +RG R++ A+++D  AK M  A+NA+ +G SAGG+A 
Sbjct  122   IRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIIDDLLAKRMNKAQNALLSGCSAGGLAS  181

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +LHCD FR L P   RVKC +D+ YFIN + + G +  +  ++ +  + GSAK LP  CT
Sbjct  182   ILHCDSFRDLVPAGARVKCFSDAGYFINGKDVSGKESIKDFYNQVATTHGSAKNLPSSCT  241

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS--------C-VTYNNC  964
             S+   S+CFFPQY +Q ++TP+F+  +A+D  Q+K  +  P  S        C +    C
Sbjct  242   SRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIK-NILAPSPSDPRKVWGECKLDIKKC  300

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
             + N++++ Q  R +F+  LP   + SSI +++++C SH       +W       VI    
Sbjct  301   SSNQLQVMQGFRSEFMRALPA--NSSSIGMFIDSCYSHCQSGAQETWLRSDS-PVIDKMP  357

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
              A+   DWYF R +     + K + P  C +   N
Sbjct  358   IAKAVGDWYFGRTS-----MRKIDCPYPCDSTCHN  387



>ref|XP_004512351.1| PREDICTED: protein notum homolog isoform X3 [Cicer arietinum]
Length=448

 Score =   304 bits (779),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 158/387 (41%), Positives = 234/387 (60%), Gaps = 16/387 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             RLSQWL   +++  ++        V ++ + +AV KGAVCLDGS P Y++DKG G G+++
Sbjct  5     RLSQWLKLNLLVFVLVLLKAEAAYVPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINS  64

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++  EGGGWC N   C  R  +RLGSSK M        +L++    NP+FYNW+R++V 
Sbjct  65    WLVQFEGGGWCNNITTCLGRKMNRLGSSKQMAKQIAFSGILNNRRLFNPDFYNWNRIKVR  124

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ V+P T L +RG R+F+A+ME+  AKGMKNAKNAI +G SAGG+  +L
Sbjct  125   YCDGSSFTGDVEIVNPVTKLHFRGARVFNAVMEELLAKGMKNAKNAIISGCSAGGLTSIL  184

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD FRAL P   +VKCL+D+ YFIN   + G +  +  F  +V + GSA  LP+ CTS+
Sbjct  185   HCDRFRALLPQGAKVKCLSDAGYFINARDVSGTQHIEQFFSQVVTTHGSANNLPRSCTSR  244

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             +   LCFFPQY +  + TPIF   +A+D  Q+K  L   +        SC +  NNC+ N
Sbjct  245   LNPKLCFFPQYVVSQITTPIFFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDINNCSSN  304

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             ++ + Q  R +FL  L    +  S  +++++C +H  T    +W+      ++   T A+
Sbjct  305   QLDLMQGFRTEFLRALTVLGNSPSKGMFIDSCYAHCQTEMQETWFRSDS-PLLAKTTIAK  363

Query  1148  VFADWYFDRNTSPIRVIEKSNKPLNCS  1228
               ADW+++R     R+  + + P  C+
Sbjct  364   AVADWFYER-----RLFHQIDCPYPCN  385



>ref|XP_008808370.1| PREDICTED: uncharacterized protein LOC103720446 isoform X3 [Phoenix 
dactylifera]
Length=401

 Score =   303 bits (775),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 156/375 (42%), Positives = 232/375 (62%), Gaps = 22/375 (6%)
 Frame = +2

Query  95    ARLSQWLCFFVVL-LTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGV  271
             A+   W+  F++L L I  K+EG  +V LT ++SAV+KGAVCLDGS P Y++  G G GV
Sbjct  7     AKPGGWIYLFILLELLISMKVEG-FDVPLTLVQSAVAKGAVCLDGSPPAYHFAPGFGSGV  65

Query  272   DNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             +NW++ +EGGGWC N + CK R  +  GSSKYM        +L    N NP+FYNW++V+
Sbjct  66    NNWLVHMEGGGWCRNVEECKERTKNFRGSSKYM-KQLSFSGILGKKQNLNPDFYNWNKVK  124

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             + YCDGSSFT D++ V+PATNL +RG R++ A+++D  AK M  A+NA+ +G SAGG+A 
Sbjct  125   IRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIIDDLLAKRMNKAQNALLSGCSAGGLAS  184

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +LHCD FR L P   RVKC +D+ YFIN + + G +  +  ++ +  + GSAK LP  CT
Sbjct  185   ILHCDSFRDLVPAGARVKCFSDAGYFINGKDVSGKESIKDFYNQVATTHGSAKNLPSSCT  244

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS--------C-VTYNNC  964
             S+   S+CFFPQY +Q ++TP+F+  +A+D  Q+K  +  P  S        C +    C
Sbjct  245   SRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIK-NILAPSPSDPRKVWGECKLDIKKC  303

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-----EFTYHSWYGPKKLRVIG  1129
             + N++++ Q  R  FL+ L    S SS  +++N+C +H     + T+ S   P    V+ 
Sbjct  304   SSNQLQVMQGFRTQFLNALAGFGSSSSTGMFINSCYAHCQSEMQETWLSSNSP----VLE  359

Query  1130  NKTYAEVFADWYFDR  1174
                 A+   DW++DR
Sbjct  360   KIPIAKAVGDWFYDR  374



>gb|ACG39759.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/390 (40%), Positives = 231/390 (59%), Gaps = 15/390 (4%)
 Frame = +2

Query  101   LSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNW  280
             L  W C  +     L   +G + V +T +ESAV+KGAVCLDGSAP Y+  +G G G  +W
Sbjct  6     LYAWWCCALGWALALVAADGFL-VDITYVESAVAKGAVCLDGSAPAYHLARGSGSGEKSW  64

Query  281   VIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAY  460
             ++  EGGGWC N   C  R  +RLGSSK M        +LSD+P++NP+FYNW++V+V Y
Sbjct  65    LVHFEGGGWCNNVTTCLQRKRTRLGSSKEMATQIAFSGILSDTPDDNPDFYNWNKVKVRY  124

Query  461   CDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLH  640
             CDGSSFT DV+ VDPAT L YRG RI+ A+M+D  AKGM  A+NA+ +G SAGG+  +LH
Sbjct  125   CDGSSFTGDVEEVDPATKLHYRGARIWQAVMDDLLAKGMDKAENALISGCSAGGLTSILH  184

Query  641   CDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKM  820
             CD F  L P   RVKCL+D+ +FIN++ + G     + F+ +V + GSAK LP  CTS +
Sbjct  185   CDRFHDLLPPAARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVTTHGSAKNLPPSCTSTL  244

Query  821   KASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCV-TYNNCTLNE  976
                 CFFPQ  ++ ++TP+F+  +A+D  Q++  L   +        SC    + C+ ++
Sbjct  245   PPGTCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIDQCSASQ  304

Query  977   MKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAEVF  1153
             +++ Q  R DFL  + +  +  S  +++N+C  H +      +      V+GN T A   
Sbjct  305   LRVLQGFRGDFLKEVAELGNSDSRGLFINSCFVHCQSEIQELWFSSDSPVLGNTTVANAV  364

Query  1154  ADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
              DW+FDR++      +K + P  C +   N
Sbjct  365   GDWFFDRSS-----FQKIDCPYPCDSTCHN  389



>ref|XP_010248193.1| PREDICTED: uncharacterized protein LOC104591101 [Nelumbo nucifera]
Length=394

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/377 (42%), Positives = 231/377 (61%), Gaps = 11/377 (3%)
 Frame = +2

Query  119   FFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEG  298
              F+++ T++        V +T +++AV+KGAVCLDGS P Y+   G G GV+NW+I +EG
Sbjct  10    LFLLIWTLVIVGANGYFVGITYVDNAVAKGAVCLDGSPPAYHMAPGFGSGVNNWLILLEG  69

Query  299   GGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSF  478
             G WC NA  C  R  +RLGSSK M         LSD    NP+F+NW++V+V YCDGSSF
Sbjct  70    GAWCNNATTCLARKNTRLGSSKEMVKQLSFSGFLSDKEKFNPDFFNWNKVKVRYCDGSSF  129

Query  479   TSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRA  658
             T DV+ VDPATNL YRG RIF+A+++D   KGMKNA+NA+ +G SAGG++V+LHCD FR 
Sbjct  130   TGDVEAVDPATNLYYRGQRIFNAVVDDLLEKGMKNAQNALLSGCSAGGLSVILHCDKFRE  189

Query  659   LFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCF  838
             L P +T+VKC+AD+ +FIN + + G +  +  F  +V +  SAK LP  CTSK   +LCF
Sbjct  190   LLPQSTKVKCMADAGFFINAKTIAGTEYIKEFFSDVVTTHQSAKNLPASCTSKGDXTLCF  249

Query  839   FPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS-CVTYNNCTLN-------EMKIAQE  994
             FPQ     V TP+F+  +A+D  Q+K  L   I     T+++C L+       +++  Q 
Sbjct  250   FPQNVAPQVTTPLFILNAAYDSYQVKNILAPGIADPHGTWHDCKLDITKCSDTQLQAIQG  309

Query  995   LRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAEVFADWYFD  1171
              R +FL+ +       +  +++N+C SH +      +  +   V+ N + ++   DWYFD
Sbjct  310   FRKEFLNAIKGVEGSPTKGLFINSCYSHCQSGMQETWLREDSPVLDNMSISKAVGDWYFD  369

Query  1172  RNTSPIRVIEKSNKPLN  1222
             R T  ++ IE+   P +
Sbjct  370   RGT--VQKIEQCEYPCD  384



>ref|XP_010942975.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
 ref|XP_010942976.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
Length=397

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 230/371 (62%), Gaps = 15/371 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             A L  W+ + ++ L I  K EG   V +T +ESA++KGAVCLDGS P Y+   G G GV+
Sbjct  4     AELRTWI-YALICLLIFLKAEGYF-VDITYVESALAKGAVCLDGSPPAYHLSPGFGSGVN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N   C  R  SRLGSS++M        +L++    NP+FYNW++V+V
Sbjct  62    NWLVHIEGGGWCNNVTTCLARKNSRLGSSRHMAKQIAFSGILNNRQTFNPDFYNWNKVKV  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ V+PATNL YRG R++ A+MED  AKGM  AKNA+ +G SAGG+  +
Sbjct  122   RYCDGSSFTGDVERVNPATNLHYRGARVWLAVMEDLLAKGMSKAKNALLSGCSAGGLTSI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD FRA+ P  TR KCL+D+ YFI+ + + G +  ++ F+ +V + GSA+ LP  CTS
Sbjct  182   LHCDNFRAILPLGTRAKCLSDAGYFIDMKDVTGAEHIKAFFNDVVTTHGSAQNLPSSCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS--------C-VTYNNCT  967
             ++  S+CFFPQ  +Q + TP+F+  +A+D  Q++  + +P V+        C +    C+
Sbjct  242   RLTPSMCFFPQNMVQQIHTPLFILNAAYDSWQIR-NILVPGVADPHGTWHYCKLDIQQCS  300

Query  968   LNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTY  1141
               +++I Q  R +FL+ L      SS  +++N+C +H       +W       V+     
Sbjct  301   SPQLQIMQGFRTEFLNALAGFGRSSSTGMFINSCYAHCQSEMQETWLSSDS-PVLEKMPI  359

Query  1142  AEVFADWYFDR  1174
             A+   DW++DR
Sbjct  360   AKAVGDWFYDR  370



>ref|XP_008355284.1| PREDICTED: uncharacterized protein LOC103418943 [Malus domestica]
Length=398

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 161/378 (43%), Positives = 236/378 (62%), Gaps = 15/378 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             RL QWL   V LL +L+     + +TL  +E+AV+KGAVCLDGSAP Y++DKG G G++N
Sbjct  5     RLGQWLTLLVCLLILLKAESHPVGITL--VENAVAKGAVCLDGSAPAYHFDKGFGAGINN  62

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++ +EGGGWC +   C  R  +  GSS  M        +L +    NP+FYNW+R++V 
Sbjct  63    WLVHVEGGGWCNSVATCLDRKNNYRGSSTKMEKTMSFSGVLGNKQQTNPDFYNWNRIKVR  122

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VDPATNL +RG R+F A+++D  AKGMKNA+ A+ +G SAGG+A +L
Sbjct  123   YCDGSSFTGDVEAVDPATNLHFRGARVFRAIIDDLLAKGMKNAQTALLSGCSAGGLASIL  182

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             +CD F +L P  T+VKCLAD+ YFIN + + G +  Q+ +  +V   GSAK LP  CTS+
Sbjct  183   NCDNFHSLLPVGTKVKCLADAGYFINAKTVSGSQYIQTFYSEVVALHGSAKNLPASCTSR  242

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             M   LCFFPQ  +   +TPIF   +A+D  Q+K  L   +        +C ++  NC+ +
Sbjct  243   MSPGLCFFPQNVVPQTRTPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPS  302

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAE  1147
             +++  QE RL FL+ +   +S SS  +++++C +H    T  +W       ++   T A+
Sbjct  303   QLQTMQEYRLQFLNAVAGASSSSSNGLFIDSCYAHCQIGTQETWLATDS-PMLSKTTIAK  361

Query  1148  VFADWYFDRNTSPIRVIE  1201
                DWY+DR  +P + I+
Sbjct  362   AVGDWYYDR--TPFKNID  377



>ref|XP_010054028.1| PREDICTED: uncharacterized protein LOC104442333 isoform X2 [Eucalyptus 
grandis]
 gb|KCW78411.1| hypothetical protein EUGRSUZ_D02577 [Eucalyptus grandis]
Length=400

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/371 (42%), Positives = 230/371 (62%), Gaps = 14/371 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR   WLC  + L+ +L+     + +T     SAV++GAVCLDGS P Y+ D+G G G++
Sbjct  4     ARSRLWLCSLLFLVALLQARGVPVRITYVR-NSAVARGAVCLDGSPPAYHLDRGFGTGIN  62

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N   C  R  +RLGSSK M        +LS+    NP+FYNW+R++V
Sbjct  63    NWLVHIEGGGWCNNVTTCLARKNTRLGSSKQMAKEIPFSGILSNKRRYNPDFYNWNRIKV  122

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDG+SFT D++ V+PATNL +RG R++ A+MED  + GM   +NAI +G SAGG+  +
Sbjct  123   RYCDGASFTGDIEAVNPATNLHFRGARVWQAVMEDLLSIGMAKVENAILSGCSAGGLTTI  182

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             +HCD FRAL P   +VKCL+D+ +FIN + + G    +S ++ +V + GSAK LP+ CTS
Sbjct  183   IHCDGFRALLPMGAKVKCLSDAGFFINAKDVSGVLHIESYYNQVVATHGSAKHLPRSCTS  242

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTL  970
                  LCFFPQY  + ++TP+F+  +A+D  Q+K  L   +         C +  NNC+ 
Sbjct  243   IFSPGLCFFPQYMARQMQTPLFILNAAYDSWQIKNILAPGVADPQGTWHGCELDINNCSP  302

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSW-YGPKKLRVIGNKTY  1141
             N++K+ Q+ RL+F+  L +  S SS  +++++C +H    T  +W +G     V+   + 
Sbjct  303   NQLKVMQDFRLEFMYSLGRLGSSSSRGLFIDSCYAHCQSETQETWLWGDSP--VLAKTSI  360

Query  1142  AEVFADWYFDR  1174
             A    DW+FDR
Sbjct  361   ARAVGDWFFDR  371



>ref|XP_003613922.1| Notum-like protein [Medicago truncatula]
 gb|AES96880.1| pectinacetylesterase family protein [Medicago truncatula]
Length=394

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/340 (44%), Positives = 212/340 (62%), Gaps = 5/340 (1%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V  T +++AV+KGAVCLDGS P Y +DKG+G+G ++W++ +EGGGWC N  +C  R  +R
Sbjct  29    VPTTIVQNAVAKGAVCLDGSPPAYNFDKGYGKGSNSWLVHMEGGGWCHNVTNCLGRMTTR  88

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +L+D    NP+FYNW+R+++ YCDGSSFT DV+ VDP T L +RG
Sbjct  89    LGSSKQMNKTLAFSGILNDKKQFNPDFYNWNRIKIRYCDGSSFTGDVEAVDPVTKLHFRG  148

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF+A+ME+  AKGMK A+NAI +G SAGG+  +LHCD FRAL P  + VKC++D+ YF
Sbjct  149   ARIFEAVMEELLAKGMKKAQNAILSGCSAGGLTSLLHCDRFRALLPKGSNVKCISDAGYF  208

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN + + G   F+  F+ +V   GS K LP  CTSK+K  LCFFPQ  +  + TPIF+  
Sbjct  209   INAKDISGAPHFEEYFNQIVTLHGSVKNLPGSCTSKLKPELCFFPQNFVSQITTPIFVVN  268

Query  890   SAFDQIQLKYGLTMPI---VSC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIW  1057
             S  D  Q+K  L        +C +    CT  ++   Q  R +FL  L    + SS+  +
Sbjct  269   SPIDSYQIKNILAPDADDWKNCKLDITKCTPAQLNQVQGFRKEFLRALAPIGNSSSVGTF  328

Query  1058  VNNCVSH-EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
             +++C  H +     ++      ++ N T A+  ADW++DR
Sbjct  329   IDSCYLHCQTELQEFWLFNGSPLLANTTIAKSVADWFYDR  368



>ref|XP_010111521.1| hypothetical protein L484_021346 [Morus notabilis]
 gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis]
Length=386

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 153/373 (41%), Positives = 225/373 (60%), Gaps = 25/373 (7%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             +  R  QWL              G++ +  T     + + + CLDGS P Y++  G G G
Sbjct  2     VNTRFGQWL--------------GRLLLVCTLTIPLLLQDSFCLDGSPPAYHFSHGFGSG  47

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ IEGGGWC N   C  R  +RLGSSK M        +LS+    NP+FY+W+R+
Sbjct  48    VNNWLVQIEGGGWCNNVTTCLARKNTRLGSSKAMVKELSFSGILSNKQKFNPDFYDWNRI  107

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDGSSFT DV+ V+PATNL +RG R+F A++ED QAKGMKNA+NAI +G SAGG+A
Sbjct  108   KVRYCDGSSFTGDVEAVNPATNLHFRGARVFLAIIEDLQAKGMKNAQNAILSGCSAGGLA  167

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD F++L P+TT+VKCL+D+ YFIN   + G K  ++ +  +V + GSAK LP  C
Sbjct  168   SILHCDKFKSLMPSTTKVKCLSDAGYFINTNDVSGAKHIETFYTEVVATHGSAKNLPSSC  227

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN----  973
             TS++   LCFFPQY +  ++TPIF   +A+D  Q+K  L   +     T++ C L+    
Sbjct  228   TSRLSPGLCFFPQYVVSQIQTPIFFVNAAYDSWQIKNILAPGVADPHGTWHYCKLDITKC  287

Query  974   ---EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKT  1138
                ++K  Q+ RL+FL  +    +  S  +++++C +H  T    +W      R +G  T
Sbjct  288   SSIQLKTMQDFRLEFLKAISVVGNSLSKGLFIDSCYAHCQTEMQETWLRANSPR-LGATT  346

Query  1139  YAEVFADWYFDRN  1177
              A+   DW++DR+
Sbjct  347   IAKAVGDWFYDRS  359



>ref|XP_004512349.1| PREDICTED: protein notum homolog isoform X1 [Cicer arietinum]
 ref|XP_004512350.1| PREDICTED: protein notum homolog isoform X2 [Cicer arietinum]
Length=487

 Score =   304 bits (778),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/387 (41%), Positives = 234/387 (60%), Gaps = 16/387 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             RLSQWL   +++  ++        V ++ + +AV KGAVCLDGS P Y++DKG G G+++
Sbjct  44    RLSQWLKLNLLVFVLVLLKAEAAYVPISYVHNAVIKGAVCLDGSPPAYHFDKGFGTGINS  103

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++  EGGGWC N   C  R  +RLGSSK M        +L++    NP+FYNW+R++V 
Sbjct  104   WLVQFEGGGWCNNITTCLGRKMNRLGSSKQMAKQIAFSGILNNRRLFNPDFYNWNRIKVR  163

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ V+P T L +RG R+F+A+ME+  AKGMKNAKNAI +G SAGG+  +L
Sbjct  164   YCDGSSFTGDVEIVNPVTKLHFRGARVFNAVMEELLAKGMKNAKNAIISGCSAGGLTSIL  223

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             HCD FRAL P   +VKCL+D+ YFIN   + G +  +  F  +V + GSA  LP+ CTS+
Sbjct  224   HCDRFRALLPQGAKVKCLSDAGYFINARDVSGTQHIEQFFSQVVTTHGSANNLPRSCTSR  283

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             +   LCFFPQY +  + TPIF   +A+D  Q+K  L   +        SC +  NNC+ N
Sbjct  284   LNPKLCFFPQYVVSQITTPIFFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDINNCSSN  343

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             ++ + Q  R +FL  L    +  S  +++++C +H  T    +W+      ++   T A+
Sbjct  344   QLDLMQGFRTEFLRALTVLGNSPSKGMFIDSCYAHCQTEMQETWFRSDS-PLLAKTTIAK  402

Query  1148  VFADWYFDRNTSPIRVIEKSNKPLNCS  1228
               ADW+++R     R+  + + P  C+
Sbjct  403   AVADWFYER-----RLFHQIDCPYPCN  424



>gb|KHG23648.1| Notum [Gossypium arboreum]
Length=395

 Score =   300 bits (769),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 218/345 (63%), Gaps = 14/345 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T ++SAV+KGAVCLDG+ P Y++DKG+G G+++W+I +EGGGWC N   C  R  + 
Sbjct  28    VPITYVQSAVAKGAVCLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSCLVRKNTH  87

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +L+     N  FYNW+R++V YCDGSSFT DV  V+P  NL +RG
Sbjct  88    LGSSKRMVKQIPFSGILN-----NKHFYNWNRIKVRYCDGSSFTGDVAAVNPVANLHFRG  142

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              R++ A+MED  +KGM+NA+NAI +G SAGG+A +LHCD FRAL P  T+VKC++D+ YF
Sbjct  143   ARVWLAVMEDLLSKGMRNAENAILSGCSAGGLASILHCDSFRALLPMGTKVKCISDAGYF  202

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN   + G    Q+ FD LV + GSAK L   CTS+MK  LCFFPQY  Q ++TP+F+  
Sbjct  203   INTRDVSGGHYIQTFFDQLVATHGSAKNLLPSCTSRMKPGLCFFPQYIAQQIRTPLFIIN  262

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q++  L   I        SC +   NC  +++K+ Q+ RL FL  L +    +S
Sbjct  263   AAYDSWQIRNILAPGIADPHGHWESCKLDIKNCLPSQIKVMQDFRLQFLVALLRLGKSAS  322

Query  1046  IAIWVNNCVSHEFTYHSWYGPKKLRVIGNKT-YAEVFADWYFDRN  1177
               +++++C +H  T        +   + NKT   +   DW++DRN
Sbjct  323   RGMFIDSCFAHCQTEMQELWFMQDSPLLNKTKIGKAVGDWFYDRN  367



>ref|XP_003547822.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26082.1| Protein notum like [Glycine soja]
Length=398

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/372 (43%), Positives = 232/372 (62%), Gaps = 14/372 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+S+WL   +V + +L K EG + V LT +++A SKGAVCLDGS P Y++D G  EG+ 
Sbjct  4     ARISKWL-NLLVCVLLLLKAEGSL-VPLTLVKNAESKGAVCLDGSPPAYHFDNGFEEGIK  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ IEGGGWC N + C YR  SRLGSSK M  ++    +LS+    NP+FYNW+RV+V
Sbjct  62    NWIVHIEGGGWCNNVESCLYRKDSRLGSSKQMEDLY-FSAILSNEQEYNPDFYNWNRVKV  120

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VD  TNL +RG RIF A+ME+  AKG++ A+NAI +G SAGG+  +
Sbjct  121   RYCDGSSFTGDVEEVDQTTNLHFRGARIFSAVMEELLAKGLEKAENAILSGCSAGGLTTI  180

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F+ L P+   VKC+ D+ YF+N E + G    +  +  +V + GSAK LP  CTS
Sbjct  181   LHCDRFKNLLPSEANVKCVPDAGYFVNVEDISGTHFIEKFYSEVVSTHGSAKNLPSSCTS  240

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKY----GLTMPI---VSC-VTYNNCTL  970
             K    LCFFPQY   ++ TPIF+  +A+D  Q++     G   P     SC +  +NC+ 
Sbjct  241   KFSPELCFFPQYVASHISTPIFVVNAAYDSWQIQNIFVPGSADPSDSWHSCKLDISNCSP  300

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYA  1144
             +++   Q+ + +F   +      SS  +++++C +H  T    +WY     + + N T A
Sbjct  301   DQLSKMQDFKSEFEKAVSVVGDSSSKGMFIDSCYAHCQTESQETWYKSDSPQ-LANTTIA  359

Query  1145  EVFADWYFDRNT  1180
             +   DW++ R++
Sbjct  360   KAVGDWFYGRSS  371



>ref|XP_009603747.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=392

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/360 (43%), Positives = 226/360 (63%), Gaps = 13/360 (4%)
 Frame = +2

Query  131   LLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWC  310
             LL +    EG + V +T LE+A+SKGAVCLDGSAP +++D G G G+ +W+I ++GGGWC
Sbjct  19    LLCLWTTTEGDLIVNITYLETAISKGAVCLDGSAPAFHFDPGTGSGIYSWLIHLQGGGWC  78

Query  311   MNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDV  490
                 +C+YR  + L SSK M  +     +LS  P  NP+FYNW+RV+V YCDGSS+T D+
Sbjct  79    ETISNCQYRALTDL-SSKNMQNISYFTGVLSSDPQLNPDFYNWNRVKVKYCDGSSYTGDI  137

Query  491   DGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPN  670
             + VDP TNL +RG RIF+A+ME F  +GM  A+NAI +G SAGG+  ++HCD FR   P 
Sbjct  138   EEVDPDTNLHFRGARIFEAIMEYFLGQGMIYAQNAILSGTSAGGLGAIIHCDKFRLFLPL  197

Query  671   TTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS-KMKASLCFFPQ  847
             T RVKC++D+ +F++ E + G+ L +  +  +V   GSAK LP  CT+     +LCFFPQ
Sbjct  198   TARVKCISDAGFFVDLETISGEPLIEEMYKRVVALHGSAKNLPLSCTALSSDPNLCFFPQ  257

Query  848   YSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV----TY-----NNCTLNEMKIAQELR  1000
             Y  +++ TP+F+  SA+D  Q+   L +P V+      TY     N C+ ++++  Q+ R
Sbjct  258   YVARHICTPLFIVNSAYDSWQINNSL-VPRVADPDDEWTYCKKDINVCSPSQIQTLQDFR  316

Query  1001  LDFLSLLPKKNSESSIAIWVNNCVSHE-FTYHSWYGPKKLRVIGNKTYAEVFADWYFDRN  1177
             L FL  L +    +S   ++++C SH      +++  K    + NKT AE   DW+FDR+
Sbjct  317   LTFLEALNELGPSTSRGYFISSCHSHHGIEIQNYWSSKNSPTLDNKTIAEAVGDWFFDRS  376



>ref|XP_010942974.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=391

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/396 (40%), Positives = 235/396 (59%), Gaps = 21/396 (5%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             I A+   W+  F++L  ++       +V LT ++SAV+KGAVCLDGS P Y++  G G G
Sbjct  2     IGAKPGGWIYLFILLKLLILVKVEGFDVPLTLVQSAVAKGAVCLDGSPPAYHFTPGFGSG  61

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             V+NW++ +EGGGWC N + CK R  +  GSSKYM        +L +    NP+FYNW++V
Sbjct  62    VNNWLVHMEGGGWCRNVEECKERTKNFRGSSKYM-KQLSFSGILGNKQKLNPDFYNWNKV  120

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             ++ YCDGSSFT DV+ VDPATNL +RG R++ A+M+D  AKGM  A+NA+ +G SAGG+A
Sbjct  121   KIRYCDGSSFTGDVEAVDPATNLHFRGARVWRAIMDDLLAKGMSKAQNALLSGCSAGGLA  180

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FR L P   RVKC +D+ YFIN + + G +  +  ++ +V + GSAK LP  C
Sbjct  181   SILHCDSFRDLLPAGARVKCFSDAGYFINAKDVSGKESIRDFYNQVVATHGSAKNLPSSC  240

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS--------C-VTYNN  961
             TS+   S+CFFPQY +Q ++TP+F+  +A+D  Q+K  +  P  S        C +    
Sbjct  241   TSRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIK-NILAPSPSDPRKFWGECKLDIKK  299

Query  962   CTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNK  1135
             C+ +++++ Q  R +FL  LP   +  SI +++++C SH       +W        I   
Sbjct  300   CSSSQLQVMQGFRSEFLRALPA--NSPSIGMFIDSCYSHCQSGAQETWLSSDS-PAINKM  356

Query  1136  TYAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
               A+   DWYF R       ++K + P  C+    N
Sbjct  357   PIAKAVGDWYFGRT-----AMKKIDCPYPCNPTCHN  387



>gb|AGT16732.1| carboxylic ester hydrolase [Saccharum hybrid cultivar R570]
Length=398

 Score =   298 bits (763),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 156/392 (40%), Positives = 230/392 (59%), Gaps = 15/392 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             A +  W C  +V    L   +G + V +T +ESAV+KGAVCLDGSAP Y+  +G G G +
Sbjct  4     ASVCAWWCCALVCALALVAADGLL-VDITYVESAVAKGAVCLDGSAPAYHLARGSGSGEN  62

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             +W++  EGGGWC N   C  R  +RLGSSK M        +LSD+P+ NP+FYNW++V+V
Sbjct  63    SWLVHFEGGGWCNNVTTCLQRKRTRLGSSKEMVTQIAFSGILSDTPDGNPDFYNWNKVKV  122

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VD  T L YRG RI+ A+MED  AKGM  A+NA+ +G SAGG+  +
Sbjct  123   RYCDGSSFTGDVEEVDLTTKLHYRGARIWQAVMEDLLAKGMGKAENALISGCSAGGLTSI  182

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F  L P   RVKCL+D+ +FIN++ + G     + F+ +V + GSAK LP  CT 
Sbjct  183   LHCDRFHDLLPPAARVKCLSDAGFFINEKDVAGVGYIAAFFNDVVATHGSAKNLPPSCTL  242

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCV-TYNNCTL  970
              +   +CFFPQ  ++ ++TP+F+  +A+D  Q++  L   +        SC      C+ 
Sbjct  243   MLPPGMCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGVADPHGQWHSCKHDIGQCSA  302

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH-EFTYHSWYGPKKLRVIGNKTYAE  1147
             +++++ Q  R DFL  + ++    S  +++N+C  H +      +      ++GN T A 
Sbjct  303   SQLRVLQGFRGDFLKEVSEQWISDSRGLFINSCFVHCQSESQELWLSSDSPMLGNTTIAN  362

Query  1148  VFADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
                DW+FDR+T      +K + P  C +   N
Sbjct  363   AVGDWFFDRST-----FQKIDCPYPCDSTCHN  389



>gb|KDO40412.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=373

 Score =   297 bits (760),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 159/373 (43%), Positives = 221/373 (59%), Gaps = 25/373 (7%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             + AR+ QWL   V  L IL K +G  NV +T +E+AV KGAVCLDGS P Y++DKG G G
Sbjct  2     VAARMGQWLNLLVCAL-ILLKADG-FNVGITYVENAVVKGAVCLDGSPPAYHFDKGFGAG  59

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             ++NW++ IEGGGWC N   C  R  +RLGSSK M  V     +LS+    NP+FYNW+R+
Sbjct  60    INNWLVHIEGGGWCNNVTTCLERKKTRLGSSKQMVKVVAFSGMLSNKQKFNPDFYNWNRI  119

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             +V YCDG+SFT DV+ V+PA NL +RG R+F A+MED  AKGMKNA+NA+ +G SAGG+ 
Sbjct  120   KVRYCDGASFTGDVEAVNPANNLHFRGARVFQAVMEDLMAKGMKNAQNAVLSGCSAGGLT  179

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FRALFP  T+VKC AD+ YFIN + + G    +  +  +V + GSAK LP  C
Sbjct  180   SILHCDNFRALFPVGTKVKCFADAGYFINAKDVSGASHIEQFYAQVVATHGSAKHLPASC  239

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCTLNEMKIA  988
             TS++   L       ++ +  P        D     +   + I      NNC+  +++  
Sbjct  240   TSRLSPGL-------IKNILAP-----GVADPHGTWHSCKLDI------NNCSPTQLQTM  281

Query  989   QELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAEVFADW  1162
             Q  R  FL+ L      SS  ++++ C +H  T    +W       V+G  + A+   DW
Sbjct  282   QSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDS-PVLGKMSIAKAVGDW  340

Query  1163  YFDRNTSPIRVIE  1201
             Y+DR  SP + I+
Sbjct  341   YYDR--SPFQKID  351



>ref|XP_009619780.1| PREDICTED: uncharacterized protein LOC104111729 [Nicotiana tomentosiformis]
Length=391

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/372 (43%), Positives = 219/372 (59%), Gaps = 16/372 (4%)
 Frame = +2

Query  98    RLSQWLCFFVV-LLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             RL+   C  VV + T L   +    V +T ++ A +KGAVCLDGS P Y+   GHG G+ 
Sbjct  7     RLALLACLAVVSITTTLGAGDDGFYVNITIVQKATAKGAVCLDGSPPAYHLHPGHGSGLC  66

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYM--WPVFEMGDLLSDSPNENPEFYNWHRV  448
             +W+I ++ GGWC +   C  R  +  GSSKYM  W  F    +LS+   ENPEFYNW+RV
Sbjct  67    SWIIVLDAGGWCSSIPDCLDRSANFSGSSKYMDRWAFF--AGILSNISEENPEFYNWNRV  124

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             RV YCDGSSFT DV+ VDP   L +RG RIF A+MED   KGM+NA+NAI +G+SAGG+A
Sbjct  125   RVKYCDGSSFTGDVEQVDPDNKLYFRGSRIFKAIMEDLSTKGMQNAENAILSGSSAGGLA  184

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +L+CD  ++L PN  R+KC+AD+ +FIN   + G    Q  +  +V   GSAK LP  C
Sbjct  185   TILNCDKLKSLLPNVARLKCVADAGFFINGRTISGTLDIQEMYQRVVTLHGSAKNLPSAC  244

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNC  964
             TS M  SLCFFP+  + YV+TP+F+  SA+D  Q+   L    +        C    +NC
Sbjct  245   TSAMDPSLCFFPENVVPYVQTPLFIINSAYDSWQINNTLVPKYLDPELVWEQCKKQISNC  304

Query  965   TLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHE--FTYHSWYGPKKLRVIGNKT  1138
             T ++  I Q   ++FL          +   ++ +C SH    + + W+ P   R++ +KT
Sbjct  305   TFSQRLIIQAFGVEFLKAFEGLTPCFTRGYFIMSCHSHGAILSTNFWFSPTSPRLL-HKT  363

Query  1139  YAEVFADWYFDR  1174
              AE   DWYFDR
Sbjct  364   LAEAVGDWYFDR  375



>ref|XP_011082153.1| PREDICTED: protein notum homolog [Sesamum indicum]
Length=395

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 164/383 (43%), Positives = 227/383 (59%), Gaps = 19/383 (5%)
 Frame = +2

Query  113   LCFFVVLLTILR-KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIF  289
             +C  ++L T +      +INVT   L++AVS GAVCLDGS  GY+Y+KG+G G DNW+++
Sbjct  17    ICALILLTTQVHCHFNPRINVTF--LDNAVSTGAVCLDGSPAGYHYEKGYGTGADNWLVY  74

Query  290   IEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDG  469
             + GG WC +   C  R  + +G +         G +LS     NP+ YNWHR  + YCDG
Sbjct  75    LPGGAWCGSKGDCLARTKT-IGGTTVNVTTTWFGGILSADSLVNPDLYNWHRTFIRYCDG  133

Query  470   SSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDY  649
             +SF +DV+ VDP TNL  RG RIF A+++   AKGMKNAKN I AGNSAGG+A +L+CD 
Sbjct  134   ASFMADVEAVDPETNLHLRGARIFRAVVDVLLAKGMKNAKNIILAGNSAGGLATILNCDR  193

Query  650   FRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKAS  829
             FRAL PN +RVKCL+DS +FI  + L G +  +  F  +V      K+LPK CTS+M  S
Sbjct  194   FRALVPNASRVKCLSDSGFFIRAQNLPGVEKREKGFADVVAFHDITKFLPKSCTSRMDPS  253

Query  830   LCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLT-MPIV-----SCVTYNN-CTLNEMKIA  988
             LC FP+Y +  V+TP+FL  SAFDQ Q++Y L   P +      C +    CT  ++   
Sbjct  254   LCMFPEYLVGDVQTPLFLLHSAFDQYQIQYNLKPYPAIEQGWKECTSNTRLCTPAQIDFM  313

Query  989   QELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYH----SWYGPKKLRVIGNKTYAEVFA  1156
             +E R  FL  L       S  +++N+C  H+F +     ++ GP  L   GNK    V  
Sbjct  314   KEFRTTFLQTLKAIPDCPSRGMFINSCYIHDFLFSRARWNYQGPPSL---GNKIIERVIG  370

Query  1157  DWYFDRNTSPIRVIEKSNKPLNC  1225
             DWYF+R  S   +  +++ PLNC
Sbjct  371   DWYFER-CSAKAIDAETDHPLNC  392



>emb|CDY67801.1| BnaAnng25210D, partial [Brassica napus]
Length=383

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/350 (42%), Positives = 222/350 (63%), Gaps = 16/350 (5%)
 Frame = +2

Query  209   AVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEM  388
             AVCLDGS P Y+ D+G G G+++W+I +EGGGWC N  +C  R  ++LGSSK M      
Sbjct  24    AVCLDGSPPAYHIDRGSGTGINSWLIQLEGGGWCHNVTNCISRMHTKLGSSKKMVENLAF  83

Query  389   GDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQA  568
               +LS+    NP+FYNW+RV+V YCDGSSFT DV  V+PATNL +RG R++ A+M++  A
Sbjct  84    SAILSNKEQRNPDFYNWNRVKVRYCDGSSFTGDVKTVNPATNLHFRGARVWLAVMQELLA  143

Query  569   KGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQ  748
             KGM+NA+NA+ +G SAGG+A ++HCD FRAL P  T VKCL+D+ +F+N   + G +  +
Sbjct  144   KGMRNAENAVLSGCSAGGLASLMHCDSFRALLPMGTNVKCLSDAGFFLNTRDVSGAQYIK  203

Query  749   SSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLT  928
             S F+ +V   GSAK LP+ CTS++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L 
Sbjct  204   SYFNDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPVFVLNAAYDSWQIKNILA  263

Query  929   MPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--  1078
                        SC +   NC  +++K+ Q+ RL+FLS +      +S  +++++C +H  
Sbjct  264   PRAADPEGKWQSCQLDIKNCQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHCQ  323

Query  1079  EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
               T  SW+  +   ++   T A+   DW +DRN     + +K + P  C+
Sbjct  324   TETQTSWFW-QDSPILNRTTIAKAVGDWVYDRN-----LFQKIDCPYPCN  367



>gb|AFK45147.1| unknown [Lotus japonicus]
Length=394

 Score =   296 bits (757),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 221/371 (60%), Gaps = 13/371 (4%)
 Frame = +2

Query  98    RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
             R+ QWL   ++ L +L K EG + V  T ++SAV+KGAVCLDGS P Y++ KG G G++N
Sbjct  5     RMGQWL-SLLLCLLLLLKAEG-VAVPTTFVQSAVAKGAVCLDGSPPAYHFHKGFGAGINN  62

Query  278   WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
             W++  EGG WC N   C  R  +RLGSSK M          S+    NP+FYNW+R++V 
Sbjct  63    WIVHFEGGAWCNNVTTCLARRDTRLGSSKKMSQTLSFSGFFSNGQKFNPDFYNWNRIKVR  122

Query  458   YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
             YCDGSSFT DV+ VDP TNL +RG RIF A++ED  A GMKNA+NAI +G SAGG+  +L
Sbjct  123   YCDGSSFTGDVEAVDPKTNLHFRGGRIFVAVVEDLLANGMKNAQNAILSGCSAGGLTSIL  182

Query  638   HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
              CD FR+L P   +VKCL+D+ YFIN + + G    +  +  +V++ GSAK LP  CTS+
Sbjct  183   QCDRFRSLIPAAAKVKCLSDAGYFINLKDVSGAAHIEQLYSQVVETHGSAKNLPASCTSR  242

Query  818   MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLN  973
             ++  LCFFPQ     +KTPI    +A+D  Q+K  L   +         C +    C+ N
Sbjct  243   LRPGLCFFPQNVAGQIKTPISFVNAAYDSYQVKNILAPGVADPHGTWRDCKLDIKKCSSN  302

Query  974   EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFT--YHSWYGPKKLRVIGNKTYAE  1147
             ++ + Q  R +FL  +    +  S  ++V+ C SH  T    +W       V+ N T A+
Sbjct  303   QLTVMQGFRTEFLKAISVVENSPSKGMFVDGCYSHCQTGMQETWMRSDS-PVLANTTIAK  361

Query  1148  VFADWYFDRNT  1180
                DW+++R +
Sbjct  362   AVGDWFYERRS  372



>gb|AFK37852.1| unknown [Lotus japonicus]
Length=399

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 154/363 (42%), Positives = 220/363 (61%), Gaps = 14/363 (4%)
 Frame = +2

Query  149   KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHC  328
             K EG I V L  LE AVSKGAVCLDG+ P Y++D+G GEGV+NW++F+EGGGWC N   C
Sbjct  21    KTEGGI-VPLIRLEKAVSKGAVCLDGTPPAYHFDEGSGEGVNNWIVFLEGGGWCNNVTDC  79

Query  329   KYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPA  508
               R  +R GSS  M         LS++   NP+FYNW+R+ V YCDG+SFT DV+ VDPA
Sbjct  80    LLRKDTRRGSSDQMTEPRFFNGFLSENQKFNPDFYNWNRILVRYCDGASFTGDVEEVDPA  139

Query  509   TNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKC  688
             TNL +RG R+F A++E+  AKGM+NA+NAI +G SAGG+A +L CD+F++L P   +VKC
Sbjct  140   TNLHFRGARVFVAVIEELLAKGMQNAENAILSGCSAGGLATILQCDHFKSLLPAEAKVKC  199

Query  689   LADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVK  868
             + D+ YFIN +   G +  +  ++ +V + GSAK LP  CTS+    LCFFPQY    + 
Sbjct  200   VPDAGYFINVKDTSGTQYIEEYYNEVVATHGSAKNLPPSCTSRRSPGLCFFPQYVASEIS  259

Query  869   TPIFLTMSAFDQIQLK----YGLTMPI---VSC-VTYNNCTLNEMKIAQELRLDFLSLLP  1024
             TPIF   +A+D  Q+      G   P     +C +  NNC+ +++   Q  R +F+  L 
Sbjct  260   TPIFYVNAAYDTWQIHNIFARGSADPHGIWHNCKLDINNCSPDQLTAIQGFRTEFIKALS  319

Query  1025  KKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVI  1198
                +  S  +++++C  H    T  SW      + + N    +   DW+++R  SP + I
Sbjct  320   VTENSRSEGMFIDSCYVHCQTETQESWLSSDSPQ-LANTKLGKAVGDWFYER--SPFQKI  376

Query  1199  EKS  1207
             + S
Sbjct  377   DCS  379



>ref|XP_009589853.1| PREDICTED: uncharacterized protein LOC104087156 isoform X1 [Nicotiana 
tomentosiformis]
Length=381

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 158/392 (40%), Positives = 233/392 (59%), Gaps = 26/392 (7%)
 Frame = +2

Query  110   WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIF  289
             +L F V+LLT+ +     + V  T L +A+ KGAVCLDGSAP Y  D+G G GV+NW++ 
Sbjct  2     FLIFIVLLLTVSQVSADFLIVNTTILHNAIGKGAVCLDGSAPAYLIDRGSGYGVNNWLVH  61

Query  290   IEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDG  469
             IEGGGWC     C  R  +R GSS +M   +    +LS+ PNENP+F+NW+RV+V YCDG
Sbjct  62    IEGGGWCSTISECIERTGTRYGSSIHMEDQYYFQGILSNKPNENPDFFNWNRVKVKYCDG  121

Query  470   SSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDY  649
             +SFT DV  VDP T L +RG R+F A+MED   KGM  A+NAI +G SAGG+  +LHCD 
Sbjct  122   ASFTGDVQEVDPVTGLHFRGARVFLAIMEDLLYKGMWKAENAILSGTSAGGLTAILHCDK  181

Query  650   FRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK-MKA  826
             FR+ F  + RVKC++D+ +F+N + + G+   +  ++ +V   GS+K LP+ CTS  +  
Sbjct  182   FRSFFSPSARVKCISDAGFFVNIKTILGESHIEQLYERVVTLHGSSKNLPRSCTSSYLDP  241

Query  827   SLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNN----------CTLNE  976
             SLCFFP+Y +QY++TP+F+  SA+D  Q+   L       V YN           C+ ++
Sbjct  242   SLCFFPEYVVQYIRTPLFIINSAYDSWQINNSL-------VPYNEWTYCKKDINVCSPSQ  294

Query  977   MKIAQELRLDFLSLLPKKNSESSIA-IWVNNCVSHEF--TYHSWYGPKKLRVIGNKTYAE  1147
             ++  Q+ R+ F+  +      +S++  ++ +C SH+   T   W+ P     + NK  A+
Sbjct  295   IQTFQDFRVIFIRAVINGIRPTSLSGYFITSCHSHKGIETPSYWFYPNS-PTLANKAIAQ  353

Query  1148  VFADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
                +W+F      IR  E S  P  C  F Q+
Sbjct  354   AVGEWFF---VESIRFQEISC-PYPCGKFCQS  381



>ref|XP_009398466.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398467.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398468.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398469.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=395

 Score =   295 bits (755),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 152/369 (41%), Positives = 233/369 (63%), Gaps = 19/369 (5%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T +ESA+ KGAVCLDGS P Y+   G G GV+NW++ +EGGGWC N   C  R  +R
Sbjct  26    VDITYVESAIPKGAVCLDGSPPAYHLSPGFGSGVNNWLVHLEGGGWCNNITTCLARKNTR  85

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSS  M        +LS++ + NP+FYNW++V+V YCDGSSFT DV+ VDPATNL YRG
Sbjct  86    LGSSGQMAKQLAFSGILSNTQSFNPDFYNWNKVKVRYCDGSSFTGDVERVDPATNLHYRG  145

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              R++ A+ME+  A+GM  A+NA+ +G SAGG+A +LHCD FR L P + +VKCL+D+ YF
Sbjct  146   ARVWLAVMEELLARGMSKAENALLSGCSAGGLASILHCDSFRNLLPASAKVKCLSDAGYF  205

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN + + G +  ++ ++ +V + GSAK LP  CTS ++  +CFFPQY  Q +++P+F+  
Sbjct  206   INVKDISGAEHIKAFYNDVVTTHGSAKNLPL-CTSMIEPGMCFFPQYMAQEIESPLFILN  264

Query  890   SAFDQIQLKYGLTMPIVS--CVTYNNCTLN-------EMKIAQELRLDFLSLLPKKNSES  1042
             +A+D  Q+K  + +P V+    +++NC L+       +++I QE RL+FL+ +    + S
Sbjct  265   AAYDSWQIK-NILVPTVADRHGSWHNCKLDIKLCSSAQLQIMQEFRLEFLNAVNGLGTPS  323

Query  1043  SIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKP  1216
             S  +++N+C +H       +W  P    ++     AE   DW+++R+       +K + P
Sbjct  324   SRGLFINSCYAHCQSEMQETWLLPNS-PMLDKIPIAEAVGDWFYNRS-----AFQKIDCP  377

Query  1217  LNCSTFEQN  1243
               C +   N
Sbjct  378   YPCDSTCHN  386



>ref|XP_006385136.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62933.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=391

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/350 (45%), Positives = 220/350 (63%), Gaps = 14/350 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T ++SAV+KGAVCLDGS P Y++DKG G G+++W+I  EGGGWC N   C  R  + 
Sbjct  30    VGITYVKSAVAKGAVCLDGSPPAYHWDKGFGTGINSWLIHFEGGGWCNNVTSCLSRKKTH  89

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        ++++    NP+FYNW+RV++ YCDGSSFT DV  V+PATNL +RG
Sbjct  90    LGSSKLMGQQIAFSGIMNNKRPFNPDFYNWNRVKIRYCDGSSFTGDVQAVNPATNLHFRG  149

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RI+ A++ED   KG+KNA+NA+ +G SAGG+A +LHCD FRAL    T+VKCL+D+ YF
Sbjct  150   ARIWLAVIEDLLPKGLKNAENALLSGCSAGGLASILHCDSFRALLRMGTKVKCLSDAGYF  209

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I  + + G    Q+ F+ +V   GSAK LP  CTS +K S CFFPQY    V+TP+F+  
Sbjct  210   IKVKDVSGAPHVQTYFNEIVTLHGSAKNLPLSCTSVLKPSFCFFPQYVAPQVRTPLFILN  269

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q++  L   I        SC +  NNC+  ++K  Q+ RL FL+ L K  + SS
Sbjct  270   AAYDSWQIRNILAPSIADPLGVWKSCKLDINNCSPLQLKSMQDFRLQFLNALNKSTNSSS  329

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPI  1189
               +++++C +H    T   W+  +   V+G K     F+  Y    +SPI
Sbjct  330   RGLYIDSCYAHCQTETQEKWFM-EDSPVLGKKVRDCKFSPHY---QSSPI  375



>gb|EYU37453.1| hypothetical protein MIMGU_mgv1a007583mg [Erythranthe guttata]
Length=403

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/393 (40%), Positives = 232/393 (59%), Gaps = 17/393 (4%)
 Frame = +2

Query  107   QWLCFFVVLLTILR---KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
              WL   + ++ +      +     V +T L +AV KGAVCLDGS  GY+Y KG+G+G ++
Sbjct  12    HWLKLLICVIALSSTKVNVRASEMVNITLLSNAVEKGAVCLDGSPAGYHYAKGYGDGANS  71

Query  278   WVIFIEGGGWCMNAQHC--KYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVR  451
             W+I++ GGGWC   Q C  + +    L S+K +      G +LS +   NP+FYNW+RV 
Sbjct  72    WMIYLPGGGWCGRKQSCIDRVKYSPMLSSTKNITQE-NFGAILSPNKTSNPDFYNWNRVF  130

Query  452   VAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             + YCDGSSF  DV  VDP TNL  RG RIF +++++  +KG+K+AKN +  GNSAGG+A 
Sbjct  131   IRYCDGSSFMGDVKKVDPETNLHKRGSRIFTSVIDELLSKGLKDAKNVMLTGNSAGGLAT  190

Query  632   MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
             +L+CD FRAL PN   VKC++DS +FI+ + L      + +F  +V   G +K+LPK CT
Sbjct  191   ILNCDRFRALVPNANMVKCVSDSGFFIHAKNLPNAAGRERTFSRVVHFHGISKFLPKSCT  250

Query  812   SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCVTYNNCTLN------  973
             S+MK  LCFFP+  + ++KTP+FL  S FD+ Q++  L    V    + NCT N      
Sbjct  251   SRMKPGLCFFPENLVAHIKTPLFLLNSDFDKFQIQVNLKPHPVDNPGWVNCTRNITTCTP  310

Query  974   -EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTY-HSWYGPKKLRVIGNKTYAE  1147
              +++I ++ R  FL  L    +  S  +++N+C  H+F Y    Y       + NKT A+
Sbjct  311   PQLQIIKDFRNTFLETLKGVGNNPSRGLFINSCYIHDFLYLMGRYNSPDSPKLHNKTIAQ  370

Query  1148  VFADWYFDRNTSPIRVIE-KSNKPLNCSTFEQN  1243
                DWYF+R  S +R+I+ K + PL+C     N
Sbjct  371   AIGDWYFNR--SSVRLIDTKIDYPLDCKIGSGN  401



>ref|NP_974575.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE84179.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=365

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 222/350 (63%), Gaps = 16/350 (5%)
 Frame = +2

Query  209   AVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEM  388
             AVCLDGS P Y+ D+G G G+++W+I +EGGGWC N  +C  R  +RLGSSK M      
Sbjct  6     AVCLDGSPPAYHLDRGSGTGINSWLIQLEGGGWCNNVTNCVSRMHTRLGSSKKMVENLAF  65

Query  389   GDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQA  568
               +LS+    NP+FYNW+RV+V YCDG+SFT DV+ V+PATNL +RG R++ A+M++  A
Sbjct  66    SAILSNKKQYNPDFYNWNRVKVRYCDGASFTGDVEAVNPATNLHFRGARVWLAVMQELLA  125

Query  569   KGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQ  748
             KGM NA+NA+ +G SAGG+A ++HCD FRAL P  T+VKCL+D+ +F+N   + G +  +
Sbjct  126   KGMINAENAVLSGCSAGGLASLMHCDSFRALLPMGTKVKCLSDAGFFLNTRDVSGVQYIK  185

Query  749   SSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLT  928
             + F+ +V   GSAK LP+ CTS++  ++CFFPQY  + ++TP+F+  +A+D  Q+K  L 
Sbjct  186   TYFEDVVTLHGSAKNLPRSCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILA  245

Query  929   MPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--  1078
                        SC +   NC  +++K+ Q+ RL+FLS +      SS  +++++C +H  
Sbjct  246   PRAADPYGKWQSCQLDIKNCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQ  305

Query  1079  EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
               T  SW+  +   ++   T A+   DW +DR      + +K + P  C+
Sbjct  306   TETQTSWFW-QDSPILNRTTIAKAVGDWVYDRT-----LFQKIDCPYPCN  349



>gb|KDO40409.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=372

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 149/340 (44%), Positives = 207/340 (61%), Gaps = 11/340 (3%)
 Frame = +2

Query  209   AVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEM  388
             AVCLDGS P Y++DKG G G++NW++ I+GG WC N + C  R  S  GSSK+M      
Sbjct  22    AVCLDGSPPAYHFDKGFGAGINNWLVHIDGGAWCNNVEDCSKRRDSSYGSSKHMVKEANF  81

Query  389   GDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQA  568
               +LS+    NP+FY+W+RVRV YCDG+SFT DV+ V+P TNL +RG R+F+A+MED  A
Sbjct  82    TGILSNEQKFNPDFYDWNRVRVRYCDGASFTGDVEAVNPETNLHFRGARVFEAVMEDLLA  141

Query  569   KGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQ  748
             KGMKNA+NAI  G SAGG+  +LHCD FRALFP  TRVKC AD+ YF+N + + G+   +
Sbjct  142   KGMKNAQNAILTGCSAGGLTSILHCDNFRALFPVDTRVKCFADAGYFVNAKDVSGESHIE  201

Query  749   SSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLT  928
               +  +V   GSAK LP  CTS++   LCFFP+     +KTP+F+  SA+D  Q+   L 
Sbjct  202   EFYKQVVALHGSAKHLPASCTSRLSPGLCFFPENVAGQIKTPLFIINSAYDSWQISNILV  261

Query  929   MPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEF  1084
                        SC V    C+  +++  Q  R+ FL+ L    + SS  ++V++C +H  
Sbjct  262   PEDADPKGAWSSCKVDIKTCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMFVDSCYTHCR  321

Query  1085  T-YHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIE  1201
             T Y   +      V+     A+   DWY+DR  SP + I+
Sbjct  322   TDYQETWFSADSPVLDKTPIAKAVGDWYYDR--SPFQKID  359



>gb|KDP28067.1| hypothetical protein JCGZ_19475 [Jatropha curcas]
Length=394

 Score =   292 bits (748),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 153/380 (40%), Positives = 232/380 (61%), Gaps = 16/380 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             +RLSQW C+ +  + IL K EG  ++ +  +E+A +KGAVCLDGSAP Y++ KG G G++
Sbjct  4     SRLSQW-CYLLAFMLILFKTEGG-SIPIVLIENAKAKGAVCLDGSAPAYHFQKGEGTGIN  61

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC + + C  R  +  GSS  M        +L      NP+FYNW+R+++
Sbjct  62    NWIVHMEGGGWCDDIESCLARRNTYKGSSSKMNKTMGFSGILGSKQVSNPDFYNWNRIKI  121

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DV+ VDP TNL +RG R++ A++++  AKGM NA+NAI +G SAGG+A +
Sbjct  122   RYCDGSSFTGDVEEVDPKTNLYFRGERVWQAVIDELLAKGMNNAQNAILSGCSAGGLAAI  181

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F++  P T  VKC++D+ YFI+ + + G    ++ F  +V + GSAK LP  CTS
Sbjct  182   LHCDKFKSFLPATATVKCVSDAGYFIHGKDIAGGYEIENFFGRIVTTHGSAKNLPASCTS  241

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN------  973
             KMK  LCFFP+   Q ++TP+F+  SA+D  QLK  L         T+ +C L+      
Sbjct  242   KMKPELCFFPENVAQTMQTPLFVINSAYDFWQLKNVLAPSAADRKGTFKSCKLDLTKCKP  301

Query  974   -EMKIAQELRLDFLSLLPKKNSESSI-AIWVNNCVSHEFTYHS--WYGPKKLRVIGNKTY  1141
              +++  Q+ R  F++ L       ++   ++++C +H  T     W   +K  V+ +   
Sbjct  302   AQLETVQDFRTQFINALNIGLGNKTVNGYFIDSCYAHCQTGSPLVWLA-EKSPVLNDTRI  360

Query  1142  AEVFADWYFDRNTSPIRVIE  1201
             A+   DWYFDR  +P + I+
Sbjct  361   AKAVGDWYFDR--APFQKID  378



>ref|XP_009397056.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009397057.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   292 bits (748),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 154/396 (39%), Positives = 237/396 (60%), Gaps = 19/396 (5%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIE-GKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGE  265
             + A+   W+  F+    +L  +E    +V +T L SAV+KGAVCLDGS P Y++  G G 
Sbjct  2     VGAKSGTWIYPFICFYFLLASLEVDAYDVPMTLLHSAVAKGAVCLDGSPPAYHFSPGSGS  61

Query  266   GVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHR  445
             G +NW++ +EGGGWC N + C  R  +  GSS +M P+   G +L +S   NP+FYNW+R
Sbjct  62    GANNWLVHMEGGGWCRNVEECLERKNNFRGSSNHMKPLSFSG-ILGNSKKSNPDFYNWNR  120

Query  446   VRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGV  625
             +++ YCDGSSFT DV+ VDPATNL YRG R++ A+MED   KGM  A+NA+ +G SAGG+
Sbjct  121   IKIRYCDGSSFTGDVERVDPATNLHYRGARVWLAIMEDLLLKGMNRAENALLSGCSAGGL  180

Query  626   AVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKE  805
             A +LHCD FR+L P + +VKC +D+ YFI+ + + G    +S ++ +V+  GS K LP  
Sbjct  181   ASILHCDKFRSLLPASAKVKCFSDAGYFIDGKDISGTTSVRSLYNDVVNLHGSGKNLPSS  240

Query  806   CTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN---  973
             CTS++  S+CFFPQ  +  + TP+F+  +A+D  Q+K  L         ++N C LN   
Sbjct  241   CTSRLSPSMCFFPQNVVPKMSTPLFILNAAYDAWQIKNTLAPSSADPRKSWNACKLNIKS  300

Query  974   ----EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNK  1135
                 +++  QE R +FL  LP   + S+  +++ +C +H    +  +W G     +I   
Sbjct  301   CSSDQLEKMQEFRSEFLRALPASGNPST-GMFIISCYAHCQSGSQDTWLGADS-PMIDKM  358

Query  1136  TYAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
               A+   DW++ R+     V+ K + P  C++  +N
Sbjct  359   PIAKAVGDWFYGRS-----VVRKIDCPYPCNSSCRN  389



>ref|XP_002454426.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
 gb|EES07402.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Length=398

 Score =   292 bits (748),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 148/368 (40%), Positives = 221/368 (60%), Gaps = 16/368 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V +T +ESAV+KGAVCLDGSAP Y+  +G G G ++W++  EGGGWC N   C  R  +R
Sbjct  28    VDITYVESAVAKGAVCLDGSAPAYHLARGSGSGENSWLVHFEGGGWCNNVTTCLQRKRTR  87

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +LSD+P+ NP+FYNW++V+V YCDGSSFT DV+ VDP T L +RG
Sbjct  88    LGSSKEMATQIAFSGILSDTPDGNPDFYNWNKVKVRYCDGSSFTGDVEEVDPTTKLHFRG  147

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RI+ A+MED  AKGM  A+NA+ +G SAGG+  +LHCD F  L P   RVKCL+D+ +F
Sbjct  148   ARIWQAVMEDLLAKGMDKAENALISGCSAGGLTSILHCDRFHDLLPLAARVKCLSDAGFF  207

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN++ + G     + F+ +V + GSA  LP  CTS +   +CFFP+  ++ + TP+F+  
Sbjct  208   INEKDVAGVGYIAAFFNDVVTTHGSANNLPPSCTSMLPPGMCFFPKNEVKQIHTPLFILN  267

Query  890   SAFDQIQLKYGLTMPIV-------SCV-TYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  Q++  L   +        SC      C+ +++++ Q  R DFL  + ++ +  S
Sbjct  268   AAYDSWQVRNILVPGVADPHGKWHSCKHDIGQCSASQLRVLQGFRGDFLKEVSEQANSDS  327

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKPL  1219
               +++N+C  H    +   W+     + +GN T A    DW+F R++      +K + P 
Sbjct  328   RGLFINSCFVHCQSESQELWFSSDSPK-LGNTTIANAVGDWFFGRSS-----FQKIDCPY  381

Query  1220  NCSTFEQN  1243
              C +   N
Sbjct  382   PCDSTCHN  389



>ref|XP_009413211.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=397

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/372 (40%), Positives = 227/372 (61%), Gaps = 15/372 (4%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
             AR+   +C   +L  +   +    +V +T LE AV +GAVCLDGS P Y++  G G G++
Sbjct  11    ARICPLVCVCCLLAAL---VVNGFDVPMTLLEGAVDEGAVCLDGSPPAYHFSPGFGSGMN  67

Query  275   NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
             NW++ +EGGGWC N Q C  R  +  GSSKYM P+   G +L +S N NP+FYNW++V++
Sbjct  68    NWLVHMEGGGWCTNVQDCLARRDTFRGSSKYMKPLSFSG-ILGNSQNSNPDFYNWNKVKI  126

Query  455   AYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVM  634
              YCDGSSFT DVD VDPAT L +RG +I+ A++E+  AKGM  A+NA+ +G SAGG+A +
Sbjct  127   RYCDGSSFTGDVDEVDPATKLYFRGAKIWLAVIEELLAKGMNKAENALLSGCSAGGLASI  186

Query  635   LHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS  814
             LHCD F  L P    VKCL+D+ YFIN + + G +  ++ +  +V + GSAK LP  CTS
Sbjct  187   LHCDKFGDLLPAGATVKCLSDAGYFINAKDITGTESIKAYYSEVVSTHGSAKNLPSSCTS  246

Query  815   KMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSC-VTYNNCTL-------  970
             +M  S+CFFPQY +  ++T +F+  +A+D  Q+K  L         T+N+C L       
Sbjct  247   RMTPSMCFFPQYVVPQMRTSLFILNAAYDAWQIKNILAPSAADPHKTWNDCKLDIKQCSS  306

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYA  1144
             ++++I Q  R +FL+ L    + S+  +++N+C +H    +  +W        + N    
Sbjct  307   DQLQIMQGFRSEFLNALAALGNSSARGMFINSCYAHCQSGSQDTWLAADS-PALDNIPIG  365

Query  1145  EVFADWYFDRNT  1180
             +   DW++DR+ 
Sbjct  366   KAVGDWFYDRSA  377



>gb|KDP28066.1| hypothetical protein JCGZ_19474 [Jatropha curcas]
Length=395

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 229/367 (62%), Gaps = 13/367 (4%)
 Frame = +2

Query  107   QWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVI  286
             QW  + +V + +L K EG  ++ +T +E+A ++GAVCLDGS P Y++DKG+G G +NW++
Sbjct  8     QWFSYLLVFMLLLLKTEGG-SIPITIVETAKTRGAVCLDGSPPAYHFDKGYGSGANNWIV  66

Query  287   FIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCD  466
              +EGGGWC + + C  R  +  GSS  M        +L      NP+FYNW+R+++ YCD
Sbjct  67    HMEGGGWCDDIESCLERRDTYKGSSLKMEKTMGFSGILGSKQAANPDFYNWNRIKIKYCD  126

Query  467   GSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCD  646
             GSSFT DV+ VDP T L +RG RI+ A+++D  AKGM+NA+NAI +G SAGG+A +LHCD
Sbjct  127   GSSFTGDVEAVDPKTKLYFRGERIWRAVIDDLLAKGMRNAQNAILSGCSAGGLASILHCD  186

Query  647   YFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKA  826
              FR+L P + +VKC++D+ YFI+ + + G    ++ +  +V   GSAK LP  CTS+M+ 
Sbjct  187   KFRSLLPASAKVKCVSDAGYFIHGKDIAGGYEIENFYGRVVRLHGSAKNLPTSCTSRMRP  246

Query  827   SLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTLNEMK  982
              LCFFPQ   Q ++TP+F+  SA+D  Q+K  L    V       SC T    C+ ++++
Sbjct  247   ELCFFPQNVAQTMQTPLFVINSAYDSWQIKNILAPSAVDKKGSFKSCKTDLKKCSASQLQ  306

Query  983   IAQELRLDFLSLLPKK-NSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVF  1153
               Q+ RL F++ L     ++ +  +++N+C +H    +  +W+  K   V+ N    +  
Sbjct  307   TVQDFRLQFINALNSGVANKPANGMFINSCHAHCQSGSVSTWFDAKS-PVLSNTKIGKAV  365

Query  1154  ADWYFDR  1174
              DW++DR
Sbjct  366   GDWFYDR  372



>dbj|BAD94756.1| putative pectinacetylesterase protein [Arabidopsis thaliana]
Length=285

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/276 (49%), Positives = 187/276 (68%), Gaps = 5/276 (2%)
 Frame = +2

Query  92   MARLSQ-WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
            M RL Q W    V+ + ++    G   V +T L+SAV+KGAVCLDGSAP Y++DKG G G
Sbjct  1    MGRLKQCWSSLLVLAVLVI----GTGAVPITYLQSAVAKGAVCLDGSAPAYHFDKGFGSG  56

Query  269  VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
            V+NW++ +EGGGWC +   C  R  +  GSSK+M   F    +L    + NP+FYNW+R+
Sbjct  57   VNNWIVHMEGGGWCTDVASCNERKGTMKGSSKFMNKDFGFSGILGGKQSTNPDFYNWNRI  116

Query  449  RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
            +V YCDGSSFT +V+ V+PA  L +RG R++ A+++D  AKGMKNA+NAI +G SAG +A
Sbjct  117  KVRYCDGSSFTGNVEAVNPANKLFFRGARVWRAVVDDLMAKGMKNAQNAILSGCSAGALA  176

Query  629  VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
             +LHCD FRA+ P T  VKC++D+ YFI+ + + G    QS +  +V   GSAK LP  C
Sbjct  177  AILHCDTFRAILPRTASVKCVSDAGYFIHGKDITGGSYIQSYYSKVVALHGSAKSLPVSC  236

Query  809  TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLK  916
            TSKMK  LCFFPQY +  ++TP+F+  +AFD  Q+K
Sbjct  237  TSKMKPELCFFPQYVVPSMRTPLFVINAAFDSWQIK  272



>dbj|BAJ97261.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00807.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/347 (43%), Positives = 212/347 (61%), Gaps = 14/347 (4%)
 Frame = +2

Query  176   LTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLG  355
             +  ++SAV+KGAVCLDGS P Y++  G G G DNWV+ +EGGGWC   + C  R  +  G
Sbjct  31    MVFVKSAVAKGAVCLDGSPPVYHFSPGSGSGADNWVVHMEGGGWCKTPEECAVRKGNFRG  90

Query  356   SSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVR  535
             SSKYM P+   G +L  S   NP+FYNW+RV+V YCDGSSFT DV+ VD +TNL YRG R
Sbjct  91    SSKYMKPLSFSG-ILGGSQQYNPDFYNWNRVKVRYCDGSSFTGDVEEVDSSTNLHYRGAR  149

Query  536   IFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFIN  715
             ++DA++ED   +GM  AKNAI +G SAGG+A +LHCD F  L P +  VKC++D+ YFI+
Sbjct  150   VWDAIIEDLLNRGMSKAKNAILSGCSAGGLAAILHCDKFNDLLPPSASVKCVSDAGYFID  209

Query  716   DEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSA  895
                + G+K  ++SF  +V+  GS K LP  CTS+    LCFFPQ+ L  +KTP+F+  +A
Sbjct  210   GTDITGNKFVRTSFKNVVNLHGSVKNLPSSCTSRTSPELCFFPQHVLPTLKTPLFILNAA  269

Query  896   FDQIQLKYGLTMPIVS--------C-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSI  1048
             +D  Q++  + +P  +        C +    C+ +++   Q  R +FLS LPK     S+
Sbjct  270   YDSWQIR-NILVPSAADKKKEWAKCKLDIKGCSSSQLVTLQHFRDEFLSALPKPGQSPSV  328

Query  1049  AIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTS  1183
              +++++C +H       SW       +   K   +   DW+FDR  S
Sbjct  329   GMFIDSCFAHCQSGAQDSWNADGSPSLQKTKI-GKAVGDWFFDRAVS  374



>ref|XP_010235852.1| PREDICTED: protein notum homolog isoform X2 [Brachypodium distachyon]
Length=353

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/338 (43%), Positives = 208/338 (62%), Gaps = 11/338 (3%)
 Frame = +2

Query  212   VCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMG  391
             +CLDGSAP Y+  +G G GVD+W++  EGGGWC N   C  R  +RLGSSK M       
Sbjct  1     MCLDGSAPAYHLARGFGSGVDSWLVHFEGGGWCSNVTTCLERKNTRLGSSKEMAKQVAFS  60

Query  392   DLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAK  571
              +LS++P+ NP+FYNW++VRV YCDGSSFT D + VDP T L YRG R++ A+MED  AK
Sbjct  61    GILSNTPDHNPDFYNWNKVRVRYCDGSSFTGDKEEVDPTTKLHYRGARVWQAVMEDLLAK  120

Query  572   GMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQS  751
             GM  A+NA+ +G SAGG+  +LHCD FR   P    VKCL+D+ +FI+ + + G+K    
Sbjct  121   GMDRAENALISGCSAGGLTSVLHCDRFRDRMPVEANVKCLSDAGFFIDVKDIAGEKHAAD  180

Query  752   SFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKY----  919
              F+ +V + GSAK LP  CTSK+   +C FPQ  ++ ++TP+F+  +A+D  Q++     
Sbjct  181   FFNDVVTTHGSAKNLPSSCTSKLPPGMCLFPQNEVKQIQTPLFILNAAYDSWQVRNILVP  240

Query  920   GLTMPIVSCVTY--NNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFT  1087
             G + P      +  N C+  ++K  Q  R DFL  L ++ S SS  +++N+C +H     
Sbjct  241   GGSDPHWRSCKHDINQCSEKQLKTLQGFRDDFLKALEEQGSSSSRGLFINSCFAHCQSEI  300

Query  1088  YHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIE  1201
                W+ P    V+GNK  A    DW++DR  SP + I+
Sbjct  301   QEIWFAPDS-PVLGNKKIANAIGDWFYDR--SPFQEID  335



>ref|XP_009612887.1| PREDICTED: uncharacterized protein LOC104106115 [Nicotiana tomentosiformis]
Length=389

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 211/345 (61%), Gaps = 11/345 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             + +T L SA+++GAVCLDGS P Y+ DKG+G G+ +W+I ++GG WC +   C  R  + 
Sbjct  28    INITILNSAIAEGAVCLDGSPPAYHLDKGYGSGLSSWIIVMDGGAWCQSIPDCLSRSTTE  87

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +L ++P  NP+FYNW+RVRV YCDGSSFT D++ VDP   L +RG
Sbjct  88    LGSSKQMKNGSRFAGILYNNPQNNPDFYNWNRVRVKYCDGSSFTGDIEQVDPDNKLFFRG  147

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF A+M+D  +KGM+NA+NAI +G SAGG+A +L+CD F++L PN  +VKC+AD+ +F
Sbjct  148   ARIFKAIMKDLWSKGMQNAENAILSGVSAGGLATILNCDKFKSLLPNDAKVKCVADAGFF  207

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN + + G    Q  +  +V   GSAK LP  CTS M+ SLCFFPQ  + YV+TP+F+  
Sbjct  208   INGKTISGTSDIQEMYQRVVTLHGSAKNLPPSCTSAMEPSLCFFPQNVVPYVETPLFIIN  267

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             S +D  Q++  L    +        C    +NCT ++  I Q   ++FL      +   +
Sbjct  268   SHYDSWQIENILVPKYLDPQHVWDDCKKQISNCTFSQRLIIQVFGVEFLKAFEGLDPSFT  327

Query  1046  IAIWVNNCVSHE--FTYHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
                ++ +C  H    + + W  P   R++ +KT  E   DW+FDR
Sbjct  328   RGYFITSCHIHGAIMSTNFWLSPTSPRLL-HKTIGEAVGDWFFDR  371



>gb|KCW72718.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72719.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=403

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 212/333 (64%), Gaps = 9/333 (3%)
 Frame = +2

Query  203   KGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVF  382
             + AVCLDGS P Y+++KG G G +NW++  EGGGWC N   C  R  +RLGSSK M    
Sbjct  2     RPAVCLDGSPPAYHFNKGLGTGANNWLVQFEGGGWCNNVTTCLARRDTRLGSSKEMVKEV  61

Query  383   EMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDF  562
                 +LS++ + NP+FYNW+R++V YCDG+SFT DV+ VDPAT L +RG R F A++ED 
Sbjct  62    AFSGILSNNHSFNPDFYNWNRIKVRYCDGASFTGDVEAVDPATKLHFRGARAFVAIIEDL  121

Query  563   QAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKL  742
              +KGM +A+NAI +G SAGG+  +LHCD FRAL P +  VKC+AD+ YFIN + + G + 
Sbjct  122   LSKGMSDAENAILSGCSAGGLTSILHCDRFRALMPTSATVKCVADAGYFINAKDISGAQH  181

Query  743   FQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYG  922
              ++ +  +V + GSAK LP  CTS+++  LCFFPQ  ++ ++TP+F+  +A+D  Q+K  
Sbjct  182   IETFYSEVVATHGSAKNLPTSCTSRLRPGLCFFPQNVVKQIQTPLFILNAAYDAWQIKNI  241

Query  923   LTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH  1078
             L   +        SC +  NNC+L++++I Q+ R  FL  L +  +  S  I++++C +H
Sbjct  242   LAPGVADPHGTWHSCKLDINNCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAH  301

Query  1079  -EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
              +      +      V+   + A+   DWY+DR
Sbjct  302   CQSEMQETWLRDDSPVLIETSIAKAVGDWYYDR  334



>ref|XP_006359967.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=384

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/361 (41%), Positives = 215/361 (60%), Gaps = 10/361 (3%)
 Frame = +2

Query  122   FVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGG  301
              ++L T L  +     + +T L +A ++GAVCLDGS P YY+D+G   GV NW+I+++GG
Sbjct  7     LILLTTWLGAVAVAQKINITILHNATTQGAVCLDGSPPAYYFDRGFDAGVSNWIIYLQGG  66

Query  302   GWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFT  481
             GWC N   C YR     GSSK M    + G +L+++P  NP+FYNW+RV V YCDGSSFT
Sbjct  67    GWCENLNDCHYRTFQPAGSSKLMQGKTQFGGILNNTPQYNPDFYNWNRVWVNYCDGSSFT  126

Query  482   SDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRAL  661
              DV+ VDP   L +RG RI  A+++D   KG++NAKNAI +G+SAGG+A +L+CD F+A 
Sbjct  127   GDVEDVDPGNKLYFRGARILKAVLQDLSLKGLQNAKNAILSGSSAGGLATILNCDKFKAF  186

Query  662   FPN-TTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCF  838
             F N + +VKC+A + +FIN   + G    Q  +  + D  GS K LP  CTSKM+ SLCF
Sbjct  187   FSNDSIKVKCVASAGFFININTISGAPNIQKMYQNVEDLHGSVKNLPMSCTSKMEPSLCF  246

Query  839   FPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTLNEMKIAQE  994
             FPQ+ +  V+TP+F+  SA+D  Q+   L    +        C    N+CT ++  I ++
Sbjct  247   FPQHVVPNVETPLFIFNSAYDSWQINNSLIPSDLDPQHVWDQCKNQINSCTFSQRTIIKD  306

Query  995   LRLDFLSLLPKKNSESSIAIWVNNCVSHE-FTYHSWYGPKKLRVIGNKTYAEVFADWYFD  1171
               ++F+         S+   ++ +C  H+   +  ++       I NKT AE   DW+FD
Sbjct  307   FGVEFMKAFGGGTPSSTRGYFITSCHIHQDIIWDKYWFDTSGPTIYNKTIAEAVGDWFFD  366

Query  1172  R  1174
             R
Sbjct  367   R  367



>ref|XP_009771487.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=387

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 212/345 (61%), Gaps = 11/345 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             + +T L SA+++GAVCLDGS P Y+ D+G+G G+ +W+I ++GG WC +   C  R  + 
Sbjct  27    INITILNSAIAQGAVCLDGSPPAYHLDRGYGSGLRSWIIVMDGGAWCQSISDCLSRSTTE  86

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSK M        +L ++P  NP+FYNW+RVRV YCDGSSFT D++ VDP   L +RG
Sbjct  87    LGSSKQMKNGSRFAGILYNNPQNNPDFYNWNRVRVKYCDGSSFTGDIEQVDPDNKLFFRG  146

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF A+M+D  +KGM+NA+NAI +G SAGG+A +L+CD F++L PN  +VKC+AD+ +F
Sbjct  147   ARIFKAIMKDLWSKGMQNAENAILSGVSAGGLATILNCDKFKSLMPNDAKVKCVADAGFF  206

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             IN + + G    Q  +  +V   GSAK LP  CT  M+ SLCFFPQ  + YV+TP+F+  
Sbjct  207   INGKTISGTSDIQEMYQRVVTLHGSAKNLPPSCTYAMEPSLCFFPQNVVPYVETPLFIMN  266

Query  890   SAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             S +D  Q++  L    +       +C    +NCT ++  I Q    +FL      N   +
Sbjct  267   SHYDTWQIENILVPKYLDPQHVWDNCKKQISNCTFSQRLIIQVFGGEFLKAFEGLNPSFT  326

Query  1046  IAIWVNNCVSHE--FTYHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
                ++ +C SH    + + W  P   R++ +KT  E  ADW+F+R
Sbjct  327   SGYFITSCHSHGAIMSTNFWLSPTSPRLL-HKTIGEAVADWFFER  370



>ref|XP_011074218.1| PREDICTED: protein notum homolog [Sesamum indicum]
Length=387

 Score =   291 bits (744),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/387 (42%), Positives = 226/387 (58%), Gaps = 12/387 (3%)
 Frame = +2

Query  86    YIMARLSQWLCFFVVLLTILR-KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHG  262
             +I      W+   + LL ++  ++ G   V +T L+SAVSKGAVCLDGS P Y+  KG G
Sbjct  4     HIQTTTDHWIRPLICLLIVMSTQVHGSHMVDITLLKSAVSKGAVCLDGSPPAYFLQKGSG  63

Query  263   EGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWH  442
             EG DNW++++EGGGWC +   C  R  + +GSS         G +LS     NP+FYNW+
Sbjct  64    EGADNWLVYLEGGGWCASHDGCDQRKRTGIGSSNLRKGALYFGQILSSEKTINPDFYNWN  123

Query  443   RVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGG  622
              V V YCDGSS+T +V G    T++  RG RIFDA+MED  AKGMKNAKNAI +G SAGG
Sbjct  124   MVSVVYCDGSSYTGNVKG---NTDIKRRGARIFDAIMEDLLAKGMKNAKNAILSGGSAGG  180

Query  623   VAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPK  802
             +  +LHCD FRAL P+ +RVKC++DS +FI+ + L G K  +  F ++    G  K LP 
Sbjct  181   LGTILHCDGFRALLPSASRVKCISDSGFFIHAKDLPGAKKREQLFSFITAYHGITKSLPA  240

Query  803   ECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGL--TMPIVSCVTYN--NCTL  970
              CTSKM   LC FP+  ++ ++TP F   SAFD  QLK       P     T N   CT 
Sbjct  241   SCTSKMSPGLCLFPENIVKDIQTPFFFLESAFDDHQLKKHFFSNDPTWRSCTRNLKVCTP  300

Query  971   NEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTYAEV  1150
              +++  ++ R   +  L K  +  +  I+V++C  H   Y   +  K   V+G+KT  + 
Sbjct  301   TQLQTMKDFRAAMIKTLRKVANSKTTGIFVHSCYRHGHFYDKEFW-KHSPVLGDKTIVKA  359

Query  1151  FADWYFDRNTSPIRVIEKSNK-PLNCS  1228
               DWYF+R  S ++ I+  N+ P NC+
Sbjct  360   IGDWYFER--SSVQEIDIQNELPQNCT  384



>ref|XP_010911666.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=388

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 150/390 (38%), Positives = 231/390 (59%), Gaps = 22/390 (6%)
 Frame = +2

Query  89    IMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEG  268
             I  +   W+   V+L+++   +EG  +V LT ++ AV+KGAVCLDGS P Y++  G G G
Sbjct  2     IGVKRGAWIYLIVLLISL--TVEG-FDVPLTLVQDAVAKGAVCLDGSPPAYHFAPGFGSG  58

Query  269   VDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRV  448
             VDNW++ +EGGGWC N + CK R  +  GSSKYM        +L +    +P+FYNW++V
Sbjct  59    VDNWLVHMEGGGWCSNVEECKQRTKNFRGSSKYM-EQLSFSGILGNKQTSSPDFYNWNKV  117

Query  449   RVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVA  628
             ++ YCDGSSFT D++ V+PATNL +RG R++ A+M++  AKGM  A+NA+ +G SAGG+A
Sbjct  118   KIRYCDGSSFTGDIEAVNPATNLHFRGARVWRAIMDELLAKGMNKAQNALLSGCSAGGLA  177

Query  629   VMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKEC  808
              +LHCD FR L P    VKC +D+ YFI+ + + G +  +  +  +V   GSAK LP  C
Sbjct  178   SILHCDSFRDLLPAGATVKCFSDAGYFIDAKDVSGKESIKDFYSQVVTIHGSAKNLPSSC  237

Query  809   TSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLT-MPIVSCVTYNNCTLN----  973
             TS    S+CFFPQY +Q ++TP+F+  +A+D  Q+K  L   P      +  C L+    
Sbjct  238   TSSFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIKNILAPSPSDPSKVWGECKLDIKKC  297

Query  974   ---EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKT  1138
                ++++ Q+ R +FL  LP  +   S  +++++C SH       +W        I   +
Sbjct  298   SSSQLQVLQDFRSEFLHALPANS--PSTGLFIDSCYSHCQSGAQETWLSSNS-PAIDKMS  354

Query  1139  YAEVFADWYFDRNTSPIRVIEKSNKPLNCS  1228
              A+   DW++ R+      I+K + P  C+
Sbjct  355   IAKAVGDWFYGRS-----AIQKIDCPYPCN  379



>ref|XP_008797987.1| PREDICTED: protein notum homolog isoform X1 [Phoenix dactylifera]
Length=391

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 149/376 (40%), Positives = 230/376 (61%), Gaps = 22/376 (6%)
 Frame = +2

Query  149   KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHC  328
             K+EG  +V LT +++AV+KGAVCLDGS P Y++  G G GV+NW++ +EGGGWC N + C
Sbjct  23    KVEG-FDVPLTLVQAAVAKGAVCLDGSPPAYHFAPGFGSGVNNWLVHMEGGGWCSNVEEC  81

Query  329   KYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPA  508
             K R  +  GSSKYM        +L +  N NP+FYNW++V++ YCDGSSFT D++ V+PA
Sbjct  82    KERTGNFRGSSKYM-KQLSFSGILGNQQNLNPDFYNWNKVKIRYCDGSSFTGDIEAVNPA  140

Query  509   TNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKC  688
             TNL +RG R++ A+M++  AKGM  A+NA+ +G SAGG+A +LHCD F  L P   RVKC
Sbjct  141   TNLHFRGARVWRAIMDELLAKGMNKAQNALLSGCSAGGLASILHCDSFHDLLPAGARVKC  200

Query  689   LADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVK  868
              +D+ YFI+ + + G +  +  ++ +V + GSAK LP  CTS+   SLCFFPQY +Q ++
Sbjct  201   FSDAGYFIDAKDVSGKETIKDFYNQVVTTHGSAKNLPSSCTSRFPPSLCFFPQYVVQNMR  260

Query  869   TPIFLTMSAFDQIQLKYGLTMPIVS--------C-VTYNNCTLNEMKIAQELRLDFLSLL  1021
             TP+F+  +A+D  Q+K  +  P  S        C +    C+ ++++  Q  R +FL  L
Sbjct  261   TPLFILNAAYDAWQIK-NIFAPSPSDPRKIWSECKLDIKKCSSSQLQALQGFRSEFLRAL  319

Query  1022  PKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRV  1195
             P+  +  S+ +++++C SH       +W        I   + A+   DW++ R+      
Sbjct  320   PR--NSPSVGMFIDSCYSHCQSGAQETWLSSNS-PAIDRMSIAKAVGDWFYGRS-----A  371

Query  1196  IEKSNKPLNCSTFEQN  1243
             ++K + P  C+    N
Sbjct  372   VQKIDCPYPCNPTCHN  387



>gb|EPS71965.1| hypothetical protein M569_02793, partial [Genlisea aurea]
Length=377

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/380 (40%), Positives = 225/380 (59%), Gaps = 12/380 (3%)
 Frame = +2

Query  113   LCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFI  292
             +C  VV+L     + G   V ++ ++ AVSKGAVCLDG+   Y+   G G G ++WV+++
Sbjct  2     VCSLVVILNGCALLHGYKLVDISFVKDAVSKGAVCLDGTPAAYFMSPGSGSGANSWVVYL  61

Query  293   EGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGS  472
             EGGGWC     C  R  + LGS+          +LL D+P  NP+ +NW++VR+AYCDG+
Sbjct  62    EGGGWCSTPADCLDRTRTYLGSTNLRNKNNTFANLLDDNPAYNPDLHNWNKVRIAYCDGA  121

Query  473   SFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYF  652
              +  DV  VDP TNL+YRG+RIF+A+M++  AKG+  A NAI AG+SAG +A +LHCD F
Sbjct  122   FYAGDVQQVDPGTNLSYRGLRIFEAVMDEMLAKGLAGADNAILAGSSAGALATILHCDSF  181

Query  653   RALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASL  832
             R LF    RVKC++D+ +FI  + L G +  +  F  ++D  G  K LPK CTSKM  SL
Sbjct  182   RGLFTRAERVKCISDAGFFIYGDDLPGKEYRRDDFAKVIDLHGLEKILPKSCTSKMDPSL  241

Query  833   CFFPQYSLQYVKTPIFLTMSAFDQIQLKY-GLTMPIVSCVTYNN-------CTLNEMKIA  988
             C FP+  +  ++TP+ +  ++FD  Q+ +  + +  ++ V ++N       CT +++   
Sbjct  242   CLFPENLISDIQTPLLMLETSFDAWQVSHLFICLLFITNVHWSNCTNDLTQCTTDQIHGL  301

Query  989   QELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHSWYGPKKLRVIGNKTYAEVFADWYF  1168
             Q+ R  FL  L K     S  I+++NC SH  T+ + Y  + L V GN T + V  DW+F
Sbjct  302   QDYRRAFLQSLGKLKDSRSRGIFLSNCYSHT-TFTTTYLWRCLTV-GNTTISSVIGDWFF  359

Query  1169  DRNTSPIRVIEKSNKPLNCS  1228
             DR    + V    N P NC+
Sbjct  360   DRKY--VHVTVDDNYPRNCT  377



>ref|XP_006351092.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=318

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 183/272 (67%), Gaps = 2/272 (1%)
 Frame = +2

Query  170  VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
            V  T L++AVSKGAVCLDGS P YY D+G  EG  +W+I + GGGWC + + C+ R  + 
Sbjct  40   VEKTILKNAVSKGAVCLDGSPPAYYMDRGFEEGAQSWMIHLSGGGWCRDVRECQNRSTTP  99

Query  350  LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             GSSK+M P    G   S++ N NP+ +NW++V VAYCDG +FT DV+ VDPATNL +RG
Sbjct  100  FGSSKHMPPFKFRGHDFSNNKNANPDLFNWNKVMVAYCDGVAFTGDVETVDPATNLYFRG  159

Query  530  VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
             RIF A+MED  AKG+K+ KNA+  G+SAG    ML+CD F  L PNT R+KCL DS YF
Sbjct  160  ARIFSAVMEDLLAKGLKDDKNALLIGSSAGAYPAMLYCDRFSKLLPNTPRIKCLTDSGYF  219

Query  710  IN-DEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLT  886
            I+ ++ L+  K F++ +  LV   GSAK LPK CTS+MK  LCFFPQ   QY+KTP++  
Sbjct  220  IDVNKNLQKGKGFETIYKALVTLHGSAKALPKSCTSRMKPELCFFPQNMQQYIKTPLYTI  279

Query  887  MSAFDQIQLKYGLTMPIVSCVTYNNCTLNEMK  982
            MS FD +Q+   L     + +  NNC+ N+ K
Sbjct  280  MSPFDIVQVGTSLG-DYYNAIKQNNCSANQKK  310



>ref|XP_008365238.1| PREDICTED: uncharacterized protein LOC103428882 [Malus domestica]
Length=311

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/249 (53%), Positives = 173/249 (69%), Gaps = 0/249 (0%)
 Frame = +2

Query  170  VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
            V LT +E+AV+KGAVCLDGSAP Y++DKG G G++NW++ +EGGGWC   + C  R  + 
Sbjct  27   VALTLVENAVAKGAVCLDGSAPAYHFDKGFGAGINNWLVHVEGGGWCNTVEDCLDRKSNY  86

Query  350  LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             GSS  M        +L + P  NP+FYNW+R++V YCDGSSFT DV+ VDPATNL +RG
Sbjct  87   RGSSTKMEKTMSFSGVLGNKPKTNPDFYNWNRIKVRYCDGSSFTGDVEAVDPATNLHFRG  146

Query  530  VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
             R+F A+++   AKGMKNA+NA+ +G SAGG+  +LHCD FR+L P  T+VKCLAD+ YF
Sbjct  147  ARVFRAIIDXLLAKGMKNAQNALLSGCSAGGLTSILHCDNFRSLLPVGTKVKCLADAGYF  206

Query  710  INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
            IN + L G +  Q  +  +V   GSAK LP  CTS+M   LCFFPQ  +   +TPIFL  
Sbjct  207  INAKSLSGSZHIQGFYSEVVALHGSAKNLPASCTSRMSPGLCFFPQNVVPQTRTPIFLVN  266

Query  890  SAFDQIQLK  916
            +A+D  Q+K
Sbjct  267  AAYDSWQIK  275



>emb|CAD41867.2| OSJNBa0041A02.14 [Oryza sativa Japonica Group]
 emb|CAH67867.1| B0403H10-OSIGBa0105A11.19 [Oryza sativa Indica Group]
Length=396

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/379 (39%), Positives = 228/379 (60%), Gaps = 16/379 (4%)
 Frame = +2

Query  89    IMARLSQWL---CFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGH  259
             + A   +WL      +VL  ++       +V +  L+SAVS GAVCLDGS P Y++  G 
Sbjct  1     MAASSGEWLSRAAMVLVLGLVVASSAKAGDVDMVFLKSAVSTGAVCLDGSPPVYHFSPGS  60

Query  260   GEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNW  439
             G G +NW++ +EGGGWC NAQ C  R  +  GSSK+M P+   G ++  +   NP+FYNW
Sbjct  61    GSGANNWLVHMEGGGWCRNAQECSVRQGNFRGSSKFMRPLSFSG-IIGGNQRNNPDFYNW  119

Query  440   HRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAG  619
             +R++V YCDGSSFT DV+ V+ +TNL +RG R+++A++ED  AKGM  A+NA+ +G SAG
Sbjct  120   NRIKVRYCDGSSFTGDVETVETSTNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAG  179

Query  620   GVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLP  799
             G+A +LHCD FR L P T  VKC +D+ +F++ + + G+   ++ +  +V+  GSAK LP
Sbjct  180   GLAAILHCDQFRDLLPATANVKCFSDAGFFVDGKDITGNDFVRTFYKDVVNLHGSAKNLP  239

Query  800   KECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPI-------VSC-VTY  955
               CTSKM   LCFFPQ  +  ++TP+F+  +A+D  Q+K  L             C +  
Sbjct  240   SSCTSKMSPDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDI  299

Query  956   NNCTLNEMKIAQELRLDFLSLLPK-KNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVI  1126
               C+ +++   Q  R DFL+ LPK + S ++++I++++C +H    +  +W   +   V+
Sbjct  300   TACSSSQLTTLQNFRTDFLAALPKPEQSPANLSIFIDSCYAHCQSGSQDTWLA-QGSPVV  358

Query  1127  GNKTYAEVFADWYFDRNTS  1183
                   +   DW+ DR  S
Sbjct  359   EKTQIGKAVGDWFHDREVS  377



>gb|EYU37448.1| hypothetical protein MIMGU_mgv1a007102mg [Erythranthe guttata]
Length=419

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 160/400 (40%), Positives = 236/400 (59%), Gaps = 19/400 (5%)
 Frame = +2

Query  89    IMA--RLSQWLCFFVVLLT-ILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGH  259
             IMA  R    +C F+VL T  L ++  KIN+T   + SAV KGAVCLDG+ P YY+  G 
Sbjct  7     IMADHRSKLLVCVFLVLTTQTLSELTDKINITY--VNSAVEKGAVCLDGTPPAYYHSVGF  64

Query  260   GEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFE-MGDLLSDSPNENPEFYN  436
             G+G DNW++++EGG WC + + C  R   +  +S    P    +  + + +   N  FYN
Sbjct  65    GDGADNWLVYLEGGAWCNSTETCLERVKIKWLASTSTRPAIRYVSGIFTVNQTFNQAFYN  124

Query  437   WHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSA  616
             W++V + YCDG+SFT DV+ VDP TNL YRG RIF A+++D  AKGMKNAKNA+  G+SA
Sbjct  125   WNKVIIVYCDGASFTGDVEEVDPTTNLHYRGARIFRAVIDDLLAKGMKNAKNAVLTGSSA  184

Query  617   GGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWL  796
             GG+A +L+CD FR+L P+ TRVKC++DS +FI+ + + G    ++ F  + +  G AK L
Sbjct  185   GGLATILNCDRFRSLVPHATRVKCISDSGFFIHSKNMPGANEREAYFTQVAELHGMAKAL  244

Query  797   PKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNNCTLN  973
             P+ C SKM   LC FP+Y ++ ++TP+F+  S FD  Q+K  L   +  C   +++CT N
Sbjct  245   PQSCASKMNPGLCLFPEYVIKDMQTPLFILDSLFDLYQIKEMLAPFVGGCKEQWDDCTTN  304

Query  974   -------EMKIAQELRLDFLSLLPKKNSESSIAIWVNNCV--SHEFTYHSWYGPKKLR-V  1123
                    +++I ++ R  FL  L +  S  S+ I+V+ C   +H      W      R V
Sbjct  305   LTLCTSSQLQIMKDHRTAFLETLQEVES-PSLGIFVHTCFLHTHVLDKDGWRCSFVARNV  363

Query  1124  IGNKTYAEVFADWYFDRNTSPIRVIEKSNKPLNCSTFEQN  1243
             +  KT  E   DWY+DR +S  ++   +  P NC+    N
Sbjct  364   LAKKTIEEAIDDWYYDR-SSFQQIDTYTTVPRNCTVSRDN  402



>ref|XP_009776988.1| PREDICTED: uncharacterized protein LOC104226656 isoform X2 [Nicotiana 
sylvestris]
Length=386

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/363 (42%), Positives = 219/363 (60%), Gaps = 11/363 (3%)
 Frame = +2

Query  122   FVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGG  301
              V LL I    E  + V  T LESA++KGAVCLDGSAP + +  G G GV NW+I ++GG
Sbjct  8     LVSLLFIWTTTEANLIVYTTFLESAIAKGAVCLDGSAPAFNFHPGTGSGVYNWLIQLQGG  67

Query  302   GWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFT  481
             GWC +A  C+ R  +  G+SK +  +     +LS+    NP+FYNW+R++V YCDGSS+T
Sbjct  68    GWCDSASDCQDRATNGYGTSKNISKIGYFMGVLSNDSQLNPDFYNWNRIKVRYCDGSSYT  127

Query  482   SDVDGVDPATNLTYRGVRIFDALMED-FQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRA  658
              D++ VDPATNL +RG RIF A+M++    KGM  A+NAI +G SAGG+  +LHCD FR 
Sbjct  128   GDIEEVDPATNLHFRGARIFKAIMDELLYHKGMIYAENAILSGTSAGGLGAILHCDKFRL  187

Query  659   LFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT-SKMKASLC  835
              F  T RVKC++D+ +FIN + +  +   +  F  +V   GSAK LP  CT   +  SLC
Sbjct  188   FFSLTARVKCISDAGFFINAKTITDEPHIKEYFKRVVALHGSAKNLPLSCTFLSLDPSLC  247

Query  836   FFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS-------CV-TYNNCTLNEMKIAQ  991
             FFPQY+ Q++ TP+F+  SA+D  Q+   L             C    NNC+L++++  Q
Sbjct  248   FFPQYAAQHICTPLFIINSAYDSWQINNSLVPQEADPRHVWDFCKGNINNCSLSQIQTLQ  307

Query  992   ELRLDFLSLLPKKNSESSIAIWVNNCVSHE-FTYHSWYGPKKLRVIGNKTYAEVFADWYF  1168
             + RL FL  L +    +S   ++++C SH+     +++       + NKT AE   DW+F
Sbjct  308   DFRLTFLEALNELGPSTSRGYFISSCHSHKGIEAQAYWSYNNSPTLANKTIAEAVGDWFF  367

Query  1169  DRN  1177
             DR+
Sbjct  368   DRS  370



>ref|XP_008238015.1| PREDICTED: protein notum homolog isoform X5 [Prunus mume]
Length=311

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/309 (46%), Positives = 196/309 (63%), Gaps = 11/309 (4%)
 Frame = +2

Query  95   ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
            A+L QWL      +T+L+     + V +T + SA++KGAVCLDGS P Y++DKG G G++
Sbjct  4    AKLGQWLFLLACAVTLLK--AAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGIN  61

Query  275  NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
            NW++ IEGGGWC N   C  R  +RLGSSK M        +LS+    NP+FYNW+R++V
Sbjct  62   NWLVHIEGGGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRIKV  121

Query  455  AYCDGSSFTSDVDGVDP-ATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             YCDG+SFT DV  V+P AT L +RG RIF A++ED  AKGM NA+NAI +G SAGG+  
Sbjct  122  RYCDGASFTGDVAAVNPQATGLYFRGARIFRAVIEDLLAKGMGNAQNAILSGCSAGGLTS  181

Query  632  MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
            +LHCD F AL P  T VKC++D+ YFIN + + G +  +  F  +V++ GSA+ LP  CT
Sbjct  182  ILHCDNFHALLPVGTNVKCVSDAGYFINVKDVSGAQHIEEFFSQVVETHGSARNLPPSCT  241

Query  812  SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCT  967
            SK++  LCFFPQY    ++T IF   +A+D  Q+K  L   +         C +   NC+
Sbjct  242  SKLRPGLCFFPQYMASQIRTRIFFVNAAYDSWQIKNILAPGVADPHGTWHECKLDIKNCS  301

Query  968  LNEMKIAQE  994
              ++K  Q+
Sbjct  302  PTQLKAMQD  310



>ref|XP_010325697.1| PREDICTED: uncharacterized protein LOC101260962 [Solanum lycopersicum]
Length=608

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 211/345 (61%), Gaps = 11/345 (3%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             + +T L SA ++GAVCLDGS P Y+ D+GHG G+ +WVI+++GGGWC N   C  R    
Sbjct  249   INITVLHSATAQGAVCLDGSPPAYHLDRGHGTGLHSWVIYLDGGGWCNNISDCLNRSTKF  308

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSS  M      G +L ++  ENPEF+NW+RVRV YCDG+SFT DV+ ++P   L +RG
Sbjct  309   LGSSTKMKRQSFFGGILHNTSKENPEFHNWNRVRVKYCDGASFTGDVEQINPENKLYFRG  368

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RIF A+MED   KGMKNA+NAI  G SAGG+A +L+CD F++L P + RVKC+A + +F
Sbjct  369   ARIFKAIMEDLWCKGMKNAENAILTGTSAGGLATILNCDKFKSLLPGSARVKCVASAGFF  428

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I+ + + G    Q  ++ +V   GSAK LP  CTS M+ SLCFFPQ  + Y++TP+F+  
Sbjct  429   IDGKTITGTSHIQEMYEEIVSLHGSAKNLPSACTSAMEPSLCFFPQNVVSYIQTPLFIIN  488

Query  890   SAFDQIQLKYGLTMPIV-------SCV-TYNNCTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             S +D  Q+   L    +        C+   ++CT +++ I +   ++FL +        +
Sbjct  489   SVYDSWQINNTLVPSYLDPQHAWKGCIKNISSCTSSQLIIIRAFGVEFLKIFGALPPCFT  548

Query  1046  IAIWVNNCVSHE--FTYHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
                ++ +C SH    +   WY     R++ +KT AE   DWYF+R
Sbjct  549   RGYFLTSCYSHGDILSTSYWYNTTSPRLL-SKTIAEAVGDWYFER  592



>ref|XP_004509524.1| PREDICTED: uncharacterized protein LOC101493258 isoform X3 [Cicer 
arietinum]
Length=303

 Score =   284 bits (727),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 183/273 (67%), Gaps = 1/273 (0%)
 Frame = +2

Query  98   RLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDN  277
            R+ Q L   +  L +L K EG + V +T ++SAV+KGAVCLDGS P Y++DKG G G+DN
Sbjct  5    RMDQLLSLVICTLLLLLKAEG-VAVPITYVQSAVAKGAVCLDGSPPAYHFDKGVGAGIDN  63

Query  278  WVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVA  457
            W++  EGGGWC N   C  R  +RLGSSK M          S+    NP+FY+W+R++V 
Sbjct  64   WIVHFEGGGWCNNVSTCLDRRDTRLGSSKKMDKQLSFSGFFSNGKKFNPDFYDWNRIKVR  123

Query  458  YCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVML  637
            YCDG+SFT DV+ VDPATNL +RG RIF A++ED  AKGMKNAKNAI +G SAGG+  +L
Sbjct  124  YCDGASFTGDVEAVDPATNLHFRGARIFVAVIEDLLAKGMKNAKNAILSGCSAGGLTSIL  183

Query  638  HCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSK  817
             CD F+ L P   +VKC++D+ YFIN + + G +  +  +  +V + GSAK LP+ CTS+
Sbjct  184  QCDRFKTLLPAAAKVKCVSDAGYFINVKAVSGAQHIEQFYSQVVQTHGSAKNLPQSCTSR  243

Query  818  MKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLK  916
            +   LCFFPQ     +KTPIF   +A+D  Q++
Sbjct  244  LSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQVR  276



>ref|XP_008238014.1| PREDICTED: protein notum homolog isoform X4 [Prunus mume]
Length=315

 Score =   285 bits (728),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 184/275 (67%), Gaps = 3/275 (1%)
 Frame = +2

Query  95   ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
            A+L QWL      +T+L+     + V +T + SA++KGAVCLDGS P Y++DKG G G++
Sbjct  4    AKLGQWLFLLACAVTLLK--AAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGIN  61

Query  275  NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
            NW++ IEGGGWC N   C  R  +RLGSSK M        +LS+    NP+FYNW+R++V
Sbjct  62   NWLVHIEGGGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRIKV  121

Query  455  AYCDGSSFTSDVDGVDP-ATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             YCDG+SFT DV  V+P AT L +RG RIF A++ED  AKGM NA+NAI +G SAGG+  
Sbjct  122  RYCDGASFTGDVAAVNPQATGLYFRGARIFRAVIEDLLAKGMGNAQNAILSGCSAGGLTS  181

Query  632  MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
            +LHCD F AL P  T VKC++D+ YFIN + + G +  +  F  +V++ GSA+ LP  CT
Sbjct  182  ILHCDNFHALLPVGTNVKCVSDAGYFINVKDVSGAQHIEEFFSQVVETHGSARNLPPSCT  241

Query  812  SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLK  916
            SK++  LCFFPQY    ++T IF   +A+D  Q+K
Sbjct  242  SKLRPGLCFFPQYMASQIRTRIFFVNAAYDSWQIK  276



>ref|NP_001053773.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAF15687.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAG93730.1| unnamed protein product [Oryza sativa Japonica Group]
Length=466

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/382 (39%), Positives = 230/382 (60%), Gaps = 17/382 (4%)
 Frame = +2

Query  83    TYIMARLS-QWL---CFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYD  250
             T  MA  S +WL      +VL  ++       +V +  L+SAVS GAVCLDGS P Y++ 
Sbjct  68    TLAMAASSGEWLSRAAMVLVLGLVVASSAKAGDVDMVFLKSAVSTGAVCLDGSPPVYHFS  127

Query  251   KGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEF  430
              G G G +NW++ +EGGGWC NAQ C  R  +  GSSK+M P+   G ++  +   NP+F
Sbjct  128   PGSGSGANNWLVHMEGGGWCRNAQECSVRQGNFRGSSKFMRPLSFSG-IIGGNQRNNPDF  186

Query  431   YNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGN  610
             YNW+R++V YCDGSSFT DV+ V+ +TNL +RG R+++A++ED  AKGM  A+NA+ +G 
Sbjct  187   YNWNRIKVRYCDGSSFTGDVETVETSTNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGC  246

Query  611   SAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAK  790
             SAGG+A +LHCD FR L P T  VKC +D+ +F++ + + G+   ++ +  +V+  GSAK
Sbjct  247   SAGGLAAILHCDQFRDLLPATANVKCFSDAGFFVDGKDITGNDFVRTFYKDVVNLHGSAK  306

Query  791   WLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPI-------VSC-  946
              LP  CTSKM   LCFFPQ  +  ++TP+F+  +A+D  Q+K  L             C 
Sbjct  307   NLPSSCTSKMSPDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCK  366

Query  947   VTYNNCTLNEMKIAQELRLDFLSLLPK-KNSESSIAIWVNNCVSH--EFTYHSWYGPKKL  1117
             +    C+ +++   Q  R DFL+ LPK + S ++++I++++C +H    +  +W   +  
Sbjct  367   LDITACSSSQLTTLQNFRTDFLAALPKPEQSPANLSIFIDSCYAHCQSGSQDTWLA-QGS  425

Query  1118  RVIGNKTYAEVFADWYFDRNTS  1183
              V+      +   DW+ DR  S
Sbjct  426   PVVEKTQIGKAVGDWFHDREVS  447



>ref|XP_008238013.1| PREDICTED: protein notum homolog isoform X3 [Prunus mume]
Length=316

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 184/275 (67%), Gaps = 3/275 (1%)
 Frame = +2

Query  95   ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVD  274
            A+L QWL      +T+L+     + V +T + SA++KGAVCLDGS P Y++DKG G G++
Sbjct  4    AKLGQWLFLLACAVTLLK--AAGVPVEITYVHSAIAKGAVCLDGSPPAYHHDKGFGSGIN  61

Query  275  NWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRV  454
            NW++ IEGGGWC N   C  R  +RLGSSK M        +LS+    NP+FYNW+R++V
Sbjct  62   NWLVHIEGGGWCNNVTTCLGRKNTRLGSSKQMLKAIAFSGILSNRKMFNPDFYNWNRIKV  121

Query  455  AYCDGSSFTSDVDGVDP-ATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAV  631
             YCDG+SFT DV  V+P AT L +RG RIF A++ED  AKGM NA+NAI +G SAGG+  
Sbjct  122  RYCDGASFTGDVAAVNPQATGLYFRGARIFRAVIEDLLAKGMGNAQNAILSGCSAGGLTS  181

Query  632  MLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECT  811
            +LHCD F AL P  T VKC++D+ YFIN + + G +  +  F  +V++ GSA+ LP  CT
Sbjct  182  ILHCDNFHALLPVGTNVKCVSDAGYFINVKDVSGAQHIEEFFSQVVETHGSARNLPPSCT  241

Query  812  SKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLK  916
            SK++  LCFFPQY    ++T IF   +A+D  Q+K
Sbjct  242  SKLRPGLCFFPQYMASQIRTRIFFVNAAYDSWQIK  276



>ref|XP_010266386.1| PREDICTED: uncharacterized protein LOC104603916 isoform X3 [Nelumbo 
nucifera]
Length=361

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 212/330 (64%), Gaps = 12/330 (4%)
 Frame = +2

Query  68    LSVI*TYIMARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYY  247
             L+ I  + M     W    + +L  L K+ G + V +T ++S+V+KGAVCLDGS P Y+ 
Sbjct  36    LTSIGMHRMVYARSWRKLIICILITL-KVNG-LYVQITYIKSSVAKGAVCLDGSPPAYHL  93

Query  248   DKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPE  427
             DKG G G++NW++ IEGGGWC N   C +R  + LGSSK M        +LS++   NP+
Sbjct  94    DKGFGSGINNWLVHIEGGGWCTNVTTCLFRKNTHLGSSKKMVTEIAFSGILSNNKQFNPD  153

Query  428   FYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAG  607
             FYNW+R++V YCDG+SFT D++ VDP TNL YRG RI+ A++ED   KGMKNA+ A+ +G
Sbjct  154   FYNWNRIKVRYCDGASFTGDLEKVDPVTNLHYRGARIWLAVIEDLLKKGMKNAEYALLSG  213

Query  608   NSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSA  787
              SAGG+A +LHCD F AL    T+VKCLAD+ YF+N +++ G +  +S F+ +V + GS 
Sbjct  214   CSAGGLASILHCDSFHALLSIGTKVKCLADAGYFVNLKEISGREHIKSYFNDVVTTHGSV  273

Query  788   KWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPI-------VSC  946
             K LP  CTS MK S+CFFPQY +  ++TP+FL  +A+D  Q++  L   +       +SC
Sbjct  274   KNLPTYCTSTMKPSMCFFPQYIVHGIRTPLFLLNAAYDSWQIRNILVPGVADPHGYWLSC  333

Query  947   -VTYNNCTLNEMKIAQELRLDFLSLLPKKN  1033
              +   NC+  +++  QE   D  +L P++ 
Sbjct  334   KLDIKNCSSIQLQTMQEQLGD--TLAPRRQ  361



>ref|XP_009407790.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=431

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 223/376 (59%), Gaps = 17/376 (5%)
 Frame = +2

Query  110   WLCFFVVLLTILR--KIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWV  283
             W+C  + LL +L   ++EG  NV +T L+ AV++GAVCLDGSAP Y    G G G +NW+
Sbjct  42    WVCPLICLLYLLAFLQVEGD-NVPMTVLKGAVAEGAVCLDGSAPAYNLAPGSGSGANNWL  100

Query  284   IFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYC  463
             +F+EGGGWC   + C  R  +  GSS +M P    G +L      NP+FYNW+RV++ YC
Sbjct  101   VFVEGGGWCSTVEECLARKNTFRGSSDHMPPQSFSG-MLGGVQQSNPDFYNWNRVKIRYC  159

Query  464   DGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHC  643
             DG+SFT D++ VDPAT L +RG R++ A+M+D  AKGM  A+ A+  G SAGG+  +LHC
Sbjct  160   DGASFTGDIEKVDPATGLHFRGARVWRAIMKDLLAKGMNKAQKALLGGCSAGGLTTILHC  219

Query  644   DYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMK  823
             D FR+L P T  VKC +D+ YFI+ + + G    QS +  +V   GSA  LP  CTS++ 
Sbjct  220   DNFRSLLPATATVKCFSDAGYFIDAKDISGADAIQSFYGDVVKLHGSANNLPSSCTSRLP  279

Query  824   ASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEM  979
             A+ CFFPQ  +  +KTP+F+  +A+DQ Q+ + L             C +    C+ +++
Sbjct  280   ANKCFFPQNVVATLKTPLFILNAAYDQWQIDHILVPSSADPKNTWGDCKLDIKKCSSDQL  339

Query  980   KIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTYHS--WYGPKKLRVIGNKTYAEVF  1153
             +  Q  R  FL+ LP   S SS  +++ +C +H  +  +  WY     + I N    +  
Sbjct  340   QKLQGFRTTFLNALPGAGS-SSTGLFILSCHTHCLSGDADIWYSDDSPK-IDNTPIGKAV  397

Query  1154  ADWYFDRNTSPIRVIE  1201
              DWYF R +S +R I+
Sbjct  398   GDWYFGR-SSAVRKID  412



>ref|XP_006367726.1| PREDICTED: uncharacterized protein LOC102600035, partial [Solanum 
tuberosum]
Length=377

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/351 (42%), Positives = 210/351 (60%), Gaps = 15/351 (4%)
 Frame = +2

Query  155   EGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKY  334
             E  + + +T L+SA ++GAVCLDGS P Y+ D+GHG GV +W+I+++GGGWC +   C  
Sbjct  22    EDDLYINITILQSATAQGAVCLDGSPPAYHLDRGHGSGVSSWIIYLDGGGWCDSIPDCLD  81

Query  335   RGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATN  514
             R    LGS+K M        LL +S  +NP+FYNW+RVRV YCDGSSFT DV+ VDP   
Sbjct  82    RSTKALGSTKQMKQQGFFAALLHNSSKQNPQFYNWNRVRVKYCDGSSFTGDVEQVDPENK  141

Query  515   LTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLA  694
             L +RG RIF A+M+D  +KGM NA+NAI  G SAGG+A +L+CD F++L P   +VKC+A
Sbjct  142   LFFRGARIFKAIMKDLWSKGMNNAENAILCGTSAGGLATILNCDNFKSLLPENVKVKCVA  201

Query  695   DSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTP  874
             D+ +FIN + + G    Q  +  +V+  GSAK LP  CTS M+ SLCFFP+  + Y++TP
Sbjct  202   DAGFFINGKTISGTSDIQEMYRKIVNLHGSAKNLPSACTSVMEPSLCFFPENVVPYIQTP  261

Query  875   IFLTMSAFDQIQLKYGLTMPIV-------SCVT-YNNCTLNEMKIAQELRLDFLSLLPKK  1030
             +F+  S +D  Q+K  L    +        C +  + CT ++  I Q   ++FL      
Sbjct  262   LFIINSIYDTWQIKNILIPEKLDPQHTWKDCKSNISGCTFSQRIIIQAFGVEFLKKFEGL  321

Query  1031  NSESSIAIWVNNCVSH----EFTYHSWYGPKKLRVIGNKTYAEVFADWYFD  1171
                 +   ++ +C SH      TY  W+     R++ NKT  E  ADW  D
Sbjct  322   PPCFTRGYFLTSCYSHGGILSLTY--WFSASSPRLL-NKTINEAVADWLAD  369



>gb|EEC77932.1| hypothetical protein OsI_17271 [Oryza sativa Indica Group]
Length=530

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/379 (39%), Positives = 228/379 (60%), Gaps = 16/379 (4%)
 Frame = +2

Query  89    IMARLSQWL---CFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGH  259
             + A   +WL      +VL  ++       +V +  L+SAVS GAVCLDGS P Y++  G 
Sbjct  135   MAASSGEWLSRAAMVLVLGLVVASSAKAGDVDMVFLKSAVSTGAVCLDGSPPVYHFSPGS  194

Query  260   GEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNW  439
             G G +NW++ +EGGGWC NAQ C  R  +  GSSK+M P+   G ++  +   NP+FYNW
Sbjct  195   GSGANNWLVHMEGGGWCRNAQECSVRQGNFRGSSKFMRPLSFSG-IIGGNQRNNPDFYNW  253

Query  440   HRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAG  619
             +R++V YCDGSSFT DV+ V+ +TNL +RG R+++A++ED  AKGM  A+NA+ +G SAG
Sbjct  254   NRIKVRYCDGSSFTGDVETVETSTNLHFRGARVWNAIIEDLLAKGMSKAQNALLSGCSAG  313

Query  620   GVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLP  799
             G+A +LHCD FR L P T  VKC +D+ +F++ + + G+   ++ +  +V+  GSAK LP
Sbjct  314   GLAAILHCDQFRDLLPATANVKCFSDAGFFVDGKDITGNDFVRTFYKDVVNLHGSAKNLP  373

Query  800   KECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPI-------VSC-VTY  955
               CTSKM   LCFFPQ  +  ++TP+F+  +A+D  Q+K  L             C +  
Sbjct  374   SSCTSKMSPDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDI  433

Query  956   NNCTLNEMKIAQELRLDFLSLLPK-KNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVI  1126
               C+ +++   Q  R DFL+ LPK + S ++++I++++C +H    +  +W   +   V+
Sbjct  434   TACSSSQLTTLQNFRTDFLAALPKPEQSPANLSIFIDSCYAHCQSGSQDTWLA-QGSPVV  492

Query  1127  GNKTYAEVFADWYFDRNTS  1183
                   +   DW+ DR  S
Sbjct  493   EKTQIGKAVGDWFHDREVS  511



>gb|ABK24994.1| unknown [Picea sitchensis]
Length=399

 Score =   285 bits (730),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/369 (40%), Positives = 221/369 (60%), Gaps = 19/369 (5%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V LT +E AV+KGAVCLDGS PGY+  +G G GV+NW++  EGG WC N   C  R  +R
Sbjct  31    VDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNNVTTCSARTKTR  90

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSKYM    +   LL ++   NP+FYNW+R++V YCDG+SFT DV+ V+P   L +RG
Sbjct  91    LGSSKYMIKQVDFSGLLGNNKARNPDFYNWNRIKVRYCDGASFTGDVEAVNPVDKLYFRG  150

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              R+F A++ D  AKGM NA+ A+ +G SAGG+  +LHCD FRAL P TT+VKCLAD+ +F
Sbjct  151   QRVFKAVIGDLMAKGMINAQQAVISGCSAGGLTSILHCDNFRALMPKTTKVKCLADAGFF  210

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I+ + + G    +S F+ +     S K LP  CT K+  + CFFPQY L Y++TP+FL  
Sbjct  211   IDVKDVSGAYHIRSFFNEVATLQQSVKNLPLACTEKL-GTQCFFPQYLLPYIQTPLFLLN  269

Query  890   SAFDQIQLKYGLTMPIVS--------C-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSES  1042
             + +D  Q+K  +  P V+        C +    C+ N+++  Q  RL+ L+ L    + +
Sbjct  270   AGYDSWQIK-NIVAPGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEMLNALKIFQNSA  328

Query  1043  SIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKP  1216
             S  +++N+C +H       +W      ++ G  + AE   +WYF +      ++++++ P
Sbjct  329   SGGMFINSCYAHCQSEMQETWLANDSPKLNG-LSIAEAVQNWYFGQG-----IVKETDCP  382

Query  1217  LNCSTFEQN  1243
               C +   N
Sbjct  383   YPCDSTCHN  391



>gb|ABK24433.1| unknown [Picea sitchensis]
Length=399

 Score =   285 bits (730),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/369 (40%), Positives = 221/369 (60%), Gaps = 19/369 (5%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V LT +E AV+KGAVCLDGS PGY+  +G G GV+NW++  EGG WC N   C  R  +R
Sbjct  31    VDLTLVEDAVAKGAVCLDGSPPGYHLSRGFGSGVNNWLVHFEGGSWCNNVTTCSARTKTR  90

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
             LGSSKYM    +   LL ++   NP+FYNW+R++V YCDG+SFT DV+ V+P   L +RG
Sbjct  91    LGSSKYMIKQVDFSGLLGNNKARNPDFYNWNRIKVRYCDGASFTGDVEAVNPVDKLYFRG  150

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              R+F A++ D  AKGM NA+ A+ +G SAGG+  +LHCD FRAL P TT+VKCLAD+ +F
Sbjct  151   QRVFKAVIGDLMAKGMINAQQAVISGCSAGGLTSILHCDNFRALMPKTTKVKCLADAGFF  210

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             I+ + + G    +S F+ +     S K LP  CT K+  + CFFPQY L Y++TP+FL  
Sbjct  211   IDVKDVSGAYHIRSFFNEVATLQQSVKNLPLACTEKL-GTQCFFPQYLLPYIQTPLFLLN  269

Query  890   SAFDQIQLKYGLTMPIVS--------C-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSES  1042
             + +D  Q+K  +  P V+        C +    C+ N+++  Q  RL+ L+ L    + +
Sbjct  270   AGYDSWQIK-NIVAPGVADPHGLWHNCKLDIKKCSPNQLETMQGFRLEMLNALKIFQNSA  328

Query  1043  SIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDRNTSPIRVIEKSNKP  1216
             S  +++N+C +H       +W      ++ G  + AE   +WYF +      ++++++ P
Sbjct  329   SGGMFINSCYAHCQSEMQETWLANDSPKLNG-LSIAEAVQNWYFGQG-----IVKETDCP  382

Query  1217  LNCSTFEQN  1243
               C +   N
Sbjct  383   YPCDSTCHN  391



>ref|XP_009763242.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana sylvestris]
Length=386

 Score =   285 bits (728),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 145/363 (40%), Positives = 216/363 (60%), Gaps = 12/363 (3%)
 Frame = +2

Query  122   FVVLLTILRKIEGK-INVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEG  298
             F  LL +    E K + V +T LE+A++KGAVCLDGSAP +++  G G G+++W+I ++G
Sbjct  9     FFSLLCLWTTTEAKDLYVNITYLETAITKGAVCLDGSAPAFHFHPGTGSGINSWLIHLQG  68

Query  299   GGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSF  478
             GGWC     C  R  + L SSK M  +     +LS  P  NP+FYNW+RV++ YCDGSS+
Sbjct  69    GGWCETTSDCLARATTDL-SSKNMSKIAYFTGVLSSDPQFNPDFYNWNRVKIRYCDGSSY  127

Query  479   TSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRA  658
               D++ VDP TNL +RG RIF+A+ME F  +GM  A+NAI +G SAGG+  +LHCD FR 
Sbjct  128   IGDIEEVDPDTNLHFRGARIFEAIMEYFLGQGMIYAQNAILSGTSAGGLGAILHCDKFRL  187

Query  659   LFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTS-KMKASLC  835
               P   RVKC++D+ +F+N E + G+ L +  +  +V   GSAK LP  CT+     +LC
Sbjct  188   FLPLIARVKCISDAGFFVNVEAISGEPLIEEKYKRVVALHGSAKNLPLSCTALSSDPNLC  247

Query  836   FFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS-------CV-TYNNCTLNEMKIAQ  991
             FFPQY  +++ TP+F+  SA+D  Q+   L   +         C    N C+ ++++  Q
Sbjct  248   FFPQYVARHICTPLFIVNSAYDSWQINNSLVPQVADPNNEWPYCKHDINICSPSQIQTLQ  307

Query  992   ELRLDFLSLLPKKNSESSIAIWVNNCVSHE-FTYHSWYGPKKLRVIGNKTYAEVFADWYF  1168
             + RL FL  L +     S   ++++C  H      +++  +    + NKT AE   DW+F
Sbjct  308   DFRLKFLEALNELGPSISRGYFISSCHFHNGIEIQNYWSSRNSPTLANKTIAEAIGDWFF  367

Query  1169  DRN  1177
             DR+
Sbjct  368   DRS  370



>ref|XP_010266381.1| PREDICTED: uncharacterized protein LOC104603915 isoform X2 [Nelumbo 
nucifera]
Length=399

 Score =   285 bits (728),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 144/363 (40%), Positives = 219/363 (60%), Gaps = 11/363 (3%)
 Frame = +2

Query  119   FFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEG  298
              ++++ T++        V +T +E++++KGAVCLDGS P Y+ DKG G G++NW++ +EG
Sbjct  10    LYLLICTLITMKANGFFVGITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHLEG  69

Query  299   GGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSF  478
             GGWC N   C     +R GSSK M        +LS+  N NP+FYNW++++V YCDGSSF
Sbjct  70    GGWCSNVTICLAHKDTRHGSSKKMAKQIAFSGILSNKENFNPDFYNWNKIKVRYCDGSSF  129

Query  479   TSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRA  658
             T DV+ +DPA NL  RG R++ A+MED   KGMKNAK A+ +G S+GG+A +LHCD FR 
Sbjct  130   TGDVEAIDPANNLYLRGERVWQAVMEDLLEKGMKNAKYALLSGCSSGGLAAILHCDRFRE  189

Query  659   LFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCF  838
             L P   +VKCL+D+ YFIN + + G    Q+ ++ +V +  SAK LP  CTS+ + SLCF
Sbjct  190   LLPVDAKVKCLSDAGYFINAKDVSGKDHIQAIYNDVVTTHQSAKNLPVSCTSRTEPSLCF  249

Query  839   FPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS-------C-VTYNNCTLNEMKIAQE  994
             FPQ  +Q + T +F+  +A+D  Q+K  L   +         C +   NC+ ++++  Q 
Sbjct  250   FPQNVVQDMYTQLFILNAAYDSWQIKNTLAPGVADPHGHWHYCKLDIKNCSSSQLQTMQG  309

Query  995   LRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYF  1168
              R +FL+ + +  S S   +++N+C +H       +W       V+     A+   DWY 
Sbjct  310   FRSEFLNSVGELMSSSMKGMFINSCYAHCQSEVQETWLRADS-PVLDKTPIAKAVGDWYN  368

Query  1169  DRN  1177
             DR+
Sbjct  369   DRS  371



>ref|XP_004958440.1| PREDICTED: protein notum homolog [Setaria italica]
Length=414

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/345 (41%), Positives = 207/345 (60%), Gaps = 13/345 (4%)
 Frame = +2

Query  170   VTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSR  349
             V LT ++SA +KGAVCLDGS PGY+  +G G G ++W++ +EGGGWC +   C +R  SR
Sbjct  48    VGLTLIQSAAAKGAVCLDGSLPGYHLHRGFGSGANSWLVNLEGGGWCNDVSSCVFRKGSR  107

Query  350   LGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRG  529
              GSS +M    +   ++S+ P ENP+FYNW+RV+V YCDG SFT D  G + A  L +RG
Sbjct  108   RGSSNHMERQLQFTGIMSNRPEENPDFYNWNRVKVRYCDGGSFTGD--GSNAAAGLYFRG  165

Query  530   VRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYF  709
              RI+ A M+D  A+GM+ A  A+ AG SAGGV+ +LHCD FR LFP+ TRVKCLAD+  F
Sbjct  166   QRIWQAAMDDLMAQGMRYANQALLAGCSAGGVSTILHCDEFRGLFPSNTRVKCLADAGMF  225

Query  710   INDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTM  889
             ++   + G +  +S F+ +V   GS + LP+ CTS+M  + CFFPQ  +  ++TP F+  
Sbjct  226   LDTIDVSGHREMRSFFNGIVRLQGSGRSLPRSCTSRMDKTSCFFPQNVVPNIQTPTFILN  285

Query  890   SAFDQIQLKYGLTMPIV-------SCVTYNN-CTLNEMKIAQELRLDFLSLLPKKNSESS  1045
             +A+D  QL+  +             C T +  C  N+++  Q  R + L  +   ++   
Sbjct  286   TAYDVWQLQQSVAPKAADPQGLWSKCRTNHAFCNSNQLQFLQGFRNEMLDSVRGFSASRQ  345

Query  1046  IAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
               +++N+C +H       +WY     R +GNK  AE   DWYF R
Sbjct  346   NGVFINSCFAHCQSERQDTWYASNSPR-LGNKRIAEAVGDWYFQR  389



>gb|KHG23649.1| Notum [Gossypium arboreum]
Length=381

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/330 (44%), Positives = 205/330 (62%), Gaps = 14/330 (4%)
 Frame = +2

Query  215   CLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGD  394
             CLDG+ P Y++DKG+G G+++W+I +EGGGWC N   C  R  + LGSSK M        
Sbjct  29    CLDGTPPAYHWDKGYGTGINSWLIQLEGGGWCNNVSSCLVRKNTHLGSSKRMVKQIPFSG  88

Query  395   LLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKG  574
             +L+     N  FYNW+R++V YCDGSSFT DV  V+P  NL +RG R++ A+MED  +KG
Sbjct  89    ILN-----NKHFYNWNRIKVRYCDGSSFTGDVAAVNPVANLHFRGARVWLAVMEDLLSKG  143

Query  575   MKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSS  754
             M+NA+NAI +G SAGG+A +LHCD FRAL P  T+VKC++D+ YFIN   + G    Q+ 
Sbjct  144   MRNAENAILSGCSAGGLASILHCDSFRALLPMGTKVKCISDAGYFINTRDVSGGHYIQTF  203

Query  755   FDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMP  934
             FD LV + GSAK L   CTS+MK  LCFFPQY  Q ++TP+F+  +A+D  Q++  L   
Sbjct  204   FDQLVATHGSAKNLLPSCTSRMKPGLCFFPQYIAQQIRTPLFIINAAYDSWQIRNILAPG  263

Query  935   IV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSIAIWVNNCVSHEFTY  1090
             I        SC +   NC  +++K+ Q+ RL FL  L +    +S  +++++C +H  T 
Sbjct  264   IADPHGHWESCKLDIKNCLPSQIKVMQDFRLQFLVALLRLGKSASRGMFIDSCFAHCQTE  323

Query  1091  HSWYGPKKLRVIGNKT-YAEVFADWYFDRN  1177
                    +   + NKT   +   DW++DRN
Sbjct  324   MQELWFMQDSPLLNKTKIGKAVGDWFYDRN  353



>ref|NP_851135.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 gb|AAL07047.1| putative pectin acetylesterase [Arabidopsis thaliana]
 gb|AAN12894.1| putative pectin acetylesterase [Arabidopsis thaliana]
 gb|AED95225.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=370

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 201/322 (62%), Gaps = 14/322 (4%)
 Frame = +2

Query  110   WLCFFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIF  289
             W    V+ + ++    G   V +T LESAV+KGAVCLDGSAP Y++DKG G GV+NW++ 
Sbjct  8     WSSILVLAVVVI----GARAVPITYLESAVAKGAVCLDGSAPAYHFDKGSGSGVNNWIVH  63

Query  290   IEGGGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDG  469
             +EGGGWC +   C  R  +  GSSK M   F    +L    + NP+FYNW+R++V YCDG
Sbjct  64    MEGGGWCTDIATCVQRKSTMKGSSKLMNKDFGFSGILGGKQSTNPDFYNWNRIKVRYCDG  123

Query  470   SSFTSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDY  649
             SSFT D++ VDP   L +RG R++ A+++D  AKGM NA+NAI +G SAG +A +LHCD 
Sbjct  124   SSFTGDIEAVDPTHKLFFRGARVWRAVIDDLMAKGMSNAQNAILSGCSAGALAAILHCDQ  183

Query  650   FRALFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKAS  829
             F++  P T +VKC++D+ YFI+ + + G    QS +  +V + GSAK LP  CTS MK  
Sbjct  184   FKSTLPKTAKVKCVSDAGYFIHGKDITGGSYIQSYYAKVVATHGSAKSLPASCTSSMKPD  243

Query  830   LCFFPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKI  985
             LCFFPQY  + ++TP+F+  +AFD  Q+K  L    V       +C +    CT  +++ 
Sbjct  244   LCFFPQYVAKTLQTPLFVINAAFDSWQIKNVLAPTSVDKSKAWKTCKLDLKKCTAAQLQT  303

Query  986   AQELR--LDFLSLLPKKNSESS  1045
              QE +  L +    P++ ++ S
Sbjct  304   VQETKCWLRWRLFDPRRRTDCS  325



>ref|XP_010054026.1| PREDICTED: uncharacterized protein LOC104442333 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010054027.1| PREDICTED: uncharacterized protein LOC104442333 isoform X1 [Eucalyptus 
grandis]
Length=434

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/405 (38%), Positives = 230/405 (57%), Gaps = 48/405 (12%)
 Frame = +2

Query  95    ARLSQWLCFFVVLLTILRKIEGKINVTLTTLESAVSKGA---------------------  211
             AR   WLC  + L+ +L+     + +T     SAV++GA                     
Sbjct  4     ARSRLWLCSLLFLVALLQARGVPVRITYVR-NSAVARGAGKGLIVWGQKMNASLHIRGLR  62

Query  212   -------------VCLDGSAPGYYYDKGHGEGVDNWVIFIEGGGWCMNAQHCKYRGPSRL  352
                          VCLDGS P Y+ D+G G G++NW++ IEGGGWC N   C  R  +RL
Sbjct  63    VSFYVLVLDSCDVVCLDGSPPAYHLDRGFGTGINNWLVHIEGGGWCNNVTTCLARKNTRL  122

Query  353   GSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFTSDVDGVDPATNLTYRGV  532
             GSSK M        +LS+    NP+FYNW+R++V YCDG+SFT D++ V+PATNL +RG 
Sbjct  123   GSSKQMAKEIPFSGILSNKRRYNPDFYNWNRIKVRYCDGASFTGDIEAVNPATNLHFRGA  182

Query  533   RIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRALFPNTTRVKCLADSSYFI  712
             R++ A+MED  + GM   +NAI +G SAGG+  ++HCD FRAL P   +VKCL+D+ +FI
Sbjct  183   RVWQAVMEDLLSIGMAKVENAILSGCSAGGLTTIIHCDGFRALLPMGAKVKCLSDAGFFI  242

Query  713   NDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFFPQYSLQYVKTPIFLTMS  892
             N + + G    +S ++ +V + GSAK LP+ CTS     LCFFPQY  + ++TP+F+  +
Sbjct  243   NAKDVSGVLHIESYYNQVVATHGSAKHLPRSCTSIFSPGLCFFPQYMARQMQTPLFILNA  302

Query  893   AFDQIQLKYGLTMPIV-------SC-VTYNNCTLNEMKIAQELRLDFLSLLPKKNSESSI  1048
             A+D  Q+K  L   +         C +  NNC+ N++K+ Q+ RL+F+  L +  S SS 
Sbjct  303   AYDSWQIKNILAPGVADPQGTWHGCELDINNCSPNQLKVMQDFRLEFMYSLGRLGSSSSR  362

Query  1049  AIWVNNCVSH--EFTYHSW-YGPKKLRVIGNKTYAEVFADWYFDR  1174
              +++++C +H    T  +W +G     V+   + A    DW+FDR
Sbjct  363   GLFIDSCYAHCQSETQETWLWGDSP--VLAKTSIARAVGDWFFDR  405



>ref|XP_009626489.1| PREDICTED: protein notum homolog isoform X1 [Nicotiana tomentosiformis]
Length=386

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 214/361 (59%), Gaps = 10/361 (3%)
 Frame = +2

Query  122   FVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEGG  301
             FV LL +    + +  V  T LESAV++GAVCLDGSAP + + +G G  V  W++ +EGG
Sbjct  9     FVSLLCVSTTTQAQY-VNTTILESAVAEGAVCLDGSAPAFNFYQGTGARVRRWLLHLEGG  67

Query  302   GWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSFT  481
             GWC    +C  R     GSSK + P      +LS+ P  NP+FY+W++V++ YCDG+S+T
Sbjct  68    GWCDTTSNCLTRAGQVYGSSKQIPPQAYFTGILSNDPELNPDFYDWNKVKIRYCDGASYT  127

Query  482   SDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRAL  661
              DV+ VDP+TNL YRG RIF A+++   AKGM  A+NAI +G SAGG+A +L+CD F  L
Sbjct  128   GDVEEVDPSTNLHYRGARIFKAIVQHLLAKGMYKAENAILSGTSAGGLAAILNCDKFNNL  187

Query  662   FPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCFF  841
              P + RV+C++DS +F+N E + G    Q  F  +V   GSAK LP+ C      SLCFF
Sbjct  188   LPLSVRVRCISDSGFFVNVETISGYPHIQELFYRVVKLHGSAKNLPQACAFDYDKSLCFF  247

Query  842   PQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVSCV-TYNN-------CTLNEMKIAQEL  997
             PQY   Y++TP+F+  SA+D  Q+ Y      V  +  +NN       CT ++++I  + 
Sbjct  248   PQYVAPYMQTPLFIINSAYDSWQVNYSFVPKYVDPLGVWNNCKHHISQCTPSQLQILDDY  307

Query  998   RLDFLSLLPKKNSESSIAIWVNNCVSHEFT-YHSWYGPKKLRVIGNKTYAEVFADWYFDR  1174
             RL FL  L      SS   ++ +C +H      S++  K    + NK  A+   DWYF+R
Sbjct  308   RLKFLKALQGLGPSSSRGYFIISCHTHNIVERQSYWMYKNSPTLDNKKIAKAVGDWYFER  367

Query  1175  N  1177
             +
Sbjct  368   S  368



>ref|XP_010266380.1| PREDICTED: uncharacterized protein LOC104603915 isoform X1 [Nelumbo 
nucifera]
Length=412

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/363 (40%), Positives = 219/363 (60%), Gaps = 11/363 (3%)
 Frame = +2

Query  119   FFVVLLTILRKIEGKINVTLTTLESAVSKGAVCLDGSAPGYYYDKGHGEGVDNWVIFIEG  298
              ++++ T++        V +T +E++++KGAVCLDGS P Y+ DKG G G++NW++ +EG
Sbjct  23    LYLLICTLITMKANGFFVGITYVENSIAKGAVCLDGSPPAYHMDKGFGSGINNWLVHLEG  82

Query  299   GGWCMNAQHCKYRGPSRLGSSKYMWPVFEMGDLLSDSPNENPEFYNWHRVRVAYCDGSSF  478
             GGWC N   C     +R GSSK M        +LS+  N NP+FYNW++++V YCDGSSF
Sbjct  83    GGWCSNVTICLAHKDTRHGSSKKMAKQIAFSGILSNKENFNPDFYNWNKIKVRYCDGSSF  142

Query  479   TSDVDGVDPATNLTYRGVRIFDALMEDFQAKGMKNAKNAIFAGNSAGGVAVMLHCDYFRA  658
             T DV+ +DPA NL  RG R++ A+MED   KGMKNAK A+ +G S+GG+A +LHCD FR 
Sbjct  143   TGDVEAIDPANNLYLRGERVWQAVMEDLLEKGMKNAKYALLSGCSSGGLAAILHCDRFRE  202

Query  659   LFPNTTRVKCLADSSYFINDEKLEGDKLFQSSFDYLVDSMGSAKWLPKECTSKMKASLCF  838
             L P   +VKCL+D+ YFIN + + G    Q+ ++ +V +  SAK LP  CTS+ + SLCF
Sbjct  203   LLPVDAKVKCLSDAGYFINAKDVSGKDHIQAIYNDVVTTHQSAKNLPVSCTSRTEPSLCF  262

Query  839   FPQYSLQYVKTPIFLTMSAFDQIQLKYGLTMPIVS-------C-VTYNNCTLNEMKIAQE  994
             FPQ  +Q + T +F+  +A+D  Q+K  L   +         C +   NC+ ++++  Q 
Sbjct  263   FPQNVVQDMYTQLFILNAAYDSWQIKNTLAPGVADPHGHWHYCKLDIKNCSSSQLQTMQG  322

Query  995   LRLDFLSLLPKKNSESSIAIWVNNCVSH--EFTYHSWYGPKKLRVIGNKTYAEVFADWYF  1168
              R +FL+ + +  S S   +++N+C +H       +W       V+     A+   DWY 
Sbjct  323   FRSEFLNSVGELMSSSMKGMFINSCYAHCQSEVQETWLRADS-PVLDKTPIAKAVGDWYN  381

Query  1169  DRN  1177
             DR+
Sbjct  382   DRS  384



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3428687942708