BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82435_g1_i1 len=638 path=[1:0-637]

Length=638
                                                                      Score     E

emb|CAN61169.1|  hypothetical protein VITISV_010446                     190   9e-53   Vitis vinifera
gb|KHG06920.1|  hypothetical protein F383_33692                         177   2e-52   
emb|CBI30743.3|  unnamed protein product                                184   3e-51   
gb|KHF98741.1|  hypothetical protein F383_14220                         174   3e-51   
ref|XP_009600347.1|  PREDICTED: probable LRR receptor-like serine...    188   4e-51   
ref|XP_009795508.1|  PREDICTED: probable LRR receptor-like serine...    188   4e-51   
ref|XP_010655558.1|  PREDICTED: probable LRR receptor-like serine...    186   1e-50   
ref|XP_010655559.1|  PREDICTED: probable LRR receptor-like serine...    186   1e-50   
ref|XP_006358077.1|  PREDICTED: probable LRR receptor-like serine...    185   2e-50   
ref|XP_004233025.1|  PREDICTED: probable LRR receptor-like serine...    185   3e-50   
emb|CBI30745.3|  unnamed protein product                                186   5e-50   
ref|XP_006358075.1|  PREDICTED: probable LRR receptor-like serine...    184   1e-49   
ref|XP_007213704.1|  hypothetical protein PRUPE_ppa000741mg             184   2e-49   
ref|XP_010655563.1|  PREDICTED: probable LRR receptor-like serine...    183   2e-49   
ref|XP_010655564.1|  PREDICTED: probable LRR receptor-like serine...    182   3e-49   
ref|XP_010655562.1|  PREDICTED: probable LRR receptor-like serine...    182   3e-49   
ref|XP_008245181.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    182   7e-49   
ref|XP_008225419.1|  PREDICTED: probable leucine-rich repeat rece...    181   1e-48   
ref|XP_007025271.1|  Leucine-rich repeat transmembrane protein ki...    173   2e-48   
ref|XP_008349229.1|  PREDICTED: probable LRR receptor-like serine...    171   2e-48   
ref|XP_006358076.1|  PREDICTED: probable LRR receptor-like serine...    177   1e-47   
ref|XP_007214558.1|  hypothetical protein PRUPE_ppa000742mg             177   3e-47   
emb|CAN65055.1|  hypothetical protein VITISV_012378                     173   5e-47   Vitis vinifera
ref|XP_004296291.1|  PREDICTED: probable leucine-rich repeat rece...    175   2e-46   
ref|XP_008345927.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-46   
emb|CDO96888.1|  unnamed protein product                                175   2e-46   
ref|XP_011101928.1|  PREDICTED: probable leucine-rich repeat rece...    173   2e-46   
gb|KDP21156.1|  hypothetical protein JCGZ_21627                         174   3e-46   
ref|XP_010112408.1|  putative leucine-rich repeat receptor-like s...    173   5e-46   
ref|XP_010655586.1|  PREDICTED: probable LRR receptor-like serine...    173   6e-46   
emb|CBI30748.3|  unnamed protein product                                173   7e-46   
ref|XP_006358134.1|  PREDICTED: probable LRR receptor-like serine...    173   7e-46   
ref|XP_010316867.1|  PREDICTED: probable LRR receptor-like serine...    173   7e-46   
ref|XP_008225417.1|  PREDICTED: probable LRR receptor-like serine...    173   7e-46   
ref|XP_008225418.1|  PREDICTED: probable LRR receptor-like serine...    173   7e-46   
ref|XP_007213678.1|  hypothetical protein PRUPE_ppa000939mg             173   8e-46   
ref|XP_008347521.1|  PREDICTED: probable leucine-rich repeat rece...    171   1e-45   
ref|XP_008345983.1|  PREDICTED: probable LRR receptor-like serine...    169   2e-45   
ref|XP_010655578.1|  PREDICTED: probable LRR receptor-like serine...    171   2e-45   
ref|XP_006370934.1|  hypothetical protein POPTR_0019s01910g             159   3e-45   
ref|XP_007214549.1|  hypothetical protein PRUPE_ppa001005mg             170   6e-45   
ref|XP_007025270.1|  Leucine-rich repeat transmembrane protein ki...    170   6e-45   
ref|XP_008225432.1|  PREDICTED: probable LRR receptor-like serine...    168   6e-45   
ref|XP_010655575.1|  PREDICTED: probable LRR receptor-like serine...    170   6e-45   
ref|XP_010655576.1|  PREDICTED: probable LRR receptor-like serine...    170   6e-45   
ref|XP_010655574.1|  PREDICTED: probable LRR receptor-like serine...    170   7e-45   
ref|XP_008371519.1|  PREDICTED: probable LRR receptor-like serine...    170   9e-45   
ref|XP_007214698.1|  hypothetical protein PRUPE_ppa026371mg             170   9e-45   
ref|XP_007025266.1|  Leucine-rich repeat transmembrane protein ki...    170   9e-45   
ref|XP_006377507.1|  hypothetical protein POPTR_0011s065502g            164   1e-44   
ref|XP_006371025.1|  hypothetical protein POPTR_0019s027401g            157   2e-44   
ref|XP_004296585.1|  PREDICTED: probable LRR receptor-like serine...    158   3e-44   
emb|CAN81177.1|  hypothetical protein VITISV_011951                     168   3e-44   Vitis vinifera
gb|KDO35800.1|  hypothetical protein CISIN_1g028061mg                   158   3e-44   
ref|XP_010088632.1|  putative LRR receptor-like serine/threonine-...    166   4e-44   
ref|XP_008225259.1|  PREDICTED: probable LRR receptor-like serine...    167   6e-44   
ref|XP_009351856.1|  PREDICTED: probable LRR receptor-like serine...    167   1e-43   
ref|XP_006377521.1|  hypothetical protein POPTR_0011s06650g             160   1e-43   
ref|XP_006377456.1|  hypothetical protein POPTR_0011s06100g             163   2e-43   
ref|XP_007025267.1|  Leucine-rich repeat transmembrane protein ki...    166   2e-43   
ref|XP_010088635.1|  putative LRR receptor-like serine/threonine-...    163   2e-43   
ref|XP_002522279.1|  ATP binding protein, putative                      166   2e-43   Ricinus communis
ref|XP_007214035.1|  hypothetical protein PRUPE_ppa017351mg             164   5e-43   
ref|XP_006388189.1|  hypothetical protein POPTR_0294s002001g            157   7e-43   
ref|XP_006495027.1|  PREDICTED: probable LRR receptor-like serine...    159   1e-42   
ref|XP_009758721.1|  PREDICTED: probable LRR receptor-like serine...    159   1e-42   
ref|XP_006377514.1|  hypothetical protein POPTR_0011s06595g             156   2e-42   
ref|XP_008225260.1|  PREDICTED: probable leucine-rich repeat rece...    163   3e-42   
ref|XP_008377580.1|  PREDICTED: probable LRR receptor-like serine...    162   3e-42   
ref|XP_006377525.1|  putative receptor-like protein kinase RLPK1        160   3e-42   
ref|XP_006388928.1|  hypothetical protein POPTR_0073s00200g             157   4e-42   
ref|XP_010088631.1|  putative leucine-rich repeat receptor-like s...    162   6e-42   
ref|XP_008245184.1|  PREDICTED: probable leucine-rich repeat rece...    161   1e-41   
ref|XP_009600352.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-41   
ref|XP_006377483.1|  putative receptor-like protein kinase RLPK1        158   2e-41   
ref|XP_009600351.1|  PREDICTED: probable LRR receptor-like serine...    160   2e-41   
ref|XP_004295407.1|  PREDICTED: probable LRR receptor-like serine...    161   2e-41   
ref|XP_011046381.1|  PREDICTED: probable leucine-rich repeat rece...    160   3e-41   
ref|XP_002300205.2|  hypothetical protein POPTR_0001s31610g             160   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_009600350.1|  PREDICTED: probable LRR receptor-like serine...    160   3e-41   
ref|XP_006377493.1|  hypothetical protein POPTR_0011s06440g             152   3e-41   
ref|XP_009600349.1|  PREDICTED: probable LRR receptor-like serine...    160   4e-41   
ref|XP_009600348.1|  PREDICTED: probable LRR receptor-like serine...    159   4e-41   
ref|XP_006377518.1|  hypothetical protein POPTR_0011s066201g            157   5e-41   
ref|XP_006370936.1|  hypothetical protein POPTR_0019s01930g             156   8e-41   
ref|XP_002317383.2|  hypothetical protein POPTR_0011s06220g             156   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_006371019.1|  hypothetical protein POPTR_0019s027001g            156   1e-40   
ref|XP_006377501.1|  hypothetical protein POPTR_0011s06490g             155   1e-40   
ref|XP_006377461.1|  hypothetical protein POPTR_0011s06150g             151   2e-40   
ref|XP_006467585.1|  PREDICTED: probable LRR receptor-like serine...    157   2e-40   
ref|XP_008366034.1|  PREDICTED: probable LRR receptor-like serine...    157   3e-40   
ref|XP_006377482.1|  hypothetical protein POPTR_0011s06335g             154   3e-40   
ref|XP_002325753.2|  hypothetical protein POPTR_0019s01950g             157   3e-40   Populus trichocarpa [western balsam poplar]
emb|CBI30752.3|  unnamed protein product                                154   4e-40   
ref|XP_006371027.1|  hypothetical protein POPTR_0019s02760g             156   4e-40   
ref|XP_006377459.1|  hypothetical protein POPTR_0011s06130g             154   4e-40   
ref|XP_010316866.1|  PREDICTED: probable LRR receptor-like serine...    157   4e-40   
ref|XP_004295408.1|  PREDICTED: probable LRR receptor-like serine...    157   4e-40   
emb|CBI30750.3|  unnamed protein product                                154   4e-40   
ref|XP_006449566.1|  hypothetical protein CICLE_v10014125mg             157   5e-40   
ref|XP_006377463.1|  hypothetical protein POPTR_0011s06170g             151   5e-40   
ref|XP_011045704.1|  PREDICTED: probable LRR receptor-like serine...    155   7e-40   
ref|XP_006358135.1|  PREDICTED: probable LRR receptor-like serine...    155   8e-40   
ref|XP_011046363.1|  PREDICTED: probable leucine-rich repeat rece...    155   8e-40   
ref|XP_011009667.1|  PREDICTED: probable LRR receptor-like serine...    152   9e-40   
ref|XP_011009666.1|  PREDICTED: probable LRR receptor-like serine...    152   1e-39   
ref|XP_002317319.2|  hypothetical protein POPTR_0011s032002g            153   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011014229.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
ref|XP_011046365.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
ref|XP_011014228.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
ref|XP_011014227.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
ref|XP_011045702.1|  PREDICTED: probable LRR receptor-like serine...    155   1e-39   
ref|XP_011014230.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
ref|XP_011046364.1|  PREDICTED: probable leucine-rich repeat rece...    155   1e-39   
ref|XP_011046359.1|  PREDICTED: probable leucine-rich repeat rece...    155   2e-39   
ref|XP_011046360.1|  PREDICTED: probable leucine-rich repeat rece...    155   2e-39   
ref|XP_011046349.1|  PREDICTED: probable LRR receptor-like serine...    155   2e-39   
ref|XP_011046362.1|  PREDICTED: probable leucine-rich repeat rece...    155   2e-39   
ref|XP_011046350.1|  PREDICTED: probable LRR receptor-like serine...    155   2e-39   
ref|XP_006384081.1|  hypothetical protein POPTR_0004s06270g             151   2e-39   
ref|XP_006384080.1|  hypothetical protein POPTR_0004s06270g             151   2e-39   
emb|CBI30754.3|  unnamed protein product                                152   2e-39   
ref|XP_002528777.1|  ATP binding protein, putative                      154   3e-39   Ricinus communis
ref|XP_011002041.1|  PREDICTED: probable LRR receptor-like serine...    154   3e-39   
ref|XP_011002039.1|  PREDICTED: probable LRR receptor-like serine...    154   3e-39   
ref|XP_011002042.1|  PREDICTED: probable LRR receptor-like serine...    154   3e-39   
ref|XP_011002040.1|  PREDICTED: probable LRR receptor-like serine...    154   3e-39   
ref|XP_008346191.1|  PREDICTED: probable LRR receptor-like serine...    144   3e-39   
ref|XP_006370931.1|  hypothetical protein POPTR_0019s01880g             149   4e-39   
ref|XP_008384519.1|  PREDICTED: TMV resistance protein N-like iso...    154   4e-39   
ref|XP_011002049.1|  PREDICTED: probable LRR receptor-like serine...    154   4e-39   
ref|XP_008384518.1|  PREDICTED: TMV resistance protein N-like iso...    154   4e-39   
ref|XP_002305710.2|  hypothetical protein POPTR_0004s06240g             150   5e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011002048.1|  PREDICTED: probable LRR receptor-like serine...    154   5e-39   
ref|XP_011002050.1|  PREDICTED: probable LRR receptor-like serine...    154   5e-39   
ref|NP_001235287.1|  receptor-like protein kinase                       146   5e-39   
ref|XP_011002046.1|  PREDICTED: probable LRR receptor-like serine...    154   5e-39   
ref|XP_011002045.1|  PREDICTED: probable LRR receptor-like serine...    154   5e-39   
ref|XP_011002047.1|  PREDICTED: probable LRR receptor-like serine...    154   5e-39   
ref|XP_011002044.1|  PREDICTED: probable LRR receptor-like serine...    154   6e-39   
ref|XP_010665668.1|  PREDICTED: probable LRR receptor-like serine...    153   6e-39   
ref|XP_010655585.1|  PREDICTED: probable LRR receptor-like serine...    152   8e-39   
ref|XP_010665669.1|  PREDICTED: probable LRR receptor-like serine...    152   9e-39   
ref|XP_010665665.1|  PREDICTED: probable LRR receptor-like serine...    152   1e-38   
ref|XP_010665667.1|  PREDICTED: probable LRR receptor-like serine...    152   1e-38   
ref|XP_010665666.1|  PREDICTED: probable LRR receptor-like serine...    152   1e-38   
ref|XP_010272760.1|  PREDICTED: probable leucine-rich repeat rece...    152   1e-38   
ref|XP_010655584.1|  PREDICTED: probable LRR receptor-like serine...    152   1e-38   
ref|XP_004309629.1|  PREDICTED: probable LRR receptor-like serine...    151   1e-38   
ref|XP_010655583.1|  PREDICTED: probable LRR receptor-like serine...    152   1e-38   
ref|XP_010655590.1|  PREDICTED: probable LRR receptor-like serine...    152   2e-38   
ref|XP_010655588.1|  PREDICTED: probable LRR receptor-like serine...    152   2e-38   
ref|XP_010655589.1|  PREDICTED: probable LRR receptor-like serine...    152   2e-38   
ref|XP_010655582.1|  PREDICTED: probable LRR receptor-like serine...    152   2e-38   
gb|AAL73330.1|  putative receptor-like protein kinase RLPK1             143   2e-38   Glycine max [soybeans]
ref|XP_004295405.1|  PREDICTED: probable leucine-rich repeat rece...    152   2e-38   
ref|XP_010095160.1|  putative LRR receptor-like serine/threonine-...    142   2e-38   
ref|XP_011046351.1|  PREDICTED: probable LRR receptor-like serine...    152   3e-38   
ref|XP_004491049.1|  PREDICTED: probable leucine-rich repeat rece...    141   3e-38   
ref|XP_010655580.1|  PREDICTED: probable LRR receptor-like serine...    152   3e-38   
ref|XP_010655581.1|  PREDICTED: probable LRR receptor-like serine...    152   3e-38   
gb|KHG23496.1|  putative LRR receptor-like serine/threonine-prote...    150   3e-38   
emb|CAE54078.1|  receptor-like protein kinase                           142   5e-38   Fagus sylvatica
gb|KCW48261.1|  hypothetical protein EUGRSUZ_K019901                    140   6e-38   
gb|KCW67603.1|  hypothetical protein EUGRSUZ_F013601                    139   1e-37   
ref|XP_006388874.1|  hypothetical protein POPTR_0084s00200g             139   2e-37   
gb|KHN36927.1|  Putative leucine-rich repeat receptor-like serine...    146   2e-37   
ref|XP_002522276.1|  kinase, putative                                   149   3e-37   Ricinus communis
ref|XP_010064500.1|  PREDICTED: probable LRR receptor-like serine...    137   3e-37   
ref|XP_011039371.1|  PREDICTED: probable LRR receptor-like serine...    148   4e-37   
ref|XP_007149541.1|  hypothetical protein PHAVU_005G078900g             148   4e-37   
gb|KHN38783.1|  Putative LRR receptor-like serine/threonine-prote...    142   4e-37   
ref|XP_006371021.1|  hypothetical protein POPTR_0019s027201g            145   5e-37   
gb|KCW67580.1|  hypothetical protein EUGRSUZ_F01336                     139   5e-37   
gb|KCW67550.1|  hypothetical protein EUGRSUZ_F013052                    142   5e-37   
ref|XP_006377472.1|  hypothetical protein POPTR_0011s06260g             145   8e-37   
ref|XP_010246509.1|  PREDICTED: probable leucine-rich repeat rece...    147   9e-37   
ref|XP_006847775.1|  hypothetical protein AMTR_s00162p00056910          144   2e-36   
gb|KCW67582.1|  hypothetical protein EUGRSUZ_F01341                     140   2e-36   
ref|XP_010060741.1|  PREDICTED: probable leucine-rich repeat rece...    137   2e-36   
ref|XP_006442308.1|  hypothetical protein CICLE_v10024314mg             146   2e-36   
ref|XP_010041838.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-36   
ref|XP_010094305.1|  putative LRR receptor-like serine/threonine-...    141   2e-36   
emb|CAN73789.1|  hypothetical protein VITISV_025000                     144   3e-36   Vitis vinifera
emb|CBI30739.3|  unnamed protein product                                144   6e-36   
emb|CDY35291.1|  BnaC03g59320D                                          135   7e-36   
ref|XP_006377527.1|  hypothetical protein POPTR_0011s067102g            137   7e-36   
ref|XP_010655556.1|  PREDICTED: probable LRR receptor-like serine...    144   8e-36   
ref|XP_010655557.1|  PREDICTED: probable LRR receptor-like serine...    144   8e-36   
gb|KCW78573.1|  hypothetical protein EUGRSUZ_C00047                     135   9e-36   
gb|KCW67556.1|  hypothetical protein EUGRSUZ_F01306                     144   9e-36   
ref|XP_010272675.1|  PREDICTED: probable LRR receptor-like serine...    134   1e-35   
ref|XP_007025275.1|  Receptor-like kinase in flowers 1, putative        144   1e-35   
ref|XP_007149532.1|  hypothetical protein PHAVU_005G078100g             142   1e-35   
ref|XP_010272742.1|  PREDICTED: probable leucine-rich repeat rece...    144   1e-35   
ref|XP_006377598.1|  hypothetical protein POPTR_0011s080251g            138   1e-35   
ref|XP_010272741.1|  PREDICTED: probable LRR receptor-like serine...    144   1e-35   
ref|XP_006847776.1|  hypothetical protein AMTR_s00162p00057050          138   1e-35   
ref|XP_010313922.1|  PREDICTED: probable LRR receptor-like serine...    144   1e-35   
ref|XP_010112410.1|  putative LRR receptor-like serine/threonine-...    143   2e-35   
ref|XP_002317385.1|  hypothetical protein POPTR_0011s06740g             144   2e-35   Populus trichocarpa [western balsam poplar]
gb|KCW48256.1|  hypothetical protein EUGRSUZ_K01985                     142   2e-35   
ref|XP_010036442.1|  PREDICTED: probable leucine-rich repeat rece...    142   2e-35   
ref|XP_004251900.1|  PREDICTED: probable LRR receptor-like serine...    143   2e-35   
gb|KEH28296.1|  LRR receptor-like kinase                                143   2e-35   
ref|XP_010060732.1|  PREDICTED: probable LRR receptor-like serine...    143   2e-35   
ref|XP_010036440.1|  PREDICTED: probable leucine-rich repeat rece...    142   3e-35   
ref|XP_010036446.1|  PREDICTED: probable leucine-rich repeat rece...    133   3e-35   
ref|XP_003616753.1|  Cysteine-rich receptor-like protein kinase         143   3e-35   
ref|XP_010064505.1|  PREDICTED: probable leucine-rich repeat rece...    140   4e-35   
gb|ACM89476.1|  leucine-rich repeat family protein / protein kina...    140   4e-35   Glycine max [soybeans]
ref|NP_001238634.1|  receptor-like kinase                               133   5e-35   
ref|XP_010038955.1|  PREDICTED: probable leucine-rich repeat rece...    142   5e-35   
gb|KCW48003.1|  hypothetical protein EUGRSUZ_K01737                     140   5e-35   
ref|XP_010036439.1|  PREDICTED: probable leucine-rich repeat rece...    141   5e-35   
ref|XP_010060733.1|  PREDICTED: probable LRR receptor-like serine...    142   5e-35   
ref|XP_010038874.1|  PREDICTED: probable leucine-rich repeat rece...    140   6e-35   
ref|XP_006477836.1|  PREDICTED: probable LRR receptor-like serine...    142   6e-35   
gb|KCW48028.1|  hypothetical protein EUGRSUZ_K01762                     141   6e-35   
gb|KCW48051.1|  hypothetical protein EUGRSUZ_K01793                     140   6e-35   
ref|XP_008245552.1|  PREDICTED: probable leucine-rich repeat rece...    140   6e-35   
gb|EYU29542.1|  hypothetical protein MIMGU_mgv1a0269212mg               138   7e-35   
ref|XP_008226374.1|  PREDICTED: probable leucine-rich repeat rece...    139   7e-35   
ref|XP_007025276.1|  Receptor-like kinase in flowers 1, putative        141   1e-34   
gb|KCW67547.1|  hypothetical protein EUGRSUZ_F01301                     141   1e-34   
gb|KCW67607.1|  hypothetical protein EUGRSUZ_F013621                    141   1e-34   
ref|XP_010480726.1|  PREDICTED: probable LRR receptor-like serine...    134   1e-34   
gb|KFK44797.1|  hypothetical protein AALP_AA1G304600                    140   1e-34   
gb|KHN36920.1|  Putative LRR receptor-like serine/threonine-prote...    141   1e-34   
ref|XP_010046856.1|  PREDICTED: probable leucine-rich repeat rece...    134   1e-34   
ref|XP_010060749.1|  PREDICTED: probable leucine-rich repeat rece...    141   1e-34   
ref|XP_002532988.1|  conserved hypothetical protein                     140   2e-34   Ricinus communis
ref|XP_010064483.1|  PREDICTED: probable LRR receptor-like serine...    141   2e-34   
ref|XP_011010609.1|  PREDICTED: probable LRR receptor-like serine...    140   2e-34   
ref|XP_006358931.1|  PREDICTED: probable LRR receptor-like serine...    140   2e-34   
ref|XP_006442369.1|  hypothetical protein CICLE_v10018721mg             140   2e-34   
ref|XP_008225247.1|  PREDICTED: probable LRR receptor-like serine...    140   2e-34   
ref|XP_010064492.1|  PREDICTED: probable leucine-rich repeat rece...    135   2e-34   
ref|XP_002306015.2|  hypothetical protein POPTR_0004s14310g             140   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010246510.1|  PREDICTED: probable leucine-rich repeat rece...    140   2e-34   
gb|KDO42388.1|  hypothetical protein CISIN_1g001767mg                   140   2e-34   
ref|XP_006592614.1|  PREDICTED: probable LRR receptor-like serine...    140   2e-34   
ref|XP_006449567.1|  hypothetical protein CICLE_v10014126mg             140   2e-34   
ref|XP_008451726.1|  PREDICTED: probable LRR receptor-like serine...    140   2e-34   
ref|XP_008225246.1|  PREDICTED: probable LRR receptor-like serine...    140   2e-34   
gb|KHN42594.1|  Putative LRR receptor-like serine/threonine-prote...    140   3e-34   
ref|XP_010272733.1|  PREDICTED: probable LRR receptor-like serine...    140   3e-34   
ref|XP_004146083.1|  PREDICTED: probable LRR receptor-like serine...    140   3e-34   
ref|XP_011010608.1|  PREDICTED: probable LRR receptor-like serine...    140   3e-34   
gb|KCW71078.1|  hypothetical protein EUGRSUZ_F04177                     139   3e-34   
ref|XP_006370088.1|  hypothetical protein POPTR_0001s39420g             139   3e-34   
ref|XP_006582117.1|  PREDICTED: probable LRR receptor-like serine...    140   3e-34   
ref|XP_010093476.1|  putative LRR receptor-like serine/threonine-...    131   3e-34   
ref|XP_006370080.1|  hypothetical protein POPTR_0001s39360g             140   3e-34   
dbj|BAJ53166.1|  JHL10I11.12                                            140   3e-34   
gb|KCW71080.1|  hypothetical protein EUGRSUZ_F04179                     140   3e-34   
gb|KCW67548.1|  hypothetical protein EUGRSUZ_F01302                     138   3e-34   
ref|XP_008451725.1|  PREDICTED: probable LRR receptor-like serine...    140   3e-34   
ref|XP_010065089.1|  PREDICTED: probable LRR receptor-like serine...    140   4e-34   
ref|XP_006592942.1|  PREDICTED: probable leucine-rich repeat rece...    140   4e-34   
ref|XP_006449568.1|  hypothetical protein CICLE_v10015563mg             135   4e-34   
ref|XP_011009654.1|  PREDICTED: probable LRR receptor-like serine...    139   4e-34   
gb|KDP20042.1|  hypothetical protein JCGZ_05811                         139   5e-34   
ref|XP_010272732.1|  PREDICTED: probable LRR receptor-like serine...    139   5e-34   
ref|NP_001238159.1|  receptor-like serine/threonine kinase              140   5e-34   
ref|XP_007149540.1|  hypothetical protein PHAVU_005G078800g             135   5e-34   
ref|XP_009772943.1|  PREDICTED: probable LRR receptor-like serine...    139   5e-34   
ref|XP_004491064.1|  PREDICTED: probable leucine-rich repeat rece...    139   5e-34   
ref|XP_010063817.1|  PREDICTED: probable LRR receptor-like serine...    139   5e-34   
ref|XP_010038894.1|  PREDICTED: probable leucine-rich repeat rece...    139   5e-34   
ref|XP_007048781.1|  Leucine-rich repeat transmembrane protein ki...    139   6e-34   
ref|XP_007021933.1|  Leucine-rich repeat transmembrane protein ki...    139   6e-34   
ref|XP_009351793.1|  PREDICTED: probable LRR receptor-like serine...    139   6e-34   
ref|XP_006370087.1|  hypothetical protein POPTR_0001s39420g             139   6e-34   
ref|XP_006370091.1|  hypothetical protein POPTR_0001s39450g             139   6e-34   
ref|XP_011009653.1|  PREDICTED: probable LRR receptor-like serine...    139   7e-34   
gb|KCW67604.1|  hypothetical protein EUGRSUZ_F01361                     138   7e-34   
ref|XP_011009652.1|  PREDICTED: probable LRR receptor-like serine...    139   7e-34   
ref|XP_006370076.1|  hypothetical protein POPTR_0001s39320g             138   7e-34   
ref|XP_006370097.1|  hypothetical protein POPTR_0001s394901g            138   8e-34   
ref|XP_004168262.1|  PREDICTED: probable LRR receptor-like serine...    139   8e-34   
ref|XP_006467584.1|  PREDICTED: probable LRR receptor-like serine...    139   8e-34   
gb|KCW67558.1|  hypothetical protein EUGRSUZ_F01308                     137   8e-34   
ref|NP_001062936.1|  Os09g0345300                                       134   9e-34   
gb|AES66495.2|  LRR receptor-like kinase                                139   9e-34   
ref|XP_010064503.1|  PREDICTED: probable leucine-rich repeat rece...    138   9e-34   
ref|XP_004305822.1|  PREDICTED: probable LRR receptor-like serine...    139   9e-34   
ref|XP_007149544.1|  hypothetical protein PHAVU_005G0791000g            138   9e-34   
ref|XP_004137308.1|  PREDICTED: probable LRR receptor-like serine...    139   1e-33   
ref|XP_007048780.1|  Leucine-rich repeat transmembrane protein ki...    139   1e-33   
ref|XP_007213901.1|  hypothetical protein PRUPE_ppa003884mg             136   1e-33   
ref|XP_006370084.1|  hypothetical protein POPTR_0001s39390g             139   1e-33   
gb|KHG04404.1|  putative LRR receptor-like serine/threonine-prote...    138   1e-33   
ref|XP_006388682.1|  hypothetical protein POPTR_0122s00210g             136   1e-33   
ref|XP_010060734.1|  PREDICTED: probable LRR receptor-like serine...    138   1e-33   
ref|XP_003596244.1|  Receptor-like serine/threonine kinase              138   1e-33   
ref|XP_004491355.1|  PREDICTED: probable LRR receptor-like serine...    138   1e-33   
ref|XP_008358125.1|  PREDICTED: probable leucine-rich repeat rece...    134   1e-33   
ref|XP_010064515.1|  PREDICTED: probable leucine-rich repeat rece...    138   2e-33   
gb|KCW67586.1|  hypothetical protein EUGRSUZ_F013462                    134   2e-33   
ref|XP_011082787.1|  PREDICTED: probable LRR receptor-like serine...    138   2e-33   
gb|AES66480.2|  LRR receptor-like kinase                                135   2e-33   
ref|XP_007149537.1|  hypothetical protein PHAVU_005G078500g             138   2e-33   
emb|CDY35293.1|  BnaC03g59300D                                          137   2e-33   
ref|XP_004491354.1|  PREDICTED: probable LRR receptor-like serine...    138   2e-33   
ref|XP_006346646.1|  PREDICTED: probable LRR receptor-like serine...    137   2e-33   
gb|KCW67583.1|  hypothetical protein EUGRSUZ_F013432                    137   2e-33   
ref|XP_009406148.1|  PREDICTED: probable LRR receptor-like serine...    137   2e-33   
gb|KHN19488.1|  Putative leucine-rich repeat receptor-like serine...    137   2e-33   
ref|XP_010064487.1|  PREDICTED: probable leucine-rich repeat rece...    137   2e-33   
gb|KCW67576.1|  hypothetical protein EUGRSUZ_F013322                    133   2e-33   
ref|XP_009619428.1|  PREDICTED: probable LRR receptor-like serine...    137   2e-33   
gb|KHG04296.1|  hypothetical protein F383_04630                         137   2e-33   
gb|KEH38591.1|  LRR receptor-like kinase                                137   3e-33   
ref|XP_003596229.1|  Leucine-rich repeat family protein / protein...    134   3e-33   
ref|XP_010064506.1|  PREDICTED: probable leucine-rich repeat rece...    137   3e-33   
ref|XP_006448019.1|  hypothetical protein CICLE_v10014129mg             136   3e-33   
gb|AES66493.2|  LRR receptor-like kinase                                137   3e-33   
gb|KHG04295.1|  hypothetical protein F383_04630                         137   3e-33   
emb|CDP06040.1|  unnamed protein product                                137   3e-33   
ref|XP_007214614.1|  hypothetical protein PRUPE_ppa001161mg             137   3e-33   
ref|XP_006448018.1|  hypothetical protein CICLE_v10014129mg             136   3e-33   
ref|XP_007214913.1|  hypothetical protein PRUPE_ppa000698mg             137   3e-33   
gb|KFK43087.1|  hypothetical protein AALP_AA1G077600                    136   3e-33   
ref|XP_003596245.1|  Receptor-like protein kinase                       137   3e-33   
ref|XP_006388878.1|  hypothetical protein POPTR_0084s002301g            134   4e-33   
gb|AAF75093.1|AC007583_29  Contains similarity to a receptor-like...    134   4e-33   
ref|XP_008449503.1|  PREDICTED: probable LRR receptor-like serine...    137   4e-33   
ref|XP_003596262.1|  Receptor-like serine/threonine kinase              137   4e-33   
gb|AAK32925.1|AF367338_1  At1g29720/T3M22_6                             131   4e-33   
gb|KCW48033.1|  hypothetical protein EUGRSUZ_K01771                     134   4e-33   
gb|KCW48268.1|  hypothetical protein EUGRSUZ_K020001                    132   4e-33   
ref|XP_010691210.1|  PREDICTED: probable leucine-rich repeat rece...    137   4e-33   
ref|XP_010246507.1|  PREDICTED: probable LRR receptor-like serine...    137   4e-33   
ref|XP_011002772.1|  PREDICTED: probable LRR receptor-like serine...    137   5e-33   
ref|XP_010675288.1|  PREDICTED: probable LRR receptor-like serine...    137   5e-33   
ref|NP_001117479.1|  Leucine-rich repeat transmembrane protein ki...    136   5e-33   
emb|CAN66180.1|  hypothetical protein VITISV_025180                     134   5e-33   
ref|XP_008463773.1|  PREDICTED: probable LRR receptor-like serine...    136   5e-33   
gb|KDO42407.1|  hypothetical protein CISIN_1g0044001mg                  132   5e-33   
ref|XP_008386286.1|  PREDICTED: probable leucine-rich repeat rece...    131   5e-33   
ref|XP_010246506.1|  PREDICTED: probable LRR receptor-like serine...    136   5e-33   
ref|XP_002305716.2|  hypothetical protein POPTR_0004s06180g             136   5e-33   
ref|NP_175748.1|  Leucine-rich repeat transmembrane protein kinase      136   5e-33   
ref|XP_006448020.1|  hypothetical protein CICLE_v10014129mg             136   5e-33   
ref|XP_010093471.1|  putative LRR receptor-like serine/threonine-...    136   6e-33   
emb|CBI20124.3|  unnamed protein product                                136   6e-33   
gb|AAF78446.1|AC018748_25  Contains similarity to receptor-like s...    136   6e-33   
ref|XP_011069500.1|  PREDICTED: probable LRR receptor-like serine...    126   6e-33   
ref|XP_002283596.2|  PREDICTED: probable leucine-rich repeat rece...    136   6e-33   
sp|C0LGG8.1|Y5343_ARATH  RecName: Full=Probable LRR receptor-like...    136   6e-33   
gb|KCW45029.1|  hypothetical protein EUGRSUZ_L013821                    132   6e-33   
gb|AES66496.2|  LRR receptor-like kinase                                136   6e-33   
ref|XP_009352707.1|  PREDICTED: probable LRR receptor-like serine...    136   6e-33   
ref|XP_009352711.1|  PREDICTED: probable LRR receptor-like serine...    136   6e-33   
gb|KEH28415.1|  LRR receptor-like kinase                                136   6e-33   
ref|XP_011098190.1|  PREDICTED: probable LRR receptor-like serine...    136   6e-33   
ref|XP_006306238.1|  hypothetical protein CARUB_v10012061mg             136   6e-33   
ref|XP_008443633.1|  PREDICTED: probable LRR receptor-like serine...    136   6e-33   
ref|XP_009352710.1|  PREDICTED: probable LRR receptor-like serine...    136   7e-33   
gb|ABF70100.1|  protein kinase, putative                                136   7e-33   
ref|XP_008443628.1|  PREDICTED: probable LRR receptor-like serine...    136   7e-33   
gb|KCW48008.1|  hypothetical protein EUGRSUZ_K017432                    132   7e-33   
ref|XP_004295665.1|  PREDICTED: probable leucine-rich repeat rece...    137   7e-33   
ref|XP_006492254.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    136   7e-33   
ref|XP_009352709.1|  PREDICTED: probable LRR receptor-like serine...    136   7e-33   
gb|KCW67564.1|  hypothetical protein EUGRSUZ_F01313                     134   7e-33   
ref|XP_004140247.1|  PREDICTED: probable LRR receptor-like serine...    136   7e-33   
ref|XP_009352708.1|  PREDICTED: probable LRR receptor-like serine...    136   7e-33   
emb|CAN60698.1|  hypothetical protein VITISV_022626                     136   8e-33   
gb|KEH28414.1|  LRR receptor-like kinase                                136   8e-33   
ref|XP_003596240.1|  Receptor-like protein kinase                       132   8e-33   
emb|CAN70496.1|  hypothetical protein VITISV_042040                     135   8e-33   
ref|XP_008443626.1|  PREDICTED: probable LRR receptor-like serine...    136   8e-33   
ref|XP_004146084.1|  PREDICTED: probable LRR receptor-like serine...    135   8e-33   
ref|XP_004167668.1|  PREDICTED: probable LRR receptor-like serine...    135   8e-33   
gb|KDP27082.1|  hypothetical protein JCGZ_20306                         136   8e-33   
ref|XP_010499488.1|  PREDICTED: probable LRR receptor-like serine...    135   9e-33   
ref|XP_008443627.1|  PREDICTED: probable LRR receptor-like serine...    135   9e-33   
ref|XP_006370083.1|  hypothetical protein POPTR_0001s393801g            134   9e-33   
emb|CAN81779.1|  hypothetical protein VITISV_034284                     135   9e-33   
ref|XP_010064485.1|  PREDICTED: probable leucine-rich repeat rece...    136   9e-33   
ref|XP_007211339.1|  hypothetical protein PRUPE_ppa001122mg             135   9e-33   
ref|XP_010657080.1|  PREDICTED: probable LRR receptor-like serine...    135   9e-33   
gb|KCW67557.1|  hypothetical protein EUGRSUZ_F01307                     135   9e-33   
emb|CBI20145.3|  unnamed protein product                                135   1e-32   
ref|XP_008380256.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
ref|XP_003617471.1|  BED finger-nbs resistance protein                  135   1e-32   
gb|KFK44799.1|  hypothetical protein AALP_AA1G304800                    135   1e-32   
gb|ACN59254.1|  leucine-rich repeat receptor-like protein kinase        135   1e-32   
gb|KFK44800.1|  hypothetical protein AALP_AA1G304800                    135   1e-32   
gb|KHG20508.1|  hypothetical protein F383_03730                         135   1e-32   
gb|AET00430.2|  LRR receptor-like kinase                                135   1e-32   
ref|XP_010644091.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
ref|XP_011014343.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
ref|XP_008229374.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
ref|NP_175749.1|  putative LRR receptor-like serine/threonine-pro...    135   1e-32   
ref|XP_010040114.1|  PREDICTED: probable LRR receptor-like serine...    133   1e-32   
gb|KEH38577.1|  LRR receptor-like kinase                                135   1e-32   
ref|XP_002283497.2|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
ref|XP_009350015.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
gb|AAF78445.1|AC018748_24  Contains a weak similarity to disease ...    135   1e-32   
ref|XP_010479903.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
gb|KEH38576.1|  LRR receptor-like kinase                                135   1e-32   
ref|XP_008390667.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    132   1e-32   
ref|XP_008380254.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
ref|XP_011002770.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
ref|XP_010916513.1|  PREDICTED: probable LRR receptor-like serine...    135   1e-32   
ref|XP_008380255.1|  PREDICTED: probable LRR receptor-like serine...    135   2e-32   
ref|XP_006575670.1|  PREDICTED: probable LRR receptor-like serine...    135   2e-32   
ref|XP_010479902.1|  PREDICTED: probable LRR receptor-like serine...    135   2e-32   
ref|XP_010916505.1|  PREDICTED: probable LRR receptor-like serine...    135   2e-32   
ref|XP_008226375.1|  PREDICTED: probable leucine-rich repeat rece...    135   2e-32   
ref|XP_010460740.1|  PREDICTED: probable LRR receptor-like serine...    132   2e-32   
ref|XP_006304798.1|  hypothetical protein CARUB_v10012394mg             135   2e-32   
ref|XP_010462234.1|  PREDICTED: probable LRR receptor-like serine...    135   2e-32   
ref|XP_002892411.1|  hypothetical protein ARALYDRAFT_470791             135   2e-32   
ref|XP_011044591.1|  PREDICTED: probable LRR receptor-like serine...    135   2e-32   
ref|XP_006304589.1|  hypothetical protein CARUB_v10011641mg             135   2e-32   
ref|XP_003519558.1|  PREDICTED: probable LRR receptor-like serine...    135   2e-32   
gb|KHN38301.1|  Putative LRR receptor-like serine/threonine-prote...    135   2e-32   
ref|XP_002316847.1|  receptor-like protein kinase                       135   2e-32   
emb|CBI20154.3|  unnamed protein product                                135   2e-32   
ref|XP_010316863.1|  PREDICTED: probable LRR receptor-like serine...    135   2e-32   
ref|XP_010316862.1|  PREDICTED: probable LRR receptor-like serine...    135   2e-32   
gb|KCW67574.1|  hypothetical protein EUGRSUZ_F013302                    134   2e-32   
ref|XP_010499487.1|  PREDICTED: probable LRR receptor-like serine...    134   2e-32   
ref|XP_009334012.1|  PREDICTED: probable leucine-rich repeat rece...    134   2e-32   
ref|XP_009604354.1|  PREDICTED: probable LRR receptor-like serine...    134   2e-32   
ref|XP_010316864.1|  PREDICTED: probable LRR receptor-like serine...    134   2e-32   
emb|CBI20149.3|  unnamed protein product                                134   3e-32   
ref|XP_010499489.1|  PREDICTED: probable LRR receptor-like serine...    134   3e-32   
ref|XP_006594719.1|  PREDICTED: probable leucine-rich repeat rece...    134   3e-32   
ref|XP_010462239.1|  PREDICTED: probable LRR receptor-like serine...    134   3e-32   
ref|XP_011002771.1|  PREDICTED: probable LRR receptor-like serine...    134   3e-32   
ref|XP_010479904.1|  PREDICTED: probable LRR receptor-like serine...    134   3e-32   
emb|CDY35284.1|  BnaC03g59390D                                          134   3e-32   
gb|ABF72026.1|  leucine-rich repeat-containing protein kinase fam...    134   3e-32   
ref|XP_009788430.1|  PREDICTED: probable LRR receptor-like serine...    134   3e-32   
ref|XP_006358079.1|  PREDICTED: probable LRR receptor-like serine...    134   3e-32   
ref|XP_004167247.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    134   3e-32   
gb|KDO49310.1|  hypothetical protein CISIN_1g040908mg                   134   3e-32   
ref|XP_006477830.1|  PREDICTED: probable leucine-rich repeat rece...    134   3e-32   
ref|XP_010478336.1|  PREDICTED: probable LRR receptor-like serine...    132   3e-32   
ref|XP_009788429.1|  PREDICTED: probable LRR receptor-like serine...    134   3e-32   
ref|XP_010060737.1|  PREDICTED: probable leucine-rich repeat rece...    134   3e-32   
ref|XP_003628426.1|  Receptor-like serine/threonine kinase              132   3e-32   
ref|XP_010500994.1|  PREDICTED: probable LRR receptor-like serine...    134   3e-32   
ref|XP_009334011.1|  PREDICTED: probable leucine-rich repeat rece...    134   3e-32   
gb|KCW63414.1|  hypothetical protein EUGRSUZ_G01055                     134   3e-32   
ref|XP_010644094.1|  PREDICTED: probable LRR receptor-like serine...    134   3e-32   
emb|CDY60204.1|  BnaCnng35830D                                          134   3e-32   
emb|CDY35283.1|  BnaC03g59400D                                          132   4e-32   
ref|XP_010248481.1|  PREDICTED: probable LRR receptor-like serine...    134   4e-32   
ref|XP_009334010.1|  PREDICTED: probable leucine-rich repeat rece...    134   4e-32   
ref|XP_006477831.1|  PREDICTED: probable leucine-rich repeat rece...    134   4e-32   
gb|KDO42386.1|  hypothetical protein CISIN_1g0041552mg                  131   4e-32   
ref|XP_006477832.1|  PREDICTED: probable leucine-rich repeat rece...    134   4e-32   
gb|KCW67560.1|  hypothetical protein EUGRSUZ_F013102                    134   4e-32   
ref|XP_010499480.1|  PREDICTED: probable LRR receptor-like serine...    134   4e-32   
ref|XP_010036641.1|  PREDICTED: probable leucine-rich repeat rece...    133   4e-32   
ref|XP_004147391.1|  PREDICTED: probable LRR receptor-like serine...    134   4e-32   
emb|CDY25853.1|  BnaA05g14440D                                          134   4e-32   
emb|CAN78284.1|  hypothetical protein VITISV_000422                     134   4e-32   
ref|XP_002891752.1|  leucine-rich repeat family protein                 134   4e-32   
ref|XP_009144771.1|  PREDICTED: probable LRR receptor-like serine...    134   4e-32   
ref|XP_006582633.1|  PREDICTED: probable leucine-rich repeat rece...    126   4e-32   
ref|XP_010036639.1|  PREDICTED: probable leucine-rich repeat rece...    133   4e-32   
emb|CBI20142.3|  unnamed protein product                                134   4e-32   
ref|XP_006442357.1|  hypothetical protein CICLE_v10018686mg             134   4e-32   
ref|XP_002283521.1|  PREDICTED: probable LRR receptor-like serine...    134   4e-32   
ref|XP_002283477.2|  PREDICTED: probable LRR receptor-like serine...    134   4e-32   
ref|XP_010247772.1|  PREDICTED: probable leucine-rich repeat rece...    134   5e-32   
ref|XP_007021935.1|  Leucine-rich repeat transmembrane protein ki...    134   5e-32   
ref|XP_006417782.1|  hypothetical protein EUTSA_v10006761mg             132   5e-32   
ref|XP_010924703.1|  PREDICTED: probable LRR receptor-like serine...    134   5e-32   
emb|CDX93632.1|  BnaA06g04160D                                          134   5e-32   
ref|XP_009148012.1|  PREDICTED: probable LRR receptor-like serine...    134   5e-32   
ref|NP_001172868.1|  Os02g0232500                                       127   5e-32   
ref|XP_010036447.1|  PREDICTED: probable leucine-rich repeat rece...    133   5e-32   
emb|CDX95138.1|  BnaC05g05330D                                          134   5e-32   
ref|XP_010040667.1|  PREDICTED: probable leucine-rich repeat rece...    132   6e-32   
ref|XP_009109651.1|  PREDICTED: probable LRR receptor-like serine...    134   6e-32   
emb|CDY35292.1|  BnaC03g59310D                                          134   6e-32   
ref|XP_010038877.1|  PREDICTED: probable LRR receptor-like serine...    132   6e-32   
ref|XP_003596233.1|  Receptor-like protein kinase                       130   6e-32   
ref|XP_011009658.1|  PREDICTED: probable LRR receptor-like serine...    134   6e-32   
ref|XP_008386284.1|  PREDICTED: probable LRR receptor-like serine...    133   6e-32   
ref|XP_009376743.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    133   6e-32   
ref|XP_011009659.1|  PREDICTED: probable LRR receptor-like serine...    133   6e-32   
ref|XP_010064499.1|  PREDICTED: probable leucine-rich repeat rece...    133   6e-32   
gb|KCW75321.1|  hypothetical protein EUGRSUZ_E04067                     132   6e-32   
ref|XP_006477833.1|  PREDICTED: probable leucine-rich repeat rece...    133   7e-32   
ref|XP_011009661.1|  PREDICTED: probable LRR receptor-like serine...    133   7e-32   
emb|CBI20153.3|  unnamed protein product                                133   7e-32   
ref|XP_011009660.1|  PREDICTED: probable LRR receptor-like serine...    133   7e-32   
ref|NP_172244.2|  leucine-rich repeat transmembrane protein kinase      133   7e-32   
ref|XP_010246513.1|  PREDICTED: probable leucine-rich repeat rece...    133   7e-32   
ref|XP_009109648.1|  PREDICTED: probable LRR receptor-like serine...    133   8e-32   
ref|XP_010057165.1|  PREDICTED: probable LRR receptor-like serine...    133   8e-32   



>emb|CAN61169.1| hypothetical protein VITISV_010446 [Vitis vinifera]
Length=661

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 111/134 (83%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALE++AGKNN+K+  +E+YFCLLDWA VLQ+KGNLME +DP+
Sbjct  502  ALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDYFCLLDWAFVLQQKGNLMELVDPK  561

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F KDEA+RMIKVALLCTN SP LRP+MSAVVSML+G   I EY  +P++  DEF  
Sbjct  562  LGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTVIQEYPLNPSIYGDEFGF  621

Query  350  QAMNDHYDEMAVGS  391
            +A+   YD+M + S
Sbjct  622  EALRGQYDQMQLQS  635



>gb|KHG06920.1| hypothetical protein F383_33692 [Gossypium arboreum]
Length=164

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 103/130 (79%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLTFKADVYSFGIVALEI+ GKNN K+  +E+Y CL DWALVLQ+KGNLME +DPR
Sbjct  6    ALWGYLTFKADVYSFGIVALEIVTGKNNTKYRPEEDYVCLQDWALVLQQKGNLMELVDPR  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LG+ F+++EA+RM KVALLCTN+SP LRP+MS VV+MLEG   + E   DP++  DE   
Sbjct  66   LGTEFNEEEAIRMTKVALLCTNSSPALRPTMSEVVNMLEGRTLVPELILDPSIFADESRF  125

Query  350  QAMNDHYDEM  379
             A+ D ++ M
Sbjct  126  GAVKDQFNRM  135



>emb|CBI30743.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 109/134 (81%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALE++AGKNN+K+  +E+YFCLLDWA VLQ+KGNLME +DP 
Sbjct  367  ALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDYFCLLDWAFVLQQKGNLMELVDPN  426

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F K+EA+RMIKVALLCTN SP LRP+MSAVVSML+G   + EY  +P++  DEF  
Sbjct  427  LGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTVVQEYPLNPSIYGDEFGF  486

Query  350  QAMNDHYDEMAVGS  391
            +A+   +D+  + S
Sbjct  487  EALRGQHDQTQLQS  500



>gb|KHF98741.1| hypothetical protein F383_14220 [Gossypium arboreum]
Length=167

 Score =   174 bits (442),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 102/130 (78%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFGIVALEI+AGKNN K+  +ENY CL DWA VLQ++GNLME +DPR
Sbjct  6    ALWGYLTYKADVYSFGIVALEIVAGKNNTKYRPEENYVCLQDWAFVLQQRGNLMELVDPR  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LG+ F+++EA+RM KVALLCTN+SP LRP+MS VV+MLEG   + E   DP++  DE   
Sbjct  66   LGTEFNEEEAIRMTKVALLCTNSSPALRPTMSEVVNMLEGRTLVPELILDPSIFADESRF  125

Query  350  QAMNDHYDEM  379
             A+ D  + M
Sbjct  126  GAVKDQLNRM  135



>ref|XP_009600347.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana tomentosiformis]
Length=1003

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 107/139 (77%), Gaps = 10/139 (7%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KAD+YSFG+V LE++AGKNN+K++ DENY CLLDWALVLQRKG  +E +DPR
Sbjct  840  ALWGYLTHKADLYSFGVVVLELVAGKNNMKYNPDENYVCLLDWALVLQRKGKFLELVDPR  899

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE-------YDPNLDE  340
            LGSN++K EALRMIKVALLCTN SP LRP+MS VV MLEG  D+ E       YD   DE
Sbjct  900  LGSNYNKKEALRMIKVALLCTNPSPALRPNMSTVVKMLEGRLDVNESNIDSSAYD---DE  956

Query  341  FNSQAMNDHYDEMAVGSRD  397
            FN Q + D YDEM V S +
Sbjct  957  FNFQGLRDKYDEMQVNSSE  975



>ref|XP_009795508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana sylvestris]
Length=1003

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 107/139 (77%), Gaps = 10/139 (7%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KAD+YSFG+V LE++AGKNN+K++ DENY CLLDWALVLQRKG  +E +DPR
Sbjct  840  ALWGYLTHKADLYSFGVVVLELVAGKNNMKYNPDENYVCLLDWALVLQRKGKFLELVDPR  899

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE-------YDPNLDE  340
            LGSN++K EALRMIKVALLCTN SP LRP+MS VV MLEG  D+ E       YD   DE
Sbjct  900  LGSNYNKKEALRMIKVALLCTNPSPALRPNMSTVVKMLEGRLDVNESNIDSSAYD---DE  956

Query  341  FNSQAMNDHYDEMAVGSRD  397
            FN Q + D YDEM V S +
Sbjct  957  FNFQGLRDKYDEMQVNSSE  975



>ref|XP_010655558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1003

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 110/134 (82%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALE++AGKNN+K+  +E+ FCLLDWA VLQ+KGNLME +DP+
Sbjct  844  ALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDCFCLLDWAFVLQQKGNLMELVDPK  903

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F KDEA+RMIKVALLCTN SP LRP+MSAVVSML+G   I EY  +P++  DEF  
Sbjct  904  LGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTVIQEYPLNPSIYGDEFGF  963

Query  350  QAMNDHYDEMAVGS  391
            +A+   YD+M + S
Sbjct  964  EALRGQYDQMQLQS  977



>ref|XP_010655559.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=997

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 110/134 (82%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALE++AGKNN+K+  +E+ FCLLDWA VLQ+KGNLME +DP+
Sbjct  838  ALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDCFCLLDWAFVLQQKGNLMELVDPK  897

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F KDEA+RMIKVALLCTN SP LRP+MSAVVSML+G   I EY  +P++  DEF  
Sbjct  898  LGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTVIQEYPLNPSIYGDEFGF  957

Query  350  QAMNDHYDEMAVGS  391
            +A+   YD+M + S
Sbjct  958  EALRGQYDQMQLQS  971



>ref|XP_006358077.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=932

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 108/136 (79%), Gaps = 4/136 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT K D+YSFG+V LE++AGKNN+K+H DENY CLLDWALVLQ+KG  +E +DPR
Sbjct  770  ALWGYLTHKVDLYSFGVVVLELVAGKNNMKYHPDENYVCLLDWALVLQKKGKFLELVDPR  829

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPN--LDEFNS  349
            LGSN+DK EALRMIKVAL CTN SPVLRP+MSAVV+MLEG  +I E  +D +   DE N 
Sbjct  830  LGSNYDKKEALRMIKVALRCTNPSPVLRPNMSAVVNMLEGRLNIDESNFDSSGYGDELNF  889

Query  350  QAMNDHYDEMAVGSRD  397
            Q + D YDEM V S +
Sbjct  890  QGLRDKYDEMQVTSSE  905



>ref|XP_004233025.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=1002

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 108/139 (78%), Gaps = 10/139 (7%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KAD+YSFG+V LE++AGKNN+K+H DENY CLLDWALVLQ+KG  +E +DPR
Sbjct  840  ALWGYLTHKADLYSFGVVVLELVAGKNNMKYHPDENYVCLLDWALVLQKKGKFLELVDPR  899

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE-------YDPNLDE  340
            LGS +DK+EALRMIKVAL CTN SP LRP+MSAVV+MLEG  ++ E       YD   DE
Sbjct  900  LGSYYDKEEALRMIKVALRCTNPSPALRPNMSAVVNMLEGRLNVDESNIDSSGYD---DE  956

Query  341  FNSQAMNDHYDEMAVGSRD  397
            FN Q + D YDEM V S +
Sbjct  957  FNFQGLRDKYDEMQVTSSE  975



>emb|CBI30745.3| unnamed protein product [Vitis vinifera]
Length=1901

 Score =   186 bits (473),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 110/134 (82%), Gaps = 4/134 (3%)
 Frame = +2

Query  2     ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
             ALWGYLT+KADVYSFG+VALE++AGKNN+K+  +E+ FCLLDWA VLQ+KGNLME +DP+
Sbjct  1742  ALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDCFCLLDWAFVLQQKGNLMELVDPK  1801

Query  182   LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
             LG+ F KDEA+RMIKVALLCTN SP LRP+MSAVVSML+G   I EY  +P++  DEF  
Sbjct  1802  LGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTVIQEYPLNPSIYGDEFGF  1861

Query  350   QAMNDHYDEMAVGS  391
             +A+   YD+M + S
Sbjct  1862  EALRGQYDQMQLQS  1875



>ref|XP_006358075.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X1 [Solanum tuberosum]
Length=1002

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 10/139 (7%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT K D+YSFG+V LE++AGKNN+K+H DENY CLLDWALVLQ+K   +E +DPR
Sbjct  840  ALWGYLTHKVDLYSFGVVVLELVAGKNNMKYHPDENYVCLLDWALVLQKKAKFLELVDPR  899

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE-------YDPNLDE  340
            LGSN+DK EALRMIKVAL CTN SP LRP+MSAVV+MLEG  ++ E       YD   DE
Sbjct  900  LGSNYDKKEALRMIKVALQCTNPSPALRPNMSAVVNMLEGRLNVDESNFDSSGYD---DE  956

Query  341  FNSQAMNDHYDEMAVGSRD  397
            FN Q + D YDEM V S +
Sbjct  957  FNFQGLRDKYDEMQVTSSE  975



>ref|XP_007213704.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
 gb|EMJ14903.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
Length=1017

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 113/145 (78%), Gaps = 4/145 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +EN+ CL+DWALVLQ+KGNLM+ +DPR
Sbjct  850  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPR  909

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LGSNF K+EA+RM+KVALLCTN +P LRPSMS+VVSMLEG   + E   DP++  DE   
Sbjct  910  LGSNFSKEEAIRMVKVALLCTNPAPALRPSMSSVVSMLEGKTAVHELIMDPSIYGDEMRL  969

Query  350  QAMNDHYDEMAVGSRDFPNKVDLSS  424
             A+ + +D++A  S      +  SS
Sbjct  970  TALRNQFDQIAQESSTGTQSLTRSS  994



>ref|XP_010655563.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=972

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 109/134 (81%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALE++AGKNN+K+  +E+YFCLLDWA VLQ+KGNLME +DP 
Sbjct  813  ALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDYFCLLDWAFVLQQKGNLMELVDPN  872

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F K+EA+RMIKVALLCTN SP LRP+MSAVVSML+G   + EY  +P++  DEF  
Sbjct  873  LGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTVVQEYPLNPSIYGDEFGF  932

Query  350  QAMNDHYDEMAVGS  391
            +A+   +D+  + S
Sbjct  933  EALRGQHDQTQLQS  946



>ref|XP_010655564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=972

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 109/134 (81%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALE++AGKNN+K+  +E+YFCLLDWA VLQ+KGNLME +DP 
Sbjct  813  ALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDYFCLLDWAFVLQQKGNLMELVDPN  872

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F K+EA+RMIKVALLCTN SP LRP+MSAVVSML+G   + EY  +P++  DEF  
Sbjct  873  LGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTVVQEYPLNPSIYGDEFGF  932

Query  350  QAMNDHYDEMAVGS  391
            +A+   +D+  + S
Sbjct  933  EALRGQHDQTQLQS  946



>ref|XP_010655562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=994

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 109/134 (81%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALE++AGKNN+K+  +E+YFCLLDWA VLQ+KGNLME +DP 
Sbjct  835  ALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDYFCLLDWAFVLQQKGNLMELVDPN  894

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F K+EA+RMIKVALLCTN SP LRP+MSAVVSML+G   + EY  +P++  DEF  
Sbjct  895  LGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTVVQEYPLNPSIYGDEFGF  954

Query  350  QAMNDHYDEMAVGS  391
            +A+   +D+  + S
Sbjct  955  EALRGQHDQTQLQS  968



>ref|XP_008245181.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840 [Prunus 
mume]
Length=1017

 Score =   182 bits (461),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 108/131 (82%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +EN+ CL+DWALVLQ+KGNLM+ +DPR
Sbjct  850  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPR  909

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LGSNF K+EA+RM+KVALLCTN +P LRP+MS+VVSMLEG   + E   DP++  DE   
Sbjct  910  LGSNFSKEEAIRMVKVALLCTNPAPALRPTMSSVVSMLEGKTTVHELIMDPSIYGDEMRL  969

Query  350  QAMNDHYDEMA  382
             A+ + +D +A
Sbjct  970  TALRNQFDHIA  980



>ref|XP_008225419.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1017

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 109/131 (83%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +EN+ CL+DWALVLQ+KGNLM+ +DPR
Sbjct  850  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLMDLVDPR  909

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LGSNF ++EA+RM+KVALLCTN +P LRP+MS+VVSMLEG   + E   DP++  DE   
Sbjct  910  LGSNFSEEEAIRMVKVALLCTNPAPALRPTMSSVVSMLEGKTTVHELIMDPSIYGDEMRL  969

Query  350  QAMNDHYDEMA  382
             A+ + +D++A
Sbjct  970  TALRNQFDQIA  980



>ref|XP_007025271.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY27893.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=346

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%), Gaps = 4/133 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFGIVALEI+AGKNN K+  +E++ CL DWALVLQ+KGNLME +DPR
Sbjct  182  ALWGYLTYKADVYSFGIVALEIVAGKNNTKYRPEEDFVCLQDWALVLQQKGNLMELVDPR  241

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS F+++EA+RMIKVALLCTN+SP LRP MS V++MLEG   + E   DP++  DE   
Sbjct  242  LGSEFNEEEAIRMIKVALLCTNSSPALRPIMSEVLNMLEGRALVPELIMDPSIFGDESRF  301

Query  350  QAMNDHYDEMAVG  388
             A+ D  + M  G
Sbjct  302  GALRDQLNRMQSG  314



>ref|XP_008349229.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=284

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 104/133 (78%), Gaps = 4/133 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +EN+ CL+DWALVLQ++GNL+E +DPR
Sbjct  114  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQRGNLIELVDPR  173

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+ + +EAL M+KVALLC N +P LRP+MSAVVSMLEG   + E   +PN+  DE   
Sbjct  174  LGSDIEVEEALTMVKVALLCINPAPALRPTMSAVVSMLEGRTLVRESVMNPNIYGDELKL  233

Query  350  QAMNDHYDEMAVG  388
              + + +D  A G
Sbjct  234  STLRNPFDPTAKG  246



>ref|XP_006358076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X2 [Solanum tuberosum]
Length=883

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 105/136 (77%), Gaps = 4/136 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT K D+YSFG+V LE++AGKNN+K+H DENY CLLDWALVLQ+K   +E +DPR
Sbjct  721  ALWGYLTHKVDLYSFGVVVLELVAGKNNMKYHPDENYVCLLDWALVLQKKAKFLELVDPR  780

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPN--LDEFNS  349
            LGSN+DK EALRMIKVAL CTN SP LRP+MSAVV+MLEG  ++ E  +D +   DE N 
Sbjct  781  LGSNYDKKEALRMIKVALRCTNPSPALRPNMSAVVNMLEGRLNVDESNFDSSGYGDELNF  840

Query  350  QAMNDHYDEMAVGSRD  397
              + D YDEM V S +
Sbjct  841  LGLRDKYDEMQVTSSE  856



>ref|XP_007214558.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
 gb|EMJ15757.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
Length=1017

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 108/131 (82%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +EN+ CL+DWALVLQ+K NLM+ +DPR
Sbjct  850  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKWNLMDLVDPR  909

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LGSNF K+EA+RM+KVALLCTN +P LRP+MS+V+SMLEG   + E   DP++  DE   
Sbjct  910  LGSNFSKEEAIRMVKVALLCTNPAPALRPTMSSVLSMLEGKTAVHELIMDPSIYGDEMRL  969

Query  350  QAMNDHYDEMA  382
             A+ + +D++A
Sbjct  970  TALRNQFDQIA  980



>emb|CAN65055.1| hypothetical protein VITISV_012378 [Vitis vinifera]
Length=575

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +E+YF LLDWA  LQ+KGNLME +DP+
Sbjct  411  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNEDYFSLLDWAFFLQQKGNLMELVDPK  470

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNSQAMN  361
            L S+F+K+E LRMIK++LLCTN SP LRP+MSAVV+MLEG   + E+  N   F  +A+ 
Sbjct  471  LESDFNKEEVLRMIKISLLCTNPSPALRPTMSAVVNMLEGRAPVQEFPLNPIIFGDEALR  530

Query  362  DHYDEM  379
              Y +M
Sbjct  531  SQYSQM  536



>ref|XP_004296291.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=978

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 105/132 (80%), Gaps = 4/132 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+ GKNN+K  +DEN+ C++DWALVLQ+KG LME +DPR
Sbjct  812  ALWGYLTYKADVYSFGVVALEIVVGKNNMKFRADENFVCVVDWALVLQQKGKLMELVDPR  871

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+F+++EA+RM+KVALLCTN +P LRP+MSAVVSMLEG   + E   DP++  DE   
Sbjct  872  LGSDFNQEEAIRMVKVALLCTNPAPALRPTMSAVVSMLEGRSVVHELIMDPSIYGDETRL  931

Query  350  QAMNDHYDEMAV  385
             A+ D ++    
Sbjct  932  TALRDRFERFVT  943



>ref|XP_008345927.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 [Malus domestica]
Length=159

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYL+ KADVYSFG+VALE+L+GKNN+K+  +EN+ CLLDWALVLQ+ GNLM  +D +
Sbjct  6    ALWGYLSDKADVYSFGVVALELLSGKNNIKYRPNENFVCLLDWALVLQQXGNLMXLVDRK  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN  331
            LGS F+K+EA+RMIKVALLC N SP LRP+MSAVVSMLEG   + E   N
Sbjct  66   LGSEFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTLVHEVKIN  115



>emb|CDO96888.1| unnamed protein product [Coffea canephora]
Length=1019

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 108/145 (74%), Gaps = 5/145 (3%)
 Frame = +2

Query  2     ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
             ALWGYLT+KADVYSFGIVALEI+AGK+N+ +   E+Y CLLDWALVLQ++G+L+E +DPR
Sbjct  862   ALWGYLTYKADVYSFGIVALEIVAGKSNMSYRPSEDYVCLLDWALVLQQRGSLVELVDPR  921

Query  182   LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
             LGSN ++ EA+RMIKVALLCTN SP LRP+MSA + MLEG     E+  DP++  D  N 
Sbjct  922   LGSNINEGEAIRMIKVALLCTNPSPALRPTMSAALGMLEGRISTQEFSSDPSVYNDGLNL  981

Query  350   QAMNDHYDEMAVGSRDFPNKVDLSS  424
             Q + D YDE+   S + P     SS
Sbjct  982   QGLRDKYDELQFSSIE-PQSFSTSS  1005



>ref|XP_011101928.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Sesamum indicum]
Length=815

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 106/132 (80%), Gaps = 8/132 (6%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
             LWG+LT KADVYSFG+VALEI+AGK+N+K    EN+FCLLDWALVLQ+KG+LME +DPR
Sbjct  652  VLWGHLTHKADVYSFGVVALEIVAGKSNMKFSPSENFFCLLDWALVLQKKGSLMELVDPR  711

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLD------EF  343
            LGSNF+K+EA ++I+VALLCT+ +P LRP+MS VVSMLEGH +I E+  N+D      E 
Sbjct  712  LGSNFNKNEAEKIIRVALLCTSPAPTLRPAMSEVVSMLEGHVNIQEF--NMDSRIHDSEL  769

Query  344  NSQAMNDHYDEM  379
              QA+ + YDE+
Sbjct  770  KLQALREKYDEL  781



>gb|KDP21156.1| hypothetical protein JCGZ_21627 [Jatropha curcas]
Length=962

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 4/138 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++GKNN+K+  DE++ CLLDWA VLQ+KGNLM+ +DPR
Sbjct  794  ALWGYLTQKADVYSFGVVALEIVSGKNNMKYRPDEDFVCLLDWAFVLQQKGNLMDLVDPR  853

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNL----DEFNS  349
            LGS F K+E +RM KVALLCTNTSP LRP+MS VV MLEG   + E         DE  S
Sbjct  854  LGSKFKKEEVIRMAKVALLCTNTSPALRPTMSEVVGMLEGRTPVRELVMGSGFYGDELRS  913

Query  350  QAMNDHYDEMAVGSRDFP  403
            + +++ YD++++ S   P
Sbjct  914  KVLSNQYDQISLHSSSDP  931



>ref|XP_010112408.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXC33466.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=941

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 107/133 (80%), Gaps = 8/133 (6%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADV+SF +VALEILAG +N+K+  +ENY CL+DWALVLQ++GNLME +DP 
Sbjct  757  ALWGYLTYKADVFSFAVVALEILAGTSNMKYRPNENYVCLVDWALVLQQQGNLMELVDPN  816

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG----HDDILEYDPNL--DEF  343
            LGS+F+K+EA+RMIK+A+LCTN SP LRP MSAVVSMLEG    HD I+  DP++  DE 
Sbjct  817  LGSDFNKEEAVRMIKIAILCTNQSPALRPIMSAVVSMLEGRTAVHDLIM--DPSIYGDEL  874

Query  344  NSQAMNDHYDEMA  382
               A+   +D+MA
Sbjct  875  RFTALRKQFDQMA  887



>ref|XP_010655586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 ref|XP_010655587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
Length=1006

 Score =   173 bits (439),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +E+YF LLDWA  LQ+KGNLME +DP+
Sbjct  842  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNEDYFSLLDWAFFLQQKGNLMELVDPK  901

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNSQAMN  361
            L S+F+K+E LRMIK++LLCTN SP LRP+MSAVV+MLEG   + E+  N   F  +A+ 
Sbjct  902  LESDFNKEEVLRMIKISLLCTNPSPALRPTMSAVVNMLEGRAPVQEFPLNPIIFGDEALR  961

Query  362  DHYDEM  379
              Y +M
Sbjct  962  SQYSQM  967



>emb|CBI30748.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +E+YF LLDWA  LQ+KGNLME +DP+
Sbjct  853  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNEDYFSLLDWAFFLQQKGNLMELVDPK  912

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNSQAMN  361
            L S+F+K+E LRMIK++LLCTN SP LRP+MSAVV+MLEG   + E+  N   F  +A+ 
Sbjct  913  LESDFNKEEVLRMIKISLLCTNPSPALRPTMSAVVNMLEGRAPVQEFPLNPIIFGDEALR  972

Query  362  DHYDEM  379
              Y +M
Sbjct  973  SQYSQM  978



>ref|XP_006358134.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=1028

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 101/133 (76%), Gaps = 7/133 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +E + CLLDWALVLQ+ G LME +D  
Sbjct  868  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNEKFVCLLDWALVLQKHGKLMELVDET  927

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY-------DPNLDE  340
            L S+F KDEALRMI VALLCTN SP LRP+MSAVVS+LE H D+ E+       D + DE
Sbjct  928  LSSDFKKDEALRMINVALLCTNPSPALRPTMSAVVSILEDHLDLPEFNLESRSHDDDDDE  987

Query  341  FNSQAMNDHYDEM  379
               Q + D YDEM
Sbjct  988  LKFQGLRDKYDEM  1000



>ref|XP_010316867.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=998

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 101/130 (78%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +E + CLLDWALVLQ+ G LME +D  
Sbjct  841  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNEKFVCLLDWALVLQKHGKLMELVDET  900

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYD----PNLDEFNS  349
            L S+F KDEALRMI VALLCTN SP LRP+MSAVVS+LE H D+ E++     + DE   
Sbjct  901  LNSDFKKDEALRMINVALLCTNPSPALRPTMSAVVSILEDHLDLPEFNLESRSHDDELKF  960

Query  350  QAMNDHYDEM  379
            Q + D YDEM
Sbjct  961  QGLRDKYDEM  970



>ref|XP_008225417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Prunus mume]
Length=992

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 104/128 (81%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALE+L+GKNN+K+  +EN+ CLLDWALVLQ+KGNLME +DP+
Sbjct  837  ALWGYLTDKADVYSFGVVALELLSGKNNIKYRPNENFVCLLDWALVLQQKGNLMELVDPK  896

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNL--DEFNS  349
            LGS F+K+EA+RMIKVALLC N SP LRP+MSAVVSMLEG   +  ++ +P++  DE   
Sbjct  897  LGSQFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTIVHEVKINPSIYGDELGF  956

Query  350  QAMNDHYD  373
            +A  +  D
Sbjct  957  KAFTEDSD  964



>ref|XP_008225418.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Prunus mume]
Length=989

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 104/128 (81%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALE+L+GKNN+K+  +EN+ CLLDWALVLQ+KGNLME +DP+
Sbjct  834  ALWGYLTDKADVYSFGVVALELLSGKNNIKYRPNENFVCLLDWALVLQQKGNLMELVDPK  893

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNL--DEFNS  349
            LGS F+K+EA+RMIKVALLC N SP LRP+MSAVVSMLEG   +  ++ +P++  DE   
Sbjct  894  LGSQFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTIVHEVKINPSIYGDELGF  953

Query  350  QAMNDHYD  373
            +A  +  D
Sbjct  954  KAFTEDSD  961



>ref|XP_007213678.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
 gb|EMJ14877.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
Length=955

 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 104/128 (81%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALE+L+GKNN+K+  +EN+ CLLDWALVLQ+KGNLME +DP+
Sbjct  800  ALWGYLTDKADVYSFGVVALELLSGKNNIKYRPNENFVCLLDWALVLQQKGNLMELVDPK  859

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNL--DEFNS  349
            LGS F+K+EA+RMIKVALLC N SP LRP+MSAVVSMLEG   +  ++ +P++  DE   
Sbjct  860  LGSQFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTIVHEVKINPSIYGDELGF  919

Query  350  QAMNDHYD  373
            +A  +  D
Sbjct  920  KAFTEDSD  927



>ref|XP_008347521.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Malus domestica]
Length=783

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 104/131 (79%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI+AGKNN K+  ++N+ CL+DWALVLQ+KGNLM+ +DPR
Sbjct  615  ALWGYLTDKADVYSFGVVALEIVAGKNNXKYRPNQNFVCLVDWALVLQQKGNLMDLVDPR  674

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS F K+EA+RM+KVALLCTN +P L P+MSAVV MLEG   + E   DP++  DE   
Sbjct  675  LGSQFSKEEAIRMVKVALLCTNPAPALXPTMSAVVRMLEGETAVHELIMDPSIYGDEMXL  734

Query  350  QAMNDHYDEMA  382
             A+ + +D++A
Sbjct  735  TAVRNQFDQIA  745



>ref|XP_008345983.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=674

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 104/133 (78%), Gaps = 4/133 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +EN+ CL+DWALVLQ+KGNL+E +DPR
Sbjct  503  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLIELVDPR  562

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+F+ +E + M+KVALLC N +P LRP+MSAVVSMLEG   + E   +PN+  DE   
Sbjct  563  LGSDFEVEEVITMVKVALLCINPAPALRPTMSAVVSMLEGRTLVRESVMNPNIYGDELKL  622

Query  350  QAMNDHYDEMAVG  388
              + + +D  A G
Sbjct  623  ATLRNPFDPTAQG  635



>ref|XP_010655578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Vitis vinifera]
Length=864

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 108/145 (74%), Gaps = 5/145 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +E+Y CLLDWA VLQ+KGNLME +DP+
Sbjct  696  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYKPNEDYVCLLDWAFVLQQKGNLMELVDPK  755

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHD---DILEYDPN--LDEFN  346
            LG++ +K+EA  MIKVALLCTN SP LRP+MSAVVSML+G     ++L  DP+   D   
Sbjct  756  LGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSDHLK  815

Query  347  SQAMNDHYDEMAVGSRDFPNKVDLS  421
              A+   YD+M + S      ++ S
Sbjct  816  FNALRGQYDQMQLESHSVSGPLNKS  840



>ref|XP_006370934.1| hypothetical protein POPTR_0019s01910g [Populus trichocarpa]
 gb|ERP48731.1| hypothetical protein POPTR_0019s01910g [Populus trichocarpa]
Length=173

 Score =   159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLDW L L+  G++ME +DPR
Sbjct  6    ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDWVLYLKTNGDIMEMVDPR  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  66   LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  111



>ref|XP_007214549.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
 gb|EMJ15748.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
Length=935

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 102/128 (80%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +EN+ CL+DWALVLQ+KG L+E +DPR
Sbjct  776  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGELLELVDPR  835

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+  ++EA+RMIKVALLC N +P LRP+MSAVVSMLEG   + E   DP+   DE   
Sbjct  836  LGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELVTDPSTYGDELRL  895

Query  350  QAMNDHYD  373
             A+ + +D
Sbjct  896  TALTNQFD  903



>ref|XP_007025270.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27892.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=941

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 4/135 (3%)
 Frame = +2

Query  5    LWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPRL  184
            LWGYLT+KADVYSFGIVALEI+AGKNN K+  +E++ CL DWALVLQ KGNLME +DPRL
Sbjct  778  LWGYLTYKADVYSFGIVALEIVAGKNNTKYRPEEDFVCLQDWALVLQHKGNLMELVDPRL  837

Query  185  GSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNSQ  352
            GS F+++EA+RMIKVALLCTN+SP LRP MS VV+MLEG   + E   D ++  DE    
Sbjct  838  GSEFNEEEAIRMIKVALLCTNSSPALRPIMSEVVNMLEGRTLVPELIMDSSIFGDELRIG  897

Query  353  AMNDHYDEMAVGSRD  397
            A+ D  + M  G  D
Sbjct  898  ALRDQCNRMQTGKDD  912



>ref|XP_008225432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=657

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT K DVY FG+VALE+++GKNN+K+  +ENY CLLDWA VLQ+KGNLME +DP+
Sbjct  490  ALWGHLTDKVDVYGFGVVALELVSGKNNIKYQPNENYVCLLDWAFVLQQKGNLMELVDPK  549

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN----LDEFNS  349
            LGS F+K+EA+RMIKVALLCTN SP LRP+MSAVVSMLEG   + E + N     DE   
Sbjct  550  LGSEFNKEEAMRMIKVALLCTNPSPALRPTMSAVVSMLEGRAIVHELNINPSIYCDEMRF  609

Query  350  QAMNDH  367
            +++ D 
Sbjct  610  KSLRDE  615



>ref|XP_010655575.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=986

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 108/145 (74%), Gaps = 5/145 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +E+Y CLLDWA VLQ+KGNLME +DP+
Sbjct  818  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYKPNEDYVCLLDWAFVLQQKGNLMELVDPK  877

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHD---DILEYDPN--LDEFN  346
            LG++ +K+EA  MIKVALLCTN SP LRP+MSAVVSML+G     ++L  DP+   D   
Sbjct  878  LGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSDHLK  937

Query  347  SQAMNDHYDEMAVGSRDFPNKVDLS  421
              A+   YD+M + S      ++ S
Sbjct  938  FNALRGQYDQMQLESHSVSGPLNKS  962



>ref|XP_010655576.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=985

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 108/145 (74%), Gaps = 5/145 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +E+Y CLLDWA VLQ+KGNLME +DP+
Sbjct  817  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYKPNEDYVCLLDWAFVLQQKGNLMELVDPK  876

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHD---DILEYDPN--LDEFN  346
            LG++ +K+EA  MIKVALLCTN SP LRP+MSAVVSML+G     ++L  DP+   D   
Sbjct  877  LGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSDHLK  936

Query  347  SQAMNDHYDEMAVGSRDFPNKVDLS  421
              A+   YD+M + S      ++ S
Sbjct  937  FNALRGQYDQMQLESHSVSGPLNKS  961



>ref|XP_010655574.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
 emb|CBI30746.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 108/145 (74%), Gaps = 5/145 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +E+Y CLLDWA VLQ+KGNLME +DP+
Sbjct  840  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYKPNEDYVCLLDWAFVLQQKGNLMELVDPK  899

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHD---DILEYDPN--LDEFN  346
            LG++ +K+EA  MIKVALLCTN SP LRP+MSAVVSML+G     ++L  DP+   D   
Sbjct  900  LGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSDHLK  959

Query  347  SQAMNDHYDEMAVGSRDFPNKVDLS  421
              A+   YD+M + S      ++ S
Sbjct  960  FNALRGQYDQMQLESHSVSGPLNKS  984



>ref|XP_008371519.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=1011

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 104/133 (78%), Gaps = 4/133 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +EN+ CL+DWALVLQ+KGNL+E +DPR
Sbjct  840  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGNLIELVDPR  899

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+F+ +E + M+KVALLC N +P LRP+MSAVVSMLEG   + E   +PN+  DE   
Sbjct  900  LGSDFEVEEVITMVKVALLCINPAPALRPTMSAVVSMLEGRTLVRESVMNPNIYGDELKL  959

Query  350  QAMNDHYDEMAVG  388
              + + +D  A G
Sbjct  960  ATLRNPFDPTAQG  972



>ref|XP_007214698.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
 gb|EMJ15897.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
Length=936

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 102/128 (80%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +EN+ CL+DWALVLQ+KG L+E +DPR
Sbjct  765  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALVLQQKGELLELVDPR  824

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+  ++EA+RMIKVALLC N +P LRP+MSAVVSMLEG   + E   DP+   DE   
Sbjct  825  LGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELVTDPSTYGDELRL  884

Query  350  QAMNDHYD  373
             A+ + +D
Sbjct  885  TALTNQFD  892



>ref|XP_007025266.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27888.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=988

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K   +ENY CLLDWALVLQ+KGNLME +D +
Sbjct  832  ALWGYLTYKADVYSFGVVALEIVAGKNNMKFRPNENYVCLLDWALVLQQKGNLMELLDTK  891

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LGS F+K+EA+R+I+VALLCTN SP LRP+MS  VSMLEGH  + E   +P+   D+   
Sbjct  892  LGSKFNKEEAMRIIRVALLCTNPSPALRPTMSTAVSMLEGHTAVHEISGEPSFHGDDMRF  951

Query  350  QAMNDHYDEMAVGSRD  397
            ++  D YD++ + S +
Sbjct  952  KSFPD-YDQVVLQSSE  966



>ref|XP_006377507.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
 gb|ERP55304.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
Length=387

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++G++N  H +   + CLLDWA VLQ+KGNLME +DP+
Sbjct  240  ALWGYLTDKADVYSFGVVALEIVSGRSNSSHRTTNEFVCLLDWARVLQKKGNLMEIVDPK  299

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  300  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDDLHS  359

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  360  KHLKGHYQQV  369



>ref|XP_006371025.1| hypothetical protein POPTR_0019s027401g, partial [Populus trichocarpa]
 gb|ERP48822.1| hypothetical protein POPTR_0019s027401g, partial [Populus trichocarpa]
Length=177

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  8    ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  67

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  68   LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  113



>ref|XP_004296585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=206

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 104/146 (71%), Gaps = 5/146 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT K DVYSFG+VALE+++G+NNVK   +ENY CLLD+ALVLQ+K  LME +DP+
Sbjct  46   ALWGYLTDKVDVYSFGVVALELVSGENNVKFRPNENYVCLLDYALVLQQKEKLMELVDPK  105

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLD-----EFN  346
            L S F+K+EA+RMIKVALLCT+ SP LRP+MSA +SMLEG   I E + +       E  
Sbjct  106  LESKFNKEEAMRMIKVALLCTHPSPALRPTMSAALSMLEGRAVIHELNTSSSMYSDHELA  165

Query  347  SQAMNDHYDEMAVGSRDFPNKVDLSS  424
             ++  D Y ++++  R  P   + SS
Sbjct  166  FESFRDEYHDVSIQQRLPPQGPEASS  191



>emb|CAN81177.1| hypothetical protein VITISV_011951 [Vitis vinifera]
Length=868

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 107/145 (74%), Gaps = 5/145 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI+AGKNN+K+  +E+Y CLLDWA V Q+KGNLME +DP+
Sbjct  700  ALWGYLTYKADVYSFGVVALEIVAGKNNMKYKPNEDYVCLLDWAFVXQQKGNLMELVDPK  759

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHD---DILEYDPN--LDEFN  346
            LG++ +K+EA  MIKVALLCTN SP LRP+MSAVVSML+G     ++L  DP+   D   
Sbjct  760  LGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSDHLK  819

Query  347  SQAMNDHYDEMAVGSRDFPNKVDLS  421
              A+   YD+M + S      ++ S
Sbjct  820  FNALRGQYDQMQLESHSVSGPLNKS  844



>gb|KDO35800.1| hypothetical protein CISIN_1g028061mg [Citrus sinensis]
Length=214

 Score =   158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 94/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI++GKNN+ +  D N  C LDWA  L + G LMEF+DPR
Sbjct  6    ALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHQSGTLMEFVDPR  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNL----DEFNS  349
            LGS F+K EA RMIK+ALLCTN SP LRP+MS VVSMLEG  +I +  P      ++   
Sbjct  66   LGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSEDLRF  125

Query  350  QAMNDHYDEM  379
            + + DH  EM
Sbjct  126  KTLRDHPREM  135



>ref|XP_010088632.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36794.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=617

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLTFKADVYSFGIVALE++AG +N K   DE+Y CLLDWALV Q+KG LM  +DPR
Sbjct  464  ALWGYLTFKADVYSFGIVALELVAGISNTKFGPDEDYVCLLDWALVSQQKGKLMRLVDPR  523

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+F+ +EA RMIKVAL CTN SP LRP+MSAVVSMLEG   + E   DP++  D+   
Sbjct  524  LGSDFNTEEAARMIKVALQCTNPSPALRPTMSAVVSMLEGRTLVHELVMDPSVYADQLRF  583

Query  350  QAMNDHYDEM  379
            QA+ ++ D +
Sbjct  584  QALTEYIDHL  593



>ref|XP_008225259.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=883

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 101/128 (79%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+V LEI+AGK+N+K+  +EN+ CLLDWALVLQ+KG L+E +DPR
Sbjct  712  ALWGYLTYKADVYSFGVVTLEIVAGKSNMKYRPNENFVCLLDWALVLQQKGELLELVDPR  771

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+  ++EA+RMIKVALLC N +P LRP+MSAVVSMLEG   + E   DP+   DE   
Sbjct  772  LGSDVSEEEAIRMIKVALLCINAAPALRPAMSAVVSMLEGRTAVHELVTDPSTYGDELRL  831

Query  350  QAMNDHYD  373
             A+ + +D
Sbjct  832  TALTNQFD  839



>ref|XP_009351856.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Pyrus x bretschneideri]
Length=988

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYL+ KADVYSFG+VALE+++GKNNVK+  +EN+ CLLDWALVL + GNLME +D +
Sbjct  835  ALWGYLSDKADVYSFGVVALELISGKNNVKYRPNENFVCLLDWALVLHQDGNLMELVDRK  894

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LGS F+K+EALRMIKVA+LC N+SP LRP+MSAVVSMLEG   + E   +P++  DE   
Sbjct  895  LGSEFNKEEALRMIKVAVLCVNSSPALRPTMSAVVSMLEGQTPVCEVKINPSIYGDELRF  954

Query  350  QAMNDHYDEMAVGS  391
            +A  +  D  +V S
Sbjct  955  RAFTEDSDTASVQS  968



>ref|XP_006377521.1| hypothetical protein POPTR_0011s06650g [Populus trichocarpa]
 gb|ERP55318.1| hypothetical protein POPTR_0011s06650g [Populus trichocarpa]
Length=331

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++G++N  + +   + CLLDWA V+Q+KGNLME +DP+
Sbjct  152  ALWGYLTDKADVYSFGVVALEIVSGRSNSSYRTTNEFVCLLDWAHVVQKKGNLMEMVDPK  211

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  212  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDDLHS  271

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  272  KLLKGHYQQV  281



>ref|XP_006377456.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
 gb|ERP55253.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
Length=555

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++G++N  H +   + CLLDWA VLQ+KGNLME +DP+
Sbjct  377  ALWGYLTDKADVYSFGVVALEIVSGRSNSSHRTTNEFVCLLDWAHVLQKKGNLMEIVDPK  436

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  437  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDDLHS  496

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  497  KRLKGHYQQV  506



>ref|XP_007025267.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY27889.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1007

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFGIVALE +AGK N ++  +E++ CL DWALVLQ+KGNLME +DP 
Sbjct  850  ALWGYLTYKADVYSFGIVALETVAGKKNTRYGPEEDFVCLQDWALVLQQKGNLMELVDPS  909

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG  F+K+EA+RMIKVALLCTN SP LRP+MS VV ML+G   + E   DP++  DE   
Sbjct  910  LGGEFNKEEAVRMIKVALLCTNPSPALRPNMSEVVKMLKGRTHVPELIMDPSIFGDELRL  969

Query  350  QAMNDHYDEM  379
             A+ D +++M
Sbjct  970  GALRDQFNQM  979



>ref|XP_010088635.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36797.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=550

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 102/128 (80%), Gaps = 4/128 (3%)
 Frame = +2

Query  11   GYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPRLGS  190
            GYLT+KADVYSFG VALEI+AGKNN+K+  +EN+ CL+DWA+VLQ+KGNLME +DP LGS
Sbjct  388  GYLTYKADVYSFGAVALEIVAGKNNLKYRPNENFVCLVDWAIVLQQKGNLMELVDPNLGS  447

Query  191  NFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNSQAM  358
            +F+K+EA+RMIKVA+LC N SP LRP+MS VVS+L+G   I E   DP++  DE    A+
Sbjct  448  DFNKEEAVRMIKVAILCINPSPALRPTMSTVVSVLKGRTAIPELIMDPSIYGDELRLMAL  507

Query  359  NDHYDEMA  382
               ++++A
Sbjct  508  RKQFNQIA  515


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDW  130
            ALWGYLT+KADV+SF +VALEILAG +N+K+  +ENY CL+DW
Sbjct  6    ALWGYLTYKADVFSFAVVALEILAGTSNMKYRPNENYVCLVDW  48



>ref|XP_002522279.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF40137.1| ATP binding protein, putative [Ricinus communis]
Length=988

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 112/147 (76%), Gaps = 8/147 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT+KADVYSFG+VALEI++GKNN+K   D+++ CLLDWALVL + GNLME +DPR
Sbjct  819  ALWGHLTYKADVYSFGVVALEIVSGKNNMKRRPDDDFVCLLDWALVLHQDGNLMELVDPR  878

Query  182  --LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNL--DEF  343
              L S F+K E LR+I+VALLCTN SP +RP+MS VVSMLEG  +I  L  DP+L  DEF
Sbjct  879  LDLKSKFEK-EVLRVIEVALLCTNPSPAVRPAMSTVVSMLEGRGEIHNLAIDPSLYGDEF  937

Query  344  NSQAMNDHYDEMAV-GSRDFPNKVDLS  421
              +AM   YD++ V GSR+  + V+ S
Sbjct  938  RFKAMRKQYDQILVEGSRETQSLVNSS  964



>ref|XP_007214035.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
 gb|EMJ15234.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
Length=876

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT K DVYSFG+VALE+++GKNN+K+  +ENY CLLDWA VLQ+KGNLME +D +
Sbjct  764  ALWGHLTDKVDVYSFGVVALELVSGKNNIKYRPNENYVCLLDWAFVLQQKGNLMELVDLK  823

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN  331
            LGS F+K+EA+RMIKVALLCTN SP LRP+MSAVVSMLEG   + E + N
Sbjct  824  LGSEFNKEEAMRMIKVALLCTNPSPALRPTMSAVVSMLEGQAIVHELNIN  873



>ref|XP_006388189.1| hypothetical protein POPTR_0294s002001g, partial [Populus trichocarpa]
 gb|ERP47103.1| hypothetical protein POPTR_0294s002001g, partial [Populus trichocarpa]
Length=325

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  158  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  217

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  218  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  263



>ref|XP_006495027.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Citrus sinensis]
Length=380

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI++GKNN+ +  D N  C LDWA  L R G LME +DPR
Sbjct  172  ALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPR  231

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNL----DEFNS  349
            LGS FDK EA RMIKVALLCTN SP LRP+MS VVSMLEG  +I    P      ++   
Sbjct  232  LGSEFDKVEAERMIKVALLCTNASPSLRPTMSEVVSMLEGSSNIPYVIPEAGGLSEDLRF  291

Query  350  QAMNDHYDEM  379
            + + DH  EM
Sbjct  292  KTLRDHPREM  301



>ref|XP_009758721.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650, partial [Nicotiana sylvestris]
Length=422

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI AGK+ + +  +E + CLLDWA+VLQR+G LM+ +D  
Sbjct  264  ALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDWAVVLQRQGKLMDLVDET  323

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE-------YDPNLDE  340
            LGS+  +DEALRMI VALLCTN SP LRP+MSAV+ +LE H D+ E       YD   D 
Sbjct  324  LGSDLKQDEALRMINVALLCTNPSPALRPTMSAVIRILEDHLDLPEFNVESRFYDDCDDH  383

Query  341  FNSQAMNDHYDEMAVGSRDFP  403
             N Q + D Y  M   S+  P
Sbjct  384  LNFQGLRDKYGPMLSSSQSQP  404



>ref|XP_006377514.1| hypothetical protein POPTR_0011s06595g [Populus trichocarpa]
 gb|ERP55311.1| hypothetical protein POPTR_0011s06595g [Populus trichocarpa]
Length=308

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+K NLME +DP+
Sbjct  130  ALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCLLDWAHVLQKKENLMEIVDPK  189

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  190  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDDLHS  249

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  250  KHLKGHYQQV  259



>ref|XP_008225260.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=983

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 100/128 (78%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+V LEI+AGK+N+K+  +EN+ CL+DWALVLQ+KG L+E +DPR
Sbjct  812  ALWGYLTDKADVYSFGVVTLEIVAGKSNMKYRPNENFVCLVDWALVLQKKGELLELVDPR  871

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+  ++EA+RMIKVALLC N +P LRP+MSAVVSMLEG   + E   DP+   DE   
Sbjct  872  LGSDVSEEEAIRMIKVALLCINAAPALRPAMSAVVSMLEGRTAVHELVTDPSTYGDELRL  931

Query  350  QAMNDHYD  373
             A+ + +D
Sbjct  932  TALPNQFD  939



>ref|XP_008377580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=987

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYL+ KADVYSFG+V LE+++GKNN+K+  +EN+ CLLDWALVLQ+ GNLME +D +
Sbjct  835  ALWGYLSDKADVYSFGVVTLELVSGKNNIKYRPNENFVCLLDWALVLQQNGNLMELVDRK  894

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN  331
            LGS F+K+EA+RMIKVALLC N SP LRPSMSAVVSMLEG   + E   N
Sbjct  895  LGSGFNKEEAMRMIKVALLCANPSPALRPSMSAVVSMLEGQTLVQEVKIN  944



>ref|XP_006377525.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
 gb|ERP55322.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
Length=607

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++G++N  + +   + CLLDWA VLQ+KGNLME +DP+
Sbjct  428  ALWGYLTDKADVYSFGVVALEIVSGRSNSSYRTTNEFVCLLDWAHVLQKKGNLMEIVDPK  487

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  488  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDDLHS  547

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  548  KHLKGHYQQV  557



>ref|XP_006388928.1| hypothetical protein POPTR_0073s00200g [Populus trichocarpa]
 gb|ERP47842.1| hypothetical protein POPTR_0073s00200g [Populus trichocarpa]
Length=415

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD AL LQ+ G++ME +DPR
Sbjct  248  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRALYLQKNGDIMEMVDPR  307

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  308  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  353



>ref|XP_010088631.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXB36793.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=924

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 98/128 (77%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG++ALEI+AGKNN+++  +EN+ CLLDWA+ LQ+KGNLM+ +DP+
Sbjct  763  ALWGYLTDKADVYSFGVLALEIVAGKNNMRYRPNENFVCLLDWAIFLQQKGNLMDLVDPK  822

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG----HDDILEYDPNLDEFNS  349
             GS F+K+EA RMIKVALLCTN S  LRP MS VVSMLEG    H+ I++   N D    
Sbjct  823  SGSEFNKEEANRMIKVALLCTNPSQALRPGMSEVVSMLEGRTAVHELIMDPSNNHDPLRF  882

Query  350  QAMNDHYD  373
             A+ D +D
Sbjct  883  NALRDQFD  890



>ref|XP_008245184.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1005

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 99/128 (77%), Gaps = 4/128 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+V LEI+AGK+N+K+  +EN+ CL+DWA+VLQ+KG L+E +DPR
Sbjct  834  ALWGYLTDKADVYSFGVVTLEIVAGKSNMKYRPNENFVCLVDWAIVLQQKGELLELVDPR  893

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+  ++E +RMIKVALLC N +P LRP+MSAVVSMLEG   + E   DP+   DE   
Sbjct  894  LGSDVSEEEVIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAVHELVTDPSTYGDELRL  953

Query  350  QAMNDHYD  373
             A+ + +D
Sbjct  954  TALTNQFD  961



>ref|XP_009600352.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X6 [Nicotiana tomentosiformis]
Length=812

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI AGK+ + +  +E + CLLDWALVLQR+G L+E +D  
Sbjct  654  ALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDWALVLQRQGKLVELVDET  713

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE-------YDPNLDE  340
            LGS+  +DEALRMI VALLCTN SP LRP+MSAVVS+LE   D+ E       YD   D 
Sbjct  714  LGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLDLPEFNMESRFYDDYDDH  773

Query  341  FNSQAMNDHYDEMAVGSRDFP  403
             N Q + D Y E    S+  P
Sbjct  774  LNFQGLRDKYGEKFSSSQSQP  794



>ref|XP_006377483.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP55280.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=642

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++GK+N  +  +    CLLDWA  LQ+KGNLME +DP+
Sbjct  464  ALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCLLDWAHALQKKGNLMEIVDPK  523

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  524  LQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVVSMLEGQTSIQEVTSDPSIYGDDLHS  583

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  584  KRLKGHYQQVT  594



>ref|XP_009600351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Nicotiana tomentosiformis]
Length=856

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI AGK+ + +  +E + CLLDWALVLQR+G L+E +D  
Sbjct  698  ALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDWALVLQRQGKLVELVDET  757

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE-------YDPNLDE  340
            LGS+  +DEALRMI VALLCTN SP LRP+MSAVVS+LE   D+ E       YD   D 
Sbjct  758  LGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLDLPEFNMESRFYDDYDDH  817

Query  341  FNSQAMNDHYDEMAVGSRDFP  403
             N Q + D Y E    S+  P
Sbjct  818  LNFQGLRDKYGEKFSSSQSQP  838



>ref|XP_004295407.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1681

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = +2

Query  2     ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
             ALWG LT+KADVYSFG+VALEI+AGKNN+K   ++++ CL+DWALVLQ+KGNL E +D R
Sbjct  1509  ALWGCLTYKADVYSFGVVALEIVAGKNNMKFRPNDDFVCLVDWALVLQQKGNLKELVDQR  1568

Query  182   LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
             LGS+++K++A+RM KVALLCTN++P LRP+MS VVSMLEG   + E   DP++  D+   
Sbjct  1569  LGSDYNKEQAIRMAKVALLCTNSAPSLRPTMSVVVSMLEGKTAVPELIMDPSIYGDKMRM  1628

Query  350   QAMNDHYDEM  379
              A+ + +D++
Sbjct  1629  TALRNQFDQI  1638


 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 94/129 (73%), Gaps = 12/129 (9%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG LT+KADVYSFG+VALE ++GKNN+K+  +EN  CL+DWA VL +KGNL+E +DPR
Sbjct  481  ALWGCLTYKADVYSFGVVALETVSGKNNMKYRPNENIQCLMDWAHVLHQKGNLLELVDPR  540

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            LGS+F+K EALR IKVALLC N +  LRP MSAVVSMLEG   + E   DP++       
Sbjct  541  LGSDFNKKEALRTIKVALLCANPTAALRPIMSAVVSMLEGRTPVDEVALDPSI-------  593

Query  356  MNDHYDEMA  382
               H DEM 
Sbjct  594  ---HGDEMT  599



>ref|XP_011046381.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=992

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLDW L LQ+ G++ME +DPR
Sbjct  825  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDWVLYLQKSGDIMEMVDPR  884

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI +ALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  885  LGSEFNKKEVVRMINIALLCTNQSPALRPTMSTVVSMLEGKTDVEE  930



>ref|XP_002300205.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
 gb|EEE85010.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
Length=1003

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI+AG NN++   DE++ CLLDWAL LQ+ G++ME +DP+
Sbjct  841  ALYGYLTYKADVYSFGVVALEIVAGMNNMRFRHDEDFVCLLDWALNLQQNGDIMELVDPK  900

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS FDK EA+RMI+VALLCTN SP LRP MSAVV MLEG  D+ E
Sbjct  901  LGSGFDKKEAVRMIQVALLCTNQSPALRPKMSAVVKMLEGKGDVQE  946



>ref|XP_009600350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Nicotiana tomentosiformis]
Length=911

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI AGK+ + +  +E + CLLDWALVLQR+G L+E +D  
Sbjct  753  ALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDWALVLQRQGKLVELVDET  812

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE-------YDPNLDE  340
            LGS+  +DEALRMI VALLCTN SP LRP+MSAVVS+LE   D+ E       YD   D 
Sbjct  813  LGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLDLPEFNMESRFYDDYDDH  872

Query  341  FNSQAMNDHYDEMAVGSRDFP  403
             N Q + D Y E    S+  P
Sbjct  873  LNFQGLRDKYGEKFSSSQSQP  893



>ref|XP_006377493.1| hypothetical protein POPTR_0011s06440g [Populus trichocarpa]
 gb|ERP55290.1| hypothetical protein POPTR_0011s06440g [Populus trichocarpa]
Length=276

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 96/132 (73%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A WGYLT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+K NLME +DP+
Sbjct  99   AQWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCLLDWAHVLQKKENLMEIVDPK  158

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL---DEFN  346
            L S F+K+EA RMIK ALLCTN SP +RP+MS VVSMLEG   I E   DP++   D+ +
Sbjct  159  LQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTCIPEVTSDPSIYDDDDLH  218

Query  347  SQAMNDHYDEMA  382
            S+ +  HY ++ 
Sbjct  219  SKRVKGHYQQVT  230



>ref|XP_009600349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Nicotiana tomentosiformis]
Length=993

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI AGK+ + +  +E + CLLDWALVLQR+G L+E +D  
Sbjct  835  ALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDWALVLQRQGKLVELVDET  894

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE-------YDPNLDE  340
            LGS+  +DEALRMI VALLCTN SP LRP+MSAVVS+LE   D+ E       YD   D 
Sbjct  895  LGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLDLPEFNMESRFYDDYDDH  954

Query  341  FNSQAMNDHYDEMAVGSRDFP  403
             N Q + D Y E    S+  P
Sbjct  955  LNFQGLRDKYGEKFSSSQSQP  975



>ref|XP_009600348.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana tomentosiformis]
Length=993

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI AGK+ + +  +E + CLLDWALVLQR+G L+E +D  
Sbjct  835  ALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDWALVLQRQGKLVELVDET  894

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE-------YDPNLDE  340
            LGS+  +DEALRMI VALLCTN SP LRP+MSAVVS+LE   D+ E       YD   D 
Sbjct  895  LGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLDLPEFNMESRFYDDYDDH  954

Query  341  FNSQAMNDHYDEMAVGSRDFP  403
             N Q + D Y E    S+  P
Sbjct  955  LNFQGLRDKYGEKFSSSQSQP  975



>ref|XP_006377518.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
 gb|ERP55315.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
Length=662

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 99/129 (77%), Gaps = 4/129 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++G++N  + +   + CLLDWA V+Q+KGNLME +DP+
Sbjct  534  ALWGYLTDKADVYSFGVVALEIVSGRSNSSYRTTNEFVCLLDWAHVVQKKGNLMEMVDPK  593

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  594  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDDLHS  653

Query  350  QAMNDHYDE  376
            + +  HY +
Sbjct  654  KHLIGHYQQ  662



>ref|XP_006370936.1| hypothetical protein POPTR_0019s01930g [Populus trichocarpa]
 gb|ERP48733.1| hypothetical protein POPTR_0019s01930g [Populus trichocarpa]
Length=580

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (74%), Gaps = 4/136 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+G LT+KADVYSFGIVALEI+AG +N+    +E++ CLLDWAL LQ+ G++ME +DPR
Sbjct  417  ALYGRLTYKADVYSFGIVALEIVAGMSNMSFQHNESFACLLDWALSLQQNGDMMELVDPR  476

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+F K EA RMIKVALLCTN SP LRP+MSAVV MLEG  D+ E   DP+   D    
Sbjct  477  LGSDFKKKEAARMIKVALLCTNQSPALRPTMSAVVRMLEGKGDVQELVVDPSTFGDSLRF  536

Query  350  QAMNDHYDEMAVGSRD  397
            ++   + D+ +V S D
Sbjct  537  KSFQGYSDQSSVLSID  552



>ref|XP_002317383.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
 gb|EEE97995.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
Length=591

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+K NLME +DP+
Sbjct  413  ALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCLLDWAHVLQKKENLMEIVDPK  472

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  473  LQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVVSMLEGQTSIPEVTSDPSIYGDDLHS  532

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  533  KRVKGHYQQVT  543



>ref|XP_006371019.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
 gb|ERP48816.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
Length=599

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  432  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  491

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  492  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  537



>ref|XP_006377501.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
 gb|ERP55298.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
Length=573

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 96/130 (74%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++GK+N  +       CLLDWA VLQ+K NLME +DP+
Sbjct  395  ALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPQNENVCLLDWAHVLQKKENLMEIVDPK  454

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  455  LQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDDLHS  514

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  515  KHLKGHYQQV  524



>ref|XP_006377461.1| hypothetical protein POPTR_0011s06150g [Populus trichocarpa]
 gb|ERP55258.1| hypothetical protein POPTR_0011s06150g [Populus trichocarpa]
Length=313

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 99/133 (74%), Gaps = 7/133 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNL---MEFI  172
            ALWGYLT KADVYSFG+VALEI++G++N  + +   + CLLDWA V+Q+KGNL   ME +
Sbjct  131  ALWGYLTDKADVYSFGVVALEIVSGRSNSSYRTTNEFVCLLDWAHVVQKKGNLMESMEIV  190

Query  173  DPRLGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DE  340
            DP+L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+
Sbjct  191  DPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDD  250

Query  341  FNSQAMNDHYDEM  379
             +S+ +  H  ++
Sbjct  251  LHSKLLKGHCQQV  263



>ref|XP_006467585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1-like [Citrus sinensis]
Length=1045

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI++GKNN+ +  D N  C LDWA  L R G LME +DPR
Sbjct  837  ALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPR  896

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNL----DEFNS  349
            LGS FDK EA RMIKVALLCTN SP LRP+MS VVSMLEG  +I    P      ++   
Sbjct  897  LGSEFDKVEAERMIKVALLCTNASPSLRPTMSEVVSMLEGSSNIPYVIPEAGGLSEDLRF  956

Query  350  QAMNDHYDEM  379
            + + DH  EM
Sbjct  957  KTLRDHPREM  966



>ref|XP_008366034.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=980

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 97/126 (77%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT K DVYSFG+VALE+ +GKNN+K    ENY CLLDWA VLQ+ GNLME  DP 
Sbjct  817  ALWGHLTDKVDVYSFGVVALELXSGKNNIKFRPYENYVCLLDWAFVLQQTGNLMELXDPX  876

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNL--DEFNS  349
            LGS+F+K++A+RMIKVA+LCTN +P LRP+MSAVVSMLEG   +  L  +P++  DE   
Sbjct  877  LGSDFNKEQAMRMIKVAILCTNPAPALRPTMSAVVSMLEGRAIVHELNINPSIYGDEMRF  936

Query  350  QAMNDH  367
            +++ D 
Sbjct  937  ESLRDE  942



>ref|XP_006377482.1| hypothetical protein POPTR_0011s06335g [Populus trichocarpa]
 gb|ERP55279.1| hypothetical protein POPTR_0011s06335g [Populus trichocarpa]
Length=617

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+KGNLME +DP+
Sbjct  439  ALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCLLDWAHVLQKKGNLMEIMDPK  498

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP LRP+MS V++MLEG  +I E   DP++  ++  S
Sbjct  499  LQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVLNMLEGQTNIPEVTSDPSIYDNDLQS  558

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  559  KRVKGHYQQVT  569



>ref|XP_002325753.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
 gb|EEF00135.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
Length=972

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLDW L LQ+ G++M  +DPR
Sbjct  805  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDWVLYLQKNGDIMAMVDPR  864

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+
Sbjct  865  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDV  908



>emb|CBI30752.3| unnamed protein product [Vitis vinifera]
Length=511

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 96/130 (74%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KAD+YSFG+VALEI++GKNN     +    CLLD A  LQ+KG+LME +DP+
Sbjct  329  ALWGHLTDKADIYSFGVVALEIVSGKNNSSRKPENECVCLLDRAFALQQKGSLMEIVDPK  388

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDE--FNS  349
            LGS F++DEA RMIKVA+LCTN SP LRP MSAVVSMLEG   + E   D ++DE   N 
Sbjct  389  LGSEFNRDEAERMIKVAILCTNASPTLRPIMSAVVSMLEGQTIVPEVISDASMDEDYLNF  448

Query  350  QAMNDHYDEM  379
            +++ D++  M
Sbjct  449  KSLGDYHKRM  458



>ref|XP_006371027.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
 gb|ERP48824.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
Length=781

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  614  ALYGYLTYKADVYSFGVVALEIVSGTNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  673

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  674  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  719



>ref|XP_006377459.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
 gb|ERP55256.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
Length=585

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+KGNLME +DP+
Sbjct  385  ALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCLLDWAHVLQKKGNLMEIVDPK  444

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP LRP+MS V++MLEG   I E   DP++  ++  S
Sbjct  445  LQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVLNMLEGQTSIPEVTSDPSIYDNDLQS  504

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  505  KRVKGHYQQVT  515



>ref|XP_010316866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=993

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 98/131 (75%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG++ALEI AGK+N+ +  +E + CLLDWALVLQR+G L E +D  
Sbjct  836  ALWGYLTYKADVYSFGVLALEIAAGKSNMTYRPNEKFVCLLDWALVLQRQGKLKEVVDAT  895

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYD------PNLDEF  343
            LGS+ ++DEALRM+ VALLCT+ SP LRP+MSAVV +LE H D+ E+        + D F
Sbjct  896  LGSDLNEDEALRMLNVALLCTSPSPALRPTMSAVVKILENHLDLPEFTMESRFYDDYDLF  955

Query  344  NSQAMNDHYDE  376
            N Q + D Y++
Sbjct  956  NFQGLRDKYED  966



>ref|XP_004295408.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1071

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 104/161 (65%), Gaps = 37/161 (23%)
 Frame = +2

Query  2     ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDW-----------------  130
             ALWGYLT KADVYSFG+VALE+++GKNN+K+  +EN+ CLLDW                 
Sbjct  873   ALWGYLTDKADVYSFGVVALELVSGKNNIKYRPNENFVCLLDWVRSSLYPIRMASYLFAG  932

Query  131   ----------------ALVLQRKGNLMEFIDPRLGSNFDKDEALRMIKVALLCTNTSPVL  262
                             ALVLQ+KGNLME +DP+LGS F+K+EALRMIKVALLC N+SP L
Sbjct  933   IVFLITNFTSISSPMQALVLQQKGNLMELVDPKLGSGFNKEEALRMIKVALLCANSSPAL  992

Query  263   RPSMSAVVSMLEGHDDILEY--DPNL--DEFNSQAMNDHYD  373
             RP+MS VVSMLEG  D+ E   +P++  DE   +A  +  D
Sbjct  993   RPTMSQVVSMLEGRTDVHEVTINPSIYDDEMRFKAFTEDSD  1033



>emb|CBI30750.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 90/114 (79%), Gaps = 4/114 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KAD+YSFG+VALEI++GKNN  +  +    CLLD A VLQ++G+LME +DP+
Sbjct  375  ALWGYLTNKADIYSFGVVALEIVSGKNNTSYKPENECVCLLDLAFVLQQRGSLMEIVDPK  434

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH---DDILEYDPNL  334
            LGS F++DEA RMIKVALLCTN SP LRP+MSAVVSMLEG     D++  DP +
Sbjct  435  LGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEGQTVVQDVIS-DPGI  487



>ref|XP_006449566.1| hypothetical protein CICLE_v10014125mg [Citrus clementina]
 gb|ESR62806.1| hypothetical protein CICLE_v10014125mg [Citrus clementina]
Length=1024

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI++GKNN+ +  D N  C LDWA  L R G LME +DPR
Sbjct  816  ALWGYLTYKADVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPR  875

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNL----DEFNS  349
            LGS F+K EA RMIK+ALLCTN SP LRP+MS VVSMLEG  +I +  P      ++   
Sbjct  876  LGSEFNKVEAERMIKIALLCTNASPSLRPTMSEVVSMLEGSSNIPDVIPEAGGLSEDLRF  935

Query  350  QAMNDHYDEM  379
            + + DH  EM
Sbjct  936  KTLRDHPREM  945



>ref|XP_006377463.1| hypothetical protein POPTR_0011s06170g [Populus trichocarpa]
 gb|ERP55260.1| hypothetical protein POPTR_0011s06170g [Populus trichocarpa]
Length=363

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 97/130 (75%), Gaps = 5/130 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG VALEI++G++N  + +   + CLLDWA V Q+KGNLME +DP+
Sbjct  185  ALWGYLTDKADVYSFG-VALEIVSGRSNSSYRTTNEFVCLLDWAHVPQKKGNLMEIVDPK  243

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS V SMLEG   I E   DP++  D+ +S
Sbjct  244  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVASMLEGQTSIQEMISDPSIYGDDLHS  303

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  304  KLLKGHYQQV  313



>ref|XP_011045704.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=829

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI+AG NN++   DE++ CLLDWAL LQ+ G++ME +DP 
Sbjct  667  ALYGYLTYKADVYSFGVVALEIVAGMNNMRFRHDEDFVCLLDWALNLQQNGDIMELVDPN  726

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K EA+ MIKVALLCTN SP LRP MSAVV MLEG  D+ E
Sbjct  727  LGSRFNKKEAVGMIKVALLCTNQSPALRPKMSAVVKMLEGKGDVQE  772



>ref|XP_006358135.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=779

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 97/131 (74%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG++ALEI AGK+N+ +  +E + CLLDWALVLQR+G L E +D  
Sbjct  622  ALWGYLTYKADVYSFGVLALEIAAGKSNMTYRPNEKFVCLLDWALVLQRQGKLKEVVDAT  681

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYD------PNLDEF  343
            LGS+ ++DEALRM+ VALLCT+ SP LRP+MSAVV +LE H D+ E+        + D  
Sbjct  682  LGSDLNEDEALRMLNVALLCTSPSPALRPTMSAVVKILENHLDLPEFTMESRFYDDYDLL  741

Query  344  NSQAMNDHYDE  376
            N Q + D Y++
Sbjct  742  NFQGLRDKYED  752



>ref|XP_011046363.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Populus euphratica]
Length=833

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  666  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  725

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  726  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  771



>ref|XP_011009667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=515

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 96/132 (73%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYL+ KADVYSFG+VALEI++G++N  ++      CLLDWA VLQ++GNLM  +DP+
Sbjct  336  ALWGYLSDKADVYSFGVVALEIVSGRSNSSYNPTNESVCLLDWAFVLQKRGNLMALVDPK  395

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            L S F+K+EA +MIKVALLCTN SP LRP+M AVVSMLEG   I E   DP +    SQ 
Sbjct  396  LRSEFNKEEAEKMIKVALLCTNASPSLRPTMPAVVSMLEGQTSIQEVISDPTIYGGGSQF  455

Query  356  MN---DHYDEMA  382
             +   DH+ ++A
Sbjct  456  KHVKYDHFQQVA  467



>ref|XP_011009666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=515

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 96/132 (73%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYL+ KADVYSFG+VALEI++G++N  ++      CLLDWA VLQ++GNLM  +DP+
Sbjct  336  ALWGYLSDKADVYSFGVVALEIVSGRSNSSYNPTNESVCLLDWAFVLQKRGNLMALVDPK  395

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            L S F+K+EA +MIKVALLCTN SP LRP+M AVVSMLEG   I E   DP +    SQ 
Sbjct  396  LRSEFNKEEAEKMIKVALLCTNASPSLRPTMPAVVSMLEGQTSIQEVISDPTIYGGGSQF  455

Query  356  MN---DHYDEMA  382
             +   DH+ ++A
Sbjct  456  KHVKYDHFQQVA  467



>ref|XP_002317319.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
 gb|EEE97931.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
Length=668

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A WGYLT KADVYSFG+VALEI++GK+N  +  +    CLLDWA V Q+K NLME +DP+
Sbjct  492  AQWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCLLDWAHVFQKKENLMEIVDPK  551

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP +RP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  552  LHSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIFYDDLHS  611

Query  350  QAMNDHYDEMA  382
            + +N HY ++ 
Sbjct  612  KRVNGHYQQVT  622



>ref|XP_011014229.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1002

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  835  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  894

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  895  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  940



>ref|XP_011046365.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X7 [Populus euphratica]
Length=1002

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  835  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  894

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  895  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  940



>ref|XP_011014228.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  837  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  896

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  897  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  942



>ref|XP_011014227.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
Length=1004

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  837  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  896

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  897  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  942



>ref|XP_011045702.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
 ref|XP_011045703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1006

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI+AG NN++   DE++ CLLDWAL LQ+ G++ME +DP 
Sbjct  844  ALYGYLTYKADVYSFGVVALEIVAGMNNMRFRHDEDFVCLLDWALNLQQNGDIMELVDPN  903

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K EA+ MIKVALLCTN SP LRP MSAVV MLEG  D+ E
Sbjct  904  LGSRFNKKEAVGMIKVALLCTNQSPALRPKMSAVVKMLEGKGDVQE  949



>ref|XP_011014230.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=980

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  813  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  872

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  873  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  918



>ref|XP_011046364.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Populus euphratica]
Length=1002

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  835  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  894

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  895  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  940



>ref|XP_011046359.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
 ref|XP_011046361.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1004

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  837  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  896

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  897  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  942



>ref|XP_011046360.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  837  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  896

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  897  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  942



>ref|XP_011046349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1005

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN  CLLDW L LQ+ G++M+ +DPR
Sbjct  838  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENVVCLLDWVLYLQKNGDIMDMVDPR  897

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            +G+ F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  898  MGAEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  943



>ref|XP_011046362.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=1004

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN+ CLLD  L LQ+ G++ME +DPR
Sbjct  837  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDRVLYLQKNGDIMEMVDPR  896

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  897  LGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  942



>ref|XP_011046350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=1003

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+GYLT+KADVYSFG+VALEI++G NNVK   DEN  CLLDW L LQ+ G++M+ +DPR
Sbjct  836  ALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENVVCLLDWVLYLQKNGDIMDMVDPR  895

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            +G+ F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D+ E
Sbjct  896  MGAEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTDVEE  941



>ref|XP_006384081.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
 gb|ERP61878.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
Length=464

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYL+ KADVYSFG+VALEI++G++N  ++      CLLDWA VLQ++GNLM  +DP+
Sbjct  300  ALWGYLSDKADVYSFGVVALEIVSGRSNSSYNPTNESVCLLDWAFVLQKRGNLMALVDPK  359

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            L S F+K+EA +MIKVALLC N SP LRPSM AVVSMLEG   I E   DP +    SQ 
Sbjct  360  LRSEFNKEEAEKMIKVALLCANASPSLRPSMPAVVSMLEGQTSIQEVISDPTIYGGGSQF  419

Query  356  MNDHYD  373
               +YD
Sbjct  420  KQVNYD  425



>ref|XP_006384080.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
 gb|ERP61877.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
Length=462

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYL+ KADVYSFG+VALEI++G++N  ++      CLLDWA VLQ++GNLM  +DP+
Sbjct  298  ALWGYLSDKADVYSFGVVALEIVSGRSNSSYNPTNESVCLLDWAFVLQKRGNLMALVDPK  357

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            L S F+K+EA +MIKVALLC N SP LRPSM AVVSMLEG   I E   DP +    SQ 
Sbjct  358  LRSEFNKEEAEKMIKVALLCANASPSLRPSMPAVVSMLEGQTSIQEVISDPTIYGGGSQF  417

Query  356  MNDHYD  373
               +YD
Sbjct  418  KQVNYD  423



>emb|CBI30754.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+V LEI++GKNN  +  D    CLLDWA VL++KG+LME +DP 
Sbjct  385  ALWGYLTDKADVYSFGVVTLEIVSGKNNSNYTPDTTCTCLLDWAFVLKQKGSLMELVDPN  444

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F+K EA  MIKVALLCTN S  LRP+MSAV+ MLEG D I E   DP++   +   
Sbjct  445  LGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDIIPEVISDPSIYGKDMRI  504

Query  350  QAMNDHYDEMAVGS  391
              + DHY  M + S
Sbjct  505  SPLRDHYQHMEMQS  518



>ref|XP_002528777.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33599.1| ATP binding protein, putative [Ricinus communis]
Length=1007

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 95/131 (73%), Gaps = 6/131 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI+ GK+N+K   DEN+ CLLDWALVL +KG+L++ +D R
Sbjct  818  ALWGYLTHKADVYSFGVVALEIVVGKSNMKFRPDENFVCLLDWALVLHQKGDLLKLVDER  877

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY----DPNLDEFNS  349
            L S F K EA+RMIKVALLCTN SP LRP+MS  V MLEG   + E+        D F  
Sbjct  878  LESKFSKKEAVRMIKVALLCTNPSPSLRPTMSEAVRMLEGRAAVPEFVMGQSVYADGFG-  936

Query  350  QAMNDHYDEMA  382
             A+ + YD+++
Sbjct  937  -ALRNQYDQIS  946



>ref|XP_011002041.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Populus euphratica]
Length=1009

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++G++N  + +   + CLLDWA  LQ+K NLME +DP+
Sbjct  847  ALWGYLTDKADVYSFGVVALEIVSGRSNSSYRTTNEFVCLLDWAHGLQKKRNLMEIVDPK  906

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  907  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTTIQEMISDPSIYGDDLHS  966

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  967  KRLEGHYQQV  976



>ref|XP_011002039.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Populus euphratica]
Length=1026

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++G++N  + +   + CLLDWA  LQ+K NLME +DP+
Sbjct  847  ALWGYLTDKADVYSFGVVALEIVSGRSNSSYRTTNEFVCLLDWAHGLQKKRNLMEIVDPK  906

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  907  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTTIQEMISDPSIYGDDLHS  966

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  967  KRLEGHYQQV  976



>ref|XP_011002042.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X4 [Populus euphratica]
Length=1002

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++G++N  + +   + CLLDWA  LQ+K NLME +DP+
Sbjct  823  ALWGYLTDKADVYSFGVVALEIVSGRSNSSYRTTNEFVCLLDWAHGLQKKRNLMEIVDPK  882

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  883  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTTIQEMISDPSIYGDDLHS  942

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  943  KRLEGHYQQV  952



>ref|XP_011002040.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Populus euphratica]
Length=1024

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++G++N  + +   + CLLDWA  LQ+K NLME +DP+
Sbjct  845  ALWGYLTDKADVYSFGVVALEIVSGRSNSSYRTTNEFVCLLDWAHGLQKKRNLMEIVDPK  904

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  905  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTTIQEMISDPSIYGDDLHS  964

Query  350  QAMNDHYDEM  379
            + +  HY ++
Sbjct  965  KRLEGHYQQV  974



>ref|XP_008346191.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Malus domestica]
Length=193

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT K DVYSFG+VALE+++GKNN+K+  +E+Y CLLDW      +G+LME +DP 
Sbjct  61   ALWGHLTEKVDVYSFGVVALELVSGKNNIKNWPNESYVCLLDW------RGDLMELVDPM  114

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            LGS F++ EA+RMIKVALLCTN SP LRP+MSAVVSMLEG   + E
Sbjct  115  LGSEFNEQEAMRMIKVALLCTNRSPTLRPTMSAVVSMLEGRAIVRE  160



>ref|XP_006370931.1| hypothetical protein POPTR_0019s01880g [Populus trichocarpa]
 gb|ERP48728.1| hypothetical protein POPTR_0019s01880g [Populus trichocarpa]
Length=414

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 98/136 (72%), Gaps = 4/136 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+G LT+KADVYSFGIVALEI+AG +N++   +E++ CLLDWAL L + G++ME +DPR
Sbjct  251  ALYGRLTYKADVYSFGIVALEIVAGMSNMRFRHNESFACLLDWALSLHQNGDVMELVDPR  310

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+F K EA RMIKVALLCTN SP  RP MSAVV MLEG  D+ E   DP+   D    
Sbjct  311  LGSDFKKKEAARMIKVALLCTNQSPAHRPIMSAVVRMLEGKGDVQELVVDPSTFGDSLRF  370

Query  350  QAMNDHYDEMAVGSRD  397
            ++   + D+ +V S D
Sbjct  371  KSFQGNSDQSSVLSID  386



>ref|XP_008384519.1| PREDICTED: TMV resistance protein N-like isoform X2 [Malus domestica]
Length=913

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 97/130 (75%), Gaps = 7/130 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI+AGK+N+K+  +EN  CL+DWALVLQ+KGNL+E +DP 
Sbjct  738  ALWGYLTNKADVYSFGVVALEIVAGKSNMKYIPNENLVCLVDWALVLQQKGNLIELVDPS  797

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNSQAMN  361
            LGS+F+ +EA+ M+KVALLC N +  LRP+MSAVVSMLEG   +        E    A+ 
Sbjct  798  LGSHFEVEEAITMVKVALLCINPASALRPTMSAVVSMLEGRTLV-------HELKLSALR  850

Query  362  DHYDEMAVGS  391
            + +D  A GS
Sbjct  851  NPFDPTAQGS  860



>ref|XP_011002049.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X6 [Populus euphratica]
Length=959

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+K NLME +DP+
Sbjct  800  ALWGHLTDKADVYSFGVVALEIVSGKSNSIYRPENENVCLLDWAHVLQKKENLMEIVDPK  859

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP +RP+MS VVSMLEG   I E   DP++  DE +S
Sbjct  860  LQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDELHS  919

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  920  KRVKGHYQQVT  930



>ref|XP_008384518.1| PREDICTED: TMV resistance protein N-like isoform X1 [Malus domestica]
Length=915

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 97/130 (75%), Gaps = 7/130 (5%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI+AGK+N+K+  +EN  CL+DWALVLQ+KGNL+E +DP 
Sbjct  740  ALWGYLTNKADVYSFGVVALEIVAGKSNMKYIPNENLVCLVDWALVLQQKGNLIELVDPS  799

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNSQAMN  361
            LGS+F+ +EA+ M+KVALLC N +  LRP+MSAVVSMLEG   +        E    A+ 
Sbjct  800  LGSHFEVEEAITMVKVALLCINPASALRPTMSAVVSMLEGRTLV-------HELKLSALR  852

Query  362  DHYDEMAVGS  391
            + +D  A GS
Sbjct  853  NPFDPTAQGS  862



>ref|XP_002305710.2| hypothetical protein POPTR_0004s06240g [Populus trichocarpa]
 gb|EEE86221.2| hypothetical protein POPTR_0004s06240g [Populus trichocarpa]
Length=468

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++G++N  ++      CLLDWA VLQ++GNLM  +DP+
Sbjct  300  ALWGYLTDKADVYSFGVVALEIVSGRSNSSYNPTNESVCLLDWAFVLQKRGNLMALVDPK  359

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            L S F+K+EA +M+KVALLC N SP LRPSM AVVSMLEG   I E   DP++    SQ 
Sbjct  360  LRSEFNKEEAEKMMKVALLCANASPSLRPSMPAVVSMLEGQTSIQEVISDPSIYGDGSQF  419

Query  356  MNDHYD  373
             +  YD
Sbjct  420  KHLKYD  425



>ref|XP_011002048.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X5 [Populus euphratica]
Length=963

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+K NLME +DP+
Sbjct  804  ALWGHLTDKADVYSFGVVALEIVSGKSNSIYRPENENVCLLDWAHVLQKKENLMEIVDPK  863

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP +RP+MS VVSMLEG   I E   DP++  DE +S
Sbjct  864  LQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDELHS  923

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  924  KRVKGHYQQVT  934



>ref|XP_011002050.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X7 [Populus euphratica]
Length=1002

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+K NLME +DP+
Sbjct  843  ALWGHLTDKADVYSFGVVALEIVSGKSNSIYRPENENVCLLDWAHVLQKKENLMEIVDPK  902

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP +RP+MS VVSMLEG   I E   DP++  DE +S
Sbjct  903  LQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDELHS  962

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  963  KRVKGHYQQVT  973



>ref|NP_001235287.1| receptor-like protein kinase [Glycine max]
 gb|ACM89557.1| receptor-like protein kinase [Glycine max]
Length=272

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 96/127 (76%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  H S +    LLDWA +L+ KGNLME +D R
Sbjct  99   AMHGYLTDKADVYSFGVVALEIVSGKSNTIHRSKQEALHLLDWAHLLKEKGNLMELVDRR  158

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPN--LDEFNS  349
            LGS+F+++E + MIKVALLCTNT+  LRP+MS+V+SMLEG   I E+  DP+  +DE   
Sbjct  159  LGSDFNENEVMMMIKVALLCTNTTSNLRPTMSSVLSMLEGKTMIPEFVSDPSEIMDEMKL  218

Query  350  QAMNDHY  370
            +AM  HY
Sbjct  219  EAMRQHY  225



>ref|XP_011002046.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Populus euphratica]
Length=983

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+K NLME +DP+
Sbjct  824  ALWGHLTDKADVYSFGVVALEIVSGKSNSIYRPENENVCLLDWAHVLQKKENLMEIVDPK  883

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP +RP+MS VVSMLEG   I E   DP++  DE +S
Sbjct  884  LQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDELHS  943

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  944  KRVKGHYQQVT  954



>ref|XP_011002045.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Populus euphratica]
Length=985

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+K NLME +DP+
Sbjct  826  ALWGHLTDKADVYSFGVVALEIVSGKSNSIYRPENENVCLLDWAHVLQKKENLMEIVDPK  885

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP +RP+MS VVSMLEG   I E   DP++  DE +S
Sbjct  886  LQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDELHS  945

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  946  KRVKGHYQQVT  956



>ref|XP_011002047.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X4 [Populus euphratica]
Length=983

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+K NLME +DP+
Sbjct  824  ALWGHLTDKADVYSFGVVALEIVSGKSNSIYRPENENVCLLDWAHVLQKKENLMEIVDPK  883

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP +RP+MS VVSMLEG   I E   DP++  DE +S
Sbjct  884  LQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDELHS  943

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  944  KRVKGHYQQVT  954



>ref|XP_011002044.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Populus euphratica]
Length=1007

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+K NLME +DP+
Sbjct  848  ALWGHLTDKADVYSFGVVALEIVSGKSNSIYRPENENVCLLDWAHVLQKKENLMEIVDPK  907

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK ALLCTN SP +RP+MS VVSMLEG   I E   DP++  DE +S
Sbjct  908  LQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTSIPEVTSDPSIYGDELHS  967

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  968  KRVKGHYQQVT  978



>ref|XP_010665668.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Beta vulgaris subsp. vulgaris]
Length=862

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVL-QRKGNLMEFIDP  178
            ALWGYLT+KADVYSFG+ ALEI+AG++N     D+NYFCLLDWA  L Q+KGN+ME +DP
Sbjct  699  ALWGYLTYKADVYSFGVFALEIVAGRSNTNFKPDDNYFCLLDWAFALQQQKGNIMELVDP  758

Query  179  RLGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            +LG+++ K+E LRMIK+ALLCTN SP +RP MS V+SMLEG
Sbjct  759  KLGTDYKKEEVLRMIKIALLCTNPSPAVRPVMSEVLSMLEG  799



>ref|XP_010655585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=861

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KAD+YSFG+VALEI++GKNN  +  +    CLLD A VLQ++G+LME +DP+
Sbjct  714  ALWGYLTNKADIYSFGVVALEIVSGKNNTSYKPENECVCLLDLAFVLQQRGSLMEIVDPK  773

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH  304
            LGS F++DEA RMIKVALLCTN SP LRP+MSAVVSMLEG 
Sbjct  774  LGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEGQ  814



>ref|XP_010665669.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Beta vulgaris subsp. vulgaris]
Length=858

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVL-QRKGNLMEFIDP  178
            ALWGYLT+KADVYSFG+ ALEI+AG++N     D+NYFCLLDWA  L Q+KGN+ME +DP
Sbjct  695  ALWGYLTYKADVYSFGVFALEIVAGRSNTNFKPDDNYFCLLDWAFALQQQKGNIMELVDP  754

Query  179  RLGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            +LG+++ K+E LRMIK+ALLCTN SP +RP MS V+SMLEG
Sbjct  755  KLGTDYKKEEVLRMIKIALLCTNPSPAVRPVMSEVLSMLEG  795



>ref|XP_010665665.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1000

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVL-QRKGNLMEFIDP  178
            ALWGYLT+KADVYSFG+ ALEI+AG++N     D+NYFCLLDWA  L Q+KGN+ME +DP
Sbjct  837  ALWGYLTYKADVYSFGVFALEIVAGRSNTNFKPDDNYFCLLDWAFALQQQKGNIMELVDP  896

Query  179  RLGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            +LG+++ K+E LRMIK+ALLCTN SP +RP MS V+SMLEG
Sbjct  897  KLGTDYKKEEVLRMIKIALLCTNPSPAVRPVMSEVLSMLEG  937



>ref|XP_010665667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVL-QRKGNLMEFIDP  178
            ALWGYLT+KADVYSFG+ ALEI+AG++N     D+NYFCLLDWA  L Q+KGN+ME +DP
Sbjct  813  ALWGYLTYKADVYSFGVFALEIVAGRSNTNFKPDDNYFCLLDWAFALQQQKGNIMELVDP  872

Query  179  RLGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            +LG+++ K+E LRMIK+ALLCTN SP +RP MS V+SMLEG
Sbjct  873  KLGTDYKKEEVLRMIKIALLCTNPSPAVRPVMSEVLSMLEG  913



>ref|XP_010665666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=999

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVL-QRKGNLMEFIDP  178
            ALWGYLT+KADVYSFG+ ALEI+AG++N     D+NYFCLLDWA  L Q+KGN+ME +DP
Sbjct  836  ALWGYLTYKADVYSFGVFALEIVAGRSNTNFKPDDNYFCLLDWAFALQQQKGNIMELVDP  895

Query  179  RLGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            +LG+++ K+E LRMIK+ALLCTN SP +RP MS V+SMLEG
Sbjct  896  KLGTDYKKEEVLRMIKIALLCTNPSPAVRPVMSEVLSMLEG  936



>ref|XP_010272760.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Nelumbo nucifera]
Length=983

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 96/127 (76%), Gaps = 2/127 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++G++N      E    LLDWAL+L+ +GNLM+ +DPR
Sbjct  810  AMKGYLTDKADVYSFGVVALEIVSGRSNTSFRLKEECVDLLDWALILKERGNLMDLVDPR  869

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            LGS+FDK E +RMI VALLCTN+SP LRP+MSAVVSMLEG   I E+   P+ DE   +A
Sbjct  870  LGSDFDKGEVMRMINVALLCTNSSPALRPAMSAVVSMLEGGAIIQEFVSQPSYDESRYKA  929

Query  356  MNDHYDE  376
            + +H+ +
Sbjct  930  IQNHFQQ  936



>ref|XP_010655584.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=975

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KAD+YSFG+VALEI++GKNN  +  +    CLLD A VLQ++G+LME +DP+
Sbjct  828  ALWGYLTNKADIYSFGVVALEIVSGKNNTSYKPENECVCLLDLAFVLQQRGSLMEIVDPK  887

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH  304
            LGS F++DEA RMIKVALLCTN SP LRP+MSAVVSMLEG 
Sbjct  888  LGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEGQ  928



>ref|XP_004309629.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=710

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 92/129 (71%), Gaps = 12/129 (9%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG LT+KADVYSFG+VALEI++GKNN+K+   EN  CL+DWA VL +KGNL+E +D R
Sbjct  542  ALWGCLTYKADVYSFGVVALEIVSGKNNMKYRPHENIQCLMDWAHVLHKKGNLLELVDQR  601

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            LGS+F K EALR IKVALLC N +  LRP MSAVVSMLEG   + E   DP++       
Sbjct  602  LGSDFKKKEALRTIKVALLCANPTAALRPIMSAVVSMLEGRTPVDEVALDPSI-------  654

Query  356  MNDHYDEMA  382
               H DEM 
Sbjct  655  ---HGDEMT  660



>ref|XP_010655583.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=988

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KAD+YSFG+VALEI++GKNN  +  +    CLLD A VLQ++G+LME +DP+
Sbjct  841  ALWGYLTNKADIYSFGVVALEIVSGKNNTSYKPENECVCLLDLAFVLQQRGSLMEIVDPK  900

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH  304
            LGS F++DEA RMIKVALLCTN SP LRP+MSAVVSMLEG 
Sbjct  901  LGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEGQ  941



>ref|XP_010655590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=865

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+V LEI++GKNN  +  D    CLLDWA VL++KG+LME +DP 
Sbjct  710  ALWGYLTDKADVYSFGVVTLEIVSGKNNSNYTPDTTCTCLLDWAFVLKQKGSLMELVDPN  769

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F+K EA  MIKVALLCTN S  LRP+MSAV+ MLEG D I E   DP++   +   
Sbjct  770  LGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDIIPEVISDPSIYGKDMRI  829

Query  350  QAMNDHYDEMAVGS  391
              + DHY  M + S
Sbjct  830  SPLRDHYQHMEMQS  843



>ref|XP_010655588.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=1006

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+V LEI++GKNN  +  D    CLLDWA VL++KG+LME +DP 
Sbjct  851  ALWGYLTDKADVYSFGVVTLEIVSGKNNSNYTPDTTCTCLLDWAFVLKQKGSLMELVDPN  910

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F+K EA  MIKVALLCTN S  LRP+MSAV+ MLEG D I E   DP++   +   
Sbjct  911  LGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDIIPEVISDPSIYGKDMRI  970

Query  350  QAMNDHYDEMAVGS  391
              + DHY  M + S
Sbjct  971  SPLRDHYQHMEMQS  984



>ref|XP_010655589.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=999

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+V LEI++GKNN  +  D    CLLDWA VL++KG+LME +DP 
Sbjct  851  ALWGYLTDKADVYSFGVVTLEIVSGKNNSNYTPDTTCTCLLDWAFVLKQKGSLMELVDPN  910

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            LG+ F+K EA  MIKVALLCTN S  LRP+MSAV+ MLEG D I E   DP++   +   
Sbjct  911  LGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDIIPEVISDPSIYGKDMRI  970

Query  350  QAMNDHYDEMAVGS  391
              + DHY  M + S
Sbjct  971  SPLRDHYQHMEMQS  984



>ref|XP_010655582.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=1001

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 96/130 (74%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KAD+YSFG+VALEI++GKNN     +    CLLD A  LQ+KG+LME +DP+
Sbjct  819  ALWGHLTDKADIYSFGVVALEIVSGKNNSSRKPENECVCLLDRAFALQQKGSLMEIVDPK  878

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDE--FNS  349
            LGS F++DEA RMIKVA+LCTN SP LRP MSAVVSMLEG   + E   D ++DE   N 
Sbjct  879  LGSEFNRDEAERMIKVAILCTNASPTLRPIMSAVVSMLEGQTIVPEVISDASMDEDYLNF  938

Query  350  QAMNDHYDEM  379
            +++ D++  M
Sbjct  939  KSLGDYHKRM  948



>gb|AAL73330.1| putative receptor-like protein kinase RLPK1 [Glycine max]
Length=225

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E +  LLDWA VLQ +GNL+E +DP 
Sbjct  46   AMRGYLTDKADVYSFGVVALEIVSGKSNANYRPKEEFVYLLDWAYVLQEQGNLLELVDPS  105

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGS +  +EA+RM+++ALLCTN SP LRPSMS+VVSMLEG   I
Sbjct  106  LGSKYSSEEAMRMLQLALLCTNPSPTLRPSMSSVVSMLEGKTPI  149



>ref|XP_004295405.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=1351

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 93/129 (72%), Gaps = 12/129 (9%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG LT+KADVYSFG+VALE ++GKNN+K+   EN  CL+DWA VL +KGNL+E +DPR
Sbjct  808  ALWGCLTYKADVYSFGVVALETVSGKNNMKYRPHENIQCLMDWAHVLHKKGNLLELVDPR  867

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            LGS+F+K EALR IKVALLC N +  LRP MSAVVSMLEG   + E   DP++       
Sbjct  868  LGSDFNKKEALRTIKVALLCANPTAALRPIMSAVVSMLEGRTPVDEVALDPSI-------  920

Query  356  MNDHYDEMA  382
               H DEM 
Sbjct  921  ---HGDEMT  926



>ref|XP_010095160.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXC41541.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=179

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 90/137 (66%), Gaps = 14/137 (10%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E +  LLDWA V Q +GNL+E +DP 
Sbjct  6    AMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWAYVQQEQGNLLELVDPS  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDIL---------EYDPNL  334
            LGS + K+EA+RM+ +ALLCTN SP LRP+MS+VVSMLEG   +          E DP  
Sbjct  66   LGSKYSKEEAMRMLNIALLCTNPSPTLRPTMSSVVSMLEGKIPVQALLAKRSSSEQDPRF  125

Query  335  DEF-----NSQAMNDHY  370
              F     +SQ  N  Y
Sbjct  126  KAFEKLTHDSQTDNSSY  142



>ref|XP_011046351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Populus euphratica]
Length=1022

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 98/136 (72%), Gaps = 4/136 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            AL+G LT KADVYSFGIVALEI+AG +N+    +E++ CLLDWAL LQ+ G++ME +DPR
Sbjct  859  ALYGRLTSKADVYSFGIVALEIVAGMSNMSFQHNESFVCLLDWALSLQQNGDIMELVDPR  918

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNL--DEFNS  349
            LGS+F K EA RMIKV LLCTN SP LRP+MSAVV MLEG  D+ E   DP+   D    
Sbjct  919  LGSDFKKKEAARMIKVTLLCTNQSPALRPTMSAVVRMLEGKGDVQELVVDPSTFGDSLRF  978

Query  350  QAMNDHYDEMAVGSRD  397
            ++   + D+ +V S D
Sbjct  979  KSFQGNSDQSSVLSID  994



>ref|XP_004491049.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cicer arietinum]
Length=167

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEI+ GKNN      E  F LLDWA +L+ KG+L+E +D R
Sbjct  6    AMHGYLTDKADVYSFGIVALEIIHGKNNTTIRQKEEAFHLLDWAHLLKEKGDLIELVDKR  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI----LEYDPNLDEFNS  349
            LG+NF+K+EA+ MI VALLCTN +  LRP+MS+VVSMLEG  DI     E     DE   
Sbjct  66   LGTNFNKEEAMVMINVALLCTNVTSNLRPAMSSVVSMLEGTIDIQEVFTESSEVSDEKKM  125

Query  350  QAMNDHYDEMAV  385
            +AM  +Y E ++
Sbjct  126  EAMRQYYQEHSI  137



>ref|XP_010655580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1038

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 96/130 (74%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KAD+YSFG+VALEI++GKNN     +    CLLD A  LQ+KG+LME +DP+
Sbjct  856  ALWGHLTDKADIYSFGVVALEIVSGKNNSSRKPENECVCLLDRAFALQQKGSLMEIVDPK  915

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDE--FNS  349
            LGS F++DEA RMIKVA+LCTN SP LRP MSAVVSMLEG   + E   D ++DE   N 
Sbjct  916  LGSEFNRDEAERMIKVAILCTNASPTLRPIMSAVVSMLEGQTIVPEVISDASMDEDYLNF  975

Query  350  QAMNDHYDEM  379
            +++ D++  M
Sbjct  976  KSLGDYHKRM  985



>ref|XP_010655581.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=1009

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 96/130 (74%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KAD+YSFG+VALEI++GKNN     +    CLLD A  LQ+KG+LME +DP+
Sbjct  827  ALWGHLTDKADIYSFGVVALEIVSGKNNSSRKPENECVCLLDRAFALQQKGSLMEIVDPK  886

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDE--FNS  349
            LGS F++DEA RMIKVA+LCTN SP LRP MSAVVSMLEG   + E   D ++DE   N 
Sbjct  887  LGSEFNRDEAERMIKVAILCTNASPTLRPIMSAVVSMLEGQTIVPEVISDASMDEDYLNF  946

Query  350  QAMNDHYDEM  379
            +++ D++  M
Sbjct  947  KSLGDYHKRM  956



>gb|KHG23496.1| putative LRR receptor-like serine/threonine-protein kinase RFK1 
[Gossypium arboreum]
Length=746

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 93/126 (74%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFGIVALE+++GK+N+ +   + Y CLLDWA  LQ+ G L+E +D +
Sbjct  582  ALWGYLTYKADVYSFGIVALELVSGKHNMNYGPVDEYTCLLDWACHLQQSGKLLELVDDK  641

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNS----  349
            LGSN++K EA RMIKVALLCTN SP LRP+MS VV MLEG   I +  PN   +N     
Sbjct  642  LGSNYNKSEAERMIKVALLCTNASPSLRPTMSDVVGMLEGTITIPDVIPNACSYNEDLRF  701

Query  350  QAMNDH  367
            +A+ DH
Sbjct  702  KAIRDH  707



>emb|CAE54078.1| receptor-like protein kinase [Fagus sylvatica]
Length=217

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEI++GK+N  +   E +  LLDWA VLQ +GNL+E +DPR
Sbjct  49   AMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNLLELVDPR  108

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            LGS++  +EA+RM+ +ALLCTN SP LRP MS+VVSM+EG
Sbjct  109  LGSSYSSEEAMRMLNLALLCTNPSPTLRPQMSSVVSMIEG  148



>gb|KCW48261.1| hypothetical protein EUGRSUZ_K019901, partial [Eucalyptus grandis]
Length=173

 Score =   140 bits (354),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 93/135 (69%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      E  F LLDWA  L+ +GNL+E +DPR
Sbjct  8    AMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKTEECFILLDWAHFLKERGNLIELVDPR  67

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+E L +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  68   LGSDFDKEEVLALIKVALMCTNVTPALRPLMSSVVSMLEGKVAVPVLDSAGAIMTEEKIE  127

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  128  AMRKHFSGDEHQAVG  142



>gb|KCW67603.1| hypothetical protein EUGRSUZ_F013601, partial [Eucalyptus grandis]
Length=168

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 90/129 (70%), Gaps = 3/129 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALE+++G++N  +   E  F LLDWA VL+++GNLM+ +D R
Sbjct  8    AMHGYLTEKADVYSFGVVALEVVSGRSNTSYQKKEKCFYLLDWARVLKKRGNLMDLVDQR  67

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FD+ E L MI VALLCTN +P LRP MS+V+SMLEG   +   D     + E   +
Sbjct  68   LGSHFDEKEVLAMINVALLCTNATPALRPPMSSVISMLEGKVVVPLLDSEDTIITEETIE  127

Query  353  AMNDHYDEM  379
            AM  H+  M
Sbjct  128  AMRKHFKSM  136



>ref|XP_006388874.1| hypothetical protein POPTR_0084s00200g [Populus trichocarpa]
 gb|ERP47788.1| hypothetical protein POPTR_0084s00200g [Populus trichocarpa]
Length=177

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 93/128 (73%), Gaps = 5/128 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYL+ KADVYSFGIVALEI++GK+N  H + E+   LLDWALVL+ KG L+E +DP+
Sbjct  6    AMRGYLSDKADVYSFGIVALEIVSGKSNTSHRTKEDTVYLLDWALVLKEKGTLLELVDPK  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH---DDILEYDPNL--DEFN  346
            LG +++K+EA+ MI VALLC+N S  +RP+MS+VVSMLEG     DI   D ++  DE  
Sbjct  66   LGQDYNKEEAITMINVALLCSNVSAAVRPAMSSVVSMLEGKAVVQDIGIPDKSMSTDEKK  125

Query  347  SQAMNDHY  370
             + M  H+
Sbjct  126  IEQMRRHF  133



>gb|KHN36927.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=506

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 96/127 (76%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  H S +    LLDWA +L+ KGNLME +D R
Sbjct  333  AMHGYLTDKADVYSFGVVALEIVSGKSNTIHRSKQEALHLLDWAHLLKEKGNLMELVDRR  392

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPN--LDEFNS  349
            LGS+F+++E + MIKVALLCTNT+  LRP+MS+V+SMLEG   I E+  DP+  +DE   
Sbjct  393  LGSDFNENEVMMMIKVALLCTNTTSNLRPTMSSVLSMLEGKTMIPEFVSDPSEIMDEMKL  452

Query  350  QAMNDHY  370
            +AM  HY
Sbjct  453  EAMRQHY  459



>ref|XP_002522276.1| kinase, putative [Ricinus communis]
 gb|EEF40134.1| kinase, putative [Ricinus communis]
Length=2046

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KAD+YSFGIVALEI++GK+N+    + N+ CLLDWA  LQ+ G LME +D +
Sbjct  828  ALWGYLTYKADIYSFGIVALEIVSGKHNMSRGPESNFGCLLDWACHLQQGGKLMELVDEK  887

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNS----  349
            LGS F K EA RMIKVALLCTN S  LRP MS VVSMLEG   I +  P    +N     
Sbjct  888  LGSEFKKVEAERMIKVALLCTNGSASLRPIMSEVVSMLEGTKTIPDVIPEESSYNEDLRF  947

Query  350  QAMNDHYDEMAVGSRDFPNKVDLSS  424
            +A+ +H+ E+   S    N    SS
Sbjct  948  KAIREHHKEIRSQSLRSQNHTSTSS  972


 Score =   149 bits (375),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  2     ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
             ALWGYLT+KADVYSFGIVALEI++G+NN+    +  + CLLDWA  LQ+ GNLME +D +
Sbjct  1886  ALWGYLTYKADVYSFGIVALEIVSGRNNMNRGPESKFTCLLDWACQLQKCGNLMELVDEK  1945

Query  182   LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH----DDILEYDPNLDEFNS  349
             LGS F+K EA RMIKVALLCTN +P +RP+MS VV MLEG     D I     N ++   
Sbjct  1946  LGSEFNKAEAERMIKVALLCTNDTPSVRPTMSEVVGMLEGTRFVPDVIANESNNTEDLRF  2005

Query  350   QAMNDHYDEMA  382
             + + DH   M 
Sbjct  2006  KIIRDHLKSMT  2016



>ref|XP_010064500.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Eucalyptus grandis]
Length=138

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N   +  E  F LL+WA VL+ +GNLM+ +D R
Sbjct  13   AMHGYLTEKADIYSFGIVALEVVSGRSNNTSYQKEKCFYLLNWARVLKERGNLMDLVDQR  72

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FD+ E L MIKVALLCTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  73   LGSHFDEKEVLAMIKVALLCTNATPALRPPMSSVVSMLEGKAAVPVLDSEGAIITEETIE  132

Query  353  AMNDHY  370
            AM  H+
Sbjct  133  AMRKHF  138



>ref|XP_011039371.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 [Populus euphratica]
Length=1037

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG LT+KADVYSFGIVALEIL+GKNN+    +  Y CLLDWA  L+R GNL+E +D +
Sbjct  831  ALWGRLTYKADVYSFGIVALEILSGKNNMSCGPENQYSCLLDWACHLERNGNLIELVDRK  890

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDP  328
            LGS F+K EA RMIKVALLCTN SP+LRP MS VVSMLEG   I E  P
Sbjct  891  LGSEFNKVEAQRMIKVALLCTNASPLLRPIMSEVVSMLEGTRIIPEVIP  939



>ref|XP_007149541.1| hypothetical protein PHAVU_005G078900g [Phaseolus vulgaris]
 gb|ESW21535.1| hypothetical protein PHAVU_005G078900g [Phaseolus vulgaris]
Length=982

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIV LEI+ GKNN+ H   E  F +LDWA +L++KG+LME +D R
Sbjct  823  AMHGYLTDKADVYSFGIVVLEIVNGKNNIIHRQKEESFSILDWAHLLKQKGDLMELVDRR  882

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH----DDILEYDPNLDEFNS  349
            LGS F+K+EAL MIKVALLCT  +  LRP+MSAVVSMLEG     + + E    LDE   
Sbjct  883  LGSEFNKEEALVMIKVALLCTQVTTTLRPTMSAVVSMLEGRNVVEEVVTETSEVLDEKRM  942

Query  350  QAMNDHYDEMAV  385
            +AM  +Y E+++
Sbjct  943  EAMRQYYHELSI  954



>gb|KHN38783.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=296

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N K+   E +  LLDWA VLQ +GNL+E +DP 
Sbjct  123  AMRGYLTDKADVYSFGVVALEIVSGKSNTKYRPKEEFVYLLDWAYVLQEQGNLLELVDPS  182

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            LGS +  +EA+RM+ +ALLCTN SP LRP+MS+VVSMLEG
Sbjct  183  LGSKYSPEEAMRMLSLALLCTNPSPTLRPTMSSVVSMLEG  222



>ref|XP_006371021.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
 gb|ERP48818.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
Length=620

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 86/121 (71%), Gaps = 17/121 (14%)
 Frame = +2

Query  2    ALWGYLTFKADVYS-----------------FGIVALEILAGKNNVKHHSDENYFCLLDW  130
            AL+GYLT+KADVYS                 FG+VALEI++G NNVK   DEN+ CLLD 
Sbjct  436  ALYGYLTYKADVYSFGVVALEIVSYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLDR  495

Query  131  ALVLQRKGNLMEFIDPRLGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDD  310
            AL LQ+ G++ME +DPRLGS F+K E +RMI VALLCTN SP LRP+MS VVSMLEG  D
Sbjct  496  ALYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKTD  555

Query  311  I  313
            +
Sbjct  556  V  556



>gb|KCW67580.1| hypothetical protein EUGRSUZ_F01336 [Eucalyptus grandis]
Length=193

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 3/126 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N  +   E  F LLDWA VL+ +GNLM+ +D R
Sbjct  20   AMHGYLTEKADIYSFGIVALEVVSGRSNTSYQKKEKCFYLLDWARVLKGRGNLMDLVDQR  79

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK E L MI VALLCTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  80   LGSHFDKKEVLAMINVALLCTNATPALRPPMSSVVSMLEGKVAVPVLDSEGTIITEETIE  139

Query  353  AMNDHY  370
            AM  H+
Sbjct  140  AMRKHF  145



>gb|KCW67550.1| hypothetical protein EUGRSUZ_F013052, partial [Eucalyptus grandis]
Length=337

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 88/131 (67%), Gaps = 9/131 (7%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+V LEI++GK+N  +   E +  LLDWA VLQ +GN +E +DPR
Sbjct  158  AMRGYLTDKADVYSFGVVTLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNFLELVDPR  217

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI---------LEYDPNL  334
            LGSN+ ++EA+RM+ +ALLCTN SP LRP+MS+VVSMLEG   I            DP  
Sbjct  218  LGSNYSEEEAMRMLNLALLCTNPSPTLRPAMSSVVSMLEGKGAIQAPIIKRAATNLDPRF  277

Query  335  DEFNSQAMNDH  367
              F+  A N  
Sbjct  278  RAFDRLANNSQ  288



>ref|XP_006377472.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
 gb|ERP55269.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
Length=582

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++GK+N  +  +    CLLDWA VLQ+KGNLME +DP+
Sbjct  449  ALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCLLDWAHVLQKKGNLMEIVDPK  508

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLE  298
            L S F+K+EA RMIK ALLCTN SP LRP+MS VVSML+
Sbjct  509  LQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVVSMLK  547



>ref|XP_010246509.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1013

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 91/127 (72%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEI++GK+N           LLDWAL+L+ KG LM+ +D R
Sbjct  841  AMRGYLTDKADVYSFGIVALEIVSGKSNTSFRPKGESVYLLDWALILKEKGKLMDLVDIR  900

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNL----DEFNS  349
            LGS FDK+E +RMI VALLCTNTS  LRP+MSAVVSMLEG   I E+ P+     DE   
Sbjct  901  LGSEFDKEEVMRMINVALLCTNTSSTLRPAMSAVVSMLEGQAAIQEFVPDSSITDDEVRY  960

Query  350  QAMNDHY  370
            +A+ DH+
Sbjct  961  KAIQDHF  967



>ref|XP_006847775.1| hypothetical protein AMTR_s00162p00056910 [Amborella trichopoda]
 gb|ERN09356.1| hypothetical protein AMTR_s00162p00056910 [Amborella trichopoda]
Length=559

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEI++GK+N  +   E    LLDWA VLQ KG+L+E +DP 
Sbjct  374  AMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEECVYLLDWAYVLQEKGSLLELVDPE  433

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGSN+ KDEAL+M+ V LLCTN SP LRPSMSAVVSMLEG+ ++
Sbjct  434  LGSNYSKDEALKMLNVGLLCTNPSPTLRPSMSAVVSMLEGNANV  477



>gb|KCW67582.1| hypothetical protein EUGRSUZ_F01341 [Eucalyptus grandis]
Length=301

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALE+++G++N  +   E  F LLDWA VL+ +GNLM+ +D R
Sbjct  128  AMHGYLTEKADVYSFGVVALEVVSGRSNTSYQKKEKCFYLLDWARVLKERGNLMDLVDQR  187

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FD+ E L MIKVALLCTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  188  LGSHFDEKEVLAMIKVALLCTNVTPALRPPMSSVVSMLEGKAAVPVLDSEGAIITEETIE  247

Query  353  AMNDHY  370
            AM  H+
Sbjct  248  AMRKHF  253



>ref|XP_010060741.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=193

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 89/126 (71%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++ ++N+ +   E  F LLDWA VL+ +GNLM+ +D R
Sbjct  20   AMHGYLTEKADIYSFGIVALEVVSDRSNISYQKKEKCFYLLDWARVLKERGNLMDLVDQR  79

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNSQAMN  361
            LGS+FD+ E L MIKVALLCTN +P LRP MS+VVSMLEG   +    P LD   +  M 
Sbjct  80   LGSHFDEKEVLAMIKVALLCTNATPALRPPMSSVVSMLEGKAAV----PMLDSEAAIIME  135

Query  362  DHYDEM  379
            +  + M
Sbjct  136  ETIEAM  141



>ref|XP_006442308.1| hypothetical protein CICLE_v10024314mg, partial [Citrus clementina]
 gb|ESR55548.1| hypothetical protein CICLE_v10024314mg, partial [Citrus clementina]
Length=925

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEI++G++NV   + E  FCLLDWALVL+ +G+LME +DP 
Sbjct  750  AMRGYLTDKADVYSFGIVALEIVSGRSNVICRTKEAQFCLLDWALVLKEQGHLMELVDPH  809

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDP-----NLDEFN  346
            LGSNF +++ + MI VALLC + SP  RP MS+VVSMLEG   + ++ P     N+DE  
Sbjct  810  LGSNFVEEQVMVMINVALLCADVSPTNRPLMSSVVSMLEGRVAVPDFIPDSSISNMDETK  869

Query  347  SQAMNDHYD  373
            SQAM  +Y 
Sbjct  870  SQAMRKYYQ  878



>ref|XP_010041838.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=607

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 95/150 (63%), Gaps = 11/150 (7%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+V LEI++GK+N  +   E +  LLDWA VLQ +GN++E +DPR
Sbjct  428  AMRGYLTDKADVYSFGVVTLEIVSGKSNTNYRPKEEFVYLLDWAYVLQERGNVLELVDPR  487

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI---------LEYDPNL  334
            LGSN+ ++EA+RM+ +ALLCTN SP LRP MS+VVSMLEG   I            DP  
Sbjct  488  LGSNYSEEEAMRMLNLALLCTNPSPTLRPPMSSVVSMLEGKGAIQAPIIKRAATNLDPRF  547

Query  335  DEFNSQAMNDHYDEMAVG--SRDFPNKVDL  418
              F+  A N   + +     +R  P  + L
Sbjct  548  RAFDRLANNSQTNVLTFSHDTRQVPGSMSL  577



>ref|XP_010094305.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB55701.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=363

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E++  LLDWA VLQ +GNL+E +DP 
Sbjct  195  AMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEDFVYLLDWAYVLQERGNLLELVDPA  254

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNLDEFNSQ  352
            LGS +  +EA+ M+ VALLCTN SP LRP+MS VVSMLEG  ++  L  DP     NS+
Sbjct  255  LGSEYLSEEAILMLNVALLCTNASPTLRPTMSQVVSMLEGRTEVQDLLSDPGFSSMNSR  313



>emb|CAN73789.1| hypothetical protein VITISV_025000 [Vitis vinifera]
Length=667

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI++GK+N  +    +  CLLDWA  LQ+ G++ME +D +
Sbjct  448  ALWGYLTYKADVYSFGVVALEIVSGKHNXSYXPKNDCACLLDWACXLQQSGDIMELVDQK  507

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFN  346
            LGS F+K EA RMIKVALLCTN SP LRP+MS  VSMLEG   I +  P    ++
Sbjct  508  LGSEFNKKEAERMIKVALLCTNASPSLRPNMSEAVSMLEGITTIPDAIPEAGSYS  562



>emb|CBI30739.3| unnamed protein product [Vitis vinifera]
Length=839

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI++GK+N+ +    +  CLLDWA  LQ+ G++ME +D +
Sbjct  558  ALWGYLTYKADVYSFGVVALEIVSGKHNMSYQPKNDCACLLDWACSLQQSGDIMELVDQK  617

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFN  346
            LGS F+K EA RMIKVALLCTN SP LRP+MS  VSMLEG   I +  P    ++
Sbjct  618  LGSEFNKKEAERMIKVALLCTNASPSLRPNMSEAVSMLEGITTIPDAIPEAGSYS  672



>emb|CDY35291.1| BnaC03g59320D [Brassica napus]
Length=180

 Score =   135 bits (340),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  5    LWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPRL  184
            LWG LT KADVYSFG+VA+EI++GK+N KH    ++  L+DWAL L +KGN++E +DP L
Sbjct  7    LWGQLTEKADVYSFGVVAMEIVSGKSNTKHKGTADHLSLIDWALSLHQKGNILEVVDPIL  66

Query  185  GSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
              +FD+ EA+RMI VAL+CTN+SP LRP+MS  + MLEG
Sbjct  67   EGHFDRKEAVRMINVALVCTNSSPALRPTMSEAMKMLEG  105



>ref|XP_006377527.1| hypothetical protein POPTR_0011s067102g, partial [Populus trichocarpa]
 gb|ERP55324.1| hypothetical protein POPTR_0011s067102g, partial [Populus trichocarpa]
Length=225

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHH-SDENYFCLLDWALVLQRKGNLMEFIDP  178
            ALWGYLT KADVYSFG+VALEI++GKNN  +  S+ +  CLLDWA  LQ+ G+ +E +D 
Sbjct  57   ALWGYLTDKADVYSFGVVALEIISGKNNNNYMPSNSSCVCLLDWACHLQQSGSFIELVDE  116

Query  179  RLGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNS---  349
             LGS  + +EA  M+KVALLCTN SP LRP+MS VVSMLEG   + +  P L  +N    
Sbjct  117  TLGSEVNIEEAETMVKVALLCTNASPTLRPTMSEVVSMLEGRMAVPDTRPELSSYNEDLR  176

Query  350  -QAMND  364
             +AM D
Sbjct  177  FKAMRD  182



>ref|XP_010655556.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Vitis vinifera]
Length=1067

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI++GK+N+ +    +  CLLDWA  LQ+ G++ME +D +
Sbjct  848  ALWGYLTYKADVYSFGVVALEIVSGKHNMSYQPKNDCACLLDWACSLQQSGDIMELVDQK  907

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFN  346
            LGS F+K EA RMIKVALLCTN SP LRP+MS  VSMLEG   I +  P    ++
Sbjct  908  LGSEFNKKEAERMIKVALLCTNASPSLRPNMSEAVSMLEGITTIPDAIPEAGSYS  962



>ref|XP_010655557.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Vitis vinifera]
Length=1060

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFG+VALEI++GK+N+ +    +  CLLDWA  LQ+ G++ME +D +
Sbjct  841  ALWGYLTYKADVYSFGVVALEIVSGKHNMSYQPKNDCACLLDWACSLQQSGDIMELVDQK  900

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFN  346
            LGS F+K EA RMIKVALLCTN SP LRP+MS  VSMLEG   I +  P    ++
Sbjct  901  LGSEFNKKEAERMIKVALLCTNASPSLRPNMSEAVSMLEGITTIPDAIPEAGSYS  955



>gb|KCW78573.1| hypothetical protein EUGRSUZ_C00047 [Eucalyptus grandis]
Length=179

 Score =   135 bits (340),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      E  F LL+WA  L+ +  L+E +DPR
Sbjct  6    AMHGYLTDKADIYSFGIVALEVVSGRSNTSSQKTEECFILLNWAHFLKERETLIELVDPR  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FD++EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  66   LGSHFDREEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEEKIE  125

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  126  AMRKHFRGDEHQAVG  140



>gb|KCW67556.1| hypothetical protein EUGRSUZ_F01306 [Eucalyptus grandis]
Length=914

 Score =   144 bits (363),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 73/141 (52%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E +  LLDWA VLQ +GN++E +DPR
Sbjct  735  AMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWACVLQEQGNVLELVDPR  794

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI---------LEYDPNL  334
            LGS++ K+EA+RM+ +ALLCTN SP LRP MS+VVSMLEG   I            DP  
Sbjct  795  LGSDYSKEEAMRMLNLALLCTNLSPTLRPPMSSVVSMLEGKGAIQAPIIKRTATNPDPRF  854

Query  335  DEFNSQAMNDHYDEMAVGSRD  397
              F+  A ND    ++  S+D
Sbjct  855  RAFDRLA-NDSQTTLSTFSQD  874



>ref|XP_010272675.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Nelumbo nucifera]
Length=162

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  11   GYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPRLGS  190
            GYLT KADVYSFG+V LEI++GK+N  +   E++  LLDW  VL+ +GNL+E +DP L S
Sbjct  3    GYLTDKADVYSFGVVLLEIVSGKSNTSYRPKEDFVYLLDWTYVLEEQGNLLELVDPILES  62

Query  191  NFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            N+ K+EALRM+ +ALLCTN SP LRP+MSAVVSM+EG
Sbjct  63   NYSKEEALRMLNLALLCTNPSPTLRPAMSAVVSMIEG  99



>ref|XP_007025275.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
 gb|EOY27897.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
Length=995

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFGIVALEI++GK+N+ +  D+ + CLLDWA  LQ+ G L+E +D +
Sbjct  829  ALWGYLTYKADVYSFGIVALEIVSGKHNMNYGPDDKHTCLLDWACHLQQSGKLLELVDNQ  888

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNS----  349
            LGS ++K EA  MIKVALLCTN SP LRP+MS VV MLEG   I +  PN   ++     
Sbjct  889  LGSEYNKSEAEGMIKVALLCTNASPSLRPTMSQVVEMLEGTIAIPDAVPNASSYSEDLRF  948

Query  350  QAMNDH  367
            + + DH
Sbjct  949  KVIRDH  954



>ref|XP_007149532.1| hypothetical protein PHAVU_005G078100g [Phaseolus vulgaris]
 gb|ESW21526.1| hypothetical protein PHAVU_005G078100g [Phaseolus vulgaris]
Length=690

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI+ GK N  H   +    LLDWA +++ KGNLME +D R
Sbjct  517  AMHGYLTDKADVYSFGVVALEIVTGKTNTIHRPKQEALLLLDWAHLVKEKGNLMELVDRR  576

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN----LDEFNS  349
            LGSNF++ E + MIKV LLCTNT+  LRPSMS+V+SMLEG   I E+  +    +DE   
Sbjct  577  LGSNFNEKEVMMMIKVGLLCTNTTANLRPSMSSVLSMLEGKTVIPEFISDSSEVMDEMKL  636

Query  350  QAMNDHYDEMAVGSRDFPNKVDLSS  424
            +AM  +Y +M    R   +    SS
Sbjct  637  EAMRQYYSQMEENERSETHTTHSSS  661



>ref|XP_010272742.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=954

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 100/145 (69%), Gaps = 4/145 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LTFKADVYSFG+VALEI++G+ N  +    +  CLLDWA +LQ++ +L+E +DPR
Sbjct  787  ALWGHLTFKADVYSFGVVALEIVSGRTNSTYRPKSDCTCLLDWAFLLQKRESLLELVDPR  846

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNLDEFNSQ-  352
            LGS+F++ E  RMIKVALLC   SP LRPSMS VVSMLEG   I +   DP++   +S+ 
Sbjct  847  LGSDFNRQEVERMIKVALLCITASPTLRPSMSQVVSMLEGSMAIQDEISDPSISGEDSRF  906

Query  353  -AMNDHYDEMAVGSRDFPNKVDLSS  424
              + +++ +M +         +LSS
Sbjct  907  SGIREYFQQMILQDSSGAQTQNLSS  931



>ref|XP_006377598.1| hypothetical protein POPTR_0011s080251g, partial [Populus trichocarpa]
 gb|ERP55395.1| hypothetical protein POPTR_0011s080251g, partial [Populus trichocarpa]
Length=308

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 91/131 (69%), Gaps = 11/131 (8%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI + K+N  +  +    CLLDW       GNLME +DP+
Sbjct  171  ALWGYLTDKADVYSFGVVALEIFSVKSNSSYWPENENVCLLDW-------GNLMEIVDPK  223

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEFNS  349
            L S F+K+EA RMIK+ALLCTN SP LRP+MS VVSMLEG   I E   DP++  D+ +S
Sbjct  224  LQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTSIPEVTLDPSIYGDDLHS  283

Query  350  QAMNDHYDEMA  382
            + +  HY ++ 
Sbjct  284  KRVKGHYQQVT  294



>ref|XP_010272741.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nelumbo nucifera]
Length=1008

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 100/145 (69%), Gaps = 4/145 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LTFKADVYSFG+VALEI++G+ N  +    +  CLLDWA +LQ++ +L+E +DPR
Sbjct  841  ALWGHLTFKADVYSFGVVALEIVSGRTNSTYRPKSDCTCLLDWAFLLQKRESLLELVDPR  900

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE--YDPNLDEFNSQ-  352
            LGS+F++ E  RMIKVALLC   SP LRPSMS VVSMLEG   I +   DP++   +S+ 
Sbjct  901  LGSDFNRQEVERMIKVALLCITASPTLRPSMSQVVSMLEGSMAIQDEISDPSISGEDSRF  960

Query  353  -AMNDHYDEMAVGSRDFPNKVDLSS  424
              + +++ +M +         +LSS
Sbjct  961  SGIREYFQQMILQDSSGAQTQNLSS  985



>ref|XP_006847776.1| hypothetical protein AMTR_s00162p00057050, partial [Amborella 
trichopoda]
 gb|ERN09357.1| hypothetical protein AMTR_s00162p00057050, partial [Amborella 
trichopoda]
Length=326

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 84/116 (72%), Gaps = 7/116 (6%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDW-------ALVLQRKGNL  160
            A+ GYLT KADVYSFGIVALEI++GK+N  +   E+   LLDW       A VLQ KG+L
Sbjct  144  AMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEDCVYLLDWISICKLPAYVLQEKGSL  203

Query  161  MEFIDPRLGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDP  328
            +E +DP LGSN+ KDEAL+M+ V  LCTN SP LRPSMSAVVSMLEG+ ++    P
Sbjct  204  LELVDPELGSNYSKDEALKMLNVGFLCTNPSPTLRPSMSAVVSMLEGNANVQAPQP  259



>ref|XP_010313922.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Solanum lycopersicum]
Length=919

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+V LEI++GK+N  +   E +  LLDWA VLQ +GNL+E +DPR
Sbjct  737  AMRGYLTDKADVYSFGVVLLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNLLELVDPR  796

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH  304
            LG+N+ K EA+RMI V+LLCTN SP LRPSMS+VVSMLEG 
Sbjct  797  LGTNYSKKEAMRMINVSLLCTNPSPTLRPSMSSVVSMLEGK  837



>ref|XP_010112410.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXC33468.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=851

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 91/118 (77%), Gaps = 4/118 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++GK N  +    N  CLLD+A VLQ+KG+L++ +D +
Sbjct  649  ALWGYLTEKADVYSFGVVALEIVSGKCNTSYRPQNNCVCLLDYAFVLQKKGDLLQIMDEK  708

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL--DEF  343
            LGS F+++EA R+IK+ALLCTN SP LRP+MS VVSMLEG+  + E   DP +  DE+
Sbjct  709  LGSEFNEEEAKRIIKIALLCTNASPALRPTMSEVVSMLEGNTVVKELISDPGIYGDEY  766



>ref|XP_002317385.1| hypothetical protein POPTR_0011s06740g [Populus trichocarpa]
 gb|EEE97997.1| hypothetical protein POPTR_0011s06740g [Populus trichocarpa]
Length=1024

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG LT+KADVYSFGIVALEI++GK N+    +  Y CLLDWA  L+R GNL+E +D +
Sbjct  830  ALWGRLTYKADVYSFGIVALEIVSGKYNMSCGPENQYSCLLDWACHLERNGNLIELVDRK  889

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            LGS F+K EA RMIKVALLC N SP+LRP MS VVSMLEG   I E   +P  ++   +A
Sbjct  890  LGSEFNKVEAQRMIKVALLCANASPLLRPIMSEVVSMLEGTRIIPEVIPEPISEDLRFKA  949

Query  356  MNDHYDE  376
            +  H ++
Sbjct  950  IRGHQEQ  956



>gb|KCW48256.1| hypothetical protein EUGRSUZ_K01985 [Eucalyptus grandis]
Length=684

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      E  F LLDWA  L+ KGNL+E +DPR
Sbjct  511  AMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKPEECFILLDWAHFLKEKGNLIELVDPR  570

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  571  LGSHFDKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTEEKIE  630

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  631  AMRKHFRGDEHQAVG  645



>ref|XP_010036442.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Eucalyptus grandis]
Length=659

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      E  F LLDWA  L+ +GNL+E +DPR
Sbjct  491  AMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKTEECFILLDWAHFLKERGNLIELVDPR  550

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  551  LGSHFDKEEALALIKVALVCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEEKIE  610

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  611  AMRKHFRGDEHQAVG  625



>ref|XP_004251900.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Solanum lycopersicum]
 ref|XP_010313921.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Solanum lycopersicum]
Length=1018

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+V LEI++GK+N  +   E +  LLDWA VLQ +GNL+E +DPR
Sbjct  836  AMRGYLTDKADVYSFGVVLLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNLLELVDPR  895

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH  304
            LG+N+ K EA+RMI V+LLCTN SP LRPSMS+VVSMLEG 
Sbjct  896  LGTNYSKKEAMRMINVSLLCTNPSPTLRPSMSSVVSMLEGK  936



>gb|KEH28296.1| LRR receptor-like kinase [Medicago truncatula]
Length=864

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEIL G NN      E  F LLDWA +L+ KGN +E +D R
Sbjct  702  AMHGYLTDKADVYSFGIVALEILHGSNNTILRQKEEAFHLLDWAHILKEKGNEIELVDKR  761

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG----HDDILEYDPNLDEFNS  349
            LGSNF+K+EA+ MI VALLCTN +  LRP+MS+VVSMLEG     + +LE    LDE   
Sbjct  762  LGSNFNKEEAMLMINVALLCTNVTSSLRPAMSSVVSMLEGKIAIQELVLESSEVLDEKKM  821

Query  350  QAMNDHYDEMAV  385
            +AM  HY + ++
Sbjct  822  EAMRKHYQDQSI  833



>ref|XP_010060732.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=1011

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E +  LLDWA VLQ +GN++E +DPR
Sbjct  832  AMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWACVLQEQGNVLELVDPR  891

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI---------LEYDPNL  334
            LGS++ K+EA+RM+ +ALLCTN SP LRP MS+VVSMLEG   I            DP  
Sbjct  892  LGSDYSKEEAMRMLNLALLCTNLSPTLRPPMSSVVSMLEGKGAIQAPIIKRTATNPDPRF  951

Query  335  DEFNSQAMNDHYDEMAVGSRD  397
              F+  A ND    ++  S+D
Sbjct  952  RAFDRLA-NDSQTTLSTFSQD  971



>ref|XP_010036440.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Eucalyptus grandis]
Length=714

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      E  F LLDWA  L+ +GNL+E +DPR
Sbjct  546  AMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKTEECFILLDWAHFLKERGNLIELVDPR  605

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  606  LGSHFDKEEALALIKVALVCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEEKIE  665

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  666  AMRKHFRGDEHQAVG  680



>ref|XP_010036446.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=167

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 92/139 (66%), Gaps = 14/139 (10%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFG+VALE++ G++N      E  F LLDWA  L+   NL+E +DPR
Sbjct  6    AMHGYLTDKADIYSFGVVALEVVNGRSNTSSQRTEECFNLLDWAHFLKEGENLIELVDPR  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNS----  349
            LGS+F+K+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +    P LD   +    
Sbjct  66   LGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAV----PVLDSAGTIMTQ  121

Query  350  ---QAMNDHY---DEMAVG  388
               +AM  H+   +  AVG
Sbjct  122  EKIEAMKKHFRGDEHQAVG  140



>ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES99711.1| LRR receptor-like kinase [Medicago truncatula]
Length=996

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEIL G NN      E  F LLDWA +L+ KGN +E +D R
Sbjct  834  AMHGYLTDKADVYSFGIVALEILHGSNNTILRQKEEAFHLLDWAHILKEKGNEIELVDKR  893

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG----HDDILEYDPNLDEFNS  349
            LGSNF+K+EA+ MI VALLCTN +  LRP+MS+VVSMLEG     + +LE    LDE   
Sbjct  894  LGSNFNKEEAMLMINVALLCTNVTSSLRPAMSSVVSMLEGKIAIQELVLESSEVLDEKKM  953

Query  350  QAMNDHYDEMAV  385
            +AM  HY + ++
Sbjct  954  EAMRKHYQDQSI  965



>ref|XP_010064505.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=607

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALE+++G++N  +   E  F LLDWA VL+ +GNLM+ +D R
Sbjct  434  AMHGYLTEKADVYSFGVVALEVVSGRSNTSYQKKEKCFYLLDWARVLKERGNLMDLVDQR  493

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FD+ E L MIKVALLCTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  494  LGSHFDEKEVLAMIKVALLCTNVTPALRPPMSSVVSMLEGKAAVPVLDSEGAIITEETIE  553

Query  353  AMNDHY  370
            AM  H+
Sbjct  554  AMRKHF  559



>gb|ACM89476.1| leucine-rich repeat family protein / protein kinase family protein 
[Glycine max]
Length=631

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N K+   E +  LLDWA VLQ +GNL+E +DP 
Sbjct  458  AMRGYLTDKADVYSFGVVALEIVSGKSNTKYRPKEEFVYLLDWAYVLQEQGNLLELVDPN  517

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            LGS +  +EA+RM+ +ALLCTN SP LRP+MS+VVSMLEG
Sbjct  518  LGSKYSPEEAMRMLSLALLCTNPSPTLRPTMSSVVSMLEG  557



>ref|NP_001238634.1| receptor-like kinase [Glycine max]
 gb|ACM89500.1| receptor-like kinase [Glycine max]
Length=176

 Score =   133 bits (334),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT KADVYSFG+VALEI++GK+N  +  D+   CLLD A  L +  NLME ID R
Sbjct  6    ALWGYLTDKADVYSFGVVALEIVSGKSNNNYLPDDGSVCLLDRACQLNQTRNLMELIDER  65

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFN  346
            LG + +K E  +++K+ LLC+N SP LRP+MS VV+MLEGH DI +  P    +N
Sbjct  66   LGPDLNKMEVEKVVKIGLLCSNASPTLRPTMSEVVNMLEGHADIPDVIPEPSTYN  120



>ref|XP_010038955.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=873

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      E  F LLDWA  L+ KGNL+E +DPR
Sbjct  700  AMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKPEECFILLDWAHFLKEKGNLIELVDPR  759

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  760  LGSHFDKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGTIMTEEKIE  819

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  820  AMRKHFRGDEHQAVG  834



>gb|KCW48003.1| hypothetical protein EUGRSUZ_K01737 [Eucalyptus grandis]
Length=658

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      +  F LLDWA  L+ +GNL+E +DPR
Sbjct  485  AMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKTKECFILLDWAHFLKERGNLIELVDPR  544

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  545  LGSHFDKEEALALIKVALMCTNATPALRPQMSSVVSMLEGKVAVPVLDSAGAIMTEEKIE  604

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  605  AMRKHFRGDEHQAVG  619



>ref|XP_010036439.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Eucalyptus grandis]
 ref|XP_010036441.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Eucalyptus grandis]
Length=815

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      E  F LLDWA  L+ +GNL+E +DPR
Sbjct  647  AMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKTEECFILLDWAHFLKERGNLIELVDPR  706

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  707  LGSHFDKEEALALIKVALVCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEEKIE  766

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  767  AMRKHFRGDEHQAVG  781



>ref|XP_010060733.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=1010

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 88/131 (67%), Gaps = 9/131 (7%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+V LEI++GK+N  +   E +  LLDWA VLQ +GN +E +DPR
Sbjct  831  AMRGYLTDKADVYSFGVVTLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNFLELVDPR  890

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI---------LEYDPNL  334
            LGSN+ ++EA+RM+ +ALLCTN SP LRP+MS+VVSMLEG   I            DP  
Sbjct  891  LGSNYSEEEAMRMLNLALLCTNPSPTLRPAMSSVVSMLEGKGAIQAPIIKRAATNLDPRF  950

Query  335  DEFNSQAMNDH  367
              F+  A N  
Sbjct  951  RAFDRLANNSQ  961



>ref|XP_010038874.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=669

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      +  F LLDWA  L+ +GNL+E +DPR
Sbjct  496  AMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKTKECFILLDWAHFLKERGNLIELVDPR  555

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  556  LGSHFDKEEALALIKVALMCTNATPALRPQMSSVVSMLEGKVAVPVLDSAGAIMTEEKIE  615

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  616  AMRKHFRGDEHQAVG  630



>ref|XP_006477836.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X1 [Citrus sinensis]
 ref|XP_006477837.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X2 [Citrus sinensis]
 ref|XP_006477838.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X3 [Citrus sinensis]
Length=1016

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEI++GK+N  +   E +  LLDWA VLQ +GNL+E +DP 
Sbjct  835  AMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNLLELVDPS  894

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGSNF K EA+ M+ +ALLCTN SP LRP+MS+VVSMLEG   +
Sbjct  895  LGSNFSKKEAMTMLNIALLCTNPSPTLRPTMSSVVSMLEGKTAV  938



>gb|KCW48028.1| hypothetical protein EUGRSUZ_K01762 [Eucalyptus grandis]
Length=817

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      E  F LLDWA  L+ +GNL+E +DPR
Sbjct  649  AMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKTEECFILLDWAHFLKERGNLIELVDPR  708

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  709  LGSHFDKEEALALIKVALVCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEEKIE  768

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  769  AMRKHFRGDEHQAVG  783



>gb|KCW48051.1| hypothetical protein EUGRSUZ_K01793 [Eucalyptus grandis]
Length=642

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 93/135 (69%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      E  F LLDWA  L+ +G L+E +DPR
Sbjct  469  AMHGYLTDKADIYSFGIVALEVVSGRSNTSSQKTEECFILLDWAHFLKERGTLIELVDPR  528

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  529  LGSHFDKEEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEEKIE  588

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  589  AMRKHFRGDEHQAVG  603



>ref|XP_008245552.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=657

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGI+ LEI++G+NN  +   E  F LLDWA +L+ +GNLM+ +DPR
Sbjct  487  AMRGYLTDKADVYSFGILVLEIVSGRNNTTYRGKEKSFYLLDWAQLLKGQGNLMDMVDPR  546

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            LGS+F+K+E +  I VALLC N +  +RP+MS+VVSMLEG   + E   DPN   F  +A
Sbjct  547  LGSDFNKEEMMLTINVALLCCNVTSTVRPTMSSVVSMLEGRAAVQELVSDPNASSFEIEA  606

Query  356  MNDHY  370
            M  H+
Sbjct  607  MRKHF  611



>gb|EYU29542.1| hypothetical protein MIMGU_mgv1a0269212mg, partial [Erythranthe 
guttata]
Length=423

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEI++GK+N  +   E +  LLDWA VL  +GNL+E +DP 
Sbjct  245  AMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDWAYVLHEQGNLLELVDPI  304

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            LG+N+ K EALRM+ +ALLC N SP LRPSMS+VVSMLEG
Sbjct  305  LGTNYSKKEALRMLNLALLCANPSPTLRPSMSSVVSMLEG  344



>ref|XP_008226374.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=497

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A  GYLT KADVYSFGI+ LEI++G+NN  +   E  F LLDWA +L+ +GNLM+ +DPR
Sbjct  327  ATRGYLTDKADVYSFGILVLEIVSGRNNTTYRGKEKSFYLLDWAQLLKGQGNLMQLVDPR  386

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLDEFNSQA  355
            LGS+F+++E +  I VALLC N +  +RP+MS+VVSMLEG   + E   DPN   F  +A
Sbjct  387  LGSDFNEEEIMLTINVALLCCNVTATVRPTMSSVVSMLEGRAAVQELVSDPNASSFEIEA  446

Query  356  MNDHYD  373
            M  H+ 
Sbjct  447  MRKHFQ  452



>ref|XP_007025276.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
 gb|EOY27898.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
Length=951

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWGYLT+KADVYSFGIVALEI++GK+N+ +  +  Y CLLDWA  LQ+   L E +D +
Sbjct  752  ALWGYLTYKADVYSFGIVALEIVSGKHNMTYGPENKYTCLLDWACNLQQNRKLSELVDEK  811

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNS----  349
            LG+ F+K EA  MIK+ALLCTN SP LRP+MS VV MLEG   + E  P+   ++     
Sbjct  812  LGTEFNKAEAEAMIKIALLCTNGSPSLRPTMSEVVGMLEGKIILPESVPDPGSYSQDLRF  871

Query  350  QAMNDHYDEM  379
            +A+ DH+  M
Sbjct  872  KAIRDHHKSM  881



>gb|KCW67547.1| hypothetical protein EUGRSUZ_F01301 [Eucalyptus grandis]
Length=918

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +  +E +  LLDWA VLQ +GN++E +DPR
Sbjct  739  AMRGYLTDKADVYSFGVVALEIVSGKSNTNYMPEEEFVHLLDWAYVLQEQGNVLELVDPR  798

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGS++ ++EA+RM+ +ALLCTN SP LRP MS+VVSMLEG   I
Sbjct  799  LGSDYSEEEAMRMLNLALLCTNPSPTLRPPMSSVVSMLEGKSAI  842



>gb|KCW67607.1| hypothetical protein EUGRSUZ_F013621, partial [Eucalyptus grandis]
Length=933

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALE+++G++N  +   E  F LLDWA VL+ +GNLM+ +D R
Sbjct  760  AMHGYLTEKADVYSFGIVALEVVSGQSNTSYQKKEKCFYLLDWARVLKERGNLMDLVDQR  819

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FD+ E L MIKVALLCTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  820  LGSHFDEKEVLAMIKVALLCTNVTPALRPPMSSVVSMLEGKAAVPVLDSEGAIITEETIE  879

Query  353  AMNDHY---DEMAVG  388
            AM  H+   ++ AVG
Sbjct  880  AMRKHFKSDEDQAVG  894



>ref|XP_010480726.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 [Camelina sativa]
Length=250

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG LT KADVYSFG+VA+EI++GK+N       ++  L++WAL LQ+ G++ME ID +
Sbjct  84   ALWGQLTEKADVYSFGVVAMEIVSGKHNANQKGSVDHVSLINWALTLQQTGDIMEIIDSK  143

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNL  334
            L   F+ DEA+RMIKVAL+CTN+SP LRP+MS  V MLEG  +I +   DP L
Sbjct  144  LEGEFNSDEAVRMIKVALICTNSSPSLRPAMSEAVKMLEGEIEIKQVMSDPGL  196



>gb|KFK44797.1| hypothetical protein AALP_AA1G304600 [Arabis alpina]
Length=838

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT KADVYSFG+VA+EI++G++N K     ++  L++WAL LQ+KG++ME +DP 
Sbjct  344  ALWGHLTEKADVYSFGVVAMEIVSGRSNAKQKGSADHVSLINWALTLQQKGDIMEIVDPM  403

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILE  319
            L  +F++ EA+RMIKVAL+CTN+SP LRP+MS VV MLEG  DI +
Sbjct  404  LEGDFNRKEAVRMIKVALVCTNSSPSLRPTMSEVVQMLEGEMDITQ  449



>gb|KHN36920.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1023

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E +  LLDWA VLQ +GNL+E +DP 
Sbjct  844  AMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNLLELVDPS  903

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGS +  +EA+RM+++ALLCTN SP LRPSMS+VVSMLEG   I
Sbjct  904  LGSKYSSEEAMRMLQLALLCTNPSPTLRPSMSSVVSMLEGKTPI  947



>ref|XP_010046856.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=268

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGIVALE+++G++N      E  F LL+WA  L+ +  L+E +DPR
Sbjct  95   AMHGYLTDKADIYSFGIVALEVVSGRSNTSSQKTEECFILLNWAHFLKERETLIELVDPR  154

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FD++EAL +IKVAL+CTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  155  LGSHFDREEALALIKVALMCTNVTPALRPPMSSVVSMLEGKVAVPVLDSAGAIMTEEKIE  214

Query  353  AMNDHY---DEMAVG  388
            AM  H+   +  AVG
Sbjct  215  AMRKHFRGDEHQAVG  229



>ref|XP_010060749.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Eucalyptus grandis]
Length=1021

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALE+++G++N  +   E  F LLDWA VL+ +GNLM+ +D R
Sbjct  848  AMHGYLTEKADVYSFGIVALEVVSGQSNTSYQKKEKCFYLLDWARVLKERGNLMDLVDQR  907

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FD+ E L MIKVALLCTN +P LRP MS+VVSMLEG   +   D     + E   +
Sbjct  908  LGSHFDEKEVLAMIKVALLCTNVTPALRPPMSSVVSMLEGKAAVPVLDSEGAIITEETIE  967

Query  353  AMNDHY---DEMAVG  388
            AM  H+   ++ AVG
Sbjct  968  AMRKHFKSDEDQAVG  982



>ref|XP_002532988.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29396.1| conserved hypothetical protein [Ricinus communis]
Length=941

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (71%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E +  LLDWA VLQ +G+L+E +DP 
Sbjct  759  AMRGYLTNKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWAYVLQERGSLLELVDPE  818

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNLDEFNS--  349
            LGS +  +EA+ M+ VALLCTN SP LRP+MS VVSMLEG   +  L  DP     NS  
Sbjct  819  LGSAYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEGRTAVQDLLSDPGFSAINSKY  878

Query  350  QAMNDHY  370
            +A+ +H+
Sbjct  879  KAIRNHF  885



>ref|XP_010064483.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Eucalyptus grandis]
Length=1018

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +  +E +  LLDWA VLQ +GN++E +DPR
Sbjct  839  AMRGYLTDKADVYSFGVVALEIVSGKSNTNYMPEEEFVHLLDWAYVLQEQGNVLELVDPR  898

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGS++ ++EA+RM+ +ALLCTN SP LRP MS+VVSMLEG   I
Sbjct  899  LGSDYSEEEAMRMLNLALLCTNPSPTLRPPMSSVVSMLEGKSAI  942



>ref|XP_011010609.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=879

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 90/127 (71%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E +  LLDWA VLQ +G+L+E +DP 
Sbjct  710  AMRGYLTNKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWAYVLQERGSLLELVDPE  769

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNLDEFNS--  349
            LGS +  +EA+ M+ VALLCTN SP LRP+MS VVSMLEG   +  L  DP     N+  
Sbjct  770  LGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEGRTPVQDLLSDPGFSAINTKY  829

Query  350  QAMNDHY  370
            +A+ +H+
Sbjct  830  KAIRNHF  836



>ref|XP_006358931.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Solanum tuberosum]
Length=1020

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+V LEI++GK+N  +   E +  LLDWA VLQ +GNL+E +DPR
Sbjct  838  AMRGYLTDKADVYSFGVVLLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNLLELVDPR  897

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            LG+++ K EA+RMI ++LLCTN SP LRPSMS+VVSMLEG
Sbjct  898  LGTHYSKKEAMRMINISLLCTNPSPTLRPSMSSVVSMLEG  937



>ref|XP_006442369.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
 gb|ESR55609.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
Length=966

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 92/137 (67%), Gaps = 3/137 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEI++GK+N  +   E +  LLDWA VLQ +GNL+E +DP 
Sbjct  785  AMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNLLELVDPS  844

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFNSQAMN  361
            LGSNF K EA+ M+ +ALLCTN SP LRP+MS+ VSMLEG   +      +   NS + +
Sbjct  845  LGSNFSKKEAMTMLNIALLCTNPSPTLRPTMSSAVSMLEGKTAV---QAPIIRRNSDSQD  901

Query  362  DHYDEMAVGSRDFPNKV  412
              +    + S+D   +V
Sbjct  902  ARFRAFEILSQDSQTQV  918



>ref|XP_008225247.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Prunus mume]
Length=938

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 92/129 (71%), Gaps = 4/129 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT+KADVYSFG+VALEI++GKNN  +   +++ CLLDWA  LQ+ GNL+E +D +
Sbjct  770  ALWGHLTYKADVYSFGVVALEIISGKNNNNYIPSDDWVCLLDWACHLQQTGNLLELVDEK  829

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH----DDILEYDPNLDEFNS  349
            LGS FD+ EA  M+KVAL+CTN S  LRPSMS VVSMLEG     D I E     ++   
Sbjct  830  LGSEFDQKEAEIMVKVALICTNASASLRPSMSEVVSMLEGQTLVPDVIPEPSTYREDLRF  889

Query  350  QAMNDHYDE  376
            +AM D + +
Sbjct  890  KAMRDLHRQ  898



>ref|XP_010064492.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=326

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KAD+YSFGI+ALE+++G++N+    +E  F +LDWA  L+ +GNL++ +D R
Sbjct  154  AMHGYLTDKADIYSFGIIALEVVSGQSNIGSQKNEECFYILDWACFLKERGNLIDLVDRR  213

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPN---LDEFNSQ  352
            LGS+FDK+EAL +IKVAL+CTN +P LRP MS+VVSMLEG   I   D     + E    
Sbjct  214  LGSHFDKEEALALIKVALMCTNATPALRPLMSSVVSMLEGKVAIPVLDSEGAIMTEEKID  273

Query  353  AMNDHY  370
            AM  H+
Sbjct  274  AMRKHF  279



>ref|XP_002306015.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa]
 gb|EEE86526.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa]
Length=1028

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 90/127 (71%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E +  LLDWA VLQ +G+L+E +DP 
Sbjct  859  AMRGYLTNKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWAYVLQERGSLLELVDPE  918

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNLDEFNS--  349
            LGS +  +EA+ M+ VALLCTN SP LRP+MS VVSMLEG   +  L  DP     N+  
Sbjct  919  LGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEGRTPVQDLLSDPGFSAINTKY  978

Query  350  QAMNDHY  370
            +A+ +H+
Sbjct  979  KAIRNHF  985



>ref|XP_010246510.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1011

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 94/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK N      E +  LLDWAL+L+ +G+L++ +DPR
Sbjct  837  AMKGYLTNKADVYSFGVVALEIVSGKRNTSFKPQEEFIDLLDWALILKDQGSLLDLVDPR  896

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEY--DPNLD--EFNS  349
            LG  F+KDEA++MI VALLCTNT   LRP+MSAVV MLEG   + E+  D ++   E+  
Sbjct  897  LGLEFNKDEAMKMINVALLCTNTCAPLRPTMSAVVGMLEGQASVTEFVSDTSISSVEWRF  956

Query  350  QAMNDHYDEM  379
            + M +HY ++
Sbjct  957  KTMMNHYSQV  966



>gb|KDO42388.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
 gb|KDO42389.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
Length=1016

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEI++GK+N  +   E +  LLDWA VLQ +GNL+E +DP 
Sbjct  835  AMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNLLELVDPS  894

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGSNF K EA+ M+ +ALLCTN SP LRP+MS+ VSMLEG   +
Sbjct  895  LGSNFSKKEAMTMLNIALLCTNPSPTLRPTMSSAVSMLEGKTAV  938



>ref|XP_006592614.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Glycine max]
Length=1011

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N K+   E +  LLDWA VLQ +GNL+E +DP 
Sbjct  838  AMRGYLTDKADVYSFGVVALEIVSGKSNTKYRPKEEFVYLLDWAYVLQEQGNLLELVDPN  897

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGS +  +EA+RM+ +ALLCTN SP LRP+MS+VVSMLEG   I
Sbjct  898  LGSKYSPEEAMRMLSLALLCTNPSPTLRPTMSSVVSMLEGKIPI  941



>ref|XP_006449567.1| hypothetical protein CICLE_v10014126mg [Citrus clementina]
 gb|ESR62807.1| hypothetical protein CICLE_v10014126mg [Citrus clementina]
Length=1023

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENY--FCLLDWALVLQRKGNLMEFID  175
            ALWGYLT+KADVYSFGIVALEI++GKNN+ + S   +   CLLDWA  LQ  G L+E +D
Sbjct  825  ALWGYLTYKADVYSFGIVALEIVSGKNNMSYASALEFDCTCLLDWACHLQLDGKLVELVD  884

Query  176  PRLGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDILEYDPNLDEFN  346
             RLGS ++K+EA RMIKV+LLCTN SP LRP+MS VV+MLEG   I +  P    ++
Sbjct  885  ERLGSKYNKEEAERMIKVSLLCTNASPSLRPTMSEVVNMLEGKTAIPDMIPEAGSYS  941



>ref|XP_008451726.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Cucumis melo]
Length=927

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFGIVALEI++GK+N  +   E +  LLDWA VL+ +GNL+E +DP 
Sbjct  737  AMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDWAYVLEEQGNLLELVDPD  796

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEG  301
            LGSN+  +EA+RM+ VALLCTN SP LRP+MS+VVSMLEG
Sbjct  797  LGSNYSSEEAMRMLNVALLCTNPSPTLRPAMSSVVSMLEG  836



>ref|XP_008225246.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Prunus mume]
Length=1010

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 90/125 (72%), Gaps = 4/125 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            ALWG+LT+KADVYSFG+VALEI++GKNN  +   +++ CLLDWA  LQ+ GNL+E +D +
Sbjct  842  ALWGHLTYKADVYSFGVVALEIISGKNNNNYIPSDDWVCLLDWACHLQQTGNLLELVDEK  901

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH----DDILEYDPNLDEFNS  349
            LGS FD+ EA  M+KVAL+CTN S  LRPSMS VVSMLEG     D I E     ++   
Sbjct  902  LGSEFDQKEAEIMVKVALICTNASASLRPSMSEVVSMLEGQTLVPDVIPEPSTYREDLRF  961

Query  350  QAMND  364
            +AM D
Sbjct  962  KAMRD  966



>gb|KHN42594.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1011

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N K+   E +  LLDWA VLQ +GNL+E +DP 
Sbjct  838  AMRGYLTDKADVYSFGVVALEIVSGKSNTKYRPKEEFVYLLDWAYVLQEQGNLLELVDPN  897

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGS +  +EA+RM+ +ALLCTN SP LRP+MS+VVSMLEG   I
Sbjct  898  LGSKYSPEEAMRMLSLALLCTNPSPTLRPTMSSVVSMLEGKIPI  941



>ref|XP_010272733.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nelumbo nucifera]
Length=882

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 89/127 (70%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VA+EI++GK+N  +   E +  LLDWA VLQ +G L+E +DP 
Sbjct  715  AMRGYLTEKADVYSFGVVAMEIVSGKSNTNYRPKEEFVYLLDWAYVLQERGCLLELVDPN  774

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNLDEFNS--  349
            LGS F  +EA+ M+ VALLCTN SP LRP+MS VVSMLEG   +  L  DP     NS  
Sbjct  775  LGSEFSTEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEGQTAVQDLLSDPGFTTVNSKF  834

Query  350  QAMNDHY  370
            +A+ +H+
Sbjct  835  KAIRNHF  841



>ref|XP_004146083.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Cucumis sativus]
 ref|XP_004167552.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Cucumis sativus]
Length=1012

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E +  LLDWA VLQ +GNL+E +DP 
Sbjct  836  AMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNLLELVDPN  895

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGH  304
            L SN+ K+E +RMI +ALLCTN SP LRPSMS+VVSMLEG 
Sbjct  896  LDSNYPKEEVMRMINIALLCTNPSPTLRPSMSSVVSMLEGK  936



>ref|XP_011010608.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1029

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 90/127 (71%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+VALEI++GK+N  +   E +  LLDWA VLQ +G+L+E +DP 
Sbjct  860  AMRGYLTNKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWAYVLQERGSLLELVDPE  919

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI--LEYDPNLDEFNS--  349
            LGS +  +EA+ M+ VALLCTN SP LRP+MS VVSMLEG   +  L  DP     N+  
Sbjct  920  LGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEGRTPVQDLLSDPGFSAINTKY  979

Query  350  QAMNDHY  370
            +A+ +H+
Sbjct  980  KAIRNHF  986



>gb|KCW71078.1| hypothetical protein EUGRSUZ_F04177 [Eucalyptus grandis]
Length=771

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    ALWGYLTFKADVYSFGIVALEILAGKNNVKHHSDENYFCLLDWALVLQRKGNLMEFIDPR  181
            A+ GYLT KADVYSFG+V LEI++GK+N  +   E +  LLDWA VLQ +GN++E +DPR
Sbjct  592  AMRGYLTDKADVYSFGVVTLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGNVLELVDPR  651

Query  182  LGSNFDKDEALRMIKVALLCTNTSPVLRPSMSAVVSMLEGHDDI  313
            LGS++ K+EA+RM+ +ALLCTN SP LRP MS VVS+LEG+  I
Sbjct  652  LGSDYSKEEAMRMLNLALLCTNPSPTLRPPMSTVVSILEGNSPI  695



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 876761086880