BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82429_g1_i1 len=2170 path=[2148:0-2169]

Length=2170
                                                                      Score     E

emb|CDP13430.1|  unnamed protein product                                894   0.0      
ref|XP_009772032.1|  PREDICTED: beta-amylase 3, chloroplastic-like      891   0.0      
ref|XP_009601320.1|  PREDICTED: beta-amylase 3, chloroplastic-like      889   0.0      
ref|XP_009597851.1|  PREDICTED: beta-amylase 3, chloroplastic-like      888   0.0      
gb|AHJ09602.1|  chloroplast beta-amylase 3                              887   0.0      
ref|XP_002517513.1|  Beta-amylase, putative                             886   0.0      Ricinus communis
gb|AFO84076.1|  beta-amylase                                            885   0.0      
ref|XP_004245844.1|  PREDICTED: beta-amylase 3, chloroplastic           884   0.0      
ref|NP_001275172.1|  beta-amylase PCT-BMYI                              883   0.0      
ref|XP_006385389.1|  beta-amylase family protein                        882   0.0      
ref|XP_011018667.1|  PREDICTED: beta-amylase 3, chloroplastic-like      877   0.0      
ref|XP_011070282.1|  PREDICTED: beta-amylase 3, chloroplastic           877   0.0      
ref|XP_007039629.1|  Chloroplast beta-amylase isoform 1                 875   0.0      
ref|XP_006385589.1|  beta-amylase family protein                        870   0.0      
ref|XP_009802914.1|  PREDICTED: beta-amylase 3, chloroplastic-like      869   0.0      
ref|XP_010110537.1|  hypothetical protein L484_023371                   869   0.0      
ref|XP_009792527.1|  PREDICTED: beta-amylase 3, chloroplastic-like      868   0.0      
ref|XP_008448759.1|  PREDICTED: beta-amylase 3, chloroplastic           867   0.0      
gb|KDP45986.1|  hypothetical protein JCGZ_11889                         866   0.0      
ref|XP_004147264.1|  PREDICTED: beta-amylase 3, chloroplastic-like      863   0.0      
ref|XP_008229498.1|  PREDICTED: beta-amylase 3, chloroplastic           862   0.0      
ref|XP_004244551.1|  PREDICTED: beta-amylase 3, chloroplastic-like      862   0.0      
ref|XP_007209867.1|  hypothetical protein PRUPE_ppa003812mg             861   0.0      
ref|XP_009612895.1|  PREDICTED: beta-amylase 3, chloroplastic           860   0.0      
ref|XP_006362484.1|  PREDICTED: beta-amylase 3, chloroplastic-like      860   0.0      
ref|XP_011032002.1|  PREDICTED: beta-amylase 3, chloroplastic-like      856   0.0      
emb|CAN62440.1|  hypothetical protein VITISV_032500                     855   0.0      Vitis vinifera
ref|XP_002282871.1|  PREDICTED: beta-amylase 3, chloroplastic           854   0.0      Vitis vinifera
ref|XP_004300297.1|  PREDICTED: beta-amylase 3, chloroplastic-like      853   0.0      
ref|XP_006477060.1|  PREDICTED: beta-amylase 3, chloroplastic iso...    851   0.0      
gb|AFP89361.1|  beta-amylase                                            848   0.0      
ref|XP_003524296.1|  PREDICTED: beta-amylase 3, chloroplastic-like      846   0.0      
gb|AFQ33613.1|  beta-amylase 1                                          845   0.0      
ref|XP_006477059.1|  PREDICTED: beta-amylase 3, chloroplastic iso...    845   0.0      
gb|KHG28698.1|  Beta-amylase 3, chloroplastic -like protein             843   0.0      
ref|XP_006440139.1|  hypothetical protein CICLE_v10019566mg             841   0.0      
ref|XP_007155732.1|  hypothetical protein PHAVU_003G226900g             840   0.0      
ref|XP_010055392.1|  PREDICTED: beta-amylase 3, chloroplastic           838   0.0      
ref|XP_009371857.1|  PREDICTED: beta-amylase 3, chloroplastic           838   0.0      
ref|NP_001236350.1|  beta-amylase                                       834   0.0      
gb|EYU17858.1|  hypothetical protein MIMGU_mgv1a003946mg                834   0.0      
ref|XP_010531694.1|  PREDICTED: beta-amylase 3, chloroplastic-like      833   0.0      
ref|XP_010274550.1|  PREDICTED: beta-amylase 3, chloroplastic           827   0.0      
ref|XP_008361217.1|  PREDICTED: beta-amylase 3, chloroplastic-like      830   0.0      
ref|XP_010695452.1|  PREDICTED: beta-amylase 3, chloroplastic           824   0.0      
ref|XP_008373719.1|  PREDICTED: beta-amylase 3, chloroplastic           821   0.0      
gb|KEH31589.1|  beta-amylase                                            817   0.0      
gb|KHN42645.1|  Beta-amylase 3, chloroplastic                           811   0.0      
ref|XP_006573703.1|  PREDICTED: beta-amylase 3, chloroplastic-like      810   0.0      
ref|XP_010440058.1|  PREDICTED: beta-amylase 3, chloroplastic           810   0.0      
ref|XP_004508980.1|  PREDICTED: beta-amylase 3, chloroplastic-like      809   0.0      
gb|AFI56496.1|  beta-amylase                                            808   0.0      
ref|NP_567523.1|  beta-amylase                                          808   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868085.1|  beta-amylase 8                                     806   0.0      
ref|XP_010449668.1|  PREDICTED: beta-amylase 3, chloroplastic-like      805   0.0      
ref|XP_006285145.1|  hypothetical protein CARUB_v10006488mg             804   0.0      
gb|EYU24930.1|  hypothetical protein MIMGU_mgv1a020099mg                801   0.0      
ref|XP_010434720.1|  PREDICTED: beta-amylase 3, chloroplastic-like      800   0.0      
ref|XP_003539125.1|  PREDICTED: beta-amylase 3, chloroplastic-lik...    798   0.0      
gb|AFO84077.1|  beta-amylase                                            796   0.0      
emb|CDY42960.1|  BnaA01g17940D                                          796   0.0      
ref|XP_006414272.1|  hypothetical protein EUTSA_v10024842mg             796   0.0      
ref|XP_009144721.1|  PREDICTED: beta-amylase 3, chloroplastic-like      796   0.0      
ref|XP_009136825.1|  PREDICTED: beta-amylase 3, chloroplastic           793   0.0      
emb|CDX90487.1|  BnaA03g42940D                                          791   0.0      
emb|CDY09643.1|  BnaC07g34180D                                          790   0.0      
gb|KFK45005.1|  hypothetical protein AALP_AA1G332100                    789   0.0      
emb|CDY35597.1|  BnaC01g21190D                                          786   0.0      
emb|CAB46051.1|  putative beta-amylase                                  783   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003611409.1|  Beta-amylase                                       785   0.0      
ref|XP_007039631.1|  Chloroplast beta-amylase isoform 3                 781   0.0      
ref|XP_003611408.1|  Beta-amylase                                       777   0.0      
ref|XP_008794866.1|  PREDICTED: beta-amylase 3, chloroplastic           776   0.0      
ref|XP_010919815.1|  PREDICTED: beta-amylase 3, chloroplastic iso...    775   0.0      
ref|XP_004511752.1|  PREDICTED: beta-amylase 3, chloroplastic-like      764   0.0      
ref|XP_009413253.1|  PREDICTED: beta-amylase 3, chloroplastic           753   0.0      
ref|XP_009794895.1|  PREDICTED: beta-amylase 3, chloroplastic-like      735   0.0      
ref|XP_009397011.1|  PREDICTED: beta-amylase 3, chloroplastic-like      738   0.0      
emb|CBI33977.3|  unnamed protein product                                722   0.0      
gb|EPS63004.1|  hypothetical protein M569_11781                         717   0.0      
ref|XP_004983616.1|  PREDICTED: beta-amylase 3, chloroplastic-lik...    709   0.0      
ref|XP_008658465.1|  PREDICTED: beta-amylase 3, chloroplastic-like      707   0.0      
ref|XP_004983617.1|  PREDICTED: beta-amylase 3, chloroplastic-lik...    705   0.0      
ref|XP_006838474.1|  hypothetical protein AMTR_s00002p00150440          706   0.0      
ref|XP_009759389.1|  PREDICTED: beta-amylase 3, chloroplastic-like      699   0.0      
ref|XP_002464915.1|  hypothetical protein SORBIDRAFT_01g028700          699   0.0      Sorghum bicolor [broomcorn]
ref|XP_008658990.1|  PREDICTED: uncharacterized protein LOC100502...    697   0.0      
dbj|BAJ90222.1|  predicted protein                                      681   0.0      
ref|XP_003574353.1|  PREDICTED: beta-amylase 3, chloroplastic           680   0.0      
ref|XP_010919816.1|  PREDICTED: beta-amylase 3, chloroplastic iso...    675   0.0      
ref|XP_007039632.1|  Chloroplast beta-amylase isoform 4                 669   0.0      
tpg|DAA46353.1|  TPA: hypothetical protein ZEAMMB73_080734              662   0.0      
gb|AAG60205.1|AC084763_25  putative chloroplast-targeted beta-amy...    662   0.0      Oryza sativa [red rice]
ref|XP_008364514.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    640   0.0      
gb|EMT27036.1|  Beta-amylase                                            642   0.0      
ref|XP_001768786.1|  predicted protein                                  625   0.0      
ref|XP_001756520.1|  predicted protein                                  622   0.0      
ref|XP_001782016.1|  predicted protein                                  617   0.0      
ref|NP_001065418.2|  Os10g0565200                                       617   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002314522.2|  hypothetical protein POPTR_0010s07340g             613   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_001778149.1|  predicted protein                                  610   0.0      
gb|AII99838.1|  beta-amylase                                            612   0.0      
gb|AFQ33620.1|  beta-amylase 8                                          603   0.0      
gb|KDP33360.1|  hypothetical protein JCGZ_12909                         611   0.0      
ref|NP_001234556.1|  beta-amylase                                       609   0.0      
gb|KDO35878.1|  hypothetical protein CISIN_1g017328mg                   601   0.0      
gb|AAY89374.1|  beta-amylase 1                                          608   0.0      Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009785196.1|  PREDICTED: beta-amylase 1, chloroplastic-like      608   0.0      
ref|XP_009596880.1|  PREDICTED: beta-amylase 1, chloroplastic-like      608   0.0      
ref|XP_011029718.1|  PREDICTED: beta-amylase 1, chloroplastic-like      608   0.0      
ref|XP_006340896.1|  PREDICTED: beta-amylase 1, chloroplastic-like      607   0.0      
ref|XP_011091372.1|  PREDICTED: beta-amylase 1, chloroplastic           607   0.0      
gb|KHG16283.1|  Beta-amylase 1, chloroplastic -like protein             607   0.0      
ref|XP_007035340.1|  Beta-amylase 1 isoform 1                           608   0.0      
ref|XP_010264799.1|  PREDICTED: beta-amylase 1, chloroplastic-like      605   0.0      
emb|CDP20299.1|  unnamed protein product                                605   0.0      
ref|XP_008438436.1|  PREDICTED: beta-amylase 1, chloroplastic-like      603   0.0      
ref|XP_002311706.1|  beta-amylase family protein                        602   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009350111.1|  PREDICTED: beta-amylase 1, chloroplastic           603   0.0      
ref|XP_011041480.1|  PREDICTED: beta-amylase 1, chloroplastic-like      603   0.0      
ref|XP_006851336.1|  hypothetical protein AMTR_s00050p00205080          602   0.0      
ref|XP_007152599.1|  hypothetical protein PHAVU_004G143600g             602   0.0      
ref|XP_010263970.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    602   0.0      
gb|KDO55739.1|  hypothetical protein CISIN_1g008030mg                   602   0.0      
ref|XP_002518196.1|  Beta-amylase, putative                             602   0.0      Ricinus communis
ref|XP_006420416.1|  hypothetical protein CICLE_v10004620mg             601   0.0      
ref|XP_006493994.1|  PREDICTED: beta-amylase 1, chloroplastic-like      601   0.0      
ref|XP_004515248.1|  PREDICTED: beta-amylase 1, chloroplastic-like      600   0.0      
gb|EPS66628.1|  beta-amylase 1, chloroplastic                           600   0.0      
gb|AFQ33614.1|  beta-amylase 2                                          600   0.0      
emb|CAN71375.1|  hypothetical protein VITISV_002992                     599   0.0      Vitis vinifera
ref|XP_002285569.1|  PREDICTED: beta-amylase 1, chloroplastic           599   0.0      Vitis vinifera
ref|XP_008391283.1|  PREDICTED: beta-amylase 1, chloroplastic-like      598   0.0      
ref|XP_004166730.1|  PREDICTED: beta-amylase 1, chloroplastic-like      598   0.0      
gb|EAZ17007.1|  hypothetical protein OsJ_32492                          595   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009400488.1|  PREDICTED: beta-amylase 1, chloroplastic           597   0.0      
ref|XP_010666969.1|  PREDICTED: beta-amylase 1, chloroplastic           596   0.0      
gb|EPS61951.1|  beta-amylase                                            595   0.0      
ref|XP_004134029.1|  PREDICTED: beta-amylase 1, chloroplastic-like      595   0.0      
ref|XP_004985750.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    595   0.0      
ref|XP_008224054.1|  PREDICTED: beta-amylase 1, chloroplastic           595   0.0      
ref|XP_010263969.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    594   0.0      
ref|XP_007223114.1|  hypothetical protein PRUPE_ppa005431mg             589   0.0      
ref|XP_003534086.1|  PREDICTED: beta-amylase 1, chloroplastic           593   0.0      
ref|XP_009777267.1|  PREDICTED: beta-amylase 1, chloroplastic-like      592   0.0      
ref|XP_004296549.1|  PREDICTED: beta-amylase 1, chloroplastic-like      593   0.0      
ref|XP_011073736.1|  PREDICTED: beta-amylase 1, chloroplastic-like      592   0.0      
ref|XP_008342553.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    591   0.0      
ref|XP_002968794.1|  hypothetical protein SELMODRAFT_145994             587   0.0      
gb|AGT17079.1|  beta-amylase                                            589   0.0      
emb|CDY45566.1|  BnaC09g21440D                                          589   0.0      
ref|XP_009102529.1|  PREDICTED: beta-amylase 1, chloroplastic           589   0.0      
emb|CDX77441.1|  BnaA07g05790D                                          589   0.0      
ref|XP_006418770.1|  hypothetical protein EUTSA_v10002460mg             589   0.0      
dbj|BAJ96121.1|  predicted protein                                      587   0.0      
ref|XP_002974185.1|  hypothetical protein SELMODRAFT_149606             583   0.0      
ref|XP_010513371.1|  PREDICTED: beta-amylase 1, chloroplastic-like      588   0.0      
ref|XP_002885629.1|  beta-amylase 7                                     588   0.0      
ref|XP_010488521.1|  PREDICTED: beta-amylase 1, chloroplastic-like      587   0.0      
emb|CDX94831.1|  BnaC03g43570D                                          586   0.0      
gb|KFK39690.1|  hypothetical protein AALP_AA3G276400                    587   0.0      
ref|XP_003632025.2|  PREDICTED: beta-amylase 1, chloroplastic           582   0.0      
ref|XP_003548316.1|  PREDICTED: beta-amylase 1, chloroplastic-like      585   0.0      
ref|XP_006296695.1|  hypothetical protein CARUB_v10013332mg             585   0.0      
gb|ACG29617.1|  beta-amylase                                            585   0.0      Zea mays [maize]
tpg|DAA43306.1|  TPA: beta-amylase                                      585   0.0      
ref|XP_010466824.1|  PREDICTED: beta-amylase 1, chloroplastic iso...    584   0.0      
ref|NP_001148159.1|  beta-amylase                                       584   0.0      Zea mays [maize]
ref|XP_010466823.1|  PREDICTED: beta-amylase 1, chloroplastic iso...    583   0.0      
ref|XP_010023784.1|  PREDICTED: beta-amylase 1, chloroplastic           583   0.0      
ref|XP_008460711.1|  PREDICTED: beta-amylase 1, chloroplastic           581   0.0      
ref|XP_004147196.1|  PREDICTED: beta-amylase 1, chloroplastic-like      580   0.0      
gb|AAK96508.1|  AT4g17090/dl4575c                                       573   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_189034.1|  beta-amylase 1                                        580   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EAY88485.1|  hypothetical protein OsI_09956                          579   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001048926.1|  Os03g0141200                                       579   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010918964.1|  PREDICTED: beta-amylase 1, chloroplastic           579   0.0      
ref|XP_009608726.1|  PREDICTED: beta-amylase 1, chloroplastic-like      576   0.0      
ref|XP_003558837.1|  PREDICTED: beta-amylase 1, chloroplastic-like      575   0.0      
ref|XP_004168709.1|  PREDICTED: beta-amylase 3, chloroplastic-like      565   0.0      
ref|XP_004985749.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    575   0.0      
ref|XP_010550849.1|  PREDICTED: beta-amylase 1, chloroplastic           574   0.0      
emb|CDX93004.1|  BnaA03g37260D                                          571   0.0      
ref|XP_008775132.1|  PREDICTED: beta-amylase 1, chloroplastic           570   0.0      
ref|XP_004982940.1|  PREDICTED: beta-amylase 1, chloroplastic-like      567   0.0      
ref|XP_009135884.1|  PREDICTED: beta-amylase 1, chloroplastic-like      567   0.0      
ref|XP_002468533.1|  hypothetical protein SORBIDRAFT_01g047500          566   0.0      Sorghum bicolor [broomcorn]
gb|ABK24605.1|  unknown                                                 562   0.0      Picea sitchensis
ref|XP_002975660.1|  hypothetical protein SELMODRAFT_232533             559   0.0      
ref|XP_002978844.1|  hypothetical protein SELMODRAFT_233213             555   0.0      
ref|NP_001147532.1|  beta-amylase                                       557   0.0      Zea mays [maize]
ref|XP_007035341.1|  Beta-amylase 1 isoform 2                           555   0.0      
ref|XP_002467119.1|  hypothetical protein SORBIDRAFT_01g019850          556   0.0      Sorghum bicolor [broomcorn]
ref|XP_010111574.1|  Beta-amylase 1                                     553   0.0      
gb|EAZ16360.1|  hypothetical protein OsJ_31822                          545   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064798.1|  Os10g0465700                                       544   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AFI71858.1|  amylase                                                 543   0.0      
gb|EAY78842.1|  hypothetical protein OsI_33946                          541   0.0      Oryza sativa Indica Group [Indian rice]
gb|AAL37169.1|AF319168_1  putative chloroplast-targeted beta-amylase    539   2e-180   Brassica napus [oilseed rape]
ref|XP_003571854.1|  PREDICTED: beta-amylase 1, chloroplastic-like      535   3e-179   
gb|KHN24537.1|  Beta-amylase 1, chloroplastic                           529   9e-179   
tpg|DAA46351.1|  TPA: hypothetical protein ZEAMMB73_080734              524   1e-177   
dbj|BAJ95735.1|  predicted protein                                      525   1e-176   
emb|CAX51379.1|  beta-amylase                                           523   4e-176   Hordeum vulgare subsp. vulgare [barley]
gb|ABR18773.1|  beta-amylase                                            503   4e-171   Boehmeria nivea [Chinese silk-plant]
ref|XP_006662424.1|  PREDICTED: beta-amylase 1, chloroplastic-like      495   4e-165   
gb|AFK46577.1|  unknown                                                 486   1e-163   
gb|AGS94413.1|  beta-amylase                                            478   1e-159   
gb|ACY25894.1|  beta-amylase 1                                          473   1e-158   Euphorbia esula [wolf's milk]
ref|XP_006844925.1|  hypothetical protein AMTR_s00058p00155330          477   2e-156   
gb|KEH26843.1|  beta-amylase                                            465   3e-154   
ref|XP_006662612.1|  PREDICTED: beta-amylase 3, chloroplastic-like      458   1e-152   
tpg|DAA43307.1|  TPA: beta-amylase                                      460   3e-152   
ref|XP_010915994.1|  PREDICTED: beta-amylase 1, chloroplastic-like      465   7e-152   
ref|XP_004164889.1|  PREDICTED: beta-amylase 1, chloroplastic-like      456   5e-151   
ref|XP_008783150.1|  PREDICTED: beta-amylase 3, chloroplastic-like      463   5e-151   
ref|XP_008337562.1|  PREDICTED: beta-amylase 1, chloroplastic-like      460   1e-149   
ref|XP_007209090.1|  hypothetical protein PRUPE_ppa003539mg             456   2e-148   
ref|XP_008239169.1|  PREDICTED: beta-amylase 3, chloroplastic-like      456   6e-148   
ref|XP_009358648.1|  PREDICTED: beta-amylase 1, chloroplastic-like      455   8e-148   
gb|KHN22864.1|  Beta-amylase                                            451   4e-147   
pdb|1UKP|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...    450   6e-147   
pdb|1UKO|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...    450   7e-147   
ref|XP_007051810.1|  Beta-amylase 2 isoform 1                           452   7e-147   
ref|XP_003539882.1|  PREDICTED: beta-amylase-like                       450   7e-147   
pdb|1Q6C|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Co...    450   7e-147   
pdb|1V3I|A  Chain A, The Roles Of Glu186 And Glu380 In The Cataly...    450   7e-147   
dbj|BAA09462.1|  beta-amylase                                           450   7e-147   Glycine max [soybeans]
gb|AAZ38831.1|  beta-amylase                                            450   1e-146   Glycine max [soybeans]
ref|XP_010688831.1|  PREDICTED: beta-amylase-like                       452   2e-146   
ref|XP_007051811.1|  Beta-amylase 2 isoform 2                           452   2e-146   
pdb|1WDR|A  Chain A, The Role Of An Inner Loop In The Catalytic M...    449   2e-146   
pdb|1V3H|A  Chain A, The Roles Of Glu186 And Glu380 In The Cataly...    449   2e-146   
pdb|1Q6E|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...    449   2e-146   
emb|CDP20214.1|  unnamed protein product                                449   2e-146   
ref|XP_001691372.1|  beta-amylase                                       452   3e-146   Chlamydomonas reinhardtii
dbj|BAD93291.1|  beta-amylase                                           449   3e-146   Glycine max [soybeans]
pdb|1WDQ|A  Chain A, The Role Of An Inner Loop In The Catalytic M...    448   3e-146   
pdb|1WDS|A  Chain A, The Role Of An Inner Loop In The Catalytic M...    448   4e-146   
pdb|1Q6G|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...    448   5e-146   
dbj|BAD93289.1|  beta-amylase                                           448   5e-146   Glycine max [soybeans]
pdb|1Q6D|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...    448   6e-146   
ref|XP_009409087.1|  PREDICTED: beta-amylase 3, chloroplastic-like      450   6e-146   
dbj|BAD93290.1|  beta-amylase                                           447   6e-146   Glycine max [soybeans]
emb|CAN65860.1|  hypothetical protein VITISV_014849                     449   9e-146   Vitis vinifera
ref|XP_010659745.1|  PREDICTED: beta-amylase 1, chloroplastic-like      449   1e-145   
sp|O22585.1|AMYB_MEDSA  RecName: Full=Beta-amylase; AltName: Full...    447   1e-145   Medicago sativa [alfalfa]
dbj|BAD93288.1|  beta-amylase                                           447   1e-145   Glycine max [soybeans]
ref|XP_007132589.1|  hypothetical protein PHAVU_011G107700g             447   2e-145   
gb|AAY40266.1|  beta-amylase                                            446   2e-145   Glycine max [soybeans]
ref|NP_001236247.1|  beta-amylase precursor                             446   2e-145   
pdb|1BYA|A  Chain A, Crystal Structures Of Soybean Beta-Amylase R...    445   5e-145   
gb|AFK33500.1|  unknown                                                 445   6e-145   
gb|AHG94609.1|  beta-amylase                                            448   1e-144   
ref|XP_008390323.1|  PREDICTED: beta-amylase 3, chloroplastic-like      447   1e-144   
pdb|2DQX|A  Chain A, Mutant Beta-Amylase (W55r) From Soy Bean           444   2e-144   
pdb|1BTC|A  Chain A, Three-Dimensional Structure Of Soybean Beta-...    444   2e-144   
ref|XP_009341436.1|  PREDICTED: beta-amylase-like                       447   2e-144   
gb|EEC67456.1|  hypothetical protein OsI_34681                          438   2e-144   Oryza sativa Indica Group [Indian rice]
ref|XP_003062547.1|  glycoside hydrolase family 14 protein              446   2e-144   
ref|XP_009627593.1|  PREDICTED: beta-amylase 1, chloroplastic-like      446   2e-144   
gb|KEH29555.1|  beta-amylase                                            444   2e-144   
emb|CAN70833.1|  hypothetical protein VITISV_005286                     444   4e-144   Vitis vinifera
ref|XP_004289151.1|  PREDICTED: beta-amylase-like                       446   5e-144   
gb|AFQ33617.1|  beta-amylase 5                                          444   5e-144   
ref|XP_002320794.2|  hypothetical protein POPTR_0014s07950g             444   6e-144   Populus trichocarpa [western balsam poplar]
ref|XP_001416970.1|  predicted protein                                  442   6e-144   Ostreococcus lucimarinus CCE9901
ref|XP_007215122.1|  hypothetical protein PRUPE_ppa004334mg             443   7e-144   
ref|XP_009353236.1|  PREDICTED: beta-amylase-like                       446   7e-144   
emb|CBI28977.3|  unnamed protein product                                442   9e-144   
gb|AES67296.2|  beta-amylase                                            445   2e-143   
ref|XP_011036188.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    442   3e-143   
ref|XP_011036179.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    442   3e-143   
emb|CEF97167.1|  Glycoside hydrolase, catalytic domain                  442   5e-143   
ref|XP_002281003.2|  PREDICTED: beta-amylase                            443   8e-143   Vitis vinifera
ref|XP_009802726.1|  PREDICTED: beta-amylase 1, chloroplastic-like      441   9e-143   
sp|O65015.1|AMYB_TRIRP  RecName: Full=Beta-amylase; AltName: Full...    439   9e-143   Trifolium repens [creeping white clover]
ref|XP_009344038.1|  PREDICTED: beta-amylase 3, chloroplastic-like      441   1e-142   
ref|XP_008379598.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    442   2e-142   
ref|XP_009388866.1|  PREDICTED: beta-amylase isoform X2                 439   2e-142   
ref|XP_009403535.1|  PREDICTED: beta-amylase 3, chloroplastic-like      440   2e-142   
ref|XP_001755209.1|  predicted protein                                  437   2e-142   
ref|XP_002875024.1|  beta-amylase 9                                     440   3e-142   
gb|KDO59876.1|  hypothetical protein CISIN_1g010067mg                   439   4e-142   
ref|XP_008793743.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    439   4e-142   
gb|AAD15902.1|  beta-amylase                                            437   5e-142   
gb|AAA33898.1|  beta-amylase                                            437   6e-142   
ref|XP_010107262.1|  Beta-amylase 1                                     439   8e-142   
sp|O64407.1|AMYB_VIGUN  RecName: Full=Beta-amylase; AltName: Full...    437   8e-142   
ref|XP_006447463.1|  hypothetical protein CICLE_v10014929mg             438   8e-142   
dbj|BAC83773.1|  putative beta-amylase                                  437   9e-142   
gb|KDP28630.1|  hypothetical protein JCGZ_14401                         439   9e-142   
ref|XP_008232901.1|  PREDICTED: beta-amylase 2, chloroplastic           439   9e-142   
gb|KHG26296.1|  Beta-amylase                                            437   2e-141   
ref|XP_010689279.1|  PREDICTED: beta-amylase-like                       436   3e-141   
gb|ADB81912.1|  beta-amylase                                            433   6e-141   
ref|XP_010931493.1|  PREDICTED: beta-amylase                            435   9e-141   
ref|XP_004957938.1|  PREDICTED: beta-amylase-like                       434   9e-141   
ref|XP_010695752.1|  PREDICTED: beta-amylase-like                       434   9e-141   
ref|XP_004144400.1|  PREDICTED: beta-amylase 1, chloroplastic-like      436   1e-140   
ref|XP_004513548.1|  PREDICTED: beta-amylase-like                       434   1e-140   
ref|XP_001770103.1|  predicted protein                                  436   1e-140   
ref|XP_009597613.1|  PREDICTED: beta-amylase isoform X1                 437   1e-140   
ref|NP_001105496.1|  beta-amylase                                       434   1e-140   
gb|EAZ04228.1|  hypothetical protein OsI_26372                          434   1e-140   
emb|CCW36754.1|  beta-amylase 1                                         431   1e-140   
ref|XP_003562968.2|  PREDICTED: beta-amylase-like                       440   2e-140   
gb|AAA33941.1|  beta-amylase                                            433   2e-140   
gb|KDP25878.1|  hypothetical protein JCGZ_22908                         434   2e-140   
ref|XP_006360578.1|  PREDICTED: beta-amylase-like                       436   2e-140   
ref|XP_005826390.1|  hypothetical protein GUITHDRAFT_96651              435   2e-140   
dbj|BAH20736.1|  beta-amylase                                           433   3e-140   
ref|XP_010055984.1|  PREDICTED: beta-amylase 1, chloroplastic-like      435   3e-140   
ref|XP_011070357.1|  PREDICTED: beta-amylase 1, chloroplastic-like      434   3e-140   
dbj|BAK00030.1|  predicted protein                                      437   4e-140   
ref|XP_010670423.1|  PREDICTED: beta-amylase 2, chloroplastic           436   4e-140   
ref|XP_006396247.1|  hypothetical protein EUTSA_v10028560mg             434   4e-140   
ref|XP_002515712.1|  Beta-amylase, putative                             433   7e-140   
ref|XP_002946796.1|  hypothetical protein VOLCADRAFT_103220             450   7e-140   
ref|XP_008455398.1|  PREDICTED: beta-amylase-like isoform X2            433   7e-140   
ref|XP_004301815.1|  PREDICTED: beta-amylase 1, chloroplastic-like      434   7e-140   
gb|AAA33899.1|  beta-amylase                                            432   7e-140   
gb|AAK30294.1|AF353207_1  beta-amylase                                  432   8e-140   
ref|XP_008338858.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    434   8e-140   
ref|XP_010051211.1|  PREDICTED: beta-amylase                            433   9e-140   
pdb|1B1Y|A  Chain A, Sevenfold Mutant Of Barley Beta-Amylase            432   9e-140   
ref|XP_006445046.1|  hypothetical protein CICLE_v10019525mg             434   9e-140   
ref|XP_008230132.1|  PREDICTED: beta-amylase-like                       432   1e-139   
ref|XP_010109553.1|  hypothetical protein L484_018288                   432   1e-139   
ref|XP_004243448.1|  PREDICTED: beta-amylase                            434   2e-139   
ref|XP_002511858.1|  Beta-amylase, putative                             435   2e-139   
gb|KCW89435.1|  hypothetical protein EUGRSUZ_A01734                     434   2e-139   
gb|KHG19612.1|  Beta-amylase 2, chloroplastic -like protein             432   3e-139   
ref|XP_008460412.1|  PREDICTED: beta-amylase 1, chloroplastic-like      432   3e-139   
ref|XP_002868220.1|  beta-amylase                                       431   3e-139   
gb|KGN43548.1|  hypothetical protein Csa_7G044880                       431   4e-139   
gb|EYU24817.1|  hypothetical protein MIMGU_mgv1a005201mg                430   5e-139   
gb|EYU32116.1|  hypothetical protein MIMGU_mgv1a003882mg                432   5e-139   
ref|XP_004306786.1|  PREDICTED: beta-amylase 2, chloroplastic-like      432   5e-139   
ref|XP_008455397.1|  PREDICTED: beta-amylase-like isoform X1            433   5e-139   
dbj|BAA07842.1|  beta-amylase                                           430   6e-139   
ref|NP_567460.1|  beta-amylase 5                                        430   7e-139   
ref|XP_009776413.1|  PREDICTED: beta-amylase-like                       432   9e-139   
sp|P82993.1|AMYB_HORVS  RecName: Full=Beta-amylase; AltName: Full...    430   1e-138   
ref|XP_010456279.1|  PREDICTED: beta-amylase 2, chloroplastic-like      431   1e-138   
ref|XP_002460819.1|  hypothetical protein SORBIDRAFT_02g035590          432   1e-138   
ref|XP_010934794.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    430   2e-138   
ref|XP_010934793.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    431   2e-138   
ref|XP_010909265.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    436   2e-138   
ref|XP_007149944.1|  hypothetical protein PHAVU_005G112400g             432   2e-138   
gb|EYU24815.1|  hypothetical protein MIMGU_mgv1a006126mg                427   2e-138   
ref|XP_010427089.1|  PREDICTED: beta-amylase 2, chloroplastic           431   2e-138   
ref|XP_004144579.1|  PREDICTED: beta-amylase-like                       431   2e-138   
ref|XP_006657803.1|  PREDICTED: beta-amylase-like                       428   3e-138   
ref|XP_003597045.1|  Beta-amylase                                       432   3e-138   
ref|XP_010435035.1|  PREDICTED: beta-amylase 5-like                     428   3e-138   
ref|XP_009111477.1|  PREDICTED: beta-amylase 2, chloroplastic           429   4e-138   
ref|XP_010055131.1|  PREDICTED: beta-amylase 2, chloroplastic           429   4e-138   
emb|CCW36756.1|  beta-amylase 2                                         424   4e-138   
emb|CCW36749.1|  beta-amylase 2                                         424   5e-138   
emb|CCW36748.1|  beta-amylase 2                                         424   6e-138   
ref|XP_006343811.1|  PREDICTED: beta-amylase 1, chloroplastic-like      429   6e-138   
emb|CCW36750.1|  beta-amylase 2                                         424   6e-138   
gb|KDP25257.1|  hypothetical protein JCGZ_20413                         429   7e-138   
emb|CBI35772.3|  unnamed protein product                                429   8e-138   
sp|P93594.1|AMYB_WHEAT  RecName: Full=Beta-amylase; AltName: Full...    427   9e-138   
gb|AGY14529.1|  beta-amylase                                            428   9e-138   
pdb|2XFF|A  Chain A, Crystal Structure Of Barley Beta-Amylase Com...    428   1e-137   
dbj|BAA04815.1|  beta-amylase                                           428   1e-137   
emb|CAB10300.1|  beta-amylase                                           426   1e-137   
ref|XP_008338857.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    428   1e-137   
emb|CDY22736.1|  BnaA08g05660D                                          426   2e-137   
gb|AGY14527.1|  beta-amylase                                            427   2e-137   
emb|CCW36766.1|  beta-amylase 2                                         422   3e-137   
gb|KFK30629.1|  hypothetical protein AALP_AA6G006600                    427   3e-137   
emb|CAA76131.1|  beta-amylase                                           429   3e-137   
ref|XP_003566188.1|  PREDICTED: beta-amylase 3, chloroplastic-like      427   3e-137   
emb|CDY07213.1|  BnaCnng02280D                                          427   4e-137   
ref|NP_191958.3|  beta-amylase 2                                        427   4e-137   
ref|XP_006827627.1|  hypothetical protein AMTR_s00009p00244310          427   5e-137   
ref|XP_009107836.1|  PREDICTED: beta-amylase 5                          425   5e-137   
ref|XP_010241901.1|  PREDICTED: beta-amylase 2, chloroplastic-like      432   5e-137   
gb|AAO67356.1|AF414082_1  endosperm-specific beta-amylase 1             426   5e-137   
gb|AEB00844.1|  beta-amylase 8                                          424   5e-137   
ref|XP_009597614.1|  PREDICTED: beta-amylase isoform X2                 424   5e-137   
dbj|BAJ96156.1|  predicted protein                                      426   5e-137   
ref|XP_008804013.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    427   6e-137   
emb|CCW36752.1|  beta-amylase 2                                         421   6e-137   
gb|ACN24986.1|  beta-amylase                                            426   6e-137   
gb|AAO67355.1|AF414081_1  endosperm-specific beta-amylase 1             426   7e-137   
emb|CCW36764.1|  beta-amylase 2                                         421   7e-137   
ref|XP_008804015.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    426   7e-137   
gb|AAG25638.1|  beta-amylase                                            426   7e-137   
ref|XP_008804014.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    426   8e-137   
ref|XP_010540283.1|  PREDICTED: beta-amylase 2, chloroplastic           426   8e-137   
gb|AGY14524.1|  beta-amylase                                            426   8e-137   
gb|ACF05414.1|  beta-amylase                                            426   9e-137   
ref|XP_008787503.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...    426   9e-137   
emb|CCW36758.1|  beta-amylase 2                                         421   9e-137   
emb|CCW36757.1|  beta-amylase 2                                         421   9e-137   
emb|CCW36761.1|  beta-amylase 2                                         421   1e-136   
gb|AGY14530.1|  beta-amylase                                            426   1e-136   
gb|AGY14536.1|  beta-amylase                                            425   1e-136   
ref|XP_008455399.1|  PREDICTED: beta-amylase-like isoform X3            424   1e-136   
gb|AAC67245.1|  beta-amylase                                            425   1e-136   
emb|CCW36755.1|  beta-amylase 2                                         421   1e-136   
sp|P16098.1|AMYB_HORVU  RecName: Full=Beta-amylase; AltName: Full...    425   1e-136   
ref|XP_010449959.1|  PREDICTED: beta-amylase 5-like                     424   1e-136   
emb|CCW36753.1|  beta-amylase 1                                         421   2e-136   
gb|AAG25637.1|  beta-amylase                                            425   2e-136   
gb|AFO64358.1|  beta-amylase                                            424   2e-136   
ref|XP_006414555.1|  hypothetical protein EUTSA_v10024989mg             424   2e-136   
emb|CCW36746.1|  beta-amylase 1                                         420   2e-136   
gb|EMS68884.1|  Beta-amylase                                            424   2e-136   
ref|XP_003541934.2|  PREDICTED: beta-amylase-like                       426   2e-136   
gb|AAX37358.1|  tissue-ubiquitous beta-amylase 2                        423   2e-136   
gb|AAX37357.1|  tissue-ubiquitous beta-amylase 2                        423   2e-136   
gb|AGY14538.1|  beta-amylase                                            424   3e-136   
ref|XP_009388864.1|  PREDICTED: beta-amylase isoform X1                 423   3e-136   
gb|AAR18251.1|  beta-amylase 1                                          423   4e-136   
emb|CDY51154.1|  BnaA09g51890D                                          424   4e-136   
emb|CCW36770.1|  beta-amylase 2                                         419   4e-136   
ref|XP_002274612.2|  PREDICTED: beta-amylase 2, chloroplastic           424   4e-136   
emb|CCW36759.1|  beta-amylase 2                                         419   5e-136   
emb|CAC16789.1|  beta-amylase                                           424   5e-136   
ref|XP_003562967.2|  PREDICTED: beta-amylase                            432   5e-136   
ref|XP_004338606.1|  betaamylase                                        421   6e-136   
ref|XP_004487367.1|  PREDICTED: beta-amylase-like                       426   6e-136   
ref|XP_005642810.1|  glycoside hydrolase                                421   7e-136   
emb|CAA77817.1|  Beta-amylase                                           422   8e-136   
gb|AFK39290.1|  unknown                                                 417   1e-135   
gb|EMT06941.1|  Beta-amylase                                            423   1e-135   
emb|CCW36765.1|  beta-amylase 2                                         418   1e-135   
emb|CCW36767.1|  beta-amylase 2                                         418   2e-135   
ref|XP_010440324.1|  PREDICTED: beta-amylase 5                          421   2e-135   
ref|XP_010105936.1|  Beta-amylase 2                                     422   3e-135   
emb|CCW36747.1|  beta-amylase 1                                         417   3e-135   
ref|XP_010267811.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase       421   3e-135   
gb|KEH21272.1|  glycoside hydrolase family 14 protein                   422   4e-135   
ref|XP_011006412.1|  PREDICTED: beta-amylase-like                       421   4e-135   
gb|AHC32020.1|  beta-amylase 2                                          421   6e-135   
ref|XP_007218058.1|  hypothetical protein PRUPE_ppa006189mg             417   6e-135   
ref|XP_004957937.1|  PREDICTED: beta-amylase-like                       422   9e-135   
ref|XP_009764518.1|  PREDICTED: beta-amylase 2, chloroplastic-like      419   1e-134   
ref|XP_006372993.1|  Chain A family protein                             420   1e-134   
ref|XP_006287426.1|  hypothetical protein CARUB_v10000631mg             420   1e-134   
ref|XP_003532447.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    420   2e-134   
emb|CCW36762.1|  beta-amylase 2                                         415   2e-134   
emb|CDY48276.1|  BnaA05g10780D                                          421   2e-134   
gb|KFK23056.1|  hypothetical protein AALP_AAs49758U000300               418   2e-134   
ref|NP_849389.1|  beta-amylase 5                                        415   2e-134   
ref|XP_009392820.1|  PREDICTED: beta-amylase 2, chloroplastic-like      419   3e-134   
ref|XP_006372990.1|  hypothetical protein POPTR_0017s06840g             421   3e-134   
ref|XP_003540325.2|  PREDICTED: beta-amylase-like                       421   4e-134   
ref|XP_011100422.1|  PREDICTED: beta-amylase-like                       420   5e-134   
gb|EMT30792.1|  Beta-amylase                                            422   7e-134   
ref|XP_002881219.1|  beta-amylase 5                                     419   8e-134   
gb|EMS48018.1|  Beta-amylase                                            419   2e-133   
ref|XP_007040595.1|  Beta-amylase 1                                     420   2e-133   
emb|CCW36771.1|  beta-amylase 2                                         412   2e-133   
ref|XP_010255371.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...    422   2e-133   
ref|XP_004245482.1|  PREDICTED: beta-amylase 3, chloroplastic-like      417   2e-133   
ref|XP_010255372.1|  PREDICTED: beta-amylase 7-like isoform X2          422   2e-133   
gb|KFK31133.1|  hypothetical protein AALP_AA6G072200                    418   2e-133   
ref|XP_010522319.1|  PREDICTED: beta-amylase 6                          418   3e-133   
emb|CCW36769.1|  beta-amylase 2                                         412   3e-133   
ref|XP_007160198.1|  hypothetical protein PHAVU_002G301200g             416   6e-133   
ref|XP_010469618.1|  PREDICTED: beta-amylase 6 isoform X1               417   7e-133   
ref|XP_004503587.1|  PREDICTED: beta-amylase 1, chloroplastic-like      416   7e-133   
ref|XP_003525331.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    416   8e-133   
ref|XP_007029518.1|  Beta-amylase 6                                     414   1e-132   
gb|AAG44882.1|AF284857_1  beta-amylase                                  414   1e-132   
ref|XP_010414016.1|  PREDICTED: beta-amylase 6-like                     416   1e-132   
ref|NP_001175243.1|  Os07g0543200                                       437   1e-132   
gb|EEC82222.1|  hypothetical protein OsI_26370                          418   2e-132   
ref|XP_010510054.1|  PREDICTED: beta-amylase 6 isoform X1               416   2e-132   
ref|NP_001059906.1|  Os07g0543100                                       417   2e-132   
ref|XP_002459849.1|  hypothetical protein SORBIDRAFT_02g012320          412   3e-132   
gb|ACG29023.1|  beta-amylase                                            415   3e-132   
ref|XP_002505301.1|  glycoside hydrolase family 14 protein              411   4e-132   
emb|CDP12194.1|  unnamed protein product                                410   4e-132   
sp|P10537.4|AMYB_IPOBA  RecName: Full=Beta-amylase; AltName: Full...    412   4e-132   
pdb|1FA2|A  Chain A, Crystal Structure Of Beta-Amylase From Sweet...    412   7e-132   
dbj|BAA02286.1|  beta-amylase                                           412   7e-132   
ref|XP_006293905.1|  hypothetical protein CARUB_v10022897mg             412   8e-132   
ref|XP_009143965.1|  PREDICTED: beta-amylase 6                          414   1e-131   
ref|XP_006283955.1|  hypothetical protein CARUB_v10005077mg             406   1e-131   
gb|AAC13634.1|  similar to the family of glycosyl hydrolases            412   1e-131   
gb|KHN36566.1|  Beta-amylase                                            427   1e-131   
emb|CDY12218.1|  BnaC04g12480D                                          413   2e-131   
ref|XP_006661569.1|  PREDICTED: beta-amylase 2, chloroplastic-like      411   2e-131   
ref|XP_010510055.1|  PREDICTED: beta-amylase 6 isoform X2               410   3e-131   
ref|XP_006293904.1|  hypothetical protein CARUB_v10022897mg             412   3e-131   
emb|CCW36751.1|  beta-amylase 2                                         407   3e-131   
ref|NP_001063976.1|  Os09g0569200                                       411   3e-131   
ref|NP_001168436.1|  beta-amylase                                       413   3e-131   
ref|XP_002454872.1|  hypothetical protein SORBIDRAFT_03g000480          408   4e-131   
tpg|DAA60723.1|  TPA: hypothetical protein ZEAMMB73_150352              416   5e-131   
dbj|BAJ96466.1|  predicted protein                                      415   8e-131   
ref|XP_007511103.1|  beta-amylase                                       418   1e-130   



>emb|CDP13430.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/550 (78%), Positives = 486/550 (88%), Gaps = 6/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQ---  224
             MALTLRSSTSFIN K+   +K PDD+  +VCF+Q + +C  RLRA++SMQEA +  +   
Sbjct  1     MALTLRSSTSFINFKDSSSLKTPDDYSGMVCFAQIRPTC--RLRARNSMQEAPISRERPS  58

Query  225   PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
              LEGR NE+ E+LHGL A +S + S RVPVF+MLPLDT+++GGNLNKPR+MNASLMAL+S
Sbjct  59    QLEGRKNEQGEKLHGLPAPRSQNGS-RVPVFVMLPLDTVSVGGNLNKPRAMNASLMALKS  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGPLKYNWEGYA LV MVQ HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAELVNMVQNHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LP+LRGRTP+QVY+DYM SFR+R
Sbjct  178   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDSLPLLRGRTPIQVYSDYMMSFRDR  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             FK+++G VI+E+QVGMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYM++SL ASAEA 
Sbjct  238   FKDHLGEVIMEIQVGMGPCGELRYPSYPETNGTWRFPGIGEFQCYDKYMKSSLEASAEAI  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK +WG  GPHDAG YNQFPEDTGFFRRDGTW +EYG FFLEWYS KLLEHGDRIL AA 
Sbjct  298   GKKDWGNGGPHDAGHYNQFPEDTGFFRRDGTWNSEYGHFFLEWYSTKLLEHGDRILAAAE  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQGTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GYLPIA+M+ KHGVVFNFT
Sbjct  358   GIFQGTGAKLSGKVAGIHWHYKTRSHAAELTAGYYNTRHRDGYLPIANMMGKHGVVFNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKD +QP  ANCSP+GLVRQ+K+AT+ AG ELAGENALER+D+  Y QVLATSRSD+
Sbjct  418   CMEMKDEQQPEYANCSPQGLVRQIKMATRTAGIELAGENALERHDAGAYAQVLATSRSDA  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGLSAFTYLRMNK+LFEP NW+ LVEFVKSMSEGGR TRLPE D+SRT+LYVG IK ++
Sbjct  478   GNGLSAFTYLRMNKHLFEPNNWQNLVEFVKSMSEGGRHTRLPESDTSRTELYVGFIKGKS  537

Query  1665  AKNANEAVLV  1694
              +  NEA LV
Sbjct  538   EQKINEAALV  547



>ref|XP_009772032.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana sylvestris]
Length=542

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/547 (80%), Positives = 482/547 (88%), Gaps = 5/547 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             M LTLRSSTSFIN+KE KGVK PDDF  +V ++Q K SC  RL  K+SMQEA L  + + 
Sbjct  1     MTLTLRSSTSFINIKETKGVKTPDDFLGMVSYTQTKPSC--RLITKNSMQEAHLSHERV-  57

Query  234   GRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGV  413
               VNEKRE+LH L    S +SS++VPVF+MLPLDT+TMGGNLNKPR+M+ SLMAL+SAGV
Sbjct  58    -IVNEKREKLHVLTTTHS-NSSTKVPVFVMLPLDTMTMGGNLNKPRAMHVSLMALKSAGV  115

Query  414   EGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPL  593
             EGVMVDAWWGLVEKDGPLKYNWEGYA LVKM +EHGLKLQ+VMSFHQCGGNVGDSCSIPL
Sbjct  116   EGVMVDAWWGLVEKDGPLKYNWEGYAELVKMCKEHGLKLQIVMSFHQCGGNVGDSCSIPL  175

Query  594   PPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKE  773
             PPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVL+GRTP+QVY D+M+SFRERF  
Sbjct  176   PPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLKGRTPIQVYTDFMKSFRERFSN  235

Query  774   YMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKS  953
             Y+G+VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL+A+A+A GK 
Sbjct  236   YLGDVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLSAAAKAAGKD  295

Query  954   EWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF  1133
             +WG+ GPHD+GQYNQFPEDTGFF+RDGTW +EYGQFFLEWYSGKL+EHGDRIL AA G++
Sbjct  296   DWGQGGPHDSGQYNQFPEDTGFFQRDGTWNSEYGQFFLEWYSGKLVEHGDRILAAAEGIY  355

Query  1134  QGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCME  1313
             QGTGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  NGYLPIA M AKH VVFNFTCME
Sbjct  356   QGTGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRHTNGYLPIARMFAKHRVVFNFTCME  415

Query  1314  MKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG  1493
             M+DGEQP SANCSPEGLVRQVK AT  A  ELAGENALERYD   Y QVLATSRSDSGNG
Sbjct  416   MRDGEQPQSANCSPEGLVRQVKNATTTAEVELAGENALERYDGGAYSQVLATSRSDSGNG  475

Query  1494  LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNAKN  1673
             LSAFT+LRMNK LFEPENWR LV+FVK+MS+GGR+  LPECDSSRTDLYV  +KK ++K 
Sbjct  476   LSAFTFLRMNKRLFEPENWRNLVQFVKNMSDGGRNATLPECDSSRTDLYVHFVKKSHSKK  535

Query  1674  ANEAVLV  1694
               E  LV
Sbjct  536   TTEVALV  542



>ref|XP_009601320.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana tomentosiformis]
Length=546

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/550 (80%), Positives = 485/550 (88%), Gaps = 7/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINL--KEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP  227
             M LTL SSTSFIN+  KE KGVK PDDF  +V ++Q K SC  RL  K+SMQEA L  + 
Sbjct  1     MTLTLHSSTSFININIKETKGVKTPDDFLGMVSYAQAKPSC--RLITKNSMQEAQLSYER  58

Query  228   LEGRVNEKRERLHGLAANQSH-SSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
             +   VNEKRE+LH L    S+ +SS++VPVF+MLPLDT+TMGGNLNKPR+M+ SLMAL+S
Sbjct  59    V--IVNEKREKLHFLTTTHSNINSSTKVPVFVMLPLDTMTMGGNLNKPRAMHVSLMALKS  116

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGPLKYNWEGYA L+KM +EHGLKLQ+VMSFHQCGGNVGDSCS
Sbjct  117   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAELIKMCKEHGLKLQIVMSFHQCGGNVGDSCS  176

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVL+GRTP+QVY D+MRSFRER
Sbjct  177   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLKGRTPIQVYTDFMRSFRER  236

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F  Y+G+VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAA+A+A 
Sbjct  237   FSNYLGDVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAAAAKAA  296

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK +WG+ GPHD+GQYNQFPEDTGFF+RDGTW +EYGQFFLEWYSGKL+EHGDRIL AA 
Sbjct  297   GKDDWGQGGPHDSGQYNQFPEDTGFFQRDGTWNSEYGQFFLEWYSGKLVEHGDRILAAAE  356

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G++QGTGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  NGYLPIAHM AKH VVFNFT
Sbjct  357   GIYQGTGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRHTNGYLPIAHMFAKHRVVFNFT  416

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQP SANCSPEGLVRQVK AT+ A  ELAGENALERYD   Y QVLATSRS+S
Sbjct  417   CMEMRDGEQPQSANCSPEGLVRQVKNATRTAEVELAGENALERYDGGAYSQVLATSRSES  476

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGLSAFT+LRMNK LFEPENWR LV+FVK+MS+GGR+  LPECDSSRTDLYV  IKK +
Sbjct  477   GNGLSAFTFLRMNKRLFEPENWRNLVQFVKNMSDGGRNATLPECDSSRTDLYVHFIKKSH  536

Query  1665  AKNANEAVLV  1694
             +K A E  LV
Sbjct  537   SKKATEVALV  546



>ref|XP_009597851.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana tomentosiformis]
Length=548

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/552 (79%), Positives = 488/552 (88%), Gaps = 9/552 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             M+LTL SSTSFIN KE K  +  DD  ++ CF+Q K S H  L+AK+S +E    +  +E
Sbjct  1     MSLTLHSSTSFINKKETKNSRTHDDISNMTCFAQIKPSFH--LKAKNS-KEVQFFAPNME  57

Query  234   GR-VN--EKRERLHGL--AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMAL  398
             GR +N  E+ E+LH L  + + ++SS+++VPVF+MLPLDTI +GG LNKPR+MNASLMAL
Sbjct  58    GRNINNEEEGEKLHVLTTSTHSNNSSTTKVPVFVMLPLDTINIGGKLNKPRAMNASLMAL  117

Query  399   RSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDS  578
             +SAGVEGVMVD WWGLVEKDGPLKYNWEGY  LVKMVQEHGLKLQVVMSFHQCGGNVGDS
Sbjct  118   KSAGVEGVMVDCWWGLVEKDGPLKYNWEGYYELVKMVQEHGLKLQVVMSFHQCGGNVGDS  177

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LPVLRGRTP+QVY ++MRSFR
Sbjct  178   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDLLPVLRGRTPIQVYTEFMRSFR  237

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             ERFK+Y+G+VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM+ASLAASAE
Sbjct  238   ERFKDYLGDVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKASLAASAE  297

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A GK++WG  GPHD+GQYNQFPEDTGFF+RDGTW  EYGQFFLEWYSGKLLEHGDRIL +
Sbjct  298   AMGKNDWGWGGPHDSGQYNQFPEDTGFFKRDGTWNNEYGQFFLEWYSGKLLEHGDRILGS  357

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFN  1298
             A G+F+GTGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR R+GYLPIA M AKHGVVFN
Sbjct  358   AEGIFRGTGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRHRDGYLPIARMFAKHGVVFN  417

Query  1299  FTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRS  1478
             FTCMEM+DGEQP SANCSPEGLVRQVK AT+ AG ELAGENALERYD  GY QVLATSRS
Sbjct  418   FTCMEMRDGEQPQSANCSPEGLVRQVKKATQIAGIELAGENALERYDGGGYAQVLATSRS  477

Query  1479  DSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK  1658
             +SGNGLSAFTYLR+NK LFEPENWR LVEFVKSMSEGG+ TRLPECD+SRTDLYVG +K+
Sbjct  478   ESGNGLSAFTYLRLNKRLFEPENWRNLVEFVKSMSEGGK-TRLPECDTSRTDLYVGFLKQ  536

Query  1659  RNAKNANEAVLV  1694
              +AK   EAV+V
Sbjct  537   SHAKKTAEAVVV  548



>gb|AHJ09602.1| chloroplast beta-amylase 3 [Camellia sinensis]
Length=548

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/551 (79%), Positives = 476/551 (86%), Gaps = 7/551 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPS-IVCFSQFKRSCHHRLRAKSSMQEAALL---S  221
             MALTLRSSTSFINLK+ +  K  DDF S +VCF+Q + SC  RL AKSSMQEA LL   S
Sbjct  1     MALTLRSSTSFINLKDTRSSKTLDDFFSGMVCFAQIRPSC--RLXAKSSMQEAQLLRERS  58

Query  222   QPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
               LE   N+K E+LH L+      + SRVPVF+MLPLDTI+ GGNLNKPR+MNASLMAL+
Sbjct  59    LNLEDNRNDKWEKLHMLSDTHG-KNDSRVPVFVMLPLDTISFGGNLNKPRAMNASLMALK  117

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
             SAGVEGVMVDAWWGLVEKDGPLKYNWEGYA LV MVQ+HGLKLQVVMSFHQCGGNVGD C
Sbjct  118   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAELVNMVQKHGLKLQVVMSFHQCGGNVGDCC  177

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LPVL GRTP+QVY+DYMRSF E
Sbjct  178   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDSLPVLMGRTPIQVYSDYMRSFSE  237

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RFK+Y+G VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL ASAEA
Sbjct  238   RFKDYLGEVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLQASAEA  297

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              GK +WG +GPHD+G YNQFPEDT FF RDGTW  EYGQFFLEWYSG LLEHGDRIL AA
Sbjct  298   IGKKDWGTNGPHDSGHYNQFPEDTAFFHRDGTWNNEYGQFFLEWYSGMLLEHGDRILAAA  357

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
              G+FQGTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GY PIA M++KHGVV NF
Sbjct  358   KGIFQGTGAKLSGKVAGIHWHYRTRSHAAELTAGYYNTRHRDGYQPIAQMMSKHGVVLNF  417

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEM+D EQP +ANCSPEGLV+QVK+ATK A  ELAGENALERYD+  Y QVLATSRSD
Sbjct  418   TCMEMRDREQPENANCSPEGLVQQVKMATKTARTELAGENALERYDAGAYAQVLATSRSD  477

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKR  1661
             SGNGL AFTYLR+NK+LFE +NWR LVEFVK+MSEGGRSTRLPE DSSRT+LY+G +K+ 
Sbjct  478   SGNGLCAFTYLRLNKSLFEADNWRHLVEFVKNMSEGGRSTRLPESDSSRTNLYIGFLKEN  537

Query  1662  NAKNANEAVLV  1694
             N K   EA LV
Sbjct  538   NVKKTKEAALV  548



>ref|XP_002517513.1| Beta-amylase, putative [Ricinus communis]
 gb|EEF45055.1| Beta-amylase, putative [Ricinus communis]
Length=547

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/550 (77%), Positives = 479/550 (87%), Gaps = 6/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQ---  224
             M+LTL SSTSFIN+K+ K VK PDDF   +CF+Q K SC  RL AK+SMQEA L      
Sbjct  1     MSLTLHSSTSFINIKDTKSVKTPDDFSGTICFAQIKPSC--RLGAKNSMQEAQLSQDNIF  58

Query  225   PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
              +EGR ++ RE+LH ++ +QS S+ S+VPVF+MLPLDT+T+GGNLNKPR+MNASLMAL+S
Sbjct  59    TMEGRRSDNREKLHAMSNSQS-SNDSKVPVFVMLPLDTVTLGGNLNKPRAMNASLMALKS  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP KYNWEGYA LV MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPRKYNWEGYADLVHMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LPVLRGRTP+QVY DYMRSF  R
Sbjct  178   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDSLPVLRGRTPIQVYTDYMRSFCNR  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F++Y+G V+VE+QVGMGPCGELRYP+YPESNGTW+FPGIGEFQCYDKYM+ASL ASAEA 
Sbjct  238   FRDYLGEVVVEIQVGMGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMKASLEASAEAI  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             G  +WGR GPHDAG Y QFPE+TGFFRRDGTWKTEYGQFFLEWYSGKLL+HGDRIL AA 
Sbjct  298   GNKDWGRGGPHDAGHYKQFPEETGFFRRDGTWKTEYGQFFLEWYSGKLLDHGDRILAAAK  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQGTGAKLSGK+AGIHWHY TRSHA EL AGYYNTR  +GYL +AHM +KHGVVFNFT
Sbjct  358   GIFQGTGAKLSGKVAGIHWHYRTRSHAPELTAGYYNTRHHDGYLTVAHMFSKHGVVFNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQPG AN SPEGLVRQVK+AT+ AG ELAGENALERYD+ GY QVLATSRS+S
Sbjct  418   CMEMRDGEQPGHANSSPEGLVRQVKMATRSAGVELAGENALERYDAAGYAQVLATSRSES  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE ++W+ LVEFVKSMSE G++ RLPECDS  T+LY+G IK +N
Sbjct  478   GNGLTAFTYLRMNKKLFEGDHWQHLVEFVKSMSEHGQNKRLPECDSEGTNLYIGFIKDKN  537

Query  1665  AKNANEAVLV  1694
             A    E  L+
Sbjct  538   AIRTKEVALL  547



>gb|AFO84076.1| beta-amylase [Actinidia chinensis]
Length=547

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/550 (79%), Positives = 477/550 (87%), Gaps = 6/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQ---  224
             MALTLRSSTSFI LK+ +  K  D F  +VCF+Q + SC  RLRAKS  QEA    +   
Sbjct  1     MALTLRSSTSFIKLKDSRCFKTLDAFSGMVCFAQIRPSC--RLRAKSLTQEAQFSCERTL  58

Query  225   PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
              LE R N+  E+LH L+     + S RVPVF+MLPLDTI+ GGNLNKPR+MNASLMAL+S
Sbjct  59    NLEDRRNKNWEKLHKLSDTHGENDS-RVPVFVMLPLDTISYGGNLNKPRAMNASLMALKS  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEK+GP+KYNWEGYA LVKM Q+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKEGPMKYNWEGYAELVKMAQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LPVLRGRTP+QVYADYMRSFR+R
Sbjct  178   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDSLPVLRGRTPIQVYADYMRSFRDR  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             FK+Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL ASAEA 
Sbjct  238   FKDYLGEVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLQASAEAI  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK +WGRSGPHD+GQYNQFPEDT FFRRDGTW  EYGQFFL+WYSG LLEHGDRIL AA 
Sbjct  298   GKEDWGRSGPHDSGQYNQFPEDTRFFRRDGTWNNEYGQFFLDWYSGMLLEHGDRILAAAN  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQGTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR ++GYLPIA M+ K+GV+ NFT
Sbjct  358   GIFQGTGAKLSGKVAGIHWHYRTRSHAAELTAGYYNTRHQDGYLPIARMMGKYGVIMNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQPG+ANCSPEGLVRQVK+ATK AG ELAGENALERYD+  Y QVL TSRSDS
Sbjct  418   CMEMRDGEQPGNANCSPEGLVRQVKMATKTAGTELAGENALERYDAGAYSQVLTTSRSDS  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGLSAFTYLRMNK LFE ENWR LVEFV++MSEGGRSTRL E DSSRTDLY+G IK+++
Sbjct  478   GNGLSAFTYLRMNKRLFEGENWRHLVEFVRNMSEGGRSTRLSESDSSRTDLYIGFIKEKS  537

Query  1665  AKNANEAVLV  1694
              +   +A LV
Sbjct  538   ERKMKKAALV  547



>ref|XP_004245844.1| PREDICTED: beta-amylase 3, chloroplastic [Solanum lycopersicum]
Length=546

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/549 (80%), Positives = 481/549 (88%), Gaps = 5/549 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFK-RSCHHRLRAKSSMQEAALLSQ-P  227
             M LTL+SS SFIN KE KGVK PD+F  +V F+Q K  SC  RL AKSSMQEA L  +  
Sbjct  1     MTLTLQSSASFINFKETKGVKTPDEFLGMVSFAQAKPSSC--RLVAKSSMQEAQLSHERI  58

Query  228   LEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
             +E R  EKRE+LH L AN S+SS+ RVPVF+MLPLDT+TMGGNLN+PR+MNASLMAL+S+
Sbjct  59    MEVRKIEKREKLHELTANHSNSST-RVPVFVMLPLDTMTMGGNLNRPRAMNASLMALKSS  117

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             G EGVMVDAWWGLVEKDGPLKYNWEGYA LV M +EHGLKLQVVMSFHQCGGNVGDSCSI
Sbjct  118   GAEGVMVDAWWGLVEKDGPLKYNWEGYAELVNMCREHGLKLQVVMSFHQCGGNVGDSCSI  177

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLPPWVLEEISKNPDLVYTDRSGRRNPEY+SLGCD LPVL+GRTP+QVY DYMRSFRERF
Sbjct  178   PLPPWVLEEISKNPDLVYTDRSGRRNPEYLSLGCDMLPVLKGRTPIQVYTDYMRSFRERF  237

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
               Y+GN+IVE+QVGMGPCGELRYP+YPESNGTWRFPGIGEFQCYDKYMRASLAA+A+A G
Sbjct  238   NNYLGNIIVEIQVGMGPCGELRYPAYPESNGTWRFPGIGEFQCYDKYMRASLAAAAKATG  297

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
             K +WG+ GPHD+GQYNQFPEDTGFF+RDGTW ++YGQFFLEWYSGKLLEHGDRIL A   
Sbjct  298   KDDWGQGGPHDSGQYNQFPEDTGFFQRDGTWNSDYGQFFLEWYSGKLLEHGDRILAAGES  357

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             ++QGTGAKLSGKIAGIHWHYNTRSHAAEL AGYYNTR R+GYLPIA MLAKHGVV NFTC
Sbjct  358   IYQGTGAKLSGKIAGIHWHYNTRSHAAELTAGYYNTRHRDGYLPIARMLAKHGVVLNFTC  417

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEM+DGEQP SANCSPEGLVRQVK A + A  ELAGENALERYD   + QVLATS SDSG
Sbjct  418   MEMRDGEQPQSANCSPEGLVRQVKTAARTAEVELAGENALERYDGGAFSQVLATSMSDSG  477

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNA  1667
             NGLSAFT+LRMNK LFEPENWR LV+FVKSMSEGGR+  LPECDSSRTDLYV  IK+ ++
Sbjct  478   NGLSAFTFLRMNKRLFEPENWRNLVQFVKSMSEGGRNATLPECDSSRTDLYVRFIKESHS  537

Query  1668  KNANEAVLV  1694
             K A E  +V
Sbjct  538   KKATEVAVV  546



>ref|NP_001275172.1| beta-amylase PCT-BMYI [Solanum tuberosum]
 gb|AAK84008.1|AF393847_1 beta-amylase PCT-BMYI [Solanum tuberosum]
Length=545

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/548 (79%), Positives = 479/548 (87%), Gaps = 4/548 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQ-PL  230
             M LTL+SS SFIN KE KGVK PD+F  +V F+Q K SC  RL AKSSMQEA L  +  +
Sbjct  1     MTLTLQSSASFINFKETKGVKAPDEFLGMVSFAQAKPSC--RLVAKSSMQEAQLSHERIM  58

Query  231   EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
             E +  EKRE+LH L AN S+ S+ RVPVF+MLPLDT+TMGGNLN+PR+MNASLMAL+S+G
Sbjct  59    EVKKIEKREKLHELPANHSNRST-RVPVFVMLPLDTMTMGGNLNRPRAMNASLMALKSSG  117

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
              EGVMVDAWWGLVEKDGPLKYNWEGYA LVKM QEHGLKLQVVMSFHQCGGNVGDSCSIP
Sbjct  118   AEGVMVDAWWGLVEKDGPLKYNWEGYAELVKMCQEHGLKLQVVMSFHQCGGNVGDSCSIP  177

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWVLEEISKNPDLVYTDRSGRRNPEY+SLGCD LPVL+GRTP+QVY DYMRSFRERF 
Sbjct  178   LPPWVLEEISKNPDLVYTDRSGRRNPEYLSLGCDMLPVLKGRTPIQVYTDYMRSFRERFN  237

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
             EY+GNVIVE+QVGMGPCGELRYP+YPESNGTWRFPGIGEFQCYDKYM ASLAA A+A GK
Sbjct  238   EYLGNVIVEIQVGMGPCGELRYPAYPESNGTWRFPGIGEFQCYDKYMGASLAAVAKAAGK  297

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
              +WG+ GPHD+G+YNQFPEDTGFF+RDGTW +EYGQFFLEWYSGKLLEHGDRIL A   +
Sbjct  298   DDWGQGGPHDSGKYNQFPEDTGFFQRDGTWNSEYGQFFLEWYSGKLLEHGDRILAAGESI  357

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCM  1310
             +QGTGAKLSGK+AGIHWHYNTRSHAAEL +GYYNTR R+GYLPIA MLAKHG V NFTCM
Sbjct  358   YQGTGAKLSGKVAGIHWHYNTRSHAAELTSGYYNTRHRDGYLPIARMLAKHGAVLNFTCM  417

Query  1311  EMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGN  1490
             EM+DGEQP SANCSPEGLVRQVK A + A  ELAGENALERYD   + QVLATS SDSGN
Sbjct  418   EMRDGEQPQSANCSPEGLVRQVKTAARTAEVELAGENALERYDGGAFSQVLATSMSDSGN  477

Query  1491  GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNAK  1670
             GLSAFT+LRMNK LFEPENWR LV+FVKSMSEGGR+  LPECDSSRTDLYV  IK+ ++K
Sbjct  478   GLSAFTFLRMNKRLFEPENWRNLVQFVKSMSEGGRNASLPECDSSRTDLYVRFIKESHSK  537

Query  1671  NANEAVLV  1694
              A E  +V
Sbjct  538   KATEVAVV  545



>ref|XP_006385389.1| beta-amylase family protein [Populus trichocarpa]
 gb|ERP63186.1| beta-amylase family protein [Populus trichocarpa]
Length=547

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/550 (77%), Positives = 481/550 (87%), Gaps = 6/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M   L+SSTSFI+LK+ +  K PDDF   +CF+  K SC  RL+AK+SMQEA L    + 
Sbjct  1     MTSALQSSTSFISLKDTRSPKTPDDFSGTICFAHIKPSC--RLQAKNSMQEAQLSHDEIL  58

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               EGR ++K   LH ++  +S S+ S+VPVF+MLPLDTIT+GGNLNKPR+MNASLMALRS
Sbjct  59    MTEGRKSKKGGELHAISGPRS-SNDSKVPVFVMLPLDTITIGGNLNKPRAMNASLMALRS  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGPLKYNWEGYA LV+MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAELVQMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEE+SKNPDLVYTDRSGRRNPEYISLGCD LP+LRGRTP+QVY+DYMRSFRER
Sbjct  178   IPLPPWVLEEMSKNPDLVYTDRSGRRNPEYISLGCDSLPILRGRTPIQVYSDYMRSFRER  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             FK+Y+G+VI+E+QVGMGPCGELRYP+YPE+NGTWRFPGIGEFQCYDKYMRASL ASAEA 
Sbjct  238   FKDYLGDVIMEIQVGMGPCGELRYPAYPETNGTWRFPGIGEFQCYDKYMRASLEASAEAL  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK +WGR GPHD+GQYN FPE+TGFFRRDGTW TEYGQFFLEWYSGKLLEHG++IL AA 
Sbjct  298   GKKDWGRGGPHDSGQYNHFPEETGFFRRDGTWNTEYGQFFLEWYSGKLLEHGEKILAAAE  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQGTGA+LSGK+AGIHWHY TRSHAAEL AGYYNTR  +GYLPIA M +KHGVVFNFT
Sbjct  358   GIFQGTGAQLSGKVAGIHWHYRTRSHAAELTAGYYNTRHHDGYLPIARMFSKHGVVFNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQP  ANCSP+GLVRQVK+AT+ AG ELAGENALERYD+  Y QVLATSRS+S
Sbjct  418   CMEMRDGEQPEHANCSPQGLVRQVKMATRTAGTELAGENALERYDAGAYTQVLATSRSES  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NWR+LVEFVKSMSEGGR+ +L ECDS  T+LY+G IK ++
Sbjct  478   GNGLTAFTYLRMNKKLFEGDNWRQLVEFVKSMSEGGRNEKLSECDSHGTNLYIGFIKDKS  537

Query  1665  AKNANEAVLV  1694
              +   EA L 
Sbjct  538   VQKTKEAALA  547



>ref|XP_011018667.1| PREDICTED: beta-amylase 3, chloroplastic-like [Populus euphratica]
Length=547

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/550 (76%), Positives = 479/550 (87%), Gaps = 6/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M   +RSSTSFI+LK+ +  K PDDF   +CF+  K SC  RL+AK+SMQEA L    + 
Sbjct  1     MTSAMRSSTSFISLKDTRSPKTPDDFSGTICFAHIKPSC--RLQAKNSMQEAQLSHDEIL  58

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               +GR + K   LH ++  +S S+ S+VPVF+MLPLDTIT+GGNLNKPR+MNASLMALRS
Sbjct  59    MTDGRKSNKGGELHAISGPRS-SNDSKVPVFVMLPLDTITIGGNLNKPRAMNASLMALRS  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGPLKYNWEGYA LVKMVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAELVKMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LP+LRGRTP+QVY+DYMRSFR+R
Sbjct  178   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDSLPLLRGRTPIQVYSDYMRSFRKR  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             FK+Y+G+VI+E+QVGMGPCGELRYP+YPE+NGTWRFPGIGEFQCYDKYMRASL ASAEA 
Sbjct  238   FKDYLGDVIMEIQVGMGPCGELRYPAYPETNGTWRFPGIGEFQCYDKYMRASLEASAEAL  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK +WGR GPHD+GQYN FPE+TGFFRRDGTW TEYGQFFLEWYSGKLLEHG++IL AA 
Sbjct  298   GKKDWGRGGPHDSGQYNHFPEETGFFRRDGTWNTEYGQFFLEWYSGKLLEHGEKILAAAE  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+F+GTGA+LSGK+AGIHWHY TRSHAAEL AGYYNTR  +GYLPIA M +KHGVVFNFT
Sbjct  358   GIFRGTGAQLSGKVAGIHWHYRTRSHAAELTAGYYNTRHHDGYLPIARMFSKHGVVFNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQP  ANCSP+GLVRQVK+AT+ AG ELAGENALERYD+  Y QV+ATSRS+S
Sbjct  418   CMEMRDGEQPEHANCSPQGLVRQVKMATRTAGTELAGENALERYDAGAYSQVMATSRSES  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NWR+LVEFVKSMSEGGR  +L ECD+  T+LY+G IK ++
Sbjct  478   GNGLTAFTYLRMNKKLFEGDNWRQLVEFVKSMSEGGRKEKLSECDTHGTNLYIGFIKDKS  537

Query  1665  AKNANEAVLV  1694
              +   EA L 
Sbjct  538   VQKTKEAALA  547



>ref|XP_011070282.1| PREDICTED: beta-amylase 3, chloroplastic [Sesamum indicum]
Length=549

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/552 (78%), Positives = 481/552 (87%), Gaps = 8/552 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALL-----  218
             MALTLRSSTSFINLK+ +  K PDDF SIV F+Q K SC  +LR+K+S QEA        
Sbjct  1     MALTLRSSTSFINLKDNRSFKTPDDFSSIVGFAQIKPSC--QLRSKNSTQEAQTAWPERA  58

Query  219   SQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMAL  398
             S   EGR NE+RE+LHGLA  QSH++  RVPVF+MLPLDTI++GG+LNKPR+M ASL+AL
Sbjct  59    SLLAEGRKNERREKLHGLAGPQSHNNL-RVPVFVMLPLDTISIGGSLNKPRAMLASLVAL  117

Query  399   RSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDS  578
             +SAGVEGVMVDAWWGLVEKDGPLKYNWEGYA L+KMV++ GLKLQVVMSFHQCGGNVGDS
Sbjct  118   KSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAELIKMVEKLGLKLQVVMSFHQCGGNVGDS  177

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LPVLRGRTP+QVY+DYMRSFR
Sbjct  178   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDSLPVLRGRTPIQVYSDYMRSFR  237

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             ERFK+Y+G+V+VE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL A+A+
Sbjct  238   ERFKDYLGDVVVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLEAAAK  297

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A GK +WGR GPHDAGQYNQFPE+TGFF RDGTW  EYGQFFL+WYS KL++HG++ILT 
Sbjct  298   AIGKDDWGRGGPHDAGQYNQFPENTGFFGRDGTWNGEYGQFFLKWYSEKLIDHGEKILTT  357

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFN  1298
             A  +FQGTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GYL IA M +KHGVVFN
Sbjct  358   AERIFQGTGAKLSGKVAGIHWHYKTRSHAAELTAGYYNTRHRDGYLAIARMFSKHGVVFN  417

Query  1299  FTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRS  1478
             FTCMEM+DGEQPG ANCSPEGLVRQVK+ATK AGAELAGENALERYD   + QVLAT RS
Sbjct  418   FTCMEMRDGEQPGEANCSPEGLVRQVKLATKTAGAELAGENALERYDGGAFSQVLATGRS  477

Query  1479  DSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK  1658
              SGNGL+AFTYLRMNK LFE +NWR  VEFV+SMSEGG++TRLP+ D   TDLYVG IK+
Sbjct  478   GSGNGLNAFTYLRMNKRLFEADNWRNFVEFVRSMSEGGQNTRLPDSDRIGTDLYVGFIKQ  537

Query  1659  RNAKNANEAVLV  1694
              N +   EA LV
Sbjct  538   NNVRKTCEAALV  549



>ref|XP_007039629.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 ref|XP_007039630.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 ref|XP_007039633.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 gb|EOY24130.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 gb|EOY24131.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 gb|EOY24134.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
Length=575

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/552 (77%), Positives = 474/552 (86%), Gaps = 8/552 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGV-KNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             M LTLRSSTSF NLKE K + K PDDF   +CF+Q K SC  R +   SMQ+A L S   
Sbjct  27    MTLTLRSSTSFFNLKETKSLTKTPDDFLGTICFAQTKPSCRLRAKNSMSMQDAQLSSHGK  86

Query  231   ----EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMAL  398
                 EGR +E RE+LHGL  + + + S RVPVF+MLPLDTIT+GGNLNK R+MNASLMAL
Sbjct  87    VSIGEGRNSENREKLHGLTISHNENDS-RVPVFVMLPLDTITLGGNLNKQRAMNASLMAL  145

Query  399   RSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDS  578
             +SAGVEGVMVDAWWGLVEKDGPLKYNWEGYA LV+MV++HGLKLQVVMSFHQCGGNVGDS
Sbjct  146   KSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAELVQMVEKHGLKLQVVMSFHQCGGNVGDS  205

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             CSIPLPPWVLEEISKNPDLVYT+RSGRRNPEYISLGCD +PVLRGRTP+Q Y DYMRSFR
Sbjct  206   CSIPLPPWVLEEISKNPDLVYTERSGRRNPEYISLGCDSIPVLRGRTPIQAYTDYMRSFR  265

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             ERF++Y+G VIVE+QVGMGPCGELRYP+YPESNGTW+FPGIGEFQCYDKYMRASL A+AE
Sbjct  266   ERFRDYLGRVIVEIQVGMGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLEAAAE  325

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A GK +WG+ GPHD+G Y QFPE+TGFFRRDGTW TEYGQFFLEWYSGKLLEHGDRIL A
Sbjct  326   AIGKKDWGKGGPHDSGHYKQFPEETGFFRRDGTWNTEYGQFFLEWYSGKLLEHGDRILAA  385

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFN  1298
             A G+F GTGA LSGKIAGIHWHY TRSHAAEL AGYYNTR R+GYLPIA ML+KHGVVFN
Sbjct  386   AKGIFHGTGAILSGKIAGIHWHYRTRSHAAELTAGYYNTRHRDGYLPIAQMLSKHGVVFN  445

Query  1299  FTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRS  1478
             FTCMEM+DGEQP  ANCSPEGLVRQVK+AT+ AG ELAGENALERYD+  Y QVLATSRS
Sbjct  446   FTCMEMRDGEQPDQANCSPEGLVRQVKMATRTAGGELAGENALERYDAGAYSQVLATSRS  505

Query  1479  DSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK  1658
             DSGNGLSAFTYLRMNK LFE  NWR LVEFVK+MSEGGR  ++ ECDS  T+LY+G I++
Sbjct  506   DSGNGLSAFTYLRMNKRLFEGGNWRHLVEFVKNMSEGGR--KISECDSRGTNLYIGFIRE  563

Query  1659  RNAKNANEAVLV  1694
             +N +   EA  V
Sbjct  564   KNVEKMKEAAPV  575



>ref|XP_006385589.1| beta-amylase family protein [Populus trichocarpa]
 gb|ABK95564.1| unknown [Populus trichocarpa]
 gb|ERP63386.1| beta-amylase family protein [Populus trichocarpa]
Length=548

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/550 (76%), Positives = 473/550 (86%), Gaps = 5/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M +TLRSSTSFI+L+  + +K PD F   VCF+Q K SC  RL+AK+S QEA L    + 
Sbjct  1     MTITLRSSTSFISLRHTRSLKTPDGFSGTVCFAQIKPSC--RLQAKNSKQEAQLSQDDIL  58

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               EGR ++  E+LH ++     SS+SRVPVF+MLPLDT+T+GGNLNKPR+MNASLMALRS
Sbjct  59    VTEGRKSKNWEKLHAISGPDHSSSNSRVPVFVMLPLDTVTIGGNLNKPRAMNASLMALRS  118

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGPLKYNWEGYA LV+MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  119   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAELVQMVQKHGLKLQVVMSFHQCGGNVGDSCS  178

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEE+SKN DLVYTD+SGRRNPEYISLGCD LP+LRGRTP+QVY+DYMRSFR R
Sbjct  179   IPLPPWVLEEMSKNLDLVYTDKSGRRNPEYISLGCDSLPLLRGRTPIQVYSDYMRSFRNR  238

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             FK+Y+G VI E+QVGMGPCGELRYP+YPES GTW FPGIGEFQCYDKYMRASL ASAEA 
Sbjct  239   FKDYLGQVITEIQVGMGPCGELRYPAYPESKGTWNFPGIGEFQCYDKYMRASLEASAEAV  298

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG+ GPHD+GQYNQFPE+TGFFRRDGTW TEYGQFFLEWYSGKLLEHGD+IL AA 
Sbjct  299   GKTGWGQRGPHDSGQYNQFPEETGFFRRDGTWNTEYGQFFLEWYSGKLLEHGDKILAAAE  358

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+F+GTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR  +GYLP+A M +KHGVVFNFT
Sbjct  359   GIFRGTGAKLSGKVAGIHWHYGTRSHAAELTAGYYNTRHHDGYLPMARMFSKHGVVFNFT  418

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQP  ANCSPEGLVRQVK+AT+ A  ELAGENALERYD+  + QV+ATSRS+S
Sbjct  419   CMEMRDGEQPQHANCSPEGLVRQVKMATRTARTELAGENALERYDAGAFSQVMATSRSES  478

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NW  LV+FV+SMSEGGR  +L ECDSS T+LYVG IK ++
Sbjct  479   GNGLTAFTYLRMNKRLFEGDNWLHLVQFVESMSEGGRHGKLSECDSSGTNLYVGFIKDKS  538

Query  1665  AKNANEAVLV  1694
              +   E  L 
Sbjct  539   VQKTTEVALA  548



>ref|XP_009802914.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana sylvestris]
Length=549

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/552 (78%), Positives = 474/552 (86%), Gaps = 8/552 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAAL-----L  218
             M L + SSTSFIN+KE KG+K PDDF  +V F+Q K SC   L  KSSMQEA L     +
Sbjct  1     MTLAVHSSTSFINIKETKGIKTPDDFLGMVSFAQTKPSC--LLITKSSMQEAHLSHERVI  58

Query  219   SQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMAL  398
               P+EGR NEKRE+LH L    S++S++ VPVF+MLPLDT+TMGG LNKPR MNASL+AL
Sbjct  59    GNPIEGRKNEKREKLHVLTTTHSNNSTA-VPVFVMLPLDTVTMGGKLNKPRLMNASLIAL  117

Query  399   RSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDS  578
             RSAGVEGVMVDAWWGLVEKDGP KYNWEGYA LVKM +EHGLKLQVVMSFHQCGGNVGDS
Sbjct  118   RSAGVEGVMVDAWWGLVEKDGPHKYNWEGYAELVKMCKEHGLKLQVVMSFHQCGGNVGDS  177

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             CSIPLPPWVLE+I KNPDLVYTDRSGRRNPEYISLGCD LPVL GRTP+QVYADYMRSFR
Sbjct  178   CSIPLPPWVLEDIGKNPDLVYTDRSGRRNPEYISLGCDMLPVLNGRTPIQVYADYMRSFR  237

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             ERF +Y+G+VIVE+QVG+GPCGELRYPSYPESNGTWRFPGIGEFQ YDKYMRASLAASA+
Sbjct  238   ERFNDYLGDVIVEIQVGLGPCGELRYPSYPESNGTWRFPGIGEFQNYDKYMRASLAASAK  297

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A GK +WG+ GPHD+G+YNQFPEDTGFF+ DGTW +EYG+FFLEWYSGKLLEHGDRIL A
Sbjct  298   AAGKDDWGQGGPHDSGKYNQFPEDTGFFQNDGTWNSEYGKFFLEWYSGKLLEHGDRILGA  357

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFN  1298
             A  ++QGTGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR+ NGYLPIA M  KH VVFN
Sbjct  358   AESIYQGTGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRDTNGYLPIARMFGKHHVVFN  417

Query  1299  FTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRS  1478
             FTCMEM+DGEQP SANCSPEGLVRQVK AT+ +  ELAGENALERYD   Y QVLATSRS
Sbjct  418   FTCMEMRDGEQPQSANCSPEGLVRQVKKATRTSEVELAGENALERYDGGAYSQVLATSRS  477

Query  1479  DSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK  1658
             DSGN LSAFT+LRMNK LFEPENW+ L +FVKSMSEGGR+ R PECDSSR DLYVG IKK
Sbjct  478   DSGNALSAFTFLRMNKRLFEPENWQNLGQFVKSMSEGGRNARRPECDSSRADLYVGFIKK  537

Query  1659  RNAKNANEAVLV  1694
              ++    E  LV
Sbjct  538   THSMKVQEIALV  549



>ref|XP_010110537.1| hypothetical protein L484_023371 [Morus notabilis]
 gb|EXC26755.1| hypothetical protein L484_023371 [Morus notabilis]
Length=544

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/548 (77%), Positives = 471/548 (86%), Gaps = 5/548 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRA-KSSMQEAALLSQPL  230
             MALTLRSS  F+NLK+ KG+K PDD    VCF+Q K SC  RLRA KSSM+EA +  +  
Sbjct  1     MALTLRSSNYFLNLKDTKGLKTPDDLSGTVCFAQIKPSC--RLRATKSSMKEAQISHEKN  58

Query  231   EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
                   +RE+LH L+++ S  + SRVPVF+MLPLDT+T+GGNLNKPR+MNASLMAL++AG
Sbjct  59    FTPEGVRREKLHVLSSSHSPKNDSRVPVFVMLPLDTLTLGGNLNKPRAMNASLMALKAAG  118

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVDAWWGLVEKDGPLKYNWEGYA LV+MV++HGLKLQ VMSFHQCGGNVGDSCSIP
Sbjct  119   VEGVMVDAWWGLVEKDGPLKYNWEGYAELVQMVEKHGLKLQFVMSFHQCGGNVGDSCSIP  178

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWVLEEISKNPDLVYTDR GRRNPEYISLGCD LPVLRGRTP+QVY DYMRSFRERF+
Sbjct  179   LPPWVLEEISKNPDLVYTDRLGRRNPEYISLGCDSLPVLRGRTPIQVYTDYMRSFRERFR  238

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
             +++G+VIVEVQVGMGPCGELRYP+YPESNGTW+FPGIGEFQCYDKYMRASL ASAEA GK
Sbjct  239   DFLGDVIVEVQVGMGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLEASAEAIGK  298

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
              +WG+SGPHDAGQY QFPE+TGFFR DGTWKTEYGQFFLEWYS KL  HGDRIL AA GV
Sbjct  299   RDWGQSGPHDAGQYRQFPEETGFFRNDGTWKTEYGQFFLEWYSTKLSAHGDRILAAAKGV  358

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCM  1310
             F GT AKLSGKIAGIHWHY TRSHAAEL AGYYNTR RNGY  +A + AKH V+FNFTCM
Sbjct  359   FHGTRAKLSGKIAGIHWHYRTRSHAAELTAGYYNTRNRNGYSALAQIFAKHDVIFNFTCM  418

Query  1311  EMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGN  1490
             EMKDGEQP   +CSPEGLV+QVK+ T+ A  ELAGENALERYD+  Y +VLATSRSDSGN
Sbjct  419   EMKDGEQP--QHCSPEGLVQQVKMTTRSARIELAGENALERYDASAYGRVLATSRSDSGN  476

Query  1491  GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNAK  1670
             GL AFTYLRMNK LFE +NWR LVEFVKSMSEGGR+ RL ECDS+ TDLYVG IK++N K
Sbjct  477   GLCAFTYLRMNKRLFEGDNWRNLVEFVKSMSEGGRNRRLSECDSTGTDLYVGFIKEKNVK  536

Query  1671  NANEAVLV  1694
                EA LV
Sbjct  537   QTKEAALV  544



>ref|XP_009792527.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana sylvestris]
Length=548

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/553 (79%), Positives = 488/553 (88%), Gaps = 11/553 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             M+LTL SSTSFIN KE K  +  DD  ++ CF+Q K S H  L+AK+S +E    +  +E
Sbjct  1     MSLTLHSSTSFINKKETKNSRTHDDISNMTCFAQTKPSFH--LKAKNS-KEIQFFAPNME  57

Query  234   GR-VN--EKRERLHGLAANQSHSSSSR---VPVFIMLPLDTITMGGNLNKPRSMNASLMA  395
             GR +N  E+ E+LH L  + +HS++SR   VPVF+MLPLDTI +GGNLNKPR+MNASLMA
Sbjct  58    GRNINNEEEGEKLHVLTTS-THSNNSRTTKVPVFVMLPLDTINIGGNLNKPRAMNASLMA  116

Query  396   LRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGD  575
             L+SAGVEGVMVD WWGLVEKDGPLKYNW+GY  LVKMVQEHGLKLQVVMSFHQCGGNVGD
Sbjct  117   LKSAGVEGVMVDCWWGLVEKDGPLKYNWDGYYELVKMVQEHGLKLQVVMSFHQCGGNVGD  176

Query  576   SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSF  755
             SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LPV+RGRTP+QVY ++MRSF
Sbjct  177   SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDLLPVIRGRTPIQVYTEFMRSF  236

Query  756   RERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASA  935
             RERFK Y+G+VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM+ASLAA+A
Sbjct  237   RERFKNYLGDVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKASLAAAA  296

Query  936   EAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILT  1115
             EA GK++WGR GPHD+GQYNQFPEDTGFF+RDGTW  EYGQFFLEWYSGKLLEHGDRIL 
Sbjct  297   EAKGKNDWGRGGPHDSGQYNQFPEDTGFFKRDGTWNNEYGQFFLEWYSGKLLEHGDRILG  356

Query  1116  AAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVF  1295
             +A G+F+GTGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR R+GYLPIA M AKHGVVF
Sbjct  357   SAEGIFRGTGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRHRDGYLPIARMFAKHGVVF  416

Query  1296  NFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR  1475
             NFTCMEM+DGEQP SANCSPEGLVRQVK AT+ AG ELAGENALERYD  GY QVLATS+
Sbjct  417   NFTCMEMRDGEQPQSANCSPEGLVRQVKKATQIAGIELAGENALERYDGGGYAQVLATSK  476

Query  1476  SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK  1655
             S+SGNGLSAFTYLR+NK LFEPENWR LVEFVK+MSEGG+ TRLPECD+SRTDLYVG +K
Sbjct  477   SESGNGLSAFTYLRLNKRLFEPENWRNLVEFVKNMSEGGK-TRLPECDTSRTDLYVGFVK  535

Query  1656  KRNAKNANEAVLV  1694
             + +AK   EAV+V
Sbjct  536   ESHAKKTAEAVVV  548



>ref|XP_008448759.1| PREDICTED: beta-amylase 3, chloroplastic [Cucumis melo]
Length=537

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/541 (78%), Positives = 470/541 (87%), Gaps = 11/541 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNP--DDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP  227
             M LTLRSSTSFINLK+ K +K P  +D   I+ F Q K     RLR +SS+QE  +    
Sbjct  1     MTLTLRSSTSFINLKDTKIIKAPLLEDLHGIISFKQAKPPS--RLRIRSSLQETKI----  54

Query  228   LEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
                R  EK E+LH L++N  H+   RVPVF+MLPLDT+T+GG+LNKPR+MNASLMAL+SA
Sbjct  55    --ERGGEKLEKLHSLSSNH-HTDDLRVPVFVMLPLDTVTLGGSLNKPRAMNASLMALKSA  111

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEGVMVDAWWGLVEKDGP+KYNWEGYA LV+MVQ+HGLKLQVVMSFHQCGGNVGDSCSI
Sbjct  112   GVEGVMVDAWWGLVEKDGPMKYNWEGYAELVQMVQKHGLKLQVVMSFHQCGGNVGDSCSI  171

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LPVLRGRTP+QVYADYMRSFR+RF
Sbjct  172   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDSLPVLRGRTPIQVYADYMRSFRDRF  231

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
             ++Y+G VI+EVQVG GPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL A+AEA G
Sbjct  232   RDYLGEVIMEVQVGAGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLEAAAEAIG  291

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
             K +WG SGPHD+GQYNQFPEDTGFF+++GTWKTEYG+FFL WYS KLL+HGD IL AA G
Sbjct  292   KRDWGSSGPHDSGQYNQFPEDTGFFKKEGTWKTEYGEFFLAWYSSKLLQHGDSILAAAKG  351

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +F+GTGAKLS K+AGIHWHY TRSHAAEL AGYYNTR R+GY PIA MLAKHGVVFNFTC
Sbjct  352   IFRGTGAKLSAKVAGIHWHYGTRSHAAELTAGYYNTRHRDGYSPIAKMLAKHGVVFNFTC  411

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEM+DG+QPG ANCSPEGLVRQVK+AT+DA  ELAGENALERYD   YEQ+LATSRSDSG
Sbjct  412   MEMRDGQQPGYANCSPEGLVRQVKMATRDAKVELAGENALERYDGAAYEQILATSRSDSG  471

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNA  1667
             NGL+AFTYLRMNKNLFEP NWR LVEFVKSMSEGGR+ RLPE D   +DL+VG IK++  
Sbjct  472   NGLAAFTYLRMNKNLFEPNNWRNLVEFVKSMSEGGRNRRLPESDCCGSDLHVGFIKEKKI  531

Query  1668  K  1670
             K
Sbjct  532   K  532



>gb|KDP45986.1| hypothetical protein JCGZ_11889 [Jatropha curcas]
Length=547

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/550 (77%), Positives = 470/550 (85%), Gaps = 6/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP--  227
             M LTL SSTSFINLK+ K +K+ DDF   +CF+Q K S   RL+AK+S+QEA L      
Sbjct  1     MTLTLHSSTSFINLKDTKSLKSFDDFSGTICFAQIKPSG--RLQAKNSVQEAQLSHDNIF  58

Query  228   -LEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
              +EG  +EKRE++H ++   S S+ ++VPVF+MLPLDTIT+ GNLNKPR+MNASLMAL+S
Sbjct  59    MMEGMESEKREKVHAISGPHS-SNDTKVPVFVMLPLDTITIRGNLNKPRAMNASLMALKS  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGV GVMVDAWWGLVEKDGPLKYNWEGYA LV+MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVAGVMVDAWWGLVEKDGPLKYNWEGYAELVQMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LPVLRGRTP+Q Y DYMRSFR R
Sbjct  178   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDSLPVLRGRTPIQAYTDYMRSFRNR  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F +Y+G VIVE+QVGMGPCGELRYPSYPESNGTW+FPGIGEFQCYDKYM+ASL ASAEA 
Sbjct  238   FSDYLGEVIVEIQVGMGPCGELRYPSYPESNGTWKFPGIGEFQCYDKYMKASLEASAEAI  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK +WGRSGPH+AG Y QFPE+TGFF+RDGTW TEYGQFFLEWYSGKLL HGD IL AA 
Sbjct  298   GKKDWGRSGPHNAGHYKQFPEETGFFQRDGTWNTEYGQFFLEWYSGKLLNHGDGILAAAK  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQGTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR  +GYLPIA   +KHGVVFNFT
Sbjct  358   GIFQGTGAKLSGKVAGIHWHYRTRSHAAELTAGYYNTRHHDGYLPIARTFSKHGVVFNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+D EQP SANCSPEGLVRQVK+ TK AG ELAGENALERYD+  + QVLATSRS+S
Sbjct  418   CMEMQDKEQPESANCSPEGLVRQVKMVTKTAGVELAGENALERYDAGAHAQVLATSRSES  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL AFTYLRMNK LFE +NWR LVEFVKSMSE G++ RLPECD+  T+ YV  IK +N
Sbjct  478   GNGLVAFTYLRMNKKLFEADNWRNLVEFVKSMSEHGQNKRLPECDTQGTNFYVRFIKDKN  537

Query  1665  AKNANEAVLV  1694
              K   EA L+
Sbjct  538   VKRTKEAALI  547



>ref|XP_004147264.1| PREDICTED: beta-amylase 3, chloroplastic-like [Cucumis sativus]
 gb|KGN55808.1| hypothetical protein Csa_3G017020 [Cucumis sativus]
Length=538

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/542 (78%), Positives = 470/542 (87%), Gaps = 12/542 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNP--DDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP  227
             M LTLRSSTSFINLK+ K +K P  +D   I+ F Q K     RLR +SS+QE  +    
Sbjct  1     MTLTLRSSTSFINLKDTKIIKAPLLEDLHGIISFKQAKPLS--RLRIRSSLQETRI----  54

Query  228   LEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
                R  EK E+LH L++N  H++  RVPVF+MLPLDT+T+GG+LNKPR+MNASLMAL+SA
Sbjct  55    --ERGGEKLEKLHSLSSNH-HTNDLRVPVFVMLPLDTVTLGGSLNKPRAMNASLMALKSA  111

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEGVMVDAWWGLVEKDGP+KYNWEGYA LV+MVQ+HGLKLQVVMSFHQCGGNVGDSCSI
Sbjct  112   GVEGVMVDAWWGLVEKDGPMKYNWEGYAELVQMVQKHGLKLQVVMSFHQCGGNVGDSCSI  171

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD LPVLRGRTP+QVYADYMRSFR+RF
Sbjct  172   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDSLPVLRGRTPIQVYADYMRSFRDRF  231

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
             ++Y+G VI EVQVG GPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL A+AEA G
Sbjct  232   RDYLGEVITEVQVGAGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLEAAAEAIG  291

Query  948   KSEWGRS-GPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             K +WG S GPHD+GQYNQFPEDTGFF+++GTWKTEYG+FFL WYS KLL+HGD IL AA 
Sbjct  292   KRDWGSSGGPHDSGQYNQFPEDTGFFKKEGTWKTEYGEFFLAWYSSKLLQHGDSILAAAK  351

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+F+GTGAKLS K+AGIHWHY TRSHAAEL AGYYNTR R+GY PIA MLAKHGVVFNFT
Sbjct  352   GIFRGTGAKLSAKVAGIHWHYGTRSHAAELTAGYYNTRHRDGYSPIAKMLAKHGVVFNFT  411

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DG+QPG ANCSPEGLVRQVK+AT+DA  ELAGENALERYD   YEQ+LATSRSDS
Sbjct  412   CMEMRDGQQPGHANCSPEGLVRQVKMATRDAKVELAGENALERYDGAAYEQILATSRSDS  471

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNKNLFEP NWR LVEFVKSMSEGGR+ RLPE D   +DL+VG IK++ 
Sbjct  472   GNGLAAFTYLRMNKNLFEPNNWRNLVEFVKSMSEGGRNRRLPESDCCGSDLHVGFIKEKK  531

Query  1665  AK  1670
              K
Sbjct  532   IK  533



>ref|XP_008229498.1| PREDICTED: beta-amylase 3, chloroplastic [Prunus mume]
Length=547

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/549 (76%), Positives = 471/549 (86%), Gaps = 4/549 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTLRSSTSFINL + K +K  D+    +C++Q K +C  RLRAKSSMQE  LL +   
Sbjct  1     MTLTLRSSTSFINLNDHKSLKASDESSWTICYAQIKPTC--RLRAKSSMQETQLLHENTL  58

Query  231   -EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
                  + +RE LH L      S+ S+VPV++MLPLDT++ GG+LNKPR+MNASLMAL++A
Sbjct  59    KTACTDGRREMLHALPNIAHSSNGSKVPVYVMLPLDTVSHGGHLNKPRAMNASLMALKNA  118

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEGVMVDAWWGLVEKDGP KYNWEGYA LV+MVQ+HGLK+QVVMSFHQCGGNVGDSCSI
Sbjct  119   GVEGVMVDAWWGLVEKDGPSKYNWEGYAELVQMVQKHGLKIQVVMSFHQCGGNVGDSCSI  178

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLPPWVLEE+SKNPDLVYTD+SGRRNPEYISLGCD LPVL GRTP+QVY DYMRSF +RF
Sbjct  179   PLPPWVLEEVSKNPDLVYTDKSGRRNPEYISLGCDSLPVLGGRTPIQVYTDYMRSFHDRF  238

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
             ++Y+GNVIVE+QVGMGPCGELRYP+YPESNGTWRFPGIGEFQCYDKYMRASL ASAEA G
Sbjct  239   RDYLGNVIVEIQVGMGPCGELRYPAYPESNGTWRFPGIGEFQCYDKYMRASLEASAEALG  298

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
             K +WGRSGPHDAGQYNQFPEDTGFF+RDGTW TEYGQFF+EWYSGKLL HGDRILTAA G
Sbjct  299   KRDWGRSGPHDAGQYNQFPEDTGFFKRDGTWNTEYGQFFMEWYSGKLLRHGDRILTAAKG  358

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             VFQG+GAKLSGKIAGIHWHY +RSHAAEL AGYYNTR R+GYLP A M +K+GVV NFTC
Sbjct  359   VFQGSGAKLSGKIAGIHWHYGSRSHAAELTAGYYNTRHRDGYLPTARMFSKNGVVLNFTC  418

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEMKD EQP  ANCSPEGLVRQVK+ATK AG +LAGENALERYD+  +EQ+LATSRSDSG
Sbjct  419   MEMKDREQPAHANCSPEGLVRQVKMATKSAGIDLAGENALERYDTGAFEQILATSRSDSG  478

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNA  1667
             N LSAFTYLRMNK LFE +NWR +VEFV+ M+EGGR+  L ECDS+ ++L+V  IK++N 
Sbjct  479   NALSAFTYLRMNKRLFEGDNWRNMVEFVRGMAEGGRNRSLSECDSTGSNLFVRFIKEKNV  538

Query  1668  KNANEAVLV  1694
             K   E VLV
Sbjct  539   KKTKETVLV  547



>ref|XP_004244551.1| PREDICTED: beta-amylase 3, chloroplastic-like [Solanum lycopersicum]
Length=542

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/549 (76%), Positives = 474/549 (86%), Gaps = 9/549 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MALT  SSTSFIN KE K  +  DD  S++CF++     ++ L+AKS  QE   L+  +E
Sbjct  1     MALTPCSSTSFINKKERKNYRTHDDISSMICFAKINPPSYN-LKAKSYNQEVQFLNPNME  59

Query  234   GRVNEKRERLHGLAA--NQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
                  ++E+ H L +  + ++SSS++VPVF+MLPLDTI++GGN+NKPR+MNASLMAL+ A
Sbjct  60    -----EKEKFHMLTSGTHSNNSSSTKVPVFVMLPLDTISIGGNMNKPRAMNASLMALKGA  114

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEGVMVD WWGLVEKDGPLKYNWEGY  LVKMVQ +GLKLQVVMSFHQCGGNVGDSCSI
Sbjct  115   GVEGVMVDCWWGLVEKDGPLKYNWEGYDELVKMVQANGLKLQVVMSFHQCGGNVGDSCSI  174

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLPPWVLEEISKNPD+VYTDRSGRRNPEYISLGCDQLPVLRGRTP+QVY DYMRSFRE+F
Sbjct  175   PLPPWVLEEISKNPDIVYTDRSGRRNPEYISLGCDQLPVLRGRTPIQVYTDYMRSFREKF  234

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
             K Y+G+VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM+ASLAASA A G
Sbjct  235   KNYLGDVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKASLAASAHAMG  294

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
             K  WGR GPHD+GQYNQFPE+TGFF++DGTW +EYGQFFLEWYS KLLEHGD IL +A G
Sbjct  295   KESWGRGGPHDSGQYNQFPEETGFFKKDGTWNSEYGQFFLEWYSRKLLEHGDNILASAEG  354

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +F+GTG KLSGK+AGIHWHYNTRSHAAEL AGYYNTR ++GYLPIA M AK GVVFNFTC
Sbjct  355   IFKGTGCKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNKDGYLPIARMFAKRGVVFNFTC  414

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEM+DGEQP SANCSPEGLVRQVK AT++ G ELAGENALERYD  GY QVL+TSR+DSG
Sbjct  415   MEMRDGEQPHSANCSPEGLVRQVKNATRNVGVELAGENALERYDGGGYAQVLSTSRADSG  474

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNA  1667
             NGLSAFTYLR+NK LFEPENWR LVEFVK+MSEGG STRLPECDSSRTDLYV  +K+ +A
Sbjct  475   NGLSAFTYLRLNKRLFEPENWRNLVEFVKNMSEGG-STRLPECDSSRTDLYVRFVKQTHA  533

Query  1668  KNANEAVLV  1694
             K   E  +V
Sbjct  534   KRTTEVAVV  542



>ref|XP_007209867.1| hypothetical protein PRUPE_ppa003812mg [Prunus persica]
 gb|EMJ11066.1| hypothetical protein PRUPE_ppa003812mg [Prunus persica]
Length=547

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/550 (76%), Positives = 473/550 (86%), Gaps = 6/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP--  227
             M LTLRSSTSFINL + K +K  D+    +C++Q K +C  RLRAKSSMQE  LL +   
Sbjct  1     MTLTLRSSTSFINLNDHKSLKASDESSGTICYAQIKPTC--RLRAKSSMQETQLLQEKTL  58

Query  228   LEGRVNEKRERLHGLAANQSHSSS-SRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
             +    + +RE LH L  N +HSS+ S+VPV++MLPLDT++ GG+LNKPR+MNASLMAL++
Sbjct  59    MTAGTDGRREMLHALP-NIAHSSNGSKVPVYVMLPLDTVSHGGHLNKPRAMNASLMALKN  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP KYNWEGYA LV+MVQ+HGLK+QVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPSKYNWEGYAELVQMVQKHGLKIQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEE+S NPDLVYTD+SGRRNPEYISLGCD LPVL GRTP+QVY DYMRSF +R
Sbjct  178   IPLPPWVLEEVSMNPDLVYTDKSGRRNPEYISLGCDSLPVLGGRTPIQVYTDYMRSFHDR  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F++Y+GNVIVE+QVGMGPCGELRYP+YPESNGTWRFPGIGEFQCYDKYM ASL ASAEA 
Sbjct  238   FRDYLGNVIVEIQVGMGPCGELRYPAYPESNGTWRFPGIGEFQCYDKYMSASLEASAEAL  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK +WGRSGPHDAGQYNQFPEDTGFF+RDGTW TEYGQFFLEWYSGKLL HGDRILTAA 
Sbjct  298   GKRDWGRSGPHDAGQYNQFPEDTGFFKRDGTWNTEYGQFFLEWYSGKLLRHGDRILTAAK  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             GVFQG+GAKLSGKIAGIHWHY +RSHAAEL AGYYNTR R+GYLP A M +K+GVV NFT
Sbjct  358   GVFQGSGAKLSGKIAGIHWHYGSRSHAAELTAGYYNTRHRDGYLPTARMFSKNGVVLNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKD EQP  ANCSPEGLVRQVK+ATK AG +LAGENALERYD+  +EQVLATSRSDS
Sbjct  418   CMEMKDREQPAHANCSPEGLVRQVKMATKSAGIDLAGENALERYDTGAFEQVLATSRSDS  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GN LSAFTYLRMNK LFE +NWR +VEFV+ M +GGR+  L ECDS+ ++L+V  IK++N
Sbjct  478   GNALSAFTYLRMNKRLFEADNWRNMVEFVRGMGDGGRNRSLSECDSTGSNLFVRFIKEKN  537

Query  1665  AKNANEAVLV  1694
              K   E VLV
Sbjct  538   VKKTKETVLV  547



>ref|XP_009612895.1| PREDICTED: beta-amylase 3, chloroplastic [Nicotiana tomentosiformis]
Length=546

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/549 (78%), Positives = 473/549 (86%), Gaps = 5/549 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MALT  SSTSFIN+ E KG+K PDDF  +V F+  K SC   +  KSSMQEA L  + + 
Sbjct  1     MALTPHSSTSFINITETKGIKTPDDFLGMVSFALTKPSCRLMI-TKSSMQEAHLSHERVI  59

Query  234   GRVNEKRERLHGLAANQSH-SSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
             G  NE+RE+LH L    S+ +SS++VPVF+MLPLDTITMGGNLNKPR+M+ SLMAL+SAG
Sbjct  60    G--NEEREKLHVLTTTHSNINSSTKVPVFVMLPLDTITMGGNLNKPRAMHVSLMALKSAG  117

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVDAWWGLVEKDGPLKYNWEGYA LVKM +EHGLKLQVVMSFHQCGGNVGDSCSIP
Sbjct  118   VEGVMVDAWWGLVEKDGPLKYNWEGYAELVKMCKEHGLKLQVVMSFHQCGGNVGDSCSIP  177

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWVLE+I KNPDLVYTDRSGRRNPEYISLGCD LPVL+GRTP+QVY DYMRSFRERF 
Sbjct  178   LPPWVLEDIGKNPDLVYTDRSGRRNPEYISLGCDMLPVLKGRTPIQVYTDYMRSFRERFS  237

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
              Y+G+VIVE+QVG+GPCGELRYPSYPESNGTWRFPGIGEFQ YDKYMRASLAASA A GK
Sbjct  238   HYLGDVIVEIQVGLGPCGELRYPSYPESNGTWRFPGIGEFQNYDKYMRASLAASANAAGK  297

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
              +WG+ GPHD+GQYNQFPEDTGFF+RDGTW +EYG+FFLEWYSGKLLEHGDRIL AA  +
Sbjct  298   DDWGQGGPHDSGQYNQFPEDTGFFQRDGTWNSEYGKFFLEWYSGKLLEHGDRILGAAESI  357

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSH-AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +QGTGAKLSGK+AGIHWHYNTRSH AAEL AGYYNTR+ NGYLPI+ M  KH VVFNFTC
Sbjct  358   YQGTGAKLSGKVAGIHWHYNTRSHAAAELTAGYYNTRDTNGYLPISRMFGKHRVVFNFTC  417

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEM+DGEQP SANCSPEGLVRQVK AT+ +  ELAGENALERYD   Y QVLATSRSDSG
Sbjct  418   MEMRDGEQPQSANCSPEGLVRQVKKATRTSEVELAGENALERYDEGAYSQVLATSRSDSG  477

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNA  1667
             N LSAFT+LRMNK LFEPENW+ L +FVKSMSEGGR+ R PECDSSRTDLYVG IKK ++
Sbjct  478   NALSAFTFLRMNKRLFEPENWQNLGQFVKSMSEGGRNARRPECDSSRTDLYVGFIKKTHS  537

Query  1668  KNANEAVLV  1694
                 E  LV
Sbjct  538   MKVKEIALV  546



>ref|XP_006362484.1| PREDICTED: beta-amylase 3, chloroplastic-like [Solanum tuberosum]
Length=541

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/549 (77%), Positives = 473/549 (86%), Gaps = 10/549 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKR-SCHHRLRAKSSMQEAALLSQPL  230
             MALT  SSTSFIN KE K  +  DD  S++CF++    SC+  L+AKSS QE   L+  +
Sbjct  1     MALTPCSSTSFINKKERKNYRTHDDISSMICFAKINPPSCN--LKAKSSNQEVQFLNPNM  58

Query  231   EGRVNEKRERLHGLAA-NQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
             E     ++E+ H L +   S++SS++VPVF+MLPLDTI++GGN+NKPR+MNASLMAL+SA
Sbjct  59    E-----EKEKFHMLTSGTHSNNSSTKVPVFVMLPLDTISIGGNMNKPRAMNASLMALKSA  113

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEGVMVD WWGLVEKDGPLKYNWEGY  LVKMVQ +GLKLQVVMSFHQCGGNVGDSCSI
Sbjct  114   GVEGVMVDCWWGLVEKDGPLKYNWEGYDELVKMVQANGLKLQVVMSFHQCGGNVGDSCSI  173

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTP+QVY DYMRSFRERF
Sbjct  174   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPIQVYTDYMRSFRERF  233

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
             K Y+G+VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM+ASLAASA+A G
Sbjct  234   KNYLGDVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKASLAASADAMG  293

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
                WGR GPHD+GQYNQFPE+TGFF++DGTW +EYGQFFLEWYS KLLEHGD IL +A G
Sbjct  294   NESWGRGGPHDSGQYNQFPEETGFFKKDGTWNSEYGQFFLEWYSRKLLEHGDNILASAEG  353

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +F+GT  KLSGK+AGIHWHYNTRSHAAEL AGYYNTR ++GYLPIA M  K GVVFNFTC
Sbjct  354   IFKGTSCKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNKDGYLPIARMFVKRGVVFNFTC  413

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEM+DGEQP SANCSPEGLVRQVK AT++ G ELAGENALERYD  GY QVL+TSR+DSG
Sbjct  414   MEMRDGEQPHSANCSPEGLVRQVKNATRNVGVELAGENALERYDGGGYAQVLSTSRADSG  473

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNA  1667
             NGLSAFTYLR+NK LFEPENWR LVEFVK+MSEGG +TRLPECDSSRTDLYV  +K+  A
Sbjct  474   NGLSAFTYLRLNKRLFEPENWRNLVEFVKNMSEGG-NTRLPECDSSRTDLYVRFVKQSRA  532

Query  1668  KNANEAVLV  1694
             K   E  +V
Sbjct  533   KKNAEVAVV  541



>ref|XP_011032002.1| PREDICTED: beta-amylase 3, chloroplastic-like [Populus euphratica]
Length=547

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/550 (75%), Positives = 468/550 (85%), Gaps = 6/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M +TLRSSTSFI+L+  + +K PD F   VCF+Q K SC   L+AK+S QE  L    + 
Sbjct  1     MTITLRSSTSFISLRHGRSLKTPDGFSGTVCFAQIKPSC--SLQAKNSKQETQLSHDDIL  58

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               EGR ++  E+LH ++   S S++SRVPVF+MLPLDT+T+GGNLNKPR+MNASLMALRS
Sbjct  59    VTEGRKSKSWEKLHAISGPHS-SNNSRVPVFVMLPLDTVTIGGNLNKPRAMNASLMALRS  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AG EGVMVDAWWGLVEKDGPLKYNWEGYA LV MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGAEGVMVDAWWGLVEKDGPLKYNWEGYAELVHMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEE+SKN DLVYTD+SGRRNPEYISLGCD LP+LRGRTP+QVY+DYMRSFR R
Sbjct  178   IPLPPWVLEEMSKNHDLVYTDKSGRRNPEYISLGCDSLPLLRGRTPIQVYSDYMRSFRNR  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             FK+Y+G VI EVQVGMGPCGELRYP+YPES GTWRFPGIGEFQCYDKYMRASL ASAEA 
Sbjct  238   FKDYLGQVITEVQVGMGPCGELRYPAYPESKGTWRFPGIGEFQCYDKYMRASLEASAEAV  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG  GPHD+GQYNQFPE+TGFFRRDGTW TEYGQFFLEWYSGKLLEHGD+IL AA 
Sbjct  298   GKTGWGLRGPHDSGQYNQFPEETGFFRRDGTWNTEYGQFFLEWYSGKLLEHGDKILAAAE  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+F+GTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR  +GYL +A M +K+GVVFNFT
Sbjct  358   GIFRGTGAKLSGKVAGIHWHYRTRSHAAELTAGYYNTRHHDGYLTMARMFSKYGVVFNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQP  ANCSPEGLV+QVK+AT+ A  ELAGENALERYD+  Y QV+ATSRS+S
Sbjct  418   CMEMRDGEQPQHANCSPEGLVQQVKMATRTARIELAGENALERYDAGAYSQVMATSRSES  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NW  LV+FV SMSEGGR  +L ECDSS TDLYVG IK ++
Sbjct  478   GNGLTAFTYLRMNKRLFEGDNWLHLVQFVTSMSEGGRHGKLSECDSSGTDLYVGFIKDKS  537

Query  1665  AKNANEAVLV  1694
              +   E  L 
Sbjct  538   VQKTTEVALA  547



>emb|CAN62440.1| hypothetical protein VITISV_032500 [Vitis vinifera]
Length=543

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/548 (78%), Positives = 463/548 (84%), Gaps = 6/548 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MALTLRSSTSFIN K+ KG+K PD   S + F+  K  C   +RAK S QEA L  +   
Sbjct  1     MALTLRSSTSFINPKDTKGLKTPD-ISSSIFFTPSKPPC--SIRAKISTQEAHLCHENAM  57

Query  234   GRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGV  413
                  K + LHGL     + + SRVPVF+MLPLDT++ GGNLNKPR+MNASLMAL+SAGV
Sbjct  58    VSEGRKNQVLHGLPTPH-NKNGSRVPVFVMLPLDTVSFGGNLNKPRAMNASLMALKSAGV  116

Query  414   EGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPL  593
             EGVMVDAWWGLVEKDGP+KYNWEGYA LV+MVQ HGLKLQVVMSFHQCGGNVGDSCSIPL
Sbjct  117   EGVMVDAWWGLVEKDGPMKYNWEGYAELVQMVQRHGLKLQVVMSFHQCGGNVGDSCSIPL  176

Query  594   PPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKE  773
             PPWVLEEISKN DLVYTDRSGRRNPEYISLGCD +PVLRGRTP+QVY+DYMRSF  RFK+
Sbjct  177   PPWVLEEISKNTDLVYTDRSGRRNPEYISLGCDSIPVLRGRTPIQVYSDYMRSFHNRFKD  236

Query  774   YMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKS  953
             Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL ASA+A GK 
Sbjct  237   YLGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLEASADAVGKK  296

Query  954   EWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF  1133
             +WGRSGP DAG YNQFPEDTGFFRRDGTW TEYGQFFL+WYSGKLLEHGDRIL AA G+F
Sbjct  297   DWGRSGPQDAGHYNQFPEDTGFFRRDGTWTTEYGQFFLKWYSGKLLEHGDRILAAAEGIF  356

Query  1134  QGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCME  1313
             QGTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR  +GYLPIA M+ K+GVV NFTCME
Sbjct  357   QGTGAKLSGKVAGIHWHYKTRSHAAELTAGYYNTRNHDGYLPIARMMGKYGVVLNFTCME  416

Query  1314  MKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG  1493
             MKD EQ   ANCSPEGLVRQVK+ATK A  ELAGENALERYDS  Y QVLATSRSDSGNG
Sbjct  417   MKDREQQEHANCSPEGLVRQVKMATKTAXTELAGENALERYDSSAYAQVLATSRSDSGNG  476

Query  1494  LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLI-KKRNAK  1670
             LSAFTYLRMNK LFE +NWR LVEFV++MSEGGR+ RLPECDSS TD Y+G I KK++  
Sbjct  477   LSAFTYLRMNKRLFEGDNWRSLVEFVRNMSEGGRN-RLPECDSSGTDXYIGFIKKKKDVA  535

Query  1671  NANEAVLV  1694
                EA LV
Sbjct  536   KTMEAALV  543



>ref|XP_002282871.1| PREDICTED: beta-amylase 3, chloroplastic [Vitis vinifera]
Length=543

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/548 (78%), Positives = 465/548 (85%), Gaps = 6/548 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MALTLRSSTSFIN K+ KG+K PD   S + F+  K  C   +RAK S QEA L  +   
Sbjct  1     MALTLRSSTSFINPKDTKGLKTPD-ISSSIFFTPSKPPC--SIRAKISTQEAHLCHENAM  57

Query  234   GRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGV  413
                  K + LHGL     + + SRVPVF+MLPLDT++ GGNLNKPR+MNASLMAL+S+GV
Sbjct  58    VSEGRKNQVLHGLPTPH-NKNGSRVPVFVMLPLDTVSFGGNLNKPRAMNASLMALKSSGV  116

Query  414   EGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPL  593
             EGVMVDAWWGLVEKDGP+KYNWEGYA LV+MVQ HGLKLQVVMSFHQCGGNVGDSCSIPL
Sbjct  117   EGVMVDAWWGLVEKDGPMKYNWEGYAELVQMVQRHGLKLQVVMSFHQCGGNVGDSCSIPL  176

Query  594   PPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKE  773
             PPWVLEEISKN DLVYTDRSGRRNPEYISLGCD +PVLRGRTP+QVY+DYMRSF  RFK+
Sbjct  177   PPWVLEEISKNTDLVYTDRSGRRNPEYISLGCDSIPVLRGRTPIQVYSDYMRSFHNRFKD  236

Query  774   YMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKS  953
             Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL ASA+A GK 
Sbjct  237   YLGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLEASADAVGKK  296

Query  954   EWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF  1133
             +WGRSGP DAG YNQFPEDTGFFRRDGTW TEYGQFFL+WYSGKLLEHGDRIL AA G+F
Sbjct  297   DWGRSGPQDAGHYNQFPEDTGFFRRDGTWTTEYGQFFLKWYSGKLLEHGDRILAAAEGIF  356

Query  1134  QGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCME  1313
             QGTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR  +GYLPIA M+ K+GVV NFTCME
Sbjct  357   QGTGAKLSGKVAGIHWHYKTRSHAAELTAGYYNTRNHDGYLPIARMMGKYGVVLNFTCME  416

Query  1314  MKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG  1493
             MKD EQ   ANCSPEGLVRQVK+ATK AG ELAGENALERYDS  Y QVLATSRSDSGNG
Sbjct  417   MKDREQQEHANCSPEGLVRQVKMATKTAGTELAGENALERYDSSAYAQVLATSRSDSGNG  476

Query  1494  LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLI-KKRNAK  1670
             LSAFTYLRMNK LFE +NWR LVEFV++MSEGGR+ RLPECDSS TDLY+G I KK++  
Sbjct  477   LSAFTYLRMNKRLFEGDNWRSLVEFVRNMSEGGRN-RLPECDSSGTDLYIGFIKKKKDVA  535

Query  1671  NANEAVLV  1694
                EA LV
Sbjct  536   KTMEAALV  543



>ref|XP_004300297.1| PREDICTED: beta-amylase 3, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=553

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/557 (75%), Positives = 475/557 (85%), Gaps = 14/557 (3%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEI-KGVKNPDDFPS-IVCFSQFKRSCHHRLRAKSSMQEAALLSQP  227
             M LTLRSSTSFINLK+  KG+K  D+  S +VCF+Q K S   R+RAKSS+QEA L  + 
Sbjct  1     MTLTLRSSTSFINLKDYSKGLKTSDESSSGVVCFAQMKPS--FRIRAKSSLQEAQLFQER  58

Query  228   LEGRVNEK-----RERLHGL---AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNA  383
             +  RV+       RE LH L   A + +++ S +VPV++MLPLDT+T GG+LNKPR+MN 
Sbjct  59    I--RVSSTTDDLPRELLHALPSIAHSSNNNDSKKVPVYVMLPLDTVTHGGHLNKPRAMNV  116

Query  384   SLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGG  563
             SLMAL++AGVEGVMVDAWWGLVEKDGP KYNWEGYA LV +VQ HGLK+QVVMSFHQCGG
Sbjct  117   SLMALKNAGVEGVMVDAWWGLVEKDGPSKYNWEGYAELVNLVQRHGLKIQVVMSFHQCGG  176

Query  564   NVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADY  743
             NVGDSCSIPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD LPVLRGRTP+Q Y DY
Sbjct  177   NVGDSCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSLPVLRGRTPIQAYTDY  236

Query  744   MRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL  923
             M+SF +RF++YMG+VIVE+QVGMGPCGELRYP+YPESNGTW+FPGIGEFQCYDKYM+ASL
Sbjct  237   MKSFHDRFRDYMGDVIVEIQVGMGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMKASL  296

Query  924   AASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGD  1103
              ASAEA GK +WG +GPHD+GQYNQFPEDTGFF+RDGTW TEYG+FFLEWYS KLL HGD
Sbjct  297   EASAEAQGKRDWGTTGPHDSGQYNQFPEDTGFFKRDGTWNTEYGRFFLEWYSEKLLRHGD  356

Query  1104  RILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKH  1283
             R+L AA GVFQGTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GY+P A M +KH
Sbjct  357   RLLAAAKGVFQGTGAKLSGKVAGIHWHYRTRSHAAELTAGYYNTRLRDGYIPTAKMFSKH  416

Query  1284  GVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVL  1463
             GVV NFTCMEMKDGEQP +ANCSPEGLVRQVK+ATK AG +LAGENALERYDS  Y QVL
Sbjct  417   GVVLNFTCMEMKDGEQPDNANCSPEGLVRQVKMATKSAGIDLAGENALERYDSGAYGQVL  476

Query  1464  ATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYV  1643
             ATSRSDSGN LSAFTYLR+NK LFE +NWR +VEFVK M++GGR+ RL ECDS+ TDLYV
Sbjct  477   ATSRSDSGNALSAFTYLRLNKRLFEGDNWRNMVEFVKGMADGGRNQRLSECDSTGTDLYV  536

Query  1644  GLIKKRNAKNANEAVLV  1694
               IK++N +   + VLV
Sbjct  537   RFIKEKNVQEEKDTVLV  553



>ref|XP_006477060.1| PREDICTED: beta-amylase 3, chloroplastic isoform X2 [Citrus sinensis]
 gb|KDO57012.1| hypothetical protein CISIN_1g047891mg [Citrus sinensis]
Length=551

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/553 (74%), Positives = 471/553 (85%), Gaps = 8/553 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPS-IVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             MALTLRSSTSFINL + K +K PD+F S   CF++ K S   RLRAKSSMQEA L     
Sbjct  1     MALTLRSSTSFINLNDTKTIKTPDEFSSPTTCFAKIKPS--RRLRAKSSMQEAQLCRDKH  58

Query  231   EG-----RVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMA  395
                    R +EKRE +H LA+   +   ++VPVF+MLPLDT++  G+LNKPR+MNASLMA
Sbjct  59    STMGGIIRKSEKREMVHELASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMA  118

Query  396   LRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGD  575
             L+SAGVEGVMVDAWWGLVEKDGPL YNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGD
Sbjct  119   LKSAGVEGVMVDAWWGLVEKDGPLNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGD  178

Query  576   SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSF  755
             SC+IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +P+LRGRTP+QVY+DYMRSF
Sbjct  179   SCTIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSF  238

Query  756   RERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASA  935
             RERF++Y+G+V+ E+QVG+GPCGELRYP+YPESNGTW+FPGIGEFQCYDKYMRASL ASA
Sbjct  239   RERFRDYLGDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASA  298

Query  936   EAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILT  1115
             EA G  +WGRSGPHD+GQYNQFPEDTGFFRRDGTW +EYG+FF+EWYSGKL++HGDRIL 
Sbjct  299   EASGNEDWGRSGPHDSGQYNQFPEDTGFFRRDGTWNSEYGRFFMEWYSGKLIQHGDRILA  358

Query  1116  AAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVF  1295
             AA  +FQGTG+KLSGK+AGIHWHY +RSHAAEL AGYYNTR R+GY+PIA MLAKHGV+ 
Sbjct  359   AAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYNTRYRDGYIPIARMLAKHGVIL  418

Query  1296  NFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR  1475
             NFTCMEM+D EQPG+ANCSPEGLVRQVK+AT+ AG ELAGENALERYD+  Y QVLATS 
Sbjct  419   NFTCMEMRDTEQPGNANCSPEGLVRQVKMATRTAGVELAGENALERYDADAYAQVLATSN  478

Query  1476  SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK  1655
              D+GNGLSAFTYLRMNK LF  +NWR LVEFV+ MS  GR  RLPE DS+ +DL VG +K
Sbjct  479   LDAGNGLSAFTYLRMNKKLFMSDNWRNLVEFVQRMSSEGRRPRLPEWDSTGSDLCVGFVK  538

Query  1656  KRNAKNANEAVLV  1694
              +N     EA LV
Sbjct  539   GKNGTKTKEAALV  551



>gb|AFP89361.1| beta-amylase [Citrus limon]
Length=551

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/553 (74%), Positives = 472/553 (85%), Gaps = 8/553 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPS-IVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             MALTLRSSTSFINL + K +K PD+F S   CF++ K S   RLRAKSSMQEA L     
Sbjct  1     MALTLRSSTSFINLNDTKTIKTPDEFSSPTTCFAKIKPS--RRLRAKSSMQEAQLCRDKH  58

Query  231   EG-----RVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMA  395
                    R +EKRE +H LA+   +   ++VPVF+MLPLDT++  G+LNKPR+MNASLMA
Sbjct  59    STMGGIIRKSEKREMVHELASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMA  118

Query  396   LRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGD  575
             L+SAGVEGVMVDAWWGLVEKDGPL YNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGD
Sbjct  119   LKSAGVEGVMVDAWWGLVEKDGPLNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGD  178

Query  576   SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSF  755
             SC+IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +P+LRGRTP+QVY+DYMRSF
Sbjct  179   SCTIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSF  238

Query  756   RERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASA  935
             R+RF++Y+G+V+ E+QVG+GPCGELRYP+YPESNGTW+FPGIGEFQCYDKYMRASL ASA
Sbjct  239   RDRFRDYLGDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASA  298

Query  936   EAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILT  1115
             EA G  +WGRSGPHD+GQYNQFPEDTGFFRRDGTW +EYG+FF+EWYSGKL++HGDRIL 
Sbjct  299   EASGNEDWGRSGPHDSGQYNQFPEDTGFFRRDGTWNSEYGRFFMEWYSGKLIQHGDRILA  358

Query  1116  AAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVF  1295
             AA  +FQGTG+KLSGK+AGIHWHY +RSHAAEL AGYYNTR  +GY+PIA MLAKHGV+ 
Sbjct  359   AAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYNTRYCDGYIPIARMLAKHGVIL  418

Query  1296  NFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR  1475
             NFTCMEM+D EQPG+ANCSPEGLVRQVK+AT+ AG ELAGENALERYD+  Y QVLAT  
Sbjct  419   NFTCMEMRDREQPGNANCSPEGLVRQVKMATRTAGVELAGENALERYDADAYAQVLATCN  478

Query  1476  SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK  1655
              D+GNGLSAFTYLRMNK L+E ENWR LVEFV+ MS  GR  RLPE DS+ +DLYVG ++
Sbjct  479   LDAGNGLSAFTYLRMNKKLYESENWRNLVEFVQRMSSEGRRPRLPEWDSTGSDLYVGFVE  538

Query  1656  KRNAKNANEAVLV  1694
              +N K   EA LV
Sbjct  539   GKNGKKNKEAALV  551



>ref|XP_003524296.1| PREDICTED: beta-amylase 3, chloroplastic-like [Glycine max]
 gb|KHN08412.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=547

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/549 (75%), Positives = 466/549 (85%), Gaps = 4/549 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             MALTLRSSTSFIN KE K +K  DD P+ V FS+FK     RLRAK+SMQEA    +   
Sbjct  1     MALTLRSSTSFINQKETKVLKTSDDIPATVSFSKFKPLV--RLRAKNSMQEAHHTRENSF  58

Query  231   -EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
              E   +EK E++   +   +H+ S RVPV++MLPLDT+TM G LNKPR+MNASLMAL+SA
Sbjct  59    NEASRSEKWEKVLAPSVAHNHNDSKRVPVYVMLPLDTVTMEGRLNKPRAMNASLMALKSA  118

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEGVMVDAWWGLVEKDGPLKYNWE YA LV+MVQ HGLKLQVVMSFHQCGGNVGD+CSI
Sbjct  119   GVEGVMVDAWWGLVEKDGPLKYNWEPYAELVQMVQMHGLKLQVVMSFHQCGGNVGDNCSI  178

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLPPWVLEEISKNP+LVYTDRSGRRNPEYISLGCD +PVLRGRTP+QVY+DYMRSFR+RF
Sbjct  179   PLPPWVLEEISKNPELVYTDRSGRRNPEYISLGCDSVPVLRGRTPLQVYSDYMRSFRDRF  238

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
             ++Y+G+VIVE+QVGMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYM+ASLAA+AE  G
Sbjct  239   RDYLGSVIVEIQVGMGPCGELRYPSYPETNGTWRFPGIGEFQCYDKYMKASLAAAAEDIG  298

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
             K EWG  GPHD+GQYNQFPEDTGFF+R+GTW TEYGQFFLEWYSGKLLEHG+RIL +A G
Sbjct  299   KKEWGGGGPHDSGQYNQFPEDTGFFKREGTWNTEYGQFFLEWYSGKLLEHGERILVSAKG  358

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +FQ TG KLSGK+AGIHWHY  RSHAAEL AGYYNTR  +GYLPIA MLAKHGVVFNFTC
Sbjct  359   IFQTTGVKLSGKVAGIHWHYRARSHAAELTAGYYNTRHNDGYLPIARMLAKHGVVFNFTC  418

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEMKD EQP  A CSPEGLV QVK+AT  A AELAGENALERYD+  Y QVL+TS+S+SG
Sbjct  419   MEMKDREQPDFAYCSPEGLVHQVKMATTTARAELAGENALERYDADAYAQVLSTSKSESG  478

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNA  1667
             +GL+AFTYLRMNK LFE +NWR LV+FV++MSEGGR  RLP  DS  +DLYVG IK    
Sbjct  479   SGLAAFTYLRMNKRLFEGDNWRHLVDFVRNMSEGGRRERLPAADSHGSDLYVGHIKATRE  538

Query  1668  KNANEAVLV  1694
             K+  EA LV
Sbjct  539   KHTQEAALV  547



>gb|AFQ33613.1| beta-amylase 1 [Citrus trifoliata]
Length=551

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/553 (75%), Positives = 473/553 (86%), Gaps = 8/553 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPS-IVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             MALTLRSSTSFINL + K +K PD+F S   CF++ K S   RLRAKSSMQEA L     
Sbjct  1     MALTLRSSTSFINLNDTKTIKTPDEFSSPTTCFAKIKPS--RRLRAKSSMQEAQLCRDKH  58

Query  231   EG-----RVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMA  395
                    R +EKRE +H LA+   +   ++VPVF+MLPLDT++  G+LNKPR+MNASLMA
Sbjct  59    STMGGIIRKSEKREMVHELASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMA  118

Query  396   LRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGD  575
             L+SAGVEGVMVDAWWGLVEKDGPL YNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGD
Sbjct  119   LKSAGVEGVMVDAWWGLVEKDGPLNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGD  178

Query  576   SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSF  755
             SC+IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +P+LRGRTP+QVY+DYMRSF
Sbjct  179   SCTIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSF  238

Query  756   RERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASA  935
             R+RF++Y+G+V+ E+QVG+GPCGELRYP+YPESNGTW+FPGIGEFQCYDKYMRASL ASA
Sbjct  239   RDRFRDYLGDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASA  298

Query  936   EAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILT  1115
             EA G  +WGRSGPHD+GQYNQFPEDTGFFRRDGTW +EYG+FF+EWYSGKL++HGDRIL 
Sbjct  299   EASGNEDWGRSGPHDSGQYNQFPEDTGFFRRDGTWNSEYGRFFMEWYSGKLIQHGDRILA  358

Query  1116  AAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVF  1295
             AA  +FQGTG+KLSGK+AGIHWHY +RSHAAEL AGYYNTR  +GY+PIA MLAKHGV+ 
Sbjct  359   AAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYNTRYCDGYIPIARMLAKHGVIL  418

Query  1296  NFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR  1475
             NFTCMEM+D EQPG+ANCSPEGLVRQVK+AT+ AG ELAGENALERYD+  Y QVLATS 
Sbjct  419   NFTCMEMRDREQPGNANCSPEGLVRQVKMATRTAGVELAGENALERYDADAYAQVLATSN  478

Query  1476  SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK  1655
              D+GNGLSAFTYLRMNK LFE ENWR LVEFV+ MS  GR  RLPE DS+ +DLYVG +K
Sbjct  479   LDAGNGLSAFTYLRMNKKLFESENWRNLVEFVQRMSSEGRRPRLPEWDSTGSDLYVGFVK  538

Query  1656  KRNAKNANEAVLV  1694
              +N K   EA LV
Sbjct  539   GKNGKKNKEAALV  551



>ref|XP_006477059.1| PREDICTED: beta-amylase 3, chloroplastic isoform X1 [Citrus sinensis]
Length=554

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/556 (74%), Positives = 471/556 (85%), Gaps = 11/556 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPS-IVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             MALTLRSSTSFINL + K +K PD+F S   CF++ K S   RLRAKSSMQEA L     
Sbjct  1     MALTLRSSTSFINLNDTKTIKTPDEFSSPTTCFAKIKPS--RRLRAKSSMQEAQLCRDKH  58

Query  231   EG-----RVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMA  395
                    R +EKRE +H LA+   +   ++VPVF+MLPLDT++  G+LNKPR+MNASLMA
Sbjct  59    STMGGIIRKSEKREMVHELASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMA  118

Query  396   LRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGD  575
             L+SAGVEGVMVDAWWGLVEKDGPL YNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGD
Sbjct  119   LKSAGVEGVMVDAWWGLVEKDGPLNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGD  178

Query  576   SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSF  755
             SC+IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +P+LRGRTP+QVY+DYMRSF
Sbjct  179   SCTIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSF  238

Query  756   RERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDK---YMRASLA  926
             RERF++Y+G+V+ E+QVG+GPCGELRYP+YPESNGTW+FPGIGEFQCYDK   YMRASL 
Sbjct  239   RERFRDYLGDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKPKQYMRASLK  298

Query  927   ASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDR  1106
             ASAEA G  +WGRSGPHD+GQYNQFPEDTGFFRRDGTW +EYG+FF+EWYSGKL++HGDR
Sbjct  299   ASAEASGNEDWGRSGPHDSGQYNQFPEDTGFFRRDGTWNSEYGRFFMEWYSGKLIQHGDR  358

Query  1107  ILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHG  1286
             IL AA  +FQGTG+KLSGK+AGIHWHY +RSHAAEL AGYYNTR R+GY+PIA MLAKHG
Sbjct  359   ILAAAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYNTRYRDGYIPIARMLAKHG  418

Query  1287  VVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLA  1466
             V+ NFTCMEM+D EQPG+ANCSPEGLVRQVK+AT+ AG ELAGENALERYD+  Y QVLA
Sbjct  419   VILNFTCMEMRDTEQPGNANCSPEGLVRQVKMATRTAGVELAGENALERYDADAYAQVLA  478

Query  1467  TSRSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVG  1646
             TS  D+GNGLSAFTYLRMNK LF  +NWR LVEFV+ MS  GR  RLPE DS+ +DL VG
Sbjct  479   TSNLDAGNGLSAFTYLRMNKKLFMSDNWRNLVEFVQRMSSEGRRPRLPEWDSTGSDLCVG  538

Query  1647  LIKKRNAKNANEAVLV  1694
              +K +N     EA LV
Sbjct  539   FVKGKNGTKTKEAALV  554



>gb|KHG28698.1| Beta-amylase 3, chloroplastic -like protein [Gossypium arboreum]
Length=540

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/547 (75%), Positives = 461/547 (84%), Gaps = 8/547 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MALTLRSSTSFI LKE    K PDDF   + F+Q K SC  R R   SMQEA L+     
Sbjct  1     MALTLRSSTSFIKLKETNSFKTPDDFLGSISFAQMKPSCRIRARNSMSMQEAPLV----H  56

Query  234   GRVNEKR-ERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
             G+++ K  E+L+GL  + + ++S +VPV++MLPLDTIT+GG+LNKPR+MNASLMAL+SAG
Sbjct  57    GKISTKETEKLYGLTISHAENNS-KVPVYVMLPLDTITLGGSLNKPRAMNASLMALKSAG  115

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVDAWWGLVEKDGPL YNWEGYA LVKMV++HGLKLQVVMSFHQCGGNVGDSCSIP
Sbjct  116   VEGVMVDAWWGLVEKDGPLNYNWEGYAELVKMVEKHGLKLQVVMSFHQCGGNVGDSCSIP  175

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWVLEEI KNPDLVYTDR GRRNPEYISLGCD +PVLRGRTP+Q Y DYMRSFRERF+
Sbjct  176   LPPWVLEEIRKNPDLVYTDRLGRRNPEYISLGCDSVPVLRGRTPIQAYTDYMRSFRERFR  235

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
             +Y+G VIVE+QVGMGPCGELRYPSYPESNG W+FPGIGEFQCYDKYMRASL A+AEA G+
Sbjct  236   DYLGRVIVEIQVGMGPCGELRYPSYPESNGMWKFPGIGEFQCYDKYMRASLEAAAEAIGQ  295

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
              +WG+ GPHD+G Y Q PE+T FF+RDGTW TEYGQFFLEWYS KLLEHGDRIL AA G 
Sbjct  296   KDWGKGGPHDSGHYKQVPEETDFFKRDGTWNTEYGQFFLEWYSRKLLEHGDRILAAAKGT  355

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCM  1310
             F GTGAKLS K+AGIHWHY TRSHAAEL AGYYNTR  +GY+PIA M +KHGVVFNFTCM
Sbjct  356   FHGTGAKLSAKVAGIHWHYRTRSHAAELTAGYYNTRHHDGYVPIAQMFSKHGVVFNFTCM  415

Query  1311  EMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGN  1490
             EM+DGEQP  ANCSPEGLVRQVK+ATK A  ELAGENALERYD+  Y QVLATSRSDSGN
Sbjct  416   EMRDGEQPEYANCSPEGLVRQVKMATKIARVELAGENALERYDAGSYAQVLATSRSDSGN  475

Query  1491  GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNAK  1670
             GLSAFTYLRMNK LFE +NWR LVEFVK+MSEGGR  ++ ECDS  T+LY+G IK +  +
Sbjct  476   GLSAFTYLRMNKRLFEGDNWRHLVEFVKNMSEGGR--KISECDSRGTNLYIGFIKDKTVE  533

Query  1671  NANEAVL  1691
                 A++
Sbjct  534   KKEVALV  540



>ref|XP_006440139.1| hypothetical protein CICLE_v10019566mg [Citrus clementina]
 gb|ESR53379.1| hypothetical protein CICLE_v10019566mg [Citrus clementina]
Length=551

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/553 (73%), Positives = 470/553 (85%), Gaps = 8/553 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPS-IVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             MALTLRSSTSFINL + K +K PD+F S   CF++ K S   RLRAKSSMQEA L     
Sbjct  1     MALTLRSSTSFINLNDTKTIKTPDEFSSPTTCFAKIKPS--RRLRAKSSMQEAQLCRDKH  58

Query  231   EG-----RVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMA  395
                    R +EKRE +H LA+   +   ++VPVF+MLPLDT++  G+LNKPR+MNASLMA
Sbjct  59    STMGGIIRKSEKREMVHELASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMA  118

Query  396   LRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGD  575
             L+SAGVEGVMVDAWWGLVEKDGPL YNWEGYA L++MV++HGLKLQVVMSFHQCGGNVGD
Sbjct  119   LKSAGVEGVMVDAWWGLVEKDGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGD  178

Query  576   SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSF  755
             SC+IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +P+LRGRTP+QVY+DYMRSF
Sbjct  179   SCTIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSF  238

Query  756   RERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASA  935
             R+RF++Y+G+V+ E+QVG+GPCGELRYP+YPESNGTW+FPGIGEFQCYDKYMRASL ASA
Sbjct  239   RDRFRDYLGDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASA  298

Query  936   EAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILT  1115
             EA    +WGRSGPHD+GQYNQFPEDTGFFRRDGTW +EYG+FF+EWYSGKL++HGDRIL 
Sbjct  299   EASSNEDWGRSGPHDSGQYNQFPEDTGFFRRDGTWNSEYGRFFMEWYSGKLIQHGDRILA  358

Query  1116  AAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVF  1295
             AA  +FQGTG+KLSGK+AGIHWHY +RSHAAEL AGYYNTR  +GY+PIA MLAKHG + 
Sbjct  359   AAKEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYNTRYCDGYIPIARMLAKHGAIL  418

Query  1296  NFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR  1475
             NFTCMEM+D EQPG+ANCSPEGLV+QVK+AT+ AG ELAGENALERYD+  Y QVLATS 
Sbjct  419   NFTCMEMRDREQPGNANCSPEGLVQQVKMATRTAGVELAGENALERYDADAYAQVLATSN  478

Query  1476  SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK  1655
              D+GNGL AFTYLRM+K LFE +NWR LVEFV+ MS  GR  RLPE DS+ +DLYVG +K
Sbjct  479   LDAGNGLGAFTYLRMHKKLFESDNWRNLVEFVQRMSSEGRRPRLPEWDSTGSDLYVGFVK  538

Query  1656  KRNAKNANEAVLV  1694
              +N K   EA +V
Sbjct  539   GKNGKKTKEAAVV  551



>ref|XP_007155732.1| hypothetical protein PHAVU_003G226900g [Phaseolus vulgaris]
 gb|ESW27726.1| hypothetical protein PHAVU_003G226900g [Phaseolus vulgaris]
Length=548

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/550 (76%), Positives = 470/550 (85%), Gaps = 5/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALL---SQ  224
             MALTLRSS SFIN KE K +K  DD P+I+ F++ K S   RLR K+SMQEA      S 
Sbjct  1     MALTLRSSISFINQKETKILKTSDDVPAILSFAKLKPS--FRLRVKNSMQEAHHARDNSF  58

Query  225   PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               E R NEK E++H  +   S S S RVPV++MLPLDT+TMGG+LNKPR+MNASLMAL+S
Sbjct  59    NSEARRNEKWEKVHAPSVAHSQSGSKRVPVYVMLPLDTVTMGGSLNKPRAMNASLMALKS  118

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGPLKYNWE YA LV+MVQ HGLKLQVVMSFHQCGGNVGD+CS
Sbjct  119   AGVEGVMVDAWWGLVEKDGPLKYNWEPYAELVQMVQMHGLKLQVVMSFHQCGGNVGDTCS  178

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWV EEISKNPDLVYTDRSGRRNPEYISLGCD +P+LRGRTP+QVYADYMRSFR+R
Sbjct  179   IPLPPWVQEEISKNPDLVYTDRSGRRNPEYISLGCDSVPILRGRTPLQVYADYMRSFRDR  238

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F++Y+G+VIVE+QVGMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYM+ASLAA+AEA 
Sbjct  239   FQDYLGSVIVEIQVGMGPCGELRYPSYPETNGTWRFPGIGEFQCYDKYMKASLAAAAEAI  298

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK EWG  GPHD+GQYNQFPEDTGFF+R+GTW TEYG+FFLEWYSGKLLEHG++IL +A 
Sbjct  299   GKKEWGGGGPHDSGQYNQFPEDTGFFKREGTWNTEYGRFFLEWYSGKLLEHGEKILVSAQ  358

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+F  +G KLSGK+AGIHWHY  RSHAAEL AGYYNTR  +GY+PIA MLAKHGVVFNFT
Sbjct  359   GIFHTSGVKLSGKVAGIHWHYRARSHAAELTAGYYNTRNNDGYMPIARMLAKHGVVFNFT  418

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKD EQP  ANCSPEGLVRQVK+AT  A AELAGENALERYD+  Y QVL+TS+S+S
Sbjct  419   CMEMKDREQPDFANCSPEGLVRQVKMATTTARAELAGENALERYDADAYAQVLSTSKSES  478

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
              NGL+AFTYLRMNK LFE +NWR LV+FV+SMSEGGR+ RLP  DS  +DLYVG IK   
Sbjct  479   SNGLAAFTYLRMNKRLFEGDNWRHLVDFVRSMSEGGRTERLPASDSHGSDLYVGHIKSTQ  538

Query  1665  AKNANEAVLV  1694
              K+  EAVLV
Sbjct  539   EKHTKEAVLV  548



>ref|XP_010055392.1| PREDICTED: beta-amylase 3, chloroplastic [Eucalyptus grandis]
 gb|KCW71851.1| hypothetical protein EUGRSUZ_E00330 [Eucalyptus grandis]
Length=543

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/549 (76%), Positives = 456/549 (83%), Gaps = 8/549 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MALTLRSSTSFINLK+ K  K PD+    V F+Q K S   RLRAK+SM E  +L + + 
Sbjct  1     MALTLRSSTSFINLKDNKSFKTPDEILGTVSFTQIKPS--RRLRAKNSMHE--ILERGIS  56

Query  234   GRVNEKR--ERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
               V  K   E+LH L  +     + +VPV+IMLPLDT+T GGNLNKPR+MNASLMAL+SA
Sbjct  57    TEVTRKDILEKLHALTVSHGQQGT-KVPVYIMLPLDTVTHGGNLNKPRAMNASLMALKSA  115

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEGVMVDAWWGLVEKDGP++YNWEGYA LV+MV  HGLKLQVVMSFHQCGGNVGDSCSI
Sbjct  116   GVEGVMVDAWWGLVEKDGPMQYNWEGYAELVQMVARHGLKLQVVMSFHQCGGNVGDSCSI  175

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLPPW LEEISKNPDLVYTD SGRRNPEYISLGCD LPVLRGRTP+QVYADYM+SFR+RF
Sbjct  176   PLPPWALEEISKNPDLVYTDGSGRRNPEYISLGCDSLPVLRGRTPIQVYADYMQSFRDRF  235

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
                +G+VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL ASAEA G
Sbjct  236   SGDLGSVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLQASAEALG  295

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
               +WG+SGPHD+GQYNQFPE+TGFFRR+GTW TEYG+FFLEWYS KLLEHGDRIL AA G
Sbjct  296   HMDWGKSGPHDSGQYNQFPEETGFFRREGTWNTEYGKFFLEWYSEKLLEHGDRILAAAKG  355

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             VFQGT  KLSGK+AGIHWHY TRSHAAEL AGYYNTR  +GYLPIA M+ KHGVV NFTC
Sbjct  356   VFQGTQVKLSGKVAGIHWHYRTRSHAAELTAGYYNTRYHDGYLPIARMMGKHGVVLNFTC  415

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEM+DGEQP  ANCSPEGLVRQVKVA K AG +LAGENALERYD   Y QVL TSRSDSG
Sbjct  416   MEMRDGEQPEHANCSPEGLVRQVKVAAKTAGTDLAGENALERYDEGAYAQVLLTSRSDSG  475

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNA  1667
             N LSAFTYLRMNK LFE  NWR L  FVKSMSEGG + RL E D  RTDLY+G IK+++A
Sbjct  476   NSLSAFTYLRMNKRLFEENNWRNLAGFVKSMSEGG-NNRLSESDLGRTDLYIGFIKEKSA  534

Query  1668  KNANEAVLV  1694
                 EA LV
Sbjct  535   TKIKEAALV  543



>ref|XP_009371857.1| PREDICTED: beta-amylase 3, chloroplastic [Pyrus x bretschneideri]
Length=545

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/547 (74%), Positives = 468/547 (86%), Gaps = 2/547 (0%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             M LTLRSSTSF+NLK+ +G+K   D P  +CF+Q K SC   +RAKSSMQE  LL + L 
Sbjct  1     MTLTLRSSTSFVNLKDHEGLKTSGDSPGTICFAQIKPSCC--VRAKSSMQETRLLHENLM  58

Query  234   GRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGV  413
                + +RE LH L      SS ++VPV++MLPLDT++ GG+LNKPR+MNASLMAL+ AGV
Sbjct  59    TISDGRRELLHALPGISHTSSDNKVPVYVMLPLDTVSHGGHLNKPRAMNASLMALKQAGV  118

Query  414   EGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPL  593
             EGVMVD WWGLVE+DGP KYNWEGYA LV+MVQ+HG+K+QVVMSFHQCGGNVGDSCSIPL
Sbjct  119   EGVMVDVWWGLVEEDGPSKYNWEGYAELVQMVQKHGMKIQVVMSFHQCGGNVGDSCSIPL  178

Query  594   PPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKE  773
             PPWVLEE+SKNPDLVYTD+SGRRNPEYISLGCD LPVL GRTP+QVY DYMRSF +RF +
Sbjct  179   PPWVLEEVSKNPDLVYTDKSGRRNPEYISLGCDSLPVLGGRTPIQVYTDYMRSFHDRFID  238

Query  774   YMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKS  953
             Y+G+VIVE+QVGMGPCGELRYP+YPESNGTWRFPGIGEFQCYDKYMRASL ASAEA GK 
Sbjct  239   YLGDVIVEIQVGMGPCGELRYPAYPESNGTWRFPGIGEFQCYDKYMRASLEASAEALGKR  298

Query  954   EWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF  1133
             +WGRSGPHD+GQYNQFPEDTGFF+R+GTW TEYGQFFLEWYSGKLL HGDRIL+AA GVF
Sbjct  299   DWGRSGPHDSGQYNQFPEDTGFFKREGTWNTEYGQFFLEWYSGKLLRHGDRILSAAKGVF  358

Query  1134  QGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCME  1313
             QG+GAKLSGKIAGI+WHY +RSHAAEL AGYYNTR R+GY+P A M +K+ VV NFTCME
Sbjct  359   QGSGAKLSGKIAGIYWHYGSRSHAAELTAGYYNTRHRDGYVPTAMMFSKNMVVLNFTCME  418

Query  1314  MKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG  1493
             MKD EQP  ANCSPEGLVRQV++ATK AG +LAGENALERYD+  + QVLATSRSDSGN 
Sbjct  419   MKDSEQPEHANCSPEGLVRQVRMATKSAGIDLAGENALERYDTGAFAQVLATSRSDSGNS  478

Query  1494  LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNAKN  1673
             LSAFTYLRMNK LFE +NWR +VEFV+SM+EGGR+  L ECDS+ +DL+V  IK++  + 
Sbjct  479   LSAFTYLRMNKRLFEGDNWRNMVEFVRSMAEGGRNRSLSECDSTGSDLFVRFIKEKKVEK  538

Query  1674  ANEAVLV  1694
               E VLV
Sbjct  539   TKETVLV  545



>ref|NP_001236350.1| beta-amylase [Glycine max]
 emb|CAI39244.1| beta-amylase [Glycine max]
 gb|KHN01649.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=540

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/548 (75%), Positives = 467/548 (85%), Gaps = 9/548 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCH-HRLRAKSSMQEAALLSQPL  230
             MALTLRSSTSFIN KE K +K  D+ P+IV FS+FK S    RLRAK+SMQEA       
Sbjct  1     MALTLRSSTSFINQKETKVLKTSDNAPAIVSFSKFKPSSSLFRLRAKNSMQEAH------  54

Query  231   EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
                  EK E++   +   SH+ S RVPV++MLPLDT+TMGG+LNKPR+MNASLMAL+SAG
Sbjct  55    --HTREKWEKVLAPSVAHSHNDSKRVPVYVMLPLDTVTMGGSLNKPRAMNASLMALKSAG  112

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVDAWWGLVEK+GPLKYNWE YA LV+M+Q HGLKLQVVMSFHQCGGNVGD+CSIP
Sbjct  113   VEGVMVDAWWGLVEKEGPLKYNWEPYAELVQMLQMHGLKLQVVMSFHQCGGNVGDNCSIP  172

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWVLEEISKNP+LVYTDRSGRRNPEYISLGCD +PVL GRTP+QVY+DYMRSFR++F+
Sbjct  173   LPPWVLEEISKNPELVYTDRSGRRNPEYISLGCDSVPVLNGRTPLQVYSDYMRSFRDKFR  232

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
             +Y+G+VIVE+Q+GMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYM+ASLAA+AE  GK
Sbjct  233   DYLGSVIVEIQLGMGPCGELRYPSYPETNGTWRFPGIGEFQCYDKYMKASLAAAAEDIGK  292

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
              EWG  GPHD+GQYNQFPEDTGFF+R+GTW TEYGQFFLEWYSGKLLEHG+RIL +A G+
Sbjct  293   KEWGGGGPHDSGQYNQFPEDTGFFKREGTWNTEYGQFFLEWYSGKLLEHGERILVSAKGI  352

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCM  1310
             F+ TG KLSGK+AGIHWHY  RSHAAEL AGYYNTR  +GYLPIA MLAKHGVVFNFTCM
Sbjct  353   FETTGVKLSGKVAGIHWHYRARSHAAELTAGYYNTRNNDGYLPIARMLAKHGVVFNFTCM  412

Query  1311  EMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGN  1490
             EMKD EQP  ANCSPEGLV QVK+AT  A AELAGENALERYD+  Y QVL+TS+S+SG+
Sbjct  413   EMKDREQPDFANCSPEGLVHQVKMATTTARAELAGENALERYDADAYAQVLSTSKSESGS  472

Query  1491  GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNAK  1670
             GL+AFTYLRMNK LFE +NWR LV+FV+SMSEGGR  RLP  DS  +DLYVG IK    K
Sbjct  473   GLAAFTYLRMNKRLFEADNWRHLVDFVRSMSEGGRRERLPAADSHGSDLYVGHIKATQEK  532

Query  1671  NANEAVLV  1694
             +  EA LV
Sbjct  533   HTQEAALV  540



>gb|EYU17858.1| hypothetical protein MIMGU_mgv1a003946mg [Erythranthe guttata]
Length=553

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/554 (74%), Positives = 471/554 (85%), Gaps = 9/554 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MAL L SST  INLKE +G +NPDD  + V F++ K +C  +LRAK+S QE+ +     E
Sbjct  1     MALALHSSTPLINLKENRGFRNPDDSSTTVGFAKMKPTC--QLRAKNSTQESQISRTERE  58

Query  234   GRVNE-----KRERLHGLAANQSHSSSS-RVPVFIMLPLDTITMGGNLNKPRSMNASLMA  395
                +      +RE+LHG+A+  SHSS++ RVPVF+MLPLDT+++GG+LNK R+M ASLMA
Sbjct  59    RSFSHTIHELQREKLHGMASPHSHSSTNVRVPVFVMLPLDTVSIGGSLNKSRAMFASLMA  118

Query  396   LRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGD  575
             L+S GVEGVMVDAWWGLVEKDGP+KYNWEGYA L+KMV++ GLK+QVVMSFHQCGGNVGD
Sbjct  119   LKSGGVEGVMVDAWWGLVEKDGPMKYNWEGYAELIKMVEKLGLKIQVVMSFHQCGGNVGD  178

Query  576   SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSF  755
             SCSIPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD LPVLRGRTP+QVY+D+M SF
Sbjct  179   SCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSLPVLRGRTPIQVYSDFMTSF  238

Query  756   RERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASA  935
             RERFK Y+G V+VE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAA+A
Sbjct  239   RERFKAYLGEVVVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAAAA  298

Query  936   EAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILT  1115
             EA GK +WGR GPHDAGQYNQFP+DTGFFR+DGTW +EYG FFLEWYSG L+ HG++IL 
Sbjct  299   EAIGKDDWGRGGPHDAGQYNQFPDDTGFFRKDGTWNSEYGHFFLEWYSGNLINHGEKILA  358

Query  1116  AAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVF  1295
             AA  VF+GTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GYLPIA ML+KH VV 
Sbjct  359   AAERVFEGTGAKLSGKVAGIHWHYKTRSHAAELTAGYYNTRHRDGYLPIARMLSKHRVVL  418

Query  1296  NFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR  1475
             NFTCMEMKDGEQP  ANCSPEGLVRQVK+ATK A  +LAGENALERYD   Y QVL TSR
Sbjct  419   NFTCMEMKDGEQPNEANCSPEGLVRQVKMATKTARIDLAGENALERYDGGAYSQVLETSR  478

Query  1476  SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK  1655
             SDSGNGLSAFTYLR+NK LFEPENWR LVEFV+SMSEGG+ TRLP+ D   +DL+VG +K
Sbjct  479   SDSGNGLSAFTYLRLNKRLFEPENWRNLVEFVRSMSEGGQRTRLPDSDRIGSDLFVGFVK  538

Query  1656  KRNA-KNANEAVLV  1694
             + N  K  +E  LV
Sbjct  539   QSNVRKTISEVALV  552



>ref|XP_010531694.1| PREDICTED: beta-amylase 3, chloroplastic-like [Tarenaya hassleriana]
Length=549

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/552 (74%), Positives = 465/552 (84%), Gaps = 8/552 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAAL---LSQ  224
             M LTLRSSTS INLK+ K   NP+   S+  F++ K    H LR +SS++E      ++ 
Sbjct  1     MTLTLRSSTSLINLKDSKSPGNPE-ISSVAHFAKMKPPTPH-LRIRSSIEEVKFSRDMTF  58

Query  225   PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               EGR   + E+LH L      + SS V VF+MLPLDTIT+ GNLNKPR+MNASLMAL+S
Sbjct  59    TPEGRTTGRWEKLHTLPHIHDMNGSS-VSVFVMLPLDTITISGNLNKPRAMNASLMALKS  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGV+GVMVDAWWGLVEKDGPLKYNWEGY  L++MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVDGVMVDAWWGLVEKDGPLKYNWEGYNELIQMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCD +PVLRGRTP+QVY DYMRSFRER
Sbjct  178   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDSVPVLRGRTPIQVYTDYMRSFRER  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F++Y+G VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMR SL A AEA+
Sbjct  238   FRDYLGGVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRVSLQAYAEAN  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GKS+WG++GPHDAG+Y Q PEDTGFF+RDGTW +EYGQFFLEWYSGKLLEHGD+IL A+ 
Sbjct  298   GKSDWGKTGPHDAGEYKQLPEDTGFFQRDGTWNSEYGQFFLEWYSGKLLEHGDKILAASK  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQGTGAKLSGKIAGIHWHYNTRSHAAEL AGYYNTR+++GYLPIA ML KHG V NFT
Sbjct  358   GIFQGTGAKLSGKIAGIHWHYNTRSHAAELTAGYYNTRDQDGYLPIAQMLGKHGAVLNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQP  +NCSPEGLVRQVK AT+ AG ELAGENALERYD+  + QV+ATSRSDS
Sbjct  418   CMEMRDGEQPDCSNCSPEGLVRQVKTATRKAGTELAGENALERYDASAFRQVVATSRSDS  477

Query  1485  GN--GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK  1658
             GN  G++AFTYLRMNK LFE ENW++ VEFVK+M EGG   RL E D+S++DLYVG I+ 
Sbjct  478   GNRVGVAAFTYLRMNKRLFEGENWQQFVEFVKNMKEGGHYGRLSEHDTSKSDLYVGFIRS  537

Query  1659  RNAKNANEAVLV  1694
             ++     EA LV
Sbjct  538   KSTNRVKEAALV  549



>ref|XP_010274550.1| PREDICTED: beta-amylase 3, chloroplastic [Nelumbo nucifera]
Length=547

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/551 (75%), Positives = 461/551 (84%), Gaps = 8/551 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQ-FKRSCHHRLRAKSSM---QEAALLS  221
             MAL LRSS SFINL + K +K  DD PS V F+   K SC  RLRA++S    Q +   +
Sbjct  1     MALMLRSSPSFINLNDTKSLKPVDDSPSSVSFAHHLKPSC--RLRARNSSHDGQHSREKA  58

Query  222   QPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
                +GR +EK ERLH L    S   S+RV VF+MLPLD ++ GG+LN+PR++NASLMAL+
Sbjct  59    SVCDGRKDEKWERLHALVGGHS-KKSNRVAVFVMLPLDAVSPGGSLNRPRALNASLMALK  117

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
             SAGVEGVMVDAWWGLVEKDGPL YNW  YA LV+MVQ+HGLKLQVV+SFHQCGGNVGDSC
Sbjct  118   SAGVEGVMVDAWWGLVEKDGPLSYNWRPYAELVQMVQKHGLKLQVVVSFHQCGGNVGDSC  177

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             SIPLPPWVLEEISKNPD+VYTDRSGRRNPEYISLGCD LPVLRGRTP+QVY+DYM SFRE
Sbjct  178   SIPLPPWVLEEISKNPDIVYTDRSGRRNPEYISLGCDSLPVLRGRTPIQVYSDYMWSFRE  237

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
              F++Y+G VIVE+QVGMGPCGELRYPSYP++NGTWR+PGIGEFQCYDKYMRASL ASAEA
Sbjct  238   TFRDYLGGVIVEIQVGMGPCGELRYPSYPQTNGTWRYPGIGEFQCYDKYMRASLEASAEA  297

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              GK EWGRSGPHDAG YNQFPE+TGFFRRDGTW +EYGQFFLEWYSG LLEHGDR+L AA
Sbjct  298   IGKKEWGRSGPHDAGHYNQFPEETGFFRRDGTWNSEYGQFFLEWYSGMLLEHGDRVLAAA  357

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
              G+F+GTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GYLPIA M+ K GVV NF
Sbjct  358   EGIFKGTGAKLSGKVAGIHWHYRTRSHAAELTAGYYNTRHRDGYLPIARMMGKRGVVLNF  417

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEMKD EQP  ANCSPEGLVRQVK+A+K AG ELAGENALERYD   + QVLATSRSD
Sbjct  418   TCMEMKDWEQPDYANCSPEGLVRQVKMASKTAGTELAGENALERYDEGAFAQVLATSRSD  477

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKR  1661
             +GNGLSAFT+LRMNK LFE  NWR LV FVK+MSEGGR+ +  E DS  T LYVG I KR
Sbjct  478   AGNGLSAFTHLRMNKRLFEEGNWRNLVAFVKNMSEGGRNDKHSEYDSGHTKLYVGFINKR  537

Query  1662  NAKNANEAVLV  1694
             N K + EA LV
Sbjct  538   NTK-SQEAALV  547



>ref|XP_008361217.1| PREDICTED: beta-amylase 3, chloroplastic-like [Malus domestica]
Length=653

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/531 (76%), Positives = 455/531 (86%), Gaps = 6/531 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             M LTLRSS SFINLK+ KG+K  DD P  +CF+Q K SC  RLRAKSS QE  LL +   
Sbjct  1     MTLTLRSSASFINLKDHKGLKTSDDSPGTICFAQIKPSC--RLRAKSSXQETQLLHEKNL  58

Query  234   GRVNE-KRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
               +++ +RE LH L      S+ ++VPV++MLPLDT++ GG+LNKPR+MNASLMAL+ AG
Sbjct  59    MTISDGRRELLHXLPNTAHSSTDNKVPVYVMLPLDTVSHGGHLNKPRAMNASLMALKQAG  118

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVDAWWGLVEKDGP KYNWEGYA LV+MVQ+HG+K+Q+VMSFHQCGGNVGDSCSIP
Sbjct  119   VEGVMVDAWWGLVEKDGPSKYNWEGYAELVQMVQKHGMKIQIVMSFHQCGGNVGDSCSIP  178

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD LPVLRGRTP+QVY DYMRSFR+RF 
Sbjct  179   LPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSLPVLRGRTPIQVYTDYMRSFRDRFI  238

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
             +Y+G+VIVE+QVGMGPCGELRYP+YPESNGTWRFPGIGEFQCYDKYMRASL ASAEA GK
Sbjct  239   DYLGDVIVEIQVGMGPCGELRYPAYPESNGTWRFPGIGEFQCYDKYMRASLEASAEALGK  298

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
              +WGRSGPHD+G YNQFPEDTGFF+RDGTW TEYGQFFLEWYSGKLL HGDRIL+AA GV
Sbjct  299   RDWGRSGPHDSGHYNQFPEDTGFFKRDGTWNTEYGQFFLEWYSGKLLRHGDRILSAAKGV  358

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCM  1310
             FQG+GAKLSGKIAGIHWHY +RSHAAEL AGYYNTR R+GYLP A M +K+ VV NFTCM
Sbjct  359   FQGSGAKLSGKIAGIHWHYRSRSHAAELTAGYYNTRHRDGYLPTAKMFSKNMVVLNFTCM  418

Query  1311  EMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGN  1490
             EMKD EQP  ANCSPEGLVRQVK+ATK AG +LAGENALERYD+  + QVLATSRSDSGN
Sbjct  419   EMKDREQPEHANCSPEGLVRQVKMATKRAGIDLAGENALERYDTGAFAQVLATSRSDSGN  478

Query  1491  GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYV  1643
              LSAFTYLRMNK LF+ +NWR +VEFV+SM+E   S ++     S TDL+ 
Sbjct  479   ALSAFTYLRMNKRLFDGDNWRNMVEFVRSMAEEHXSIKMV---GSSTDLHA  526



>ref|XP_010695452.1| PREDICTED: beta-amylase 3, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=546

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/554 (72%), Positives = 465/554 (84%), Gaps = 15/554 (3%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALL-----  218
             M LTLRS+ SF+     + ++  +DFPSI+C ++ K     R+RA SS+  A        
Sbjct  1     MTLTLRSTNSFL-----RSLRASEDFPSIICIARIKPM--DRVRAISSVHTAQFTTEKIS  53

Query  219   SQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMAL  398
             S  LEG+ +EK ERLH L  +  H++++RVPV++MLPLDT+  GG LNKPR+MNASLMAL
Sbjct  54    SSELEGKSHEKLERLHELKGHH-HTNNTRVPVYVMLPLDTVCNGGKLNKPRAMNASLMAL  112

Query  399   RSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDS  578
             ++AGVEGVMVD WWGLVEKDGPLKYNW+GY  LV+MVQ HGLKLQVVMSFHQCGGNVGDS
Sbjct  113   KTAGVEGVMVDVWWGLVEKDGPLKYNWDGYVELVQMVQRHGLKLQVVMSFHQCGGNVGDS  172

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             CSIPLPPWVLEEIS NPDLVYTDRSGRRNPEYISLGCD LPVL+GRTP+QVY+DYMRSFR
Sbjct  173   CSIPLPPWVLEEISNNPDLVYTDRSGRRNPEYISLGCDSLPVLKGRTPIQVYSDYMRSFR  232

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             ++FK+Y+G VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM+ASL A+AE
Sbjct  233   DKFKDYLGRVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKASLQAAAE  292

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A G+ EWGRSGPHD+G YNQ+PEDTGFFR +GTW T YG+FFL WYS KL+EHGD +L A
Sbjct  293   AIGQEEWGRSGPHDSGNYNQYPEDTGFFRGEGTWNTAYGKFFLGWYSAKLIEHGDNLLAA  352

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFN  1298
             A G+F+ TGAKLSGK+AGIHWHY TRSHAAEL AGYYN R+++ YLP+A+M AKHGVVFN
Sbjct  353   ANGIFKETGAKLSGKVAGIHWHYKTRSHAAELTAGYYNARDKDAYLPVANMFAKHGVVFN  412

Query  1299  FTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRS  1478
             FTCMEMKDGEQP  ANCSPEGLV+QVK+AT+ AG ELAGENALERYD+  Y QVLATS+S
Sbjct  413   FTCMEMKDGEQPDHANCSPEGLVKQVKMATQIAGIELAGENALERYDASAYGQVLATSKS  472

Query  1479  DSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK  1658
              SG+GLSAFTYLRMNK LFE +NWR LVEFVKSMSEGG++ RL   DSS TDLYVG IK+
Sbjct  473   HSGSGLSAFTYLRMNKRLFEGDNWRHLVEFVKSMSEGGQNQRLSASDSSGTDLYVGFIKE  532

Query  1659  RNAK--NANEAVLV  1694
             ++ +    NE  LV
Sbjct  533   KSIQKNQKNEPALV  546



>ref|XP_008373719.1| PREDICTED: beta-amylase 3, chloroplastic [Malus domestica]
Length=546

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/548 (73%), Positives = 458/548 (84%), Gaps = 3/548 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             M LTLRSSTSF+NLK+ KG+K   D P  +CF+Q K SC  RLRAKSSMQE  LL +   
Sbjct  1     MTLTLRSSTSFVNLKDHKGLKTSXDSPGTICFAQXKPSC--RLRAKSSMQETRLLHEKNL  58

Query  234   GRVNE-KRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
               +++ +RE LH L      S+ ++VPV++MLPLDT+   G+LNKPR+MNASLMAL+ AG
Sbjct  59    XTISDGRRELLHALPNIAHTSTDNKVPVYVMLPLDTVXHXGHLNKPRAMNASLMALKQAG  118

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVD WWGLVE DGP KYNWEGYA LV+MVQ+HG+K+QVVMSFHQCGGNVGDSCSIP
Sbjct  119   VEGVMVDVWWGLVEXDGPSKYNWEGYAELVQMVQKHGMKIQVVMSFHQCGGNVGDSCSIP  178

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWVLEE+SKNPDLVYTD+SGRRNPEYISLGCD LPVL GRTP+QVY DYMRSF +RF 
Sbjct  179   LPPWVLEEVSKNPDLVYTDKSGRRNPEYISLGCDSLPVLGGRTPIQVYTDYMRSFHDRFI  238

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
             +Y+G+VIVE+QVGMGPCG LRYP+YPESNGTWRFPGIGEFQCYDKYMRASL ASAEA GK
Sbjct  239   DYLGDVIVEIQVGMGPCGXLRYPAYPESNGTWRFPGIGEFQCYDKYMRASLEASAEAMGK  298

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
              +WGRSGPHD+GQYNQFPEDTGFF+RDGTW TE GQFF EWYSGKLL HGDRIL+AA GV
Sbjct  299   RDWGRSGPHDSGQYNQFPEDTGFFKRDGTWNTEXGQFFXEWYSGKLLRHGDRILSAAKGV  358

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCM  1310
             FQG+GAKLSGKIAGIHWHY +RSHAAEL AGY NTR R+GY+P A M +K+ VV NFTCM
Sbjct  359   FQGSGAKLSGKIAGIHWHYGSRSHAAELTAGYXNTRHRDGYVPTARMFSKNMVVLNFTCM  418

Query  1311  EMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGN  1490
             EMKD EQP  ANCSPEGLVRQVK+ATK AG +LAGENALERYD+  +  VLAT  SDSGN
Sbjct  419   EMKDREQPEHANCSPEGLVRQVKMATKSAGIDLAGENALERYDTGAFAXVLATXXSDSGN  478

Query  1491  GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNAK  1670
              LSAFTYLRMNK LFE +NWR +VEFV+SM+EGGR+  L ECDS+ +DL+   IK++  +
Sbjct  479   ALSAFTYLRMNKRLFEXDNWRNMVEFVRSMAEGGRNRSLXECDSTGSDLFXRFIKEKKVE  538

Query  1671  NANEAVLV  1694
                E  LV
Sbjct  539   KTKEXXLV  546



>gb|KEH31589.1| beta-amylase [Medicago truncatula]
Length=541

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/549 (74%), Positives = 462/549 (84%), Gaps = 10/549 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             M LTLRSS SFI  KE K +K  DD  S + F++ K S   RL+AKSSMQ A        
Sbjct  1     MTLTLRSSISFIIQKETKFLKTFDDVSSTLTFAKIKPS--FRLKAKSSMQIAHTF-----  53

Query  234   GRVNEKRERLHGLA-ANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
              + +EK E++H  +  + +H +S +VPVF+MLPLDT+TMGGNLNKPR+MNASLMAL+SAG
Sbjct  54    -KSDEKWEQVHAPSIVHSNHDNSKKVPVFVMLPLDTVTMGGNLNKPRAMNASLMALKSAG  112

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVD WWGLVEKDGP KYNWE YA LV+MVQ HGLKLQVVMSFHQCGGNVGDSCS+P
Sbjct  113   VEGVMVDVWWGLVEKDGPFKYNWEAYAELVQMVQLHGLKLQVVMSFHQCGGNVGDSCSVP  172

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWV+EEISKNPD+VYTDRSGRRNPEYISLGCD +PVL+GRTP+QVYADYMRSFR+RF 
Sbjct  173   LPPWVMEEISKNPDIVYTDRSGRRNPEYISLGCDSVPVLKGRTPLQVYADYMRSFRDRFS  232

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
             +Y+G+VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM+ASLAA+AEA GK
Sbjct  233   DYLGSVISEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKASLAAAAEAIGK  292

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
              EWG  GPHD+GQYNQFPEDTGFFR+DGTW +EYGQFFLEWYSGKLLEHGDRIL +A  +
Sbjct  293   KEWGGGGPHDSGQYNQFPEDTGFFRKDGTWNSEYGQFFLEWYSGKLLEHGDRILVSAKEI  352

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCM  1310
             FQ +G KLSGK+AGIHWHY +RSHAAEL AGYYNTR  +GYLPIA M A H VVFNFTCM
Sbjct  353   FQTSGVKLSGKVAGIHWHYRSRSHAAELTAGYYNTRHNDGYLPIAKMFANHDVVFNFTCM  412

Query  1311  EMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGN  1490
             EMKD EQPG ANCSPEGLV QVK ATK A  ELAGENALERYDS GY QVL+TS SDSG+
Sbjct  413   EMKDREQPGHANCSPEGLVHQVKKATKMANIELAGENALERYDSGGYAQVLSTSMSDSGS  472

Query  1491  GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK-RNA  1667
             GL+AFTYLRMNK LFE +NWR LV+FV++MSEGGR  RLP+ DS  +D+YVG I+K +  
Sbjct  473   GLAAFTYLRMNKKLFEGDNWRHLVDFVRNMSEGGRRQRLPDSDSRGSDIYVGHIEKTKEQ  532

Query  1668  KNANEAVLV  1694
             K   EA+LV
Sbjct  533   KQEGEAILV  541



>gb|KHN42645.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=548

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/553 (73%), Positives = 456/553 (82%), Gaps = 11/553 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQ---  224
             MALTLRSS S +N KE K  K  D+ P+ V F   K +   RLRAKSSMQ+  +      
Sbjct  1     MALTLRSSISLVNQKETKLPKAKDEVPTKV-FYFGKTNPSFRLRAKSSMQQTHVTRNNSF  59

Query  225   -PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
                   +NEKRE++H  +   SH+ S RVPVF+MLPLDT+TMGG LNKPR+MNASLMAL+
Sbjct  60    NSEVTMINEKREKVHAPSVAHSHNDSMRVPVFVMLPLDTVTMGGTLNKPRAMNASLMALK  119

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
             SAGVEGVMVDAWWGLVEK+GPLKYNWE YA LV+MVQ HGLKLQVVMSFHQCGGNVGDSC
Sbjct  120   SAGVEGVMVDAWWGLVEKEGPLKYNWEAYAELVQMVQRHGLKLQVVMSFHQCGGNVGDSC  179

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             SIPLPPWVLEEISKNP+LVYTDRSGRRNPEYISLGCD +PVLRGRTP+QVY+DYMRSFR 
Sbjct  180   SIPLPPWVLEEISKNPELVYTDRSGRRNPEYISLGCDSMPVLRGRTPLQVYSDYMRSFRY  239

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF++Y+G+VI+E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL AS EA
Sbjct  240   RFRDYLGSVIIEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLEASTEA  299

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              GK EWG++GPHD+GQYNQFPEDTGFF+R+GTW TEYG+FFL+WYS KLLEHG++IL +A
Sbjct  300   IGKKEWGKNGPHDSGQYNQFPEDTGFFQREGTWNTEYGRFFLDWYSTKLLEHGEKILVSA  359

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
              G+F   G KLS K+AGIHWHY  RSHAAEL AGYYNTR R+GYLPIA MLAKHGVV NF
Sbjct  360   KGIFNSCGVKLSAKVAGIHWHYKARSHAAELTAGYYNTRFRDGYLPIAQMLAKHGVVLNF  419

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEM+D EQP   +CSPEGLV QVK+A + A AELAGENALERYD+  + QVL+T  S+
Sbjct  420   TCMEMRDREQP--EHCSPEGLVHQVKIAARTAEAELAGENALERYDAGAFSQVLST--SN  475

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK--  1655
             SG+GL+AFTYLRMNK LFE +NWR  VEFVKSMSEGG+  RLPE DS  T LYVG I   
Sbjct  476   SGSGLAAFTYLRMNKRLFEGDNWRLFVEFVKSMSEGGKRQRLPESDSCGTHLYVGHITGI  535

Query  1656  KRNAKNANEAVLV  1694
             ++  + A E  LV
Sbjct  536   QKQQEQAQEVALV  548



>ref|XP_006573703.1| PREDICTED: beta-amylase 3, chloroplastic-like [Glycine max]
Length=548

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/553 (73%), Positives = 456/553 (82%), Gaps = 11/553 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQ---  224
             MALTLRSS S +N KE K  K  D+ P+ V F   K +   RLRAKSSMQ+  +      
Sbjct  1     MALTLRSSISLVNQKETKLPKAKDEVPTKV-FYFGKTNPSFRLRAKSSMQQTHVTPNNSF  59

Query  225   -PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
                   +NEKRE++H  +   SH+ S RVPVF+MLPLDT+TMGG LNKPR+MNASLMAL+
Sbjct  60    NSEVTMINEKREKVHAPSVAHSHNDSMRVPVFVMLPLDTVTMGGTLNKPRAMNASLMALK  119

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
             SAGVEGVMVDAWWGLVEK+GPLKYNWE YA LV+MVQ HGLKLQVVMSFHQCGGNVGDSC
Sbjct  120   SAGVEGVMVDAWWGLVEKEGPLKYNWEAYAELVQMVQRHGLKLQVVMSFHQCGGNVGDSC  179

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             SIPLPPWVLEEISKNP+LVYTDRSGRRNPEYISLGCD +PVLRGRTP+QVY+DYMRSFR 
Sbjct  180   SIPLPPWVLEEISKNPELVYTDRSGRRNPEYISLGCDSMPVLRGRTPLQVYSDYMRSFRY  239

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF++Y+G+VI+E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL AS EA
Sbjct  240   RFRDYLGSVIIEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLEASTEA  299

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              GK EWG++GPHD+GQYNQFPEDTGFF+R+GTW TEYG+FFL+WYS KLLEHG++IL +A
Sbjct  300   IGKKEWGKNGPHDSGQYNQFPEDTGFFQREGTWNTEYGRFFLDWYSTKLLEHGEKILVSA  359

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
              G+F   G KLS K+AGIHWHY  RSHAAEL AGYYNTR R+GYLPIA MLAKHGVV NF
Sbjct  360   KGIFNSCGVKLSAKVAGIHWHYKARSHAAELTAGYYNTRFRDGYLPIAQMLAKHGVVLNF  419

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEM+D EQP   +CSPEGLV QVK+A + A AELAGENALERYD+  + QVL+T  S+
Sbjct  420   TCMEMRDREQP--EHCSPEGLVHQVKIAARTAEAELAGENALERYDAGAFSQVLST--SN  475

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK--  1655
             SG+GL+AFTYLRMNK LFE +NWR  VEFVKSMSEGG+  RLPE DS  T LYVG I   
Sbjct  476   SGSGLAAFTYLRMNKRLFEGDNWRLFVEFVKSMSEGGKRQRLPESDSCGTHLYVGHITGI  535

Query  1656  KRNAKNANEAVLV  1694
             ++  + A E  LV
Sbjct  536   QKQQEQAQEVALV  548



>ref|XP_010440058.1| PREDICTED: beta-amylase 3, chloroplastic [Camelina sativa]
Length=548

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/550 (71%), Positives = 458/550 (83%), Gaps = 5/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +N +   + + F++  R   ++ +AK+S++E     +   
Sbjct  1     MELTLNSSSSLIKRKDAKNSRNQESSSNNMTFAKM-RPPTYQFQAKNSVKEMKFTHEKTY  59

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               E    E+ E+LH L+     S SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  60    SPENETTERWEKLHVLSYPHPKSDSS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  118

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+KYNW+GYA L++MVQ HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  119   AGVEGVMVDAWWGLVEKDGPMKYNWDGYAELIQMVQRHGLKLQVVMSFHQCGGNVGDSCS  178

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEE+SKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  179   IPLPPWVLEEVSKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  238

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F  Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  239   FDNYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  298

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A 
Sbjct  299   GKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAK  358

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQG+GAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M +KHGVV NFT
Sbjct  359   GIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFSKHGVVLNFT  418

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKDGEQP  ANCSPEGLV+QV+ ATK AG +LAGENALERYDS  + QV+AT+RSDS
Sbjct  419   CMEMKDGEQPEHANCSPEGLVKQVQNATKQAGTDLAGENALERYDSSAFGQVVATNRSDS  478

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   RL E D++ +DLYVG +K R 
Sbjct  479   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSEEDTTGSDLYVGFVKGRI  538

Query  1665  AKNANEAVLV  1694
             A+N  EA LV
Sbjct  539   AENVEEAALV  548



>ref|XP_004508980.1| PREDICTED: beta-amylase 3, chloroplastic-like [Cicer arietinum]
Length=545

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/549 (74%), Positives = 458/549 (83%), Gaps = 6/549 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             M LTLRSS SFI  KE K +K  DD  + V +++ K S +  LR KSSMQ A       E
Sbjct  1     MTLTLRSSVSFIIQKETKFLKTFDDVSTTVTYAKIKPSFN--LRVKSSMQIAHTFKS--E  56

Query  234   GRVNEKRERLHGLAANQS-HSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
               +NEK E++   + + S H  S +VPVF+MLPLDT+TMGGNLNKPR+M+ASLMAL+SAG
Sbjct  57    VSINEKWEKVLTPSISHSNHDGSKKVPVFVMLPLDTVTMGGNLNKPRAMSASLMALKSAG  116

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVD WWGLVEKDGPLKYNWE YA L++MVQ  GLKLQVVMSFHQCGGNVGDSCSIP
Sbjct  117   VEGVMVDVWWGLVEKDGPLKYNWEAYAELIQMVQMQGLKLQVVMSFHQCGGNVGDSCSIP  176

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWV+EEISKNPD+VYTDRSGRRNPEYISLGCD +PVLRGRTP+QVYAD+MRSFR+RF 
Sbjct  177   LPPWVMEEISKNPDIVYTDRSGRRNPEYISLGCDSVPVLRGRTPLQVYADFMRSFRDRFT  236

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
             +Y+G+VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM+ASLAA+AEA GK
Sbjct  237   DYLGSVISEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKASLAAAAEAMGK  296

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
              EWGR GPHD+GQYNQFPEDTGFFR+DGTW +EYG+FFLEWYSGKLLEHG+RIL +A  +
Sbjct  297   KEWGRGGPHDSGQYNQFPEDTGFFRKDGTWNSEYGRFFLEWYSGKLLEHGERILVSAKDI  356

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCM  1310
             FQ +G KLSGKIAGIHWHY +RSHAAEL AGYYNTR  +GYLPIA M AKHGVVFNFTCM
Sbjct  357   FQTSGVKLSGKIAGIHWHYRSRSHAAELTAGYYNTRHIDGYLPIAKMFAKHGVVFNFTCM  416

Query  1311  EMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGN  1490
             EMKD EQP  ANCSPEGLV QVK AT+ A  ELAGENALERYD+ GY QVL+TS SDSG 
Sbjct  417   EMKDREQPDHANCSPEGLVHQVKAATRTAKIELAGENALERYDAGGYAQVLSTSVSDSGT  476

Query  1491  GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK-RNA  1667
             GL+AFTYLRMNK LFE +NWR LV+FV++MS GGR  RLP+ D   +DLYVG IKK +  
Sbjct  477   GLAAFTYLRMNKKLFEGDNWRNLVDFVRNMSNGGRRQRLPDSDLRGSDLYVGHIKKTKEH  536

Query  1668  KNANEAVLV  1694
             K   EA LV
Sbjct  537   KQDAEAALV  545



>gb|AFI56496.1| beta-amylase [Vaccinium corymbosum]
Length=533

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/511 (76%), Positives = 440/511 (86%), Gaps = 5/511 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP--  227
             MALTLRS TSFINLK+ +  K  D+  S+VCF+Q + SC  RL+AKS MQ   LL +   
Sbjct  1     MALTLRSPTSFINLKDTRSFKAVDEVSSMVCFAQMRPSC--RLKAKSLMQGTQLLQEKTL  58

Query  228   -LEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
              LE R N+K E+LHG       + S  VPVF+MLPLDT+++GG+LNKP++MNASLMAL+S
Sbjct  59    NLEDRRNDKWEKLHGRTEAHGKNDSRNVPVFVMLPLDTVSLGGHLNKPKAMNASLMALKS  118

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AG+EGVMVDAWWGLVEK+GP KYNWEGYA LVKMVQ+HGLK+QVVMSFHQCGGNVGDSCS
Sbjct  119   AGIEGVMVDAWWGLVEKEGPSKYNWEGYAELVKMVQKHGLKIQVVMSFHQCGGNVGDSCS  178

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEIS+NPDLVYTD+SGRRNPEY+SLGCD L VLRGRTP+QVY+DYMRSFR+R
Sbjct  179   IPLPPWVLEEISRNPDLVYTDKSGRRNPEYVSLGCDSLAVLRGRTPIQVYSDYMRSFRDR  238

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F++Y+G+VIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL ASAE  
Sbjct  239   FQDYLGDVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLQASAETL  298

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             G++ WG SGPHD+GQYNQFPEDT FFRRDGTW  EYGQFFL+WYSG  LEHG+R+L AA 
Sbjct  299   GRTNWGISGPHDSGQYNQFPEDTDFFRRDGTWNNEYGQFFLKWYSGMPLEHGNRLLAAAK  358

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQGTGAKLSGK+AG HWHY +RSHAAEL AGYYNTR ++GYLPIA M+ KHGVV NFT
Sbjct  359   GIFQGTGAKLSGKVAGTHWHYRSRSHAAELTAGYYNTRHQDGYLPIARMMGKHGVVLNFT  418

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQPG ANCSPEGLVRQVK+ATK A  +LAGENALERYD   Y QVL TS+SDS
Sbjct  419   CMEMRDGEQPGHANCSPEGLVRQVKMATKVARIDLAGENALERYDEGAYAQVLKTSQSDS  478

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKS  1577
             GNGLSAFTYLR++K LFE ENWR LV F K+
Sbjct  479   GNGLSAFTYLRLSKRLFEGENWRHLVGFAKA  509



>ref|NP_567523.1| beta-amylase [Arabidopsis thaliana]
 sp|O23553.3|BAM3_ARATH RecName: Full=Beta-amylase 3, chloroplastic; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase; AltName: Full=Beta-amylase 
8; AltName: Full=Chloroplast beta-amylase; Short=CT-BMY; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB58423.1| beta-amylase enzyme [Arabidopsis thaliana]
 gb|AAM65134.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AEE83848.1| beta-amylase [Arabidopsis thaliana]
Length=548

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/550 (71%), Positives = 460/550 (84%), Gaps = 5/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +N +   + + F++ K   + + +AK+S++E     +   
Sbjct  1     MELTLNSSSSLIKRKDAKSSRNQESSSNNMTFAKMKPPTY-QFQAKNSVKEMKFTHEKTF  59

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               EG   EK E+LH L+   S + +S VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  60    TPEGETLEKWEKLHVLSYPHSKNDAS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  118

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+ YNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  119   AGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCS  178

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  179   IPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  238

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F+ Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  239   FEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  298

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A 
Sbjct  299   GKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAK  358

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQG+GAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFT
Sbjct  359   GIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFT  418

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG ELAGENALERYDS  + QV+AT+RSDS
Sbjct  419   CMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDS  478

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   RL + D++ +DLYVG +K + 
Sbjct  479   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKI  538

Query  1665  AKNANEAVLV  1694
             A+N  EA LV
Sbjct  539   AENVEEAALV  548



>ref|XP_002868085.1| beta-amylase 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44344.1| beta-amylase 8 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/550 (71%), Positives = 459/550 (83%), Gaps = 5/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +N +   + + F++ K   + + +AK+S++E     +   
Sbjct  1     MELTLNSSSSLIKRKDAKSSRNQESSSNNMTFAKMKPPTY-QFQAKNSVKEMKFTHEKTF  59

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               EG   E+ E+LH L+   S + SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  60    TPEGETLERWEKLHVLSYPHSKNESS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  118

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+ YNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  119   AGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCS  178

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTD+SGRRN EYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  179   IPLPPWVLEEISKNPDLVYTDKSGRRNAEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  238

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F+ Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  239   FEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  298

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A 
Sbjct  299   GKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAK  358

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQG+GAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFT
Sbjct  359   GIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFT  418

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG ELAGENALERYDS  + QV+AT+RSDS
Sbjct  419   CMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDS  478

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   RL + D++ +DLYVG +K R 
Sbjct  479   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGRI  538

Query  1665  AKNANEAVLV  1694
             A+N  EA LV
Sbjct  539   AENVEEAALV  548



>ref|XP_010449668.1| PREDICTED: beta-amylase 3, chloroplastic-like [Camelina sativa]
Length=548

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/550 (70%), Positives = 457/550 (83%), Gaps = 5/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +N +   + + F++  R   ++ +AK+S++E     +   
Sbjct  1     MELTLNSSSSLIKRKDAKSSRNQESSSNNMTFAKM-RPPTYQFQAKNSVKEMKFTHEKTY  59

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               E    E+ E+LH L+     S SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  60    SPENETTERFEKLHVLSYPHPKSDSS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  118

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+KYNW+GYA L++MVQ HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  119   AGVEGVMVDAWWGLVEKDGPMKYNWDGYAELIQMVQRHGLKLQVVMSFHQCGGNVGDSCS  178

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEE+SKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFR+R
Sbjct  179   IPLPPWVLEEVSKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRDR  238

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F  Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  239   FDNYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  298

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PE+T FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A 
Sbjct  299   GKTNWGTSGPHDAGEYKNLPEETEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAK  358

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQG+GAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFT
Sbjct  359   GIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFT  418

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG +LAGENALERYDS  + QV+AT+RSDS
Sbjct  419   CMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTDLAGENALERYDSSAFGQVVATNRSDS  478

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   RL E D++ +DLYVG +K R 
Sbjct  479   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSEEDTTGSDLYVGFVKGRI  538

Query  1665  AKNANEAVLV  1694
             A+N  EA LV
Sbjct  539   AENVEEAALV  548



>ref|XP_006285145.1| hypothetical protein CARUB_v10006488mg [Capsella rubella]
 gb|EOA18043.1| hypothetical protein CARUB_v10006488mg [Capsella rubella]
Length=548

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/550 (71%), Positives = 456/550 (83%), Gaps = 5/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +N +   + + F++  R   ++ +AKSS++E     +   
Sbjct  1     MELTLNSSSSLIKRKDAKNSRNQESSSNNMTFAKM-RPPTYQFQAKSSVKEMKFTHEKTF  59

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               E    E+ E+LH L+     S SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  60    TPENETTERWEKLHVLSYPHPKSDSS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  118

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+KYNW+GYA L++MVQ HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  119   AGVEGVMVDAWWGLVEKDGPMKYNWDGYAELIQMVQRHGLKLQVVMSFHQCGGNVGDSCS  178

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  179   IPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDYVPVLRGRTPIQVYSDFMRSFRER  238

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F  Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  239   FDNYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  298

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A 
Sbjct  299   GKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAK  358

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQG+GAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFT
Sbjct  359   GIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFT  418

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG ELAGENALERYDS  + QV+AT+RSDS
Sbjct  419   CMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDS  478

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   +L E D++ +DLYVG ++ R 
Sbjct  479   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRKLSEEDTTGSDLYVGFVRGRV  538

Query  1665  AKNANEAVLV  1694
             A+   EA LV
Sbjct  539   AEKVEEASLV  548



>gb|EYU24930.1| hypothetical protein MIMGU_mgv1a020099mg [Erythranthe guttata]
Length=542

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/554 (73%), Positives = 462/554 (83%), Gaps = 20/554 (4%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAAL----LS  221
             MAL L SST  INLKE +  +NPDD  S V F++ K +C  +LRAK+S QE+ +      
Sbjct  1     MALALHSSTPLINLKENRSYRNPDDSSSTVGFAKMKPTC--QLRAKNSTQESQISRTERE  58

Query  222   QPLEGRVNE-KRERLHGLAANQSHSSSS-RVPVFIMLPLDTITMGGNLNKPRSMNASLMA  395
             +     ++E +RE+LHG+A+  SHSS++ RVPVF+MLPLDT+++GG+LNK R+M ASLMA
Sbjct  59    RSFSTTIHELQREKLHGMASPHSHSSTNVRVPVFVMLPLDTVSIGGSLNKSRAMFASLMA  118

Query  396   LRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGD  575
             L+S GVEGVMVDAWWGLVEKDGP+KYNWEGYA L+KMV++ GLK+QVVMSFHQCGGNVGD
Sbjct  119   LKSGGVEGVMVDAWWGLVEKDGPMKYNWEGYAELIKMVEKLGLKIQVVMSFHQCGGNVGD  178

Query  576   SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSF  755
             SCSIPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD LPVLRGRTP+QVY+D+M SF
Sbjct  179   SCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSLPVLRGRTPIQVYSDFMMSF  238

Query  756   RERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASA  935
             RERFK Y+G V+VE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAA+A
Sbjct  239   RERFKAYLGEVVVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAAAA  298

Query  936   EAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILT  1115
             EA GK +WGR GPHDAGQYNQFP+DTGFFR+DGTW +EYG FFLEWYSG L+ HG++IL 
Sbjct  299   EAIGKDDWGRGGPHDAGQYNQFPDDTGFFRKDGTWNSEYGHFFLEWYSGNLINHGEKILA  358

Query  1116  AAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVF  1295
             AA  VF+GTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GYLPIA ML+K     
Sbjct  359   AAERVFEGTGAKLSGKVAGIHWHYKTRSHAAELTAGYYNTRHRDGYLPIARMLSKP----  414

Query  1296  NFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR  1475
                    +DGEQP  ANCSPEGLV+QVK+ATK A  +LAGENALERYD   Y QVL TSR
Sbjct  415   -------QDGEQPNEANCSPEGLVKQVKMATKTARIDLAGENALERYDGGAYSQVLETSR  467

Query  1476  SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK  1655
             SDSGNGLSAFTYLR+NK LFEPENWR LVEFV+SMSEGG+ TRLPE D   TDL+VG +K
Sbjct  468   SDSGNGLSAFTYLRLNKRLFEPENWRNLVEFVRSMSEGGQRTRLPESDRIGTDLFVGFVK  527

Query  1656  KRNA-KNANEAVLV  1694
             + N  K  +E  LV
Sbjct  528   QSNVRKTISEVALV  541



>ref|XP_010434720.1| PREDICTED: beta-amylase 3, chloroplastic-like [Camelina sativa]
Length=548

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/550 (70%), Positives = 458/550 (83%), Gaps = 5/550 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +N +   + + F++  R   ++ +AK+S++E     +   
Sbjct  1     MELTLNSSSSLIKRKDAKNSRNQESSSNNMTFAKM-RPPTYQFQAKNSVKEMKFTHEKTY  59

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               E    E+ E+LH L+     S SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  60    SPENETTERWEKLHVLSYPHPKSDSS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  118

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+KYNW+GYA L++MVQ++GLKLQVVMSFHQCGGNVGDSCS
Sbjct  119   AGVEGVMVDAWWGLVEKDGPMKYNWDGYAELIQMVQKNGLKLQVVMSFHQCGGNVGDSCS  178

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVL+E+SKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  179   IPLPPWVLKEVSKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  238

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F  ++G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  239   FDNHIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  298

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PE+T FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A 
Sbjct  299   GKTNWGTSGPHDAGEYKNLPEETEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAK  358

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQG+GAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFT
Sbjct  359   GIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFT  418

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG +LAGENALERYDS  + QV+AT+RSDS
Sbjct  419   CMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTDLAGENALERYDSSAFGQVVATNRSDS  478

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   RL E D++ +DLYVG +K R 
Sbjct  479   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSEEDTTGSDLYVGFVKGRI  538

Query  1665  AKNANEAVLV  1694
             A+N  EA LV
Sbjct  539   AENVEEAALV  548



>ref|XP_003539125.1| PREDICTED: beta-amylase 3, chloroplastic-like isoform 1 [Glycine 
max]
 gb|KHN34883.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=554

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/559 (71%), Positives = 456/559 (82%), Gaps = 17/559 (3%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MALTLRSS S  + KE K  K  D+ P+ V F+  K +   RLRAKSSMQ+  +     +
Sbjct  1     MALTLRSSISLASQKETKLQKPDDEVPTKV-FNFAKANPSFRLRAKSSMQQTHVTGDNNK  59

Query  234   GR----------VNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNA  383
              +          +NEKRE++H  +   SH+ S RVPVF+MLPLDT+TMGG LNKPR+MNA
Sbjct  60    NKNNNFNSEVTMINEKREKVHAPSVAHSHNDSMRVPVFVMLPLDTVTMGGTLNKPRAMNA  119

Query  384   SLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGG  563
             SLMAL+SAGVEGVMVDAWWGLVEK+GPLKYNWE YA LV+MVQ HGLKLQVVMSFHQCGG
Sbjct  120   SLMALKSAGVEGVMVDAWWGLVEKEGPLKYNWEAYAELVQMVQRHGLKLQVVMSFHQCGG  179

Query  564   NVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADY  743
             NVGD CSIPLPPWVLEEI KNP++VYTDRSGRRNPEYISLGCD +PVLRGRTP+QVY+DY
Sbjct  180   NVGDCCSIPLPPWVLEEIRKNPEMVYTDRSGRRNPEYISLGCDSMPVLRGRTPLQVYSDY  239

Query  744   MRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL  923
             MRSFR RF++Y+G+VI+E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL
Sbjct  240   MRSFRHRFRDYLGSVIIEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL  299

Query  924   AASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGD  1103
              AS EA GK EWG+SGPHD+GQYNQFPEDTGFF+R+GTW TEYGQFFL+WYS KL+EHG+
Sbjct  300   EASTEAIGKKEWGKSGPHDSGQYNQFPEDTGFFKREGTWNTEYGQFFLDWYSTKLVEHGE  359

Query  1104  RILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKH  1283
             +IL +A G+F   G KLS K+AGIHWHY TRSHAAEL AGYYNTR R+GYLPIA M+AKH
Sbjct  360   KILVSAKGIFNSCGVKLSAKVAGIHWHYKTRSHAAELTAGYYNTRFRDGYLPIAQMVAKH  419

Query  1284  GVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVL  1463
             GVV NFTCMEM+D EQ    +CSPEGLV QVK+A + AGAELAGENALERYD+  + QVL
Sbjct  420   GVVLNFTCMEMRDREQ--HEHCSPEGLVHQVKMAARTAGAELAGENALERYDAGAFSQVL  477

Query  1464  ATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYV  1643
             +T  S+SG+GL+AFTYLRMN+ LFE +NWR  VEFVK MSEGG+  RLP+ DS  T LYV
Sbjct  478   ST--SNSGSGLAAFTYLRMNRRLFEGDNWRHFVEFVKCMSEGGKRQRLPQSDSCGTHLYV  535

Query  1644  GLIK--KRNAKNANEAVLV  1694
             G I   ++  + A E  LV
Sbjct  536   GHITGIQKQQEQAQEVALV  554



>gb|AFO84077.1| beta-amylase [Actinidia chinensis]
Length=520

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/514 (76%), Positives = 433/514 (84%), Gaps = 6/514 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP--  227
             MALTLRSS SFI LK+ +  K  DDF  +VCF+Q + SC  RLRAKS MQE     +   
Sbjct  1     MALTLRSSNSFIKLKDSRCFKTLDDFSGMVCFAQIRPSC--RLRAKSLMQETQFSREKTL  58

Query  228   -LEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
              LE R NEK E+LH L+      + S+VPVF+MLPLDTI+ GGNLNKPR+MNASLMAL+S
Sbjct  59    NLEDRRNEKWEKLHKLSDTHG-KNDSQVPVFVMLPLDTISNGGNLNKPRAMNASLMALKS  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AG+EGV VDAWWGLVEK+GP+KYNWEGYA LVKM Q+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGIEGVTVDAWWGLVEKEGPMKYNWEGYAELVKMAQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLP WVLEEISKNPDLVYTDRSGRRNPEY+SL CD LPVLRGRT +QVY+DYMRSFR+R
Sbjct  178   IPLPSWVLEEISKNPDLVYTDRSGRRNPEYLSLACDLLPVLRGRTIIQVYSDYMRSFRDR  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             FK+Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGE+QCYDKYMRASL ASAEA 
Sbjct  238   FKDYLGEVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEYQCYDKYMRASLQASAEAI  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK +WG SGPHD GQYNQFPEDT F RRDGTW  +YGQFFLEWY G LLEHGDRIL AA 
Sbjct  298   GKEDWGISGPHDTGQYNQFPEDTTFLRRDGTWNNDYGQFFLEWYLGMLLEHGDRILAAAN  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
              +FQGTGAKLSGK+AGIHWH  TRSHAAEL AGYYN R +NGYLPIA M+ K+GVV NFT
Sbjct  358   RIFQGTGAKLSGKVAGIHWHCRTRSHAAELTAGYYNMRHQNGYLPIARMMGKYGVVMNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQ  +A+ SPE LVRQVK ATK AG ELAGEN LERYD+  Y QVL TSRSDS
Sbjct  418   CMEMRDGEQSENASRSPERLVRQVKKATKTAGTELAGENVLERYDAGAYSQVLTTSRSDS  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSE  1586
             GNGLSAFTYLRMNK LFE ENW+ LVEFV++MS+
Sbjct  478   GNGLSAFTYLRMNKRLFEGENWKDLVEFVRNMSQ  511



>emb|CDY42960.1| BnaA01g17940D [Brassica napus]
Length=549

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/554 (71%), Positives = 455/554 (82%), Gaps = 12/554 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQ---  224
             M LTL SS+S I  K+ K  +N +   S + F++ K   + + +AKSS++E     +   
Sbjct  1     MELTLNSSSSLIKRKDTKSSRNHES-SSNMSFAKMKPPTY-QFQAKSSVKEMKFTHEKTF  58

Query  225   -PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
              P      E+ E+LH L+     + SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+
Sbjct  59    KPEGEEATERWEKLHVLSYPHPKNDSS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALK  117

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
              AGVEGVMVDAWWGLVEKDGP+KYNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGDSC
Sbjct  118   GAGVEGVMVDAWWGLVEKDGPMKYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSC  177

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             SIPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRE
Sbjct  178   SIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRE  237

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF  YMG VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMR+SL A AE+
Sbjct  238   RFDHYMGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRSSLQAYAES  297

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L +A
Sbjct  298   VGKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDKLLASA  357

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
              GVFQGTGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NF
Sbjct  358   KGVFQGTGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNF  417

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG +LAGENALERYDS  + QV+AT+RSD
Sbjct  418   TCMEMKDGEQPEHANCSPEGLVKQVQSATRQAGTDLAGENALERYDSSAFGQVVATNRSD  477

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG---GRSTRLPECDSSRTDLYVGLI  1652
             SGNGL+AFTYLRMNK LFE +NW++LVEFVK M EG   GR  +L E D++ +DLYVG +
Sbjct  478   SGNGLTAFTYLRMNKRLFEGQNWQQLVEFVKKMKEGGGDGRRRQLSEEDTTGSDLYVGFV  537

Query  1653  KKRNAKNANEAVLV  1694
             +K  ++   E  LV
Sbjct  538   RK--SRKVEEVSLV  549



>ref|XP_006414272.1| hypothetical protein EUTSA_v10024842mg [Eutrema salsugineum]
 dbj|BAJ34236.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55725.1| hypothetical protein EUTSA_v10024842mg [Eutrema salsugineum]
Length=548

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/551 (71%), Positives = 454/551 (82%), Gaps = 7/551 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +N D+  S + F+  K   + + +AK+S++E     +   
Sbjct  1     MELTLNSSSSLIKRKDTKSSRNQDN-SSNMSFAMMKPPTY-QFQAKNSVKEMKFTHEKTF  58

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               EG   E+ E+LH L+     S +S VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  59    TPEGETTERWEKLHVLSYPHPKSDAS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+KYNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPMKYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  178   IPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F   +G VI E+QVGMGPCGELRYPSYPESNGTW FPGIGEFQCYDKYMR+SL A AE+ 
Sbjct  238   FDSCIGGVIAEIQVGMGPCGELRYPSYPESNGTWSFPGIGEFQCYDKYMRSSLQAYAESI  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYS KLLEHGDR+L +A 
Sbjct  298   GKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSEKLLEHGDRLLASAK  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+FQGTGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFT
Sbjct  358   GIFQGTGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG ELAGENALERYDS  + QV+AT+RSDS
Sbjct  418   CMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDS  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK-KR  1661
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   +L E D++ +DLYVG ++ K+
Sbjct  478   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGKKLSEEDTTGSDLYVGFVRGKK  537

Query  1662  NAKNANEAVLV  1694
               +   EA LV
Sbjct  538   ITEKVEEASLV  548



>ref|XP_009144721.1| PREDICTED: beta-amylase 3, chloroplastic-like [Brassica rapa]
Length=549

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/554 (71%), Positives = 456/554 (82%), Gaps = 12/554 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQ---  224
             M LTL SS+S I  K+ K  +N +   S + F++ K   + + +AKSS++E     +   
Sbjct  1     MELTLNSSSSLIKRKDTKSSRNHES-SSNMSFAKMKPPTY-QFQAKSSVKEMKFTHEKTF  58

Query  225   -PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
              P      E+ E+LH L+     + SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+
Sbjct  59    KPEGEEATERWEKLHVLSYPHPKNDSS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALK  117

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
              AGVEGVMVDAWWGLVEKDGP+KYNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGDSC
Sbjct  118   GAGVEGVMVDAWWGLVEKDGPMKYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSC  177

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             SIPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRE
Sbjct  178   SIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRE  237

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF  Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMR+SL A AE+
Sbjct  238   RFDHYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRSSLQAYAES  297

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L +A
Sbjct  298   VGKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDKLLASA  357

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
              GVFQGTGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NF
Sbjct  358   KGVFQGTGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNF  417

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG +LAGENALERYDS  + QV+AT+RSD
Sbjct  418   TCMEMKDGEQPEHANCSPEGLVKQVQSATRQAGTDLAGENALERYDSSAFGQVVATNRSD  477

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG---GRSTRLPECDSSRTDLYVGLI  1652
             +GNGL+AFTYLRMNK LFE +NW++LVEFVK M EG   GR  +L E D++ +DLYVG +
Sbjct  478   TGNGLTAFTYLRMNKRLFEGQNWQQLVEFVKKMKEGGGDGRRRQLSEEDTTGSDLYVGFV  537

Query  1653  KKRNAKNANEAVLV  1694
             +K  ++   EA LV
Sbjct  538   RK--SRKVEEASLV  549



>ref|XP_009136825.1| PREDICTED: beta-amylase 3, chloroplastic [Brassica rapa]
Length=548

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/551 (70%), Positives = 455/551 (83%), Gaps = 7/551 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +  ++  S + F++ K   + + +AKSS++E     +   
Sbjct  1     MELTLNSSSSLIKRKDAKSSRTQEN-SSNMSFAKTKPPTY-QFQAKSSVKEMKFTHEKTY  58

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               E    E+ E+LH L+     + SS VPVF+MLPLDT+TM G+LNK R+MNASLMAL+ 
Sbjct  59    KPESETTERWEKLHVLSYPHPKNDSS-VPVFVMLPLDTVTMSGHLNKQRAMNASLMALKG  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+KYNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPMKYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  178   IPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F  Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  238   FDNYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A 
Sbjct  298   GKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAK  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
              +FQG+GAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFT
Sbjct  358   AIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG ELAGENALERYDS  + QV+AT+RSDS
Sbjct  418   CMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDS  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYV-GLIKKR  1661
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   RL E D++ +DLYV G +  +
Sbjct  478   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSEEDTTGSDLYVGGFVGSK  537

Query  1662  NAKNANEAVLV  1694
              ++   EAVLV
Sbjct  538   ISQTVEEAVLV  548



>emb|CDX90487.1| BnaA03g42940D [Brassica napus]
Length=541

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/550 (71%), Positives = 452/550 (82%), Gaps = 12/550 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +  ++  S + F++ K   + + +AKSS++E     +   
Sbjct  1     MELTLNSSSSLIKRKDAKSSRTQEN-SSNMSFAKTKPPTY-QFQAKSSVKEMKFTHEKTY  58

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               E    E+ E+LH L+     + SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  59    KPESETTERWEKLHVLSYPHPKNDSS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+KYNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPMKYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  178   IPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F  Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  238   FDNYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A 
Sbjct  298   GKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAK  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
              +FQG+GAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFT
Sbjct  358   AIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG ELAGENALERYDS  + QV+AT+RSDS
Sbjct  418   CMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDS  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   RL E D++ +DLYVG      
Sbjct  478   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSEEDTTGSDLYVGGF----  533

Query  1665  AKNANEAVLV  1694
                  EAVLV
Sbjct  534   --TVEEAVLV  541



>emb|CDY09643.1| BnaC07g34180D [Brassica napus]
Length=548

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/551 (70%), Positives = 454/551 (82%), Gaps = 7/551 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +  ++  S + F++ K   + + +AKSS++E     +   
Sbjct  1     MELTLNSSSSLIKRKDAKSSRTQEN-SSNMSFAKTKPPTY-QFQAKSSVKEMKFTHEKTY  58

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               E    E+ E+LH L+     + SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  59    KPESETTERWEKLHVLSYPHPKNDSS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+KYNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPMKYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  178   IPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F  Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  238   FDNYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A 
Sbjct  298   GKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDKLLSSAK  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
              +FQG+GAKLSGK+AGIHWHYNTRSHAAEL AGY+NTR  +GYLPIA M  KHGVV NFT
Sbjct  358   AIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYFNTRNHDGYLPIAKMFNKHGVVLNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKDGEQP  ANCSPEGLV+QV+ AT+ AG ELAGENALERYDS  + QV+AT+RSDS
Sbjct  418   CMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDS  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYV-GLIKKR  1661
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   RL E D++ +DLYV G +  +
Sbjct  478   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSEEDTTGSDLYVGGFVGSK  537

Query  1662  NAKNANEAVLV  1694
              ++   E  LV
Sbjct  538   ISETVEEVALV  548



>gb|KFK45005.1| hypothetical protein AALP_AA1G332100 [Arabis alpina]
Length=548

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/551 (70%), Positives = 455/551 (83%), Gaps = 7/551 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ +  +  +  P +  F+Q K   + + +AKSS++E     +   
Sbjct  1     MELTLNSSSSMIKPKDARSSRTQEGSPHM-SFAQMKPPTY-QFQAKSSVKEMKFTHEKTF  58

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               EG   E+ E+LH L+     ++SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  59    TPEGETMERFEKLHVLSYPHPKNNSS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+KYNWEGYA L+ MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPMKYNWEGYAELIHMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEIS NPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  178   IPLPPWVLEEISNNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F+ Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  238   FEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PEDT FFRR+GTW TEYG+FF+EWYSG LLEHGD++L +A+
Sbjct  298   GKTNWGTSGPHDAGEYKNLPEDTEFFRREGTWNTEYGRFFMEWYSGMLLEHGDKLLASAS  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+F G+G  LSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFT
Sbjct  358   GIFHGSGVTLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQP  ANCSPEGLV+QV+ AT+ AG ELAGENALERYDS  + QV+AT+RSDS
Sbjct  418   CMEMRDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDS  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK-KR  1661
             GNGL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   RLP+ D++ +DLYVG ++  R
Sbjct  478   GNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLPKEDTTGSDLYVGFVRGGR  537

Query  1662  NAKNANEAVLV  1694
              A++  EA LV
Sbjct  538   IAEDVEEASLV  548



>emb|CDY35597.1| BnaC01g21190D [Brassica napus]
Length=548

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/553 (71%), Positives = 454/553 (82%), Gaps = 11/553 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP--  227
             M LTL SS+S I  K+ K  +N +   S + F++ K   + + +AKSS++E     +   
Sbjct  1     MELTLNSSSSLIKRKDTKSSRNHES-SSNMSFAKMKPPTY-QFQAKSSVKEMFTHEKTFK  58

Query  228   LEGRVNEKR-ERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
             LEG    +R E+LH L+     + SS VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  59    LEGEEATQRWEKLHVLSYPHPKNDSS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  117

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+KYNWEGYA L+ MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  118   AGVEGVMVDAWWGLVEKDGPMKYNWEGYAELIHMVQKHGLKLQVVMSFHQCGGNVGDSCS  177

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  178   IPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  237

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F  Y+G VI E+QVGMGPCGELRYPSYPESNGTW+FPGIGEFQCYDKYMR+SL A AE+ 
Sbjct  238   FDHYIGGVIAEIQVGMGPCGELRYPSYPESNGTWKFPGIGEFQCYDKYMRSSLQAYAESV  297

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
              K+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L +A 
Sbjct  298   RKTNWGTSGPHDAGEYMNLPEDTDFFRRDGTWNSEYGKFFMEWYSGKLLEHGDKLLASAK  357

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             GVFQGTGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFT
Sbjct  358   GVFQGTGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFT  417

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEM+DGEQP  ANCSPEGLV+QV+ AT+ AG ELAGENALERYDS  + QV+AT+RSDS
Sbjct  418   CMEMRDGEQPEHANCSPEGLVKQVQSATRQAGTELAGENALERYDSSAFGQVVATNRSDS  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG---GRSTRLPECDSSRTDLYVGLIK  1655
             GNGL+ FTYLRMNK LFE +NW++LVEFVK M EG   GR  +L E D++ +DLYVG + 
Sbjct  478   GNGLTTFTYLRMNKRLFEGQNWQQLVEFVKKMKEGGGDGRRRQLSEEDTTGSDLYVGFV-  536

Query  1656  KRNAKNANEAVLV  1694
              R ++   EA LV
Sbjct  537   -RRSRKVEEASLV  548



>emb|CAB46051.1| putative beta-amylase [Arabidopsis thaliana]
 emb|CAB80980.1| putative beta-amylase [Arabidopsis thaliana]
Length=498

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/488 (76%), Positives = 428/488 (88%), Gaps = 1/488 (0%)
 Frame = +3

Query  231   EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
             EG   EK E+LH L+   S + +S VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ AG
Sbjct  12    EGETLEKWEKLHVLSYPHSKNDAS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAG  70

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVDAWWGLVEKDGP+ YNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGDSCSIP
Sbjct  71    VEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCSIP  130

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRERF+
Sbjct  131   LPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRERFE  190

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
              Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ GK
Sbjct  191   GYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESIGK  250

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
             + WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A G+
Sbjct  251   TNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAKGI  310

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCM  1310
             FQG+GAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR  +GYLPIA M  KHGVV NFTCM
Sbjct  311   FQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFTCM  370

Query  1311  EMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGN  1490
             EMKDGEQP  ANCSPEGLV+QV+ AT+ AG ELAGENALERYDS  + QV+AT+RSDSGN
Sbjct  371   EMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDSGN  430

Query  1491  GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNAK  1670
             GL+AFTYLRMNK LFE +NW++LVEFVK+M EGG   RL + D++ +DLYVG +K + A+
Sbjct  431   GLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKIAE  490

Query  1671  NANEAVLV  1694
             N  EA LV
Sbjct  491   NVEEAALV  498



>ref|XP_003611409.1| Beta-amylase [Medicago truncatula]
 gb|AES94367.1| beta-amylase [Medicago truncatula]
Length=543

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/538 (72%), Positives = 444/538 (83%), Gaps = 13/538 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPS-IVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             MALTLRSS SFI+ KE + +K+ DDF S  V   +FK   H  L+AKSSMQE     +  
Sbjct  1     MALTLRSSISFIHKKETRVLKSLDDFSSNKVSCPKFKPLFH--LKAKSSMQETHFTKENT  58

Query  231   EGRVNEKRERLHGLAANQSH---SSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
                V E ++R   LA + +H   + S+RVPVF+MLPLDT+TMGG LNK R+MNASLMAL+
Sbjct  59    NSAVKENKKREKVLAPSIAHNHDADSTRVPVFVMLPLDTVTMGGKLNKARAMNASLMALK  118

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
             SAGVEGVMVDAWWGLVEKDGP+KYNWE YA LV+MVQ+HGLKLQ+VMSFHQCGGNVGDSC
Sbjct  119   SAGVEGVMVDAWWGLVEKDGPMKYNWEAYAELVQMVQKHGLKLQIVMSFHQCGGNVGDSC  178

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             SIPLPPWVLEEI KNP+LVYTD+ GRRNPEYISLGCD +PVL GRTP+QVY+DYMRSFR+
Sbjct  179   SIPLPPWVLEEIRKNPELVYTDKLGRRNPEYISLGCDSVPVLAGRTPLQVYSDYMRSFRD  238

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF +Y+GNVI+E+QVG+GPCGELRYPSYPE++GTW+FPGIGEFQCYDKYMR+SL ASA A
Sbjct  239   RFTDYLGNVIIEIQVGLGPCGELRYPSYPETDGTWKFPGIGEFQCYDKYMRSSLEASAAA  298

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              GK EWG  GPHD+GQYNQFPEDTGFF+R+GTW TEYG FFL+WYS KL+EHG++IL +A
Sbjct  299   IGKKEWGTGGPHDSGQYNQFPEDTGFFKREGTWNTEYGDFFLDWYSSKLVEHGEKILVSA  358

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
               +FQ +G KLS KIAGIHWHYN RSHA EL AGYYNTR  +GY+PIA MLAKHGV+ NF
Sbjct  359   KSIFQTSGVKLSAKIAGIHWHYNARSHATELTAGYYNTRFHDGYIPIAQMLAKHGVILNF  418

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEMKD EQPG ANCSPEGLV QVK+ATK AG ELAGENALERYDS  Y QVL+TS   
Sbjct  419   TCMEMKDNEQPGHANCSPEGLVNQVKMATKIAGGELAGENALERYDSSAYGQVLSTS---  475

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK  1655
                GLSAFTYLR+NK L E ENWR+ V+FV SMS+GG+  RL + DS  TDLYVG IK
Sbjct  476   ---GLSAFTYLRINKRLLEGENWRQFVDFVVSMSDGGKP-RLSKSDSYGTDLYVGHIK  529



>ref|XP_007039631.1| Chloroplast beta-amylase isoform 3 [Theobroma cacao]
 gb|EOY24132.1| Chloroplast beta-amylase isoform 3 [Theobroma cacao]
Length=535

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/552 (71%), Positives = 438/552 (79%), Gaps = 48/552 (9%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGV-KNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             M LTLRSSTSF NLKE K + K PDDF   +CF+Q K SC  R +   SMQ+A L S   
Sbjct  27    MTLTLRSSTSFFNLKETKSLTKTPDDFLGTICFAQTKPSCRLRAKNSMSMQDAQLSSHGK  86

Query  231   ----EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMAL  398
                 EGR +E RE+LHGL  + + + S RVPVF+MLPLDTIT+GGNLNK R+MNASLMAL
Sbjct  87    VSIGEGRNSENREKLHGLTISHNENDS-RVPVFVMLPLDTITLGGNLNKQRAMNASLMAL  145

Query  399   RSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDS  578
             +SAGVEGVMVDAWWGLVEKDGPLKYNWEGYA LV+MV++HGLKLQVVMSFHQCGGNVGDS
Sbjct  146   KSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAELVQMVEKHGLKLQVVMSFHQCGGNVGDS  205

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             CSIPLPPWVLEEISKNPDLVYT+RSGRRNPEYISLGCD +PVLRGRTP+Q Y DYMRSFR
Sbjct  206   CSIPLPPWVLEEISKNPDLVYTERSGRRNPEYISLGCDSIPVLRGRTPIQAYTDYMRSFR  265

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             ERF++Y+G VIVE+QVGMGPCGELRYP+YPESNGTW+FPGIGEFQCYDKYMRASL A+AE
Sbjct  266   ERFRDYLGRVIVEIQVGMGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLEAAAE  325

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A GK +WG+ GPHD+G Y QFPE+TGFFRRDGTW TEYGQFFLEWYSGKLLEHGDRIL A
Sbjct  326   AIGKKDWGKGGPHDSGHYKQFPEETGFFRRDGTWNTEYGQFFLEWYSGKLLEHGDRILAA  385

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFN  1298
             A G+F GTGA LSGKIAGIHWHY TRSHAAEL AGYYNT                     
Sbjct  386   AKGIFHGTGAILSGKIAGIHWHYRTRSHAAELTAGYYNT---------------------  424

Query  1299  FTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRS  1478
                                EGLVRQVK+AT+ AG ELAGENALERYD+  Y QVLATSRS
Sbjct  425   -------------------EGLVRQVKMATRTAGGELAGENALERYDAGAYSQVLATSRS  465

Query  1479  DSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK  1658
             DSGNGLSAFTYLRMNK LFE  NWR LVEFVK+MSEGGR  ++ ECDS  T+LY+G I++
Sbjct  466   DSGNGLSAFTYLRMNKRLFEGGNWRHLVEFVKNMSEGGR--KISECDSRGTNLYIGFIRE  523

Query  1659  RNAKNANEAVLV  1694
             +N +   EA  V
Sbjct  524   KNVEKMKEAAPV  535



>ref|XP_003611408.1| Beta-amylase [Medicago truncatula]
 gb|AES94366.1| beta-amylase [Medicago truncatula]
Length=543

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/541 (71%), Positives = 443/541 (82%), Gaps = 11/541 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPS-IVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             MA TLR S S IN KE + +K+ DDF S  V   + K S  H+L+AKSS+QE    +   
Sbjct  1     MAQTLRFSISLINQKETRVLKSLDDFFSNKVSCPKMKPSIGHKLKAKSSIQETHFTTDNN  60

Query  231   EGRV--NEKRERLHGLAANQSHS-SSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
                V  ++K E++H  +   +H   S+RVPVF+MLPLDT+TMGG LNK R+MNASLMAL+
Sbjct  61    NSAVKKDKKWEKIHTSSVTHNHDGDSNRVPVFVMLPLDTVTMGGKLNKARAMNASLMALK  120

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
             SAGVEGVMVDAWWGLVEKDGP+KYNWE YA LV+MVQ+HGLKLQ+VMSFHQCGGNVGDSC
Sbjct  121   SAGVEGVMVDAWWGLVEKDGPMKYNWEAYAELVQMVQKHGLKLQIVMSFHQCGGNVGDSC  180

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             SIPLPPWVLEEI KNP+LVYTD+ GRRNPEYISLGCD +PVL GRTP+QVY+DYMRSFR+
Sbjct  181   SIPLPPWVLEEIRKNPELVYTDKLGRRNPEYISLGCDSVPVLAGRTPLQVYSDYMRSFRD  240

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF +Y+GNVI+E+QVG+GPCGELRYPSYPE++GTW+FPGIGEFQCYDKYMR+SL A+A A
Sbjct  241   RFTDYLGNVIIEIQVGLGPCGELRYPSYPETDGTWKFPGIGEFQCYDKYMRSSLEATAGA  300

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              GK EWG SGPHD+GQYNQFPEDTGFF+R+GTW TEYG FFL+WYS KL+EHG++IL +A
Sbjct  301   IGKKEWGTSGPHDSGQYNQFPEDTGFFKREGTWNTEYGDFFLDWYSSKLVEHGEKILVSA  360

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
               +FQ +G KLS KIAGIHWHYN RSHA EL AGYYNT+  +GY+PIA MLAKHGV+ NF
Sbjct  361   KSIFQTSGVKLSAKIAGIHWHYNARSHATELTAGYYNTKFHDGYIPIAQMLAKHGVILNF  420

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEMKD EQP  ANCSPEGLV QV++ATK AG ELAGENALERYDS  Y QVL+TS   
Sbjct  421   TCMEMKDNEQPCDANCSPEGLVNQVRMATKIAGGELAGENALERYDSSAYGQVLSTS---  477

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKR  1661
                GLSAFTYLR+NK L E +NWRK V+FV SMS+GG+  RL E DS  TDLYVG I K 
Sbjct  478   ---GLSAFTYLRINKRLLEGDNWRKFVDFVVSMSDGGK-LRLAESDSYGTDLYVGHIIKE  533

Query  1662  N  1664
             N
Sbjct  534   N  534



>ref|XP_008794866.1| PREDICTED: beta-amylase 3, chloroplastic [Phoenix dactylifera]
Length=547

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/543 (71%), Positives = 436/543 (80%), Gaps = 13/543 (2%)
 Frame = +3

Query  54    MALTLRSSTSFIN-LKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAA---LLS  221
             MALTLRS TSF+  +   K  K  ++FPS V     K +C  R    SS +E       S
Sbjct  1     MALTLRSPTSFMTAIDPSKAHKTAEEFPSRVHVGPAKPACRLRAVRASSHREVVERGATS  60

Query  222   QPLEGRVNEKRERLHGLAANQSHSS--SSRVPVFIMLPLDTITMGGNLNKPRSMNASLMA  395
              P       + ERLHGL   +S     S+RVPV++MLPLDT++  G L++ R++ ASLMA
Sbjct  61    TP-------QAERLHGLPGQRSGEGGVSARVPVYVMLPLDTVSASGGLSRARALQASLMA  113

Query  396   LRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGD  575
             LRSAGVEGVMVD WWGLVEKDGP++YNWE Y  LVKMV+  GLKLQ+VMSFHQCGGNVGD
Sbjct  114   LRSAGVEGVMVDVWWGLVEKDGPMRYNWEAYMELVKMVERSGLKLQMVMSFHQCGGNVGD  173

Query  576   SCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSF  755
             SCSIPLPPWVL+E+SK+PD+VYTDRSGRRNPEYISLGCD LPVLRGRTP+QVYADYMRSF
Sbjct  174   SCSIPLPPWVLQEMSKDPDIVYTDRSGRRNPEYISLGCDTLPVLRGRTPIQVYADYMRSF  233

Query  756   RERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASA  935
              ERF +Y+G+VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM+ASL A+A
Sbjct  234   HERFSDYLGDVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKASLQAAA  293

Query  936   EAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILT  1115
                G   WG+ GPHDAG YNQFPEDTGFFRR+GTW ++YG+FFLEWYSGKLL HGDRIL 
Sbjct  294   IEIGHEGWGKGGPHDAGHYNQFPEDTGFFRREGTWNSDYGKFFLEWYSGKLLGHGDRILA  353

Query  1116  AAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVF  1295
             AA G+F+GTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GYLP+A MLAK GVV 
Sbjct  354   AAEGIFRGTGAKLSGKVAGIHWHYQTRSHAAELTAGYYNTRYRDGYLPVAQMLAKRGVVL  413

Query  1296  NFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR  1475
             NFTCMEM+D +QPG ANCSPE LV+QVK ATK A AELAGENALERYD   Y QVLATSR
Sbjct  414   NFTCMEMRDEQQPGHANCSPELLVQQVKKATKVARAELAGENALERYDESAYSQVLATSR  473

Query  1476  SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK  1655
             +D G GLSAFTYLRMNK LFE ENWR  V FVKSM+EGGR   LP+ DS  +DLYVG I 
Sbjct  474   ADPGVGLSAFTYLRMNKKLFEGENWRHFVAFVKSMAEGGRKVSLPKSDSMHSDLYVGFIG  533

Query  1656  KRN  1664
              ++
Sbjct  534   SKD  536



>ref|XP_010919815.1| PREDICTED: beta-amylase 3, chloroplastic isoform X1 [Elaeis guineensis]
Length=546

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/540 (71%), Positives = 440/540 (81%), Gaps = 8/540 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGV-KNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             MA TLR ST+F+   +   V K  ++FPS V     KR+C  RLRA  +     +L +  
Sbjct  1     MASTLRLSTTFMTPTDPSKVHKTAEEFPSWVHVGIPKRAC--RLRAVRASSHHDVLER--  56

Query  231   EGRVNEKRERLHGLAANQSHS--SSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
              G    +  RLHGL   +S    +S+RVPV++MLPLDT++  G L++ R++NASLMALRS
Sbjct  57    -GAATPQAGRLHGLPGQRSGQGGTSARVPVYVMLPLDTVSASGGLSRARALNASLMALRS  115

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVM D WWGLVEKDGP+ YNWE Y  LVKMV+++GLKLQ+VMSFHQCGGNVGDSCS
Sbjct  116   AGVEGVMADVWWGLVEKDGPMHYNWEAYMELVKMVEKNGLKLQMVMSFHQCGGNVGDSCS  175

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEE+SK+PD+VYTDRSGRRNPEYISLGCD LPVLRGRTP+QVYAD+MRSFRER
Sbjct  176   IPLPPWVLEEMSKDPDIVYTDRSGRRNPEYISLGCDTLPVLRGRTPIQVYADFMRSFRER  235

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F +Y+G+VIVE+QVG+GPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM+ASL A+A   
Sbjct  236   FSDYLGDVIVEIQVGLGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKASLQAAAIEI  295

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             G+  WG+ GPHDAG Y QFPEDTGFFRR+GTW ++YG+FFLEWYSGKLLEHGDRIL +A 
Sbjct  296   GQEGWGKGGPHDAGHYKQFPEDTGFFRREGTWNSDYGKFFLEWYSGKLLEHGDRILASAE  355

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+F+GTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GYLP+A MLAK GVV NFT
Sbjct  356   GIFRGTGAKLSGKVAGIHWHYRTRSHAAELTAGYYNTRYRDGYLPVAQMLAKRGVVLNFT  415

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKD +QP  ANCSPE LV+QVK ATK AGAELAGENALERYD   Y QVLATSR+D 
Sbjct  416   CMEMKDEQQPSHANCSPELLVQQVKKATKAAGAELAGENALERYDESAYSQVLATSRADP  475

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             G GLSAFTYLRMNK LFE ENWR  V F KSMSEGGR   LP+ DS  +DLYVG I  ++
Sbjct  476   GIGLSAFTYLRMNKKLFEGENWRNFVAFAKSMSEGGRKVSLPKSDSMHSDLYVGFIGSKD  535



>ref|XP_004511752.1| PREDICTED: beta-amylase 3, chloroplastic-like [Cicer arietinum]
Length=545

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/553 (69%), Positives = 440/553 (80%), Gaps = 14/553 (3%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MALT R S S +N K+ + +K+ DD  + V   + K   H  ++AKSSMQE+    +  +
Sbjct  1     MALTTRFSISLMNKKDTRVLKSLDDISTKVYLPKMKPLFH--IKAKSSMQESHFTKENNK  58

Query  234   GRVNEKR----ERLHGLAANQSHSS-SSRVPVFIMLPLDTITMGGNLNKPRSMNASLMAL  398
                   +    + +   +   +H   S+RVPVF+MLPLDT++MGGNLNK ++MN SLMAL
Sbjct  59    NNQVVNKNKKSDNITAPSVTHNHDDDSNRVPVFVMLPLDTVSMGGNLNKQKAMNVSLMAL  118

Query  399   RSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDS  578
             +SAGVEGVMVDAWWGLVEKDGP+KYNWEGY  LV+MVQ+HGLKLQ+VMSFHQCGGNVGDS
Sbjct  119   KSAGVEGVMVDAWWGLVEKDGPMKYNWEGYFELVQMVQKHGLKLQIVMSFHQCGGNVGDS  178

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             CSIPLPPWVLEE+SKNPDLVYTD+ GRRNPEYISLGCD +P+L GRTP+QVY+DYMRSFR
Sbjct  179   CSIPLPPWVLEEVSKNPDLVYTDKLGRRNPEYISLGCDSVPILGGRTPLQVYSDYMRSFR  238

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             +RFK+Y+G VI+EVQVG+GPCGELRYPSYPES+GTWRFPGIGEFQCYDKYM ASL ASA+
Sbjct  239   DRFKDYLGTVIIEVQVGLGPCGELRYPSYPESDGTWRFPGIGEFQCYDKYMIASLEASAD  298

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A GK +WGRSGPHD+GQYNQ+PEDTGFF+R+GTW TEYG FFL+WYS KL+EHG++IL +
Sbjct  299   AIGKRDWGRSGPHDSGQYNQYPEDTGFFKREGTWNTEYGNFFLDWYSTKLVEHGEKILVS  358

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFN  1298
             A  +FQ +  KLS KIAGIHWHYN RSHA EL AGYYNTR  +GYLPIA MLAKHGVV N
Sbjct  359   AKNIFQTSEVKLSAKIAGIHWHYNARSHATELTAGYYNTRYHDGYLPIAKMLAKHGVVLN  418

Query  1299  FTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRS  1478
             FTCMEMKD EQP  ANCSPEGLV QVK ATK AG ELAGENALERYDS  Y+QVL TS  
Sbjct  419   FTCMEMKDNEQPHHANCSPEGLVNQVKNATKIAGGELAGENALERYDSSAYDQVLKTS--  476

Query  1479  DSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK  1658
                 GLSAFTYLRMN+ LFE +NWR  VEFVK+MS+     RL E DS  TDLYVG IK 
Sbjct  477   ----GLSAFTYLRMNRRLFEGDNWRNFVEFVKNMSDDCLRQRLSESDSYGTDLYVGHIKG  532

Query  1659  -RNAKNANEAVLV  1694
              +    A E VLV
Sbjct  533   IKKEDQAQEIVLV  545



>ref|XP_009413253.1| PREDICTED: beta-amylase 3, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=549

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/541 (68%), Positives = 430/541 (79%), Gaps = 4/541 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MALT+RSSTSF+   + K  +  D+ P  + F    R    RLR   + ++  +    L 
Sbjct  1     MALTIRSSTSFMAPVDSKTHRASDELPGRLAFD--VRKPAGRLRTLKASRQDVIERGTLL  58

Query  234   GRVNEKRERLHG--LAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
                 +  E LHG   A     + +SRVPV++MLPLDT+++ G L + R++NASLMALRSA
Sbjct  59    QHTEQAAELLHGPPTAHGDPGAGTSRVPVYVMLPLDTVSLAGGLTRARALNASLMALRSA  118

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEGVMVD WWGL EKDG L+YNWE YA LV+MV+ +GLKLQ+VMSFHQCGGNVGD+CSI
Sbjct  119   GVEGVMVDVWWGLAEKDGSLRYNWEAYAELVQMVERNGLKLQMVMSFHQCGGNVGDNCSI  178

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLPPWV EE S+NPD+VY DRSGRRNPEYISLGCD LPVLRGRTP+QVY+DYMRSFR+RF
Sbjct  179   PLPPWVQEERSRNPDIVYADRSGRRNPEYISLGCDMLPVLRGRTPIQVYSDYMRSFRDRF  238

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
             ++++G VIVE+QVGMGPCGELRYPSYP +N TWRFPGIGEFQCYDKYM+ASL A+A + G
Sbjct  239   RDHLGRVIVEIQVGMGPCGELRYPSYPANNATWRFPGIGEFQCYDKYMKASLQAAAVSVG  298

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
             + EWG  GPHDAG YNQFP+DTGFFRR+GTW T+YG+FFLEWYS KLLEHGDR+L AA  
Sbjct  299   REEWGNGGPHDAGHYNQFPDDTGFFRREGTWNTDYGKFFLEWYSSKLLEHGDRVLAAAHA  358

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +F GTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GYLP+A M+A  GV+ NFTC
Sbjct  359   IFHGTGAKLSGKVAGIHWHYRTRSHAAELTAGYYNTRHRDGYLPVAKMMAMRGVILNFTC  418

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEMKD +QPG A CSPE LVRQVK AT  AGAELAGENALERYD   Y QVLATSR   G
Sbjct  419   MEMKDEQQPGHAGCSPELLVRQVKQATAAAGAELAGENALERYDGSAYSQVLATSRGGDG  478

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNA  1667
              GL+AFTYLRM K LFE ENWR+LV FVKSMSEGGRS  LP+ D++R+DLYVG +   N 
Sbjct  479   MGLTAFTYLRMTKKLFEGENWRQLVAFVKSMSEGGRSVVLPKSDTARSDLYVGFVAGANR  538

Query  1668  K  1670
             K
Sbjct  539   K  539



>ref|XP_009794895.1| PREDICTED: beta-amylase 3, chloroplastic-like, partial [Nicotiana 
sylvestris]
Length=442

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/445 (80%), Positives = 390/445 (88%), Gaps = 8/445 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAAL-----L  218
             M L + SSTSFIN+KE KG+K PDDF  +V F+Q K SC   L  KSSMQEA L     +
Sbjct  1     MTLAVHSSTSFINIKETKGIKTPDDFLGMVSFAQTKPSC--LLITKSSMQEAHLSHERVI  58

Query  219   SQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMAL  398
               P+EGR NEKRE+LH L    S++S++ VPVF+MLPLDT+TMGG LNKPR MNASL+AL
Sbjct  59    GNPIEGRKNEKREKLHVLTTTHSNNSTA-VPVFVMLPLDTVTMGGKLNKPRLMNASLIAL  117

Query  399   RSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDS  578
             RSAGVEGVMVDAWWGLVEKDGP KYNWEGYA LVKM +EHGLKLQVVMSFHQCGGNVGDS
Sbjct  118   RSAGVEGVMVDAWWGLVEKDGPHKYNWEGYAELVKMCKEHGLKLQVVMSFHQCGGNVGDS  177

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             CSIPLPPWVLE+I KNPDLVYTDRSGRRNPEYISLGCD LPVL GRTP+QVYADYMRSFR
Sbjct  178   CSIPLPPWVLEDIGKNPDLVYTDRSGRRNPEYISLGCDMLPVLNGRTPIQVYADYMRSFR  237

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             ERF +Y+G+VIVE+QVG+GPCGELRYPSYPESNGTWRFPGIGEFQ YDKYMRASLAASA+
Sbjct  238   ERFNDYLGDVIVEIQVGLGPCGELRYPSYPESNGTWRFPGIGEFQNYDKYMRASLAASAK  297

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A GK +WG+ GPHD+G+YNQFPEDTGFF+ DGTW +EYG+FFLEWYSGKLLEHGDRIL A
Sbjct  298   AAGKDDWGQGGPHDSGKYNQFPEDTGFFQNDGTWNSEYGKFFLEWYSGKLLEHGDRILGA  357

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFN  1298
             A  ++QGTGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR+ NGYLPIA M  KH VVFN
Sbjct  358   AESIYQGTGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRDTNGYLPIARMFGKHHVVFN  417

Query  1299  FTCMEMKDGEQPGSANCSPEGLVRQ  1373
             FTCMEM+DGEQP SANCSPEGLVRQ
Sbjct  418   FTCMEMRDGEQPQSANCSPEGLVRQ  442



>ref|XP_009397011.1| PREDICTED: beta-amylase 3, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=547

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/546 (69%), Positives = 436/546 (80%), Gaps = 9/546 (2%)
 Frame = +3

Query  54    MALTLRSSTSFIN--LKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP  227
             MALTLRSSTSF+   +   K  K  D+ PS++  S  K +C  RLRA  +     +   P
Sbjct  1     MALTLRSSTSFMTNPIDPSKSHKASDESPSLLPLSPRKPAC--RLRAAKASNHGMIERAP  58

Query  228   -LEGRVNEKRERLHGLA-ANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
              + G    K E+LHGL+  ++    ++RVPV++MLPLDT++  G L + R++NASLMALR
Sbjct  59    AVHG--GWKAEQLHGLSGVHRVPGGTARVPVYVMLPLDTVSPEGRLQRARALNASLMALR  116

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
             SAGVEGVMVD WWGLVEKDGPL+YNWE Y  L +MV+ +GLKLQ+VMSFHQCGGNVGDSC
Sbjct  117   SAGVEGVMVDVWWGLVEKDGPLRYNWEPYLELAQMVERNGLKLQMVMSFHQCGGNVGDSC  176

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             S+PLPPWVLEE  ++PD+VYTDRSGRRNPEYISLGCD LPVL GRTP+QVY+DYMRSF++
Sbjct  177   SVPLPPWVLEETRRDPDIVYTDRSGRRNPEYISLGCDTLPVLMGRTPIQVYSDYMRSFKD  236

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF  Y+G+VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM+ASL A+A A
Sbjct  237   RFNCYLGHVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKASLQAAAVA  296

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              G  EWG+ GPHDAG YNQFPEDTGFFRR+GTW T YG+FFLEWYSG LLEHGDR+L AA
Sbjct  297   AGHEEWGKDGPHDAGHYNQFPEDTGFFRREGTWNTHYGKFFLEWYSGTLLEHGDRVLAAA  356

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
               +F+GTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR  +GYLP+A ++A  GVV NF
Sbjct  357   EAIFRGTGAKLSGKVAGIHWHYRTRSHAAELTAGYYNTRFHDGYLPVAKLMATRGVVLNF  416

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEM+D +QPG ANCSPE +VRQVK A K AGAELAGENALERYD + Y QVLATSR+D
Sbjct  417   TCMEMRDEQQPGHANCSPELIVRQVKQAAKAAGAELAGENALERYDEKAYSQVLATSRAD  476

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK-  1658
                 LSAFTYLRMNK LFE ENWR  V FVKSMSEGGR     + D S +DLYVG I   
Sbjct  477   DSIDLSAFTYLRMNKRLFEGENWRHFVSFVKSMSEGGRKVVPHKSDCSHSDLYVGHITGC  536

Query  1659  RNAKNA  1676
             +N+K A
Sbjct  537   KNSKMA  542



>emb|CBI33977.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/548 (68%), Positives = 405/548 (74%), Gaps = 84/548 (15%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             MALTLRSSTSFIN K+ KG+K PD   S + F+  K  C                     
Sbjct  1     MALTLRSSTSFINPKDTKGLKTPD-ISSSIFFTPSKPPC---------------------  38

Query  234   GRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGV  413
                      LHGL     + + SRVPVF+MLPLDT++ GGNLNKPR+MNASLMAL+S+GV
Sbjct  39    --------ILHGLPTPH-NKNGSRVPVFVMLPLDTVSFGGNLNKPRAMNASLMALKSSGV  89

Query  414   EGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPL  593
             EGVMVDAWWGLVEKDGP+KYNWEGYA LV+MVQ HGLKLQVVMSFHQCGGNVGDSCSIPL
Sbjct  90    EGVMVDAWWGLVEKDGPMKYNWEGYAELVQMVQRHGLKLQVVMSFHQCGGNVGDSCSIPL  149

Query  594   PPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKE  773
             PPWVLEEISKN DLVYTDRSGRRNPEYISLGCD +PVLRGRTP+QVY+DYMRSF  RFK+
Sbjct  150   PPWVLEEISKNTDLVYTDRSGRRNPEYISLGCDSIPVLRGRTPIQVYSDYMRSFHNRFKD  209

Query  774   YMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKS  953
             Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASL ASA+A GK 
Sbjct  210   YLGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLEASADAVGKK  269

Query  954   EWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF  1133
             +WGRSGP DAG YNQFPEDTGFFRRDGTW TEYGQFFL+WYSGKLLEHGDRIL AA G+F
Sbjct  270   DWGRSGPQDAGHYNQFPEDTGFFRRDGTWTTEYGQFFLKWYSGKLLEHGDRILAAAEGIF  329

Query  1134  QGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCME  1313
             QGTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR  +GYLPIA M+ K+GVV NFTCME
Sbjct  330   QGTGAKLSGKVAGIHWHYKTRSHAAELTAGYYNTRNHDGYLPIARMMGKYGVVLNFTCME  389

Query  1314  MKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG  1493
             MKD EQ   ANCSPEGLVRQVK+ATK AG ELAGENALERYDS  Y Q            
Sbjct  390   MKDREQQEHANCSPEGLVRQVKMATKTAGTELAGENALERYDSSAYAQ------------  437

Query  1494  LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLI-KKRNAK  1670
                                                     CDSS TDLY+G I KK++  
Sbjct  438   ----------------------------------------CDSSGTDLYIGFIKKKKDVA  457

Query  1671  NANEAVLV  1694
                EA LV
Sbjct  458   KTMEAALV  465



>gb|EPS63004.1| hypothetical protein M569_11781, partial [Genlisea aurea]
Length=455

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/452 (77%), Positives = 400/452 (88%), Gaps = 1/452 (0%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGG-NLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPVF+MLPLDT++MGG +LN+PR+M ASL AL++AGVEGVMVDAWWGLVEKDGP  YNWE
Sbjct  4     VPVFVMLPLDTVSMGGGSLNRPRAMAASLAALKTAGVEGVMVDAWWGLVEKDGPSMYNWE  63

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GY  L+KMV++ GLKLQVVMSFHQCGGNVGDSCSIPLP WVLEE++KNPDL+YTD SGRR
Sbjct  64    GYDELIKMVEKVGLKLQVVMSFHQCGGNVGDSCSIPLPAWVLEEMNKNPDLMYTDGSGRR  123

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             NPEY+SLGCD LPVLRGRTP+QVY+DYM SFRERF+EY+GNVI EVQVGMGPCGELRYPS
Sbjct  124   NPEYVSLGCDSLPVLRGRTPIQVYSDYMTSFRERFREYLGNVIAEVQVGMGPCGELRYPS  183

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPE+NGTW FPGIGEFQCYDKYM+ASLAA+AEA GK+EWGR GPHD+G Y Q+PE+TGFF
Sbjct  184   YPEANGTWAFPGIGEFQCYDKYMKASLAAAAEAIGKNEWGRGGPHDSGHYKQYPEETGFF  243

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             RR+GTW +EYG+FFLEWYS  LL+HG++IL AA  +F+GTG KLSGK+AGIHWHY TRSH
Sbjct  244   RREGTWNSEYGRFFLEWYSNMLLDHGEKILAAAEKIFRGTGVKLSGKVAGIHWHYKTRSH  303

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             AAEL AGYYNTR R+GYLP+A M+AKHGVVFNFTCMEM+DGEQP +A  SPE LVRQVK+
Sbjct  304   AAELTAGYYNTRNRDGYLPVAKMMAKHGVVFNFTCMEMRDGEQPEAAGSSPESLVRQVKM  363

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLV  1562
             ATK A AELAGENALERYD   Y QV+ TSRS++G+ LSAFTYLRMN+ LFE +NWR LV
Sbjct  364   ATKRAEAELAGENALERYDGSAYSQVINTSRSETGSRLSAFTYLRMNRRLFEADNWRNLV  423

Query  1563  EFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK  1658
             EFV++MSEG    RLPE D + TDLY+G +K+
Sbjct  424   EFVRAMSEGREQERLPESDRTGTDLYIGFLKQ  455



>ref|XP_004983616.1| PREDICTED: beta-amylase 3, chloroplastic-like isoform X1 [Setaria 
italica]
Length=557

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/551 (65%), Positives = 417/551 (76%), Gaps = 10/551 (2%)
 Frame = +3

Query  54    MALTLRSSTSFI-----NLKEIKGVKNPDDFPSIVCF-SQFKRSCHHRLRAKSSMQEAAL  215
             MALTLRS+TSF+     N K +      D  PS     +    +   R         AA 
Sbjct  1     MALTLRSTTSFLSPVDPNSKLLHKPGADDAPPSCAAVPAPSHAAAPSRRLRLVRAAAAAA  60

Query  216   LSQPLEGRVNEKRERLHGLAANQSHSSS-SRVPVFIMLPLDTITMGGNLNKPRSMNASLM  392
              +  ++    E  E LHG AA Q H      VPV++MLPLDT+  GG L++ R++ ASLM
Sbjct  61    PAPAMDRAPAEAAELLHGGAAGQDHGRPRGGVPVYVMLPLDTVGPGGQLSRQRAVAASLM  120

Query  393   ALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVG  572
             ALR AGVEGVMVD WWG+VE++GP +Y+WE YA LV+MV+  GL+LQ VMSFHQCGGNVG
Sbjct  121   ALRGAGVEGVMVDVWWGVVEREGPGRYDWEAYAELVRMVERAGLRLQAVMSFHQCGGNVG  180

Query  573   DSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRS  752
             D+C+IPLPPWVLEE+S NPD+VYTDRSGRRNPEYISLGCD LPVL+GRTP+QVYADYMRS
Sbjct  181   DTCNIPLPPWVLEEMSSNPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPIQVYADYMRS  240

Query  753   FRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAAS  932
             F +RF++Y+GNVI E+QVGMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL A+
Sbjct  241   FHDRFRDYLGNVIAEIQVGMGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLEAA  300

Query  933   AEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRIL  1112
             A A G  EWGR GPHDAG+Y Q PE+TGFFRRDGTW TEYGQFFLEWYSG LLEHGDR+L
Sbjct  301   AVAAGHEEWGRGGPHDAGEYKQMPEETGFFRRDGTWSTEYGQFFLEWYSGMLLEHGDRVL  360

Query  1113  TAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVV  1292
              AA  VF GTGA LS K+AGIHWHY TRSHAAEL AGYYNTR  +GY PIA MLAK G V
Sbjct  361   AAADAVFGGTGATLSAKVAGIHWHYGTRSHAAELTAGYYNTRHHDGYAPIARMLAKRGAV  420

Query  1293  FNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATS  1472
              NFTCMEMKD +QP  A+CSPE LV+QVK A   AG ELAGENALERYD   + QV++T+
Sbjct  421   LNFTCMEMKDEQQPQHASCSPEQLVQQVKAAASAAGVELAGENALERYDEAAFSQVVSTA  480

Query  1473  RSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLI  1652
             R   G GL+AFTYLRMNK LF+ +NWR+ V FV++M++GG    LP CD+  +DLYVG +
Sbjct  481   R---GAGLAAFTYLRMNKALFDGDNWREFVSFVRAMADGGARPALPRCDTGHSDLYVGFL  537

Query  1653  KKRNAKNANEA  1685
                  + A EA
Sbjct  538   DAAKERKAPEA  548



>ref|XP_008658465.1| PREDICTED: beta-amylase 3, chloroplastic-like [Zea mays]
 tpg|DAA46352.1| TPA: hypothetical protein ZEAMMB73_080734 [Zea mays]
Length=551

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/537 (66%), Positives = 415/537 (77%), Gaps = 10/537 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKE--IKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP  227
             MALTLRSSTSF++  +   K +  P D     C +          R ++    AA  + P
Sbjct  1     MALTLRSSTSFLSPVDPTSKLLHKPADEAQPCCVAVPPAPGR---RPRALRAAAAAATSP  57

Query  228   LEGRV-NEKRERLHGLAANQSHS-SSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
               GR   E  E LHG  A+Q H      VPV++MLPLDT+  GG L++ R++ ASLMALR
Sbjct  58    ATGRAPAEAGELLHGGGADQHHGLPRGGVPVYVMLPLDTVGPGGQLSRQRALAASLMALR  117

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
              AGVEGVMVD WWG+VE++GP +Y+WE YA LV+MV+  GL+LQ VMSFHQCGGNVGD+C
Sbjct  118   GAGVEGVMVDVWWGVVEREGPGRYDWEAYAELVRMVERAGLRLQAVMSFHQCGGNVGDTC  177

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             +IPLPPWVLEE+S NPD+VYTDRSGRRNPEYISLGCD LPVL+GRTP+QVY DYMRSFRE
Sbjct  178   NIPLPPWVLEEMSSNPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPIQVYTDYMRSFRE  237

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF++Y+GNVI E+QVGMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL A+A A
Sbjct  238   RFRDYLGNVIAEIQVGMGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLEAAAVA  297

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              G  EWGR GPHDAG+Y Q P+DTGFFRR+GTW TEYG FFL WYSG LLEHGDR+L AA
Sbjct  298   AGHQEWGRGGPHDAGEYKQMPDDTGFFRREGTWSTEYGHFFLAWYSGMLLEHGDRVLAAA  357

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
               VF GTGA LS K+AGIHWHY TRSHAAEL AGYYNTR+R+GY PIA MLAK G V NF
Sbjct  358   EAVFGGTGATLSAKVAGIHWHYRTRSHAAELTAGYYNTRDRDGYAPIARMLAKRGAVLNF  417

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEMKD +QP  A+CSPE LV+QVK A   AG ELAGENALERYD   + QV +T+R  
Sbjct  418   TCMEMKDEQQPKHASCSPELLVQQVKTAASAAGVELAGENALERYDEAAFSQVASTAR--  475

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLI  1652
              G GL+AFTYLRMNK LF+ +NWR+ V FV++M++GG    LP CD+  +DLYVG +
Sbjct  476   -GAGLAAFTYLRMNKTLFDGDNWRQFVSFVRAMADGGARPALPRCDTGHSDLYVGFL  531



>ref|XP_004983617.1| PREDICTED: beta-amylase 3, chloroplastic-like isoform X2 [Setaria 
italica]
Length=558

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/552 (65%), Positives = 416/552 (75%), Gaps = 11/552 (2%)
 Frame = +3

Query  54    MALTLRSSTSFI-----NLKEIKGVKNPDDFPSIVCF-SQFKRSCHHRLRAKSSMQEAAL  215
             MALTLRS+TSF+     N K +      D  PS     +    +   R         AA 
Sbjct  1     MALTLRSTTSFLSPVDPNSKLLHKPGADDAPPSCAAVPAPSHAAAPSRRLRLVRAAAAAA  60

Query  216   LSQPLEGRVNEKRERLHGLAANQSHSSS-SRVPVFIMLPLDTITMGGNLNKPRSMNASLM  392
              +  ++    E  E LHG AA Q H      VPV++MLPLDT+  GG L++ R++ ASLM
Sbjct  61    PAPAMDRAPAEAAELLHGGAAGQDHGRPRGGVPVYVMLPLDTVGPGGQLSRQRAVAASLM  120

Query  393   ALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVG  572
             ALR AGVEGVMVD WWG+VE++GP +Y+WE YA LV+MV+  GL+LQ VMSFHQCGGNVG
Sbjct  121   ALRGAGVEGVMVDVWWGVVEREGPGRYDWEAYAELVRMVERAGLRLQAVMSFHQCGGNVG  180

Query  573   DS-CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMR  749
             D  CSIPLPPWVLEE+S NPD+VYTDRSGRRNPEYISLGCD LPVL+GRTP+QVYADYMR
Sbjct  181   DDVCSIPLPPWVLEEMSSNPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPIQVYADYMR  240

Query  750   SFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAA  929
             SF +RF++Y+GNVI E+QVGMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL A
Sbjct  241   SFHDRFRDYLGNVIAEIQVGMGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLEA  300

Query  930   SAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRI  1109
             +A A G  EWGR GPHDAG+Y Q PE+TGFFRRDGTW TEYGQFFLEWYSG LLEHGDR+
Sbjct  301   AAVAAGHEEWGRGGPHDAGEYKQMPEETGFFRRDGTWSTEYGQFFLEWYSGMLLEHGDRV  360

Query  1110  LTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGV  1289
             L AA  VF GTGA LS K+AGIHWHY TRSHAAEL AGYYNTR  +GY PIA MLAK G 
Sbjct  361   LAAADAVFGGTGATLSAKVAGIHWHYGTRSHAAELTAGYYNTRHHDGYAPIARMLAKRGA  420

Query  1290  VFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLAT  1469
             V NFTCMEMKD +QP  A+CSPE LV+QVK A   AG ELAGENALERYD   + QV++T
Sbjct  421   VLNFTCMEMKDEQQPQHASCSPEQLVQQVKAAASAAGVELAGENALERYDEAAFSQVVST  480

Query  1470  SRSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGL  1649
             +R   G GL+AFTYLRMNK LF+ +NWR+ V FV++M++GG    LP CD+  +DLYVG 
Sbjct  481   AR---GAGLAAFTYLRMNKALFDGDNWREFVSFVRAMADGGARPALPRCDTGHSDLYVGF  537

Query  1650  IKKRNAKNANEA  1685
             +     + A EA
Sbjct  538   LDAAKERKAPEA  549



>ref|XP_006838474.1| hypothetical protein AMTR_s00002p00150440 [Amborella trichopoda]
 gb|ERN01043.1| hypothetical protein AMTR_s00002p00150440 [Amborella trichopoda]
Length=585

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/569 (63%), Positives = 422/569 (74%), Gaps = 17/569 (3%)
 Frame = +3

Query  15    FPSFINSYIF*TIMALTLRSSTSFINL------KEIKGVKNPDDFPSIVCFSQFKRS-CH  173
             FP  I S +    MAL LRSST   N        EI  + + D+        ++  S   
Sbjct  24    FPLSIPSLL---AMALGLRSSTLNTNFFRPSIEGEIPRIHSLDNLSGSSGLLKYVSSKAF  80

Query  174   HRLRAKSSMQEAALLSQ--PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITM  347
               +RAKSS   + L  +   +  R+     +LHGL +++       VPVF+MLPLDT+  
Sbjct  81    PSIRAKSSCNRSLLTHETPAMTHRIPIGEHKLHGLQSSRVKG----VPVFVMLPLDTVNF  136

Query  348   GGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLK  527
              G L++PR++NASLMAL++AGV GVMVDAWWGL EKD P +YNW GY  LV+MV++HGLK
Sbjct  137   EGALSRPRALNASLMALKAAGVAGVMVDAWWGLAEKDAPRQYNWRGYLELVRMVEKHGLK  196

Query  528   LQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVL  707
             LQVVMSFH+CGGNVGD+C+IPLPPWVLEE+SKNPDLVYTDRSGRRNPEYISLGCD LPVL
Sbjct  197   LQVVMSFHRCGGNVGDNCNIPLPPWVLEEVSKNPDLVYTDRSGRRNPEYISLGCDSLPVL  256

Query  708   RGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGE  887
             RGRTP+QVYADYMRSFR+ FK Y+G VIVE+QVGMGPCGELRYPSYPESNGTWRFPGIGE
Sbjct  257   RGRTPIQVYADYMRSFRDTFKNYLGEVIVEIQVGMGPCGELRYPSYPESNGTWRFPGIGE  316

Query  888   FQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFL  1067
             FQCYDKYM+ASL ASA A GK EWGR GPHD+GQYNQFPE+TGFFRRDGTW ++YG FFL
Sbjct  317   FQCYDKYMQASLQASAIAIGKEEWGRGGPHDSGQYNQFPEETGFFRRDGTWNSDYGNFFL  376

Query  1068  EWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERN  1247
             +WYS  LL HGDRIL A+  +F GTGAKLSGK+AGIHWHY +RSH AEL AGYYNTR  +
Sbjct  377   QWYSNMLLNHGDRILQASGAIFAGTGAKLSGKVAGIHWHYQSRSHPAELTAGYYNTRNTD  436

Query  1248  GYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenal  1427
             GY PIA + A+   + NFTCMEM+D EQPG A C PEGLVRQV  A + AG  LAGENAL
Sbjct  437   GYSPIARLFARRDTILNFTCMEMRDSEQPGHAGCGPEGLVRQVASAAQYAGIHLAGENAL  496

Query  1428  eRYDSRGYEQVLATS-RSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
             ERYD    E+V A+    ++G  L+AFTYLRMNK LFE ENWR+ V FV+S+SE G   +
Sbjct  497   ERYDDAALEKVAASCFLQENGQKLAAFTYLRMNKRLFESENWRRFVGFVRSLSEEGCYGK  556

Query  1605  LPECDSSRTDLYVGLIKKRNAKNANEAVL  1691
             L   DS R+DL V  +  RN +    A++
Sbjct  557   LSREDSGRSDLSVSWLGDRNLRTEAAALM  585



>ref|XP_009759389.1| PREDICTED: beta-amylase 3, chloroplastic-like, partial [Nicotiana 
sylvestris]
Length=418

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/413 (83%), Positives = 371/413 (90%), Gaps = 0/413 (0%)
 Frame = +3

Query  420   VMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPP  599
             +  DAWWGLVEKDGP KYNWEGYA LVKM +EHGLKLQVVMSFHQCGGNVGDSCSIPLPP
Sbjct  1     IKXDAWWGLVEKDGPHKYNWEGYAELVKMCKEHGLKLQVVMSFHQCGGNVGDSCSIPLPP  60

Query  600   WVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM  779
             WVLE+I KNPDLVYTDRSGRRNPEYISLGCD LPVL GRTP+QVYADYMRSFRERF +Y+
Sbjct  61    WVLEDIGKNPDLVYTDRSGRRNPEYISLGCDMLPVLNGRTPIQVYADYMRSFRERFNDYL  120

Query  780   GNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEW  959
             G+VIVE+QVG+GPCGELRYPSYPESNGTWRFPGIGEFQ YDKYMRASLAASA+A GK +W
Sbjct  121   GDVIVEIQVGLGPCGELRYPSYPESNGTWRFPGIGEFQNYDKYMRASLAASAKAAGKDDW  180

Query  960   GRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQG  1139
             G+ GPHD+G+YNQFPEDTGFF+ DGTW +EYG+FFLEWYSGKLLEHGDRIL AA  ++QG
Sbjct  181   GQGGPHDSGKYNQFPEDTGFFQNDGTWNSEYGKFFLEWYSGKLLEHGDRILGAAESIYQG  240

Query  1140  TGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMK  1319
             TGAKLSGK+AGIHWHYNTRSHAAEL AGYYNTR+ NGYLPIA M  KH VVFNFTCMEM+
Sbjct  241   TGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRDTNGYLPIARMFGKHHVVFNFTCMEMR  300

Query  1320  DGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLS  1499
             DGEQP SANCSPEGLVRQVK AT+ +  ELAGENALERYD   Y QVLATSRS SGN LS
Sbjct  301   DGEQPQSANCSPEGLVRQVKYATRTSEVELAGENALERYDEGAYSQVLATSRSGSGNALS  360

Query  1500  AFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKK  1658
             AFT+LRMNK LFEPENW+ L +FVKSMSEGGR+ R PECD SRTD+YVG IK+
Sbjct  361   AFTFLRMNKRLFEPENWQNLGQFVKSMSEGGRNARCPECDPSRTDIYVGFIKE  413



>ref|XP_002464915.1| hypothetical protein SORBIDRAFT_01g028700 [Sorghum bicolor]
 gb|EER91913.1| hypothetical protein SORBIDRAFT_01g028700 [Sorghum bicolor]
Length=557

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/550 (65%), Positives = 416/550 (76%), Gaps = 10/550 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKE--IKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP  227
             MALTLRSSTSF++  +   K +  P D     C +        R RA  +   AA  +  
Sbjct  1     MALTLRSSTSFLSPLDPTSKLLHKPADEAPPCCVAMPPAPPSRRPRALRASVAAAAAAAH  60

Query  228   LEGRVNEK---RERLHGLAANQSHSSSSR--VPVFIMLPLDTITMGGNLNKPRSMNASLM  392
                   ++    E LHG           R  VPV++MLPLDT+  GG L++ R++ ASLM
Sbjct  61    SPAAATDRAPAEELLHGGGGAGQQHGLPRGGVPVYVMLPLDTVGPGGQLSRQRAVAASLM  120

Query  393   ALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVG  572
             ALR AGVEGVMVD WWG+VE+DGP +Y+WE YA LV+MV+  GL+LQ VMSFHQCGGNVG
Sbjct  121   ALRGAGVEGVMVDVWWGVVERDGPGRYDWEAYAELVRMVERAGLRLQAVMSFHQCGGNVG  180

Query  573   DSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRS  752
             D+C+IPLPPWVLEE+S NPD+VYTDRSGRRNPEYISLGCD LPVL+GRTP+QVY DYMRS
Sbjct  181   DTCNIPLPPWVLEEMSSNPDIVYTDRSGRRNPEYISLGCDSLPVLKGRTPIQVYTDYMRS  240

Query  753   FRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAAS  932
             FRERF++Y+GNVI E+QVGMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL A+
Sbjct  241   FRERFRDYLGNVIAEIQVGMGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLEAA  300

Query  933   AEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRIL  1112
             A A G  EWGR GPHDAG+Y Q P+DTGFFRRDGTW TEYG FFLEWYSG LLEHGDR+L
Sbjct  301   AVAAGHEEWGRGGPHDAGEYKQMPDDTGFFRRDGTWSTEYGHFFLEWYSGMLLEHGDRVL  360

Query  1113  TAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVV  1292
              AA  VF GTGA LS K+AGIHWHY TRSHAAEL AGYYNTR+R+GY+PIA MLAK G V
Sbjct  361   AAAEAVFGGTGATLSAKVAGIHWHYRTRSHAAELTAGYYNTRDRDGYMPIARMLAKRGAV  420

Query  1293  FNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATS  1472
              NFTCMEMKD +QP  A+CSPE LV+QVK A   AG ELAGENALERYD   + QV +T+
Sbjct  421   LNFTCMEMKDEQQPQHASCSPELLVQQVKAAASKAGVELAGENALERYDEAAFSQVTSTA  480

Query  1473  RSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLI  1652
             R   G GL+AFTYLRMNK LF+ +NWR+ V FV++M++GG    LP CD+  +DLYVG +
Sbjct  481   R---GAGLAAFTYLRMNKTLFDGDNWRQFVSFVRAMADGGARPALPRCDTGHSDLYVGFV  537

Query  1653  KKRNAKNANE  1682
                  + A +
Sbjct  538   DASKQRKAPD  547



>ref|XP_008658990.1| PREDICTED: uncharacterized protein LOC100502394 isoform X1 [Zea 
mays]
 gb|AFW87825.1| hypothetical protein ZEAMMB73_675891 [Zea mays]
Length=553

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/536 (65%), Positives = 411/536 (77%), Gaps = 6/536 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKE--IKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP  227
             MALTLRSSTSF++  +   K +  P D     C S            +++   A   S  
Sbjct  1     MALTLRSSTSFLSHVDPASKLLHKPTDEAPPCCVSVPPAPSRRPRALRAAAATATAPSPA  60

Query  228   LEGRVNEKRERLHGLAANQSHS-SSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
                   E  E LHG  A Q H      VPV++MLPLDT+  GG L++ R++ ASLMALR 
Sbjct  61    THRAPAEAAELLHGGGAGQQHGLPRGGVPVYVMLPLDTVGPGGQLSRQRAVAASLMALRG  120

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVD WWG+VE++GP +Y+WE YA LV+MV+  GL+LQ VMSFHQCGGNVGD+C+
Sbjct  121   AGVEGVMVDVWWGVVEREGPGRYDWEAYAELVRMVERAGLRLQAVMSFHQCGGNVGDTCN  180

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEE+S NP++VYTDRSGRRNPEYISLGCD LPVLRGRTP+QVY DYMRSFR+R
Sbjct  181   IPLPPWVLEEMSSNPNIVYTDRSGRRNPEYISLGCDTLPVLRGRTPIQVYTDYMRSFRQR  240

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F++Y+GNVI E+QVGMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL A+A A 
Sbjct  241   FRDYLGNVIAEIQVGMGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLEAAAVAS  300

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             G  EWGR GPHDAG+Y Q P+DTGFFRR+GTW TEYG FFLEWYSG LLEHGDR++ AA 
Sbjct  301   GHEEWGRGGPHDAGEYKQMPDDTGFFRREGTWSTEYGHFFLEWYSGMLLEHGDRVMDAAE  360

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
              VF GTGA LS K+AGIHWHY TRSHAAEL AGYYNTR R+GY PIA MLAK G V NFT
Sbjct  361   AVFGGTGATLSAKVAGIHWHYRTRSHAAELTAGYYNTRGRDGYAPIARMLAKRGAVLNFT  420

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKD +QP  A+CSPE LV+QVK AT  AG +LAGENALERYD   + QV++T+R   
Sbjct  421   CMEMKDEQQPQHASCSPELLVQQVKAATSAAGVQLAGENALERYDDAAFSQVVSTAR---  477

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLI  1652
             G GL+AFTYLRMNK LF+ +NW + V FV++M++GG    LP CD+  +DLYVG +
Sbjct  478   GAGLAAFTYLRMNKTLFDGDNWGRFVSFVRAMADGGARPALPRCDTGHSDLYVGFV  533



>dbj|BAJ90222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/552 (64%), Positives = 420/552 (76%), Gaps = 17/552 (3%)
 Frame = +3

Query  54    MALTLRSSTSFINLKE--IKGVKNPDDFP-SIVCFSQFKRSCHHRLRAKSSMQEAALLSQ  224
             MALTLRSSTSF+   +   K +  P+D P S V   Q         R ++    A     
Sbjct  1     MALTLRSSTSFLAAHDPCSKLLNKPEDAPPSCVAVPQ-----QAPARLRALRAAAQAPPA  55

Query  225   PLEGRVNEKRERLHGLAANQSHSSSSR-----VPVFIMLPLDTITMGGNLNKPRSMNASL  389
             P+E     + E LHG    Q+H+   R     VPVF+MLPLDT+  GG L++ R++ ASL
Sbjct  56    PMEAPAPVQSELLHG-QVQQAHAGGGRPSRGGVPVFVMLPLDTVGPGGQLSRARALAASL  114

Query  390   MALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNV  569
             MALR+AGVEGVMVD WWG+VE+DGP +Y+WEGYA LV+MV+  GL+LQ+VMSFHQCGGNV
Sbjct  115   MALRTAGVEGVMVDVWWGVVERDGPGRYDWEGYAELVRMVERAGLRLQMVMSFHQCGGNV  174

Query  570   GDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMR  749
             GDSC+IPLPPWVLEE+S + D+VYTDRSGRRNPEYISLGCD LPVL+GRTPVQVY+DYMR
Sbjct  175   GDSCNIPLPPWVLEEVSADQDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPVQVYSDYMR  234

Query  750   SFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAA  929
             SFR+RF  ++G VI EVQVG+GPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL A
Sbjct  235   SFRDRFSGHLGTVIAEVQVGLGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLQA  294

Query  930   SAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRI  1109
             +A A G   WG SGPHDAG+Y QFPE+TGFFRRDGTW TEYG FFL+WYSG LLEHGDR+
Sbjct  295   AAVAAGHENWGTSGPHDAGEYKQFPEETGFFRRDGTWSTEYGHFFLKWYSGMLLEHGDRV  354

Query  1110  LTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGV  1289
             L AA  +F GTG  LS K+AGIHWHY TRSHAAEL AGYYNTR  +GY PIA MLA+HG 
Sbjct  355   LAAAEAIFGGTGVTLSAKVAGIHWHYRTRSHAAELTAGYYNTRHHDGYGPIARMLARHGA  414

Query  1290  VFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLAT  1469
             V NFTCMEMKD +QPG A CSPE LV+QV+ A + A  ELAGENALERYD + + QV AT
Sbjct  415   VLNFTCMEMKDEQQPGHAGCSPELLVQQVRAAARAARVELAGENALERYDEQAFAQVAAT  474

Query  1470  SRSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGL  1649
             + +    GLS FTYLRMN+NLF+ +NWR+ V FVK+M++GG  T LP CD+  +DLYVG 
Sbjct  475   AEA---AGLSTFTYLRMNRNLFDGDNWRRFVAFVKTMADGGARTALPRCDTEHSDLYVGF  531

Query  1650  IKKRNAKNANEA  1685
             +     + A E+
Sbjct  532   VDATKEQRAPES  543



>ref|XP_003574353.1| PREDICTED: beta-amylase 3, chloroplastic [Brachypodium distachyon]
Length=548

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/544 (66%), Positives = 418/544 (77%), Gaps = 17/544 (3%)
 Frame = +3

Query  54    MALTLRSSTSFINLKE--IKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP  227
             MALTLRSSTSF++  E   K  K  D  PS V       +   RLR   +  +A L   P
Sbjct  1     MALTLRSSTSFLSPLEPSSKLHKAEDAPPSCVAVP----AAPSRLRVLRAAAQAPL--SP  54

Query  228   LEGRVNEKRERLHGLAANQSHSSSSR---VPVFIMLPLDTITMGGNLNKPRSMNASLMAL  398
             +E       E LHG  A Q+HS   +   VPV++MLPLDT+  GG L + R++ ASLMAL
Sbjct  55    MEA---PAPELLHG-QAQQAHSGGQKRGGVPVYVMLPLDTVGPGGQLLRARALAASLMAL  110

Query  399   RSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDS  578
             RSAGVEGVMVD WWG+VE++GP +Y+WEGYA LV+MV+  GL+LQ+VMSFHQCGGNVGDS
Sbjct  111   RSAGVEGVMVDVWWGVVEREGPGRYDWEGYAELVRMVERAGLRLQMVMSFHQCGGNVGDS  170

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             C+IPLP WVLEE+S NPD+VYTDRSGRRNPEYISLGCD LPVL+GRTPVQVY+D+MRSFR
Sbjct  171   CNIPLPSWVLEEVSANPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPVQVYSDFMRSFR  230

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             +RF  Y+G VI E+QVG+GPCGELRYPSYPE+NGTW FPGIGEFQCYDKYMRASL A+A 
Sbjct  231   DRFSGYLGTVIAEIQVGLGPCGELRYPSYPEANGTWSFPGIGEFQCYDKYMRASLQAAAA  290

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A G   WG +GPHDAG+Y QFPE+TGFFR DGTW TEYG FFLEWYSG LLEHGDR+L A
Sbjct  291   AAGHENWGTNGPHDAGEYKQFPEETGFFRWDGTWSTEYGSFFLEWYSGMLLEHGDRVLAA  350

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFN  1298
             A  VF GTGA LS K+AGIHWHY TRSHAAEL AGYYNTR  +GY PIA MLAK GVV N
Sbjct  351   AEAVFGGTGAMLSAKVAGIHWHYRTRSHAAELTAGYYNTRNHDGYAPIAGMLAKRGVVLN  410

Query  1299  FTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYD-SRGYEQVLATSR  1475
             FTCMEMKD +QPG A CSPE LVRQV+ A + A  ELAGENALERYD S   +     + 
Sbjct  411   FTCMEMKDEQQPGHAGCSPEQLVRQVRAAARAANVELAGENALERYDESAFAQVAATAAA  470

Query  1476  SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRS-TRLPECDSSRTDLYVGLI  1652
              D+G GLSAFTYLRMN+NLF+ +NWR+ V FVK+M++GG + T LP CD+  +DLYVG +
Sbjct  471   GDAGAGLSAFTYLRMNRNLFDGDNWRRFVAFVKTMADGGGARTGLPSCDTGHSDLYVGFL  530

Query  1653  KKRN  1664
             +  N
Sbjct  531   EAAN  534



>ref|XP_010919816.1| PREDICTED: beta-amylase 3, chloroplastic isoform X2 [Elaeis guineensis]
Length=509

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/540 (64%), Positives = 403/540 (75%), Gaps = 45/540 (8%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGV-KNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             MA TLR ST+F+   +   V K  ++FPS V     KR+C  RLRA  +     +L +  
Sbjct  1     MASTLRLSTTFMTPTDPSKVHKTAEEFPSWVHVGIPKRAC--RLRAVRASSHHDVLER--  56

Query  231   EGRVNEKRERLHGLAANQSHS--SSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
              G    +  RLHGL   +S    +S+RVPV++MLPLDT++  G L++ R++NASLMALRS
Sbjct  57    -GAATPQAGRLHGLPGQRSGQGGTSARVPVYVMLPLDTVSASGGLSRARALNASLMALRS  115

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVM D WWGLVEKDGP+ YNWE Y  LVKMV+++GLKLQ+VMSFHQCGGNVGDSCS
Sbjct  116   AGVEGVMADVWWGLVEKDGPMHYNWEAYMELVKMVEKNGLKLQMVMSFHQCGGNVGDSCS  175

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEE+SK+PD+VYTDRSGRRNPEYISLGCD LPVLRGRTP+QVYAD+MRSFRER
Sbjct  176   IPLPPWVLEEMSKDPDIVYTDRSGRRNPEYISLGCDTLPVLRGRTPIQVYADFMRSFRER  235

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F +Y+G+VIV                                     YM+ASL A+A   
Sbjct  236   FSDYLGDVIV-------------------------------------YMKASLQAAAIEI  258

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             G+  WG+ GPHDAG Y QFPEDTGFFRR+GTW ++YG+FFLEWYSGKLLEHGDRIL +A 
Sbjct  259   GQEGWGKGGPHDAGHYKQFPEDTGFFRREGTWNSDYGKFFLEWYSGKLLEHGDRILASAE  318

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
             G+F+GTGAKLSGK+AGIHWHY TRSHAAEL AGYYNTR R+GYLP+A MLAK GVV NFT
Sbjct  319   GIFRGTGAKLSGKVAGIHWHYRTRSHAAELTAGYYNTRYRDGYLPVAQMLAKRGVVLNFT  378

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKD +QP  ANCSPE LV+QVK ATK AGAELAGENALERYD   Y QVLATSR+D 
Sbjct  379   CMEMKDEQQPSHANCSPELLVQQVKKATKAAGAELAGENALERYDESAYSQVLATSRADP  438

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
             G GLSAFTYLRMNK LFE ENWR  V F KSMSEGGR   LP+ DS  +DLYVG I  ++
Sbjct  439   GIGLSAFTYLRMNKKLFEGENWRNFVAFAKSMSEGGRKVSLPKSDSMHSDLYVGFIGSKD  498



>ref|XP_007039632.1| Chloroplast beta-amylase isoform 4, partial [Theobroma cacao]
 gb|EOY24133.1| Chloroplast beta-amylase isoform 4, partial [Theobroma cacao]
Length=433

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/403 (78%), Positives = 348/403 (86%), Gaps = 6/403 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGV-KNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             M LTLRSSTSF NLKE K + K PDDF   +CF+Q K SC  R +   SMQ+A L S   
Sbjct  27    MTLTLRSSTSFFNLKETKSLTKTPDDFLGTICFAQTKPSCRLRAKNSMSMQDAQLSSHGK  86

Query  231   ----EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMAL  398
                 EGR +E RE+LHGL  + + + S RVPVF+MLPLDTIT+GGNLNK R+MNASLMAL
Sbjct  87    VSIGEGRNSENREKLHGLTISHNENDS-RVPVFVMLPLDTITLGGNLNKQRAMNASLMAL  145

Query  399   RSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDS  578
             +SAGVEGVMVDAWWGLVEKDGPLKYNWEGYA LV+MV++HGLKLQVVMSFHQCGGNVGDS
Sbjct  146   KSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAELVQMVEKHGLKLQVVMSFHQCGGNVGDS  205

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             CSIPLPPWVLEEISKNPDLVYT+RSGRRNPEYISLGCD +PVLRGRTP+Q Y DYMRSFR
Sbjct  206   CSIPLPPWVLEEISKNPDLVYTERSGRRNPEYISLGCDSIPVLRGRTPIQAYTDYMRSFR  265

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             ERF++Y+G VIVE+QVGMGPCGELRYP+YPESNGTW+FPGIGEFQCYDKYMRASL A+AE
Sbjct  266   ERFRDYLGRVIVEIQVGMGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLEAAAE  325

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A GK +WG+ GPHD+G Y QFPE+TGFFRRDGTW TEYGQFFLEWYSGKLLEHGDRIL A
Sbjct  326   AIGKKDWGKGGPHDSGHYKQFPEETGFFRRDGTWNTEYGQFFLEWYSGKLLEHGDRILAA  385

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERN  1247
             A G+F GTGA LSGKIAGIHWHY TRSHAAEL AGYYNT + N
Sbjct  386   AKGIFHGTGAILSGKIAGIHWHYRTRSHAAELTAGYYNTDQAN  428



>tpg|DAA46353.1| TPA: hypothetical protein ZEAMMB73_080734 [Zea mays]
Length=534

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/537 (63%), Positives = 399/537 (74%), Gaps = 27/537 (5%)
 Frame = +3

Query  54    MALTLRSSTSFINLKE--IKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQP  227
             MALTLRSSTSF++  +   K +  P D     C +          R ++    AA  + P
Sbjct  1     MALTLRSSTSFLSPVDPTSKLLHKPADEAQPCCVAVPPAPGR---RPRALRAAAAAATSP  57

Query  228   LEGRV-NEKRERLHGLAANQSHS-SSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALR  401
               GR   E  E LHG  A+Q H      VPV++MLPLDT+  GG L++ R++ ASLMALR
Sbjct  58    ATGRAPAEAGELLHGGGADQHHGLPRGGVPVYVMLPLDTVGPGGQLSRQRALAASLMALR  117

Query  402   SAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSC  581
              AGVEGVMVD WWG+VE++GP +Y+WE YA LV+MV+  GL+LQ VMSFHQCGGNVGD+C
Sbjct  118   GAGVEGVMVDVWWGVVEREGPGRYDWEAYAELVRMVERAGLRLQAVMSFHQCGGNVGDTC  177

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             +IPLPPWVLEE+S NPD+VYT                 LPVL+GRTP+QVY DYMRSFRE
Sbjct  178   NIPLPPWVLEEMSSNPDIVYT-----------------LPVLKGRTPIQVYTDYMRSFRE  220

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF++Y+GNVI E+QVGMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL A+A A
Sbjct  221   RFRDYLGNVIAEIQVGMGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLEAAAVA  280

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              G  EWGR GPHDAG+Y Q P+DTGFFRR+GTW TEYG FFL WYSG LLEHGDR+L AA
Sbjct  281   AGHQEWGRGGPHDAGEYKQMPDDTGFFRREGTWSTEYGHFFLAWYSGMLLEHGDRVLAAA  340

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
               VF GTGA LS K+AGIHWHY TRSHAAEL AGYYNTR+R+GY PIA MLAK G V NF
Sbjct  341   EAVFGGTGATLSAKVAGIHWHYRTRSHAAELTAGYYNTRDRDGYAPIARMLAKRGAVLNF  400

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEMKD +QP  A+CSPE LV+QVK A   AG ELAGENALERYD   + QV +T+R  
Sbjct  401   TCMEMKDEQQPKHASCSPELLVQQVKTAASAAGVELAGENALERYDEAAFSQVASTAR--  458

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLI  1652
              G GL+AFTYLRMNK LF+ +NWR+ V FV++M++GG    LP CD+  +DLYVG +
Sbjct  459   -GAGLAAFTYLRMNKTLFDGDNWRQFVSFVRAMADGGARPALPRCDTGHSDLYVGFL  514



>gb|AAG60205.1|AC084763_25 putative chloroplast-targeted beta-amylase [Oryza sativa Japonica 
Group]
 gb|AAP55052.1| Glycosyl hydrolase family 14 protein, expressed [Oryza sativa 
Japonica Group]
Length=544

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/538 (63%), Positives = 403/538 (75%), Gaps = 10/538 (2%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLR-AKSSMQEAALLSQPL  230
             MALTLRSSTSF  L  +      +D P              RLR A+++  E A +    
Sbjct  1     MALTLRSSTSF--LSPLDPSSKREDAPPCCVVPMPAPGSGGRLRLARAAPVEHATME---  55

Query  231   EGRVNEKRERLH-GLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
             E    E    LH G    Q         V++MLPL+T+  GG + + R++ ASL ALRS 
Sbjct  56    EMASPEAATLLHHGGGGGQGQRRGKGTAVYVMLPLETVGAGGKVARARALAASLAALRSG  115

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEGVMVD WWG+VE++GP +Y+WEGY  LV+MV+  GL+LQ+VMSFHQCGGNVGDSC+I
Sbjct  116   GVEGVMVDVWWGVVEREGPRRYDWEGYGELVRMVERAGLRLQMVMSFHQCGGNVGDSCNI  175

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLP WVLEE+  NPD+VYTDRSGRRNPEYISLGCD LPVL+GRTP+QVY+DYMRSFR+ F
Sbjct  176   PLPGWVLEEMKSNPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPIQVYSDYMRSFRDTF  235

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
               Y+GN IVE+QVG+GPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL  +A A G
Sbjct  236   CGYLGNTIVEIQVGLGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLQQAAAAAG  295

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
               EWGR GPHDAG+Y QFPE+TGFFRRDGTW TEYG FFL WYSG LLEHGDR+L AA  
Sbjct  296   HEEWGRGGPHDAGEYKQFPEETGFFRRDGTWCTEYGDFFLGWYSGMLLEHGDRVLAAAEA  355

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             VF+GTGA LS K+AGIHWHY TRSHAAEL AGYYNTR R+GY P+A MLA+ G V NFTC
Sbjct  356   VFRGTGAALSAKVAGIHWHYRTRSHAAELTAGYYNTRRRDGYAPVAAMLARRGAVLNFTC  415

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEM+D +QP  A CSPE LVRQV+ A + A   LAGENALERYD   + QV+AT+ S   
Sbjct  416   MEMRDEQQPEHAGCSPEQLVRQVRSAARAARVGLAGENALERYDEAAFAQVVATAAS---  472

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKR  1661
              GL AFTYLRMNK LF+ +NWR+ V FV++M++GG    LP CD+ ++DLYVG ++KR
Sbjct  473   AGLGAFTYLRMNKKLFDGDNWRQFVSFVRAMADGGERAALPSCDTEQSDLYVGFLEKR  530



>ref|XP_008364514.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 3, chloroplastic-like, 
partial [Malus domestica]
Length=391

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/394 (77%), Positives = 339/394 (86%), Gaps = 5/394 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPLE  233
             M LTLRSSTSF+NLK+ KG+KN  D P  +CF+Q K SC  RLRAKSSMQE  LL +   
Sbjct  1     MTLTLRSSTSFVNLKDHKGLKNSGDSPGTICFAQTKPSC--RLRAKSSMQETRLLHEKNL  58

Query  234   GRVNE-KRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
               +++ +RE LH L      S+ ++VPV++MLPLDT+   G+LNK   MNASLMAL+ AG
Sbjct  59    XTISDGRRELLHALPNIAHTSTDNKVPVYVMLPLDTVXHXGHLNK--XMNASLMALKQAG  116

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVD WWGLVE DGP KYNWEGYA LV+MVQ+HG+K+QVVMSFHQCGGNVGDSCSIP
Sbjct  117   VEGVMVDVWWGLVEXDGPSKYNWEGYAELVQMVQKHGMKIQVVMSFHQCGGNVGDSCSIP  176

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWVLEE+SKNPDLVYTD+SGRRNPEYISLGCD LPVL GRTP+QVY DYMRSF +RF 
Sbjct  177   LPPWVLEEVSKNPDLVYTDKSGRRNPEYISLGCDSLPVLGGRTPIQVYTDYMRSFHDRFI  236

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
             +Y+G+VIVE+QVGMGPCG LRYP+YPESNGTWRFPGIGEFQCYDKYMRASL ASAEA GK
Sbjct  237   DYLGDVIVEIQVGMGPCGXLRYPAYPESNGTWRFPGIGEFQCYDKYMRASLEASAEAMGK  296

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGV  1130
              +WGRSGPHD+GQYNQFPEDTGFF+RDGTW TEYGQFFLEWYSGKLL HGDRIL+AA GV
Sbjct  297   RDWGRSGPHDSGQYNQFPEDTGFFKRDGTWNTEYGQFFLEWYSGKLLRHGDRILSAAKGV  356

Query  1131  FQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYN  1232
             FQG+GAKLSGKIAGIHWHY +RSHAAEL AG YN
Sbjct  357   FQGSGAKLSGKIAGIHWHYGSRSHAAELTAGXYN  390



>gb|EMT27036.1| Beta-amylase [Aegilops tauschii]
Length=514

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/547 (62%), Positives = 402/547 (73%), Gaps = 42/547 (8%)
 Frame = +3

Query  54    MALTLRSSTSFINLKE--IKGVKNPDDFP-SIVCFSQFKRSCHHRLRAKSSMQEAALLSQ  224
             MALTLRSSTSF+   +   K +  P+D P S V   Q       RLRA  ++ +A     
Sbjct  1     MALTLRSSTSFLAPLDPCSKLLHKPEDAPPSCVAVPQAPA----RLRALRAVAQAPPAPM  56

Query  225   PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
                     + E LHG                             +++ R++  SLMALRS
Sbjct  57    ----EAPAQSELLHG----------------------------QVSRGRALAVSLMALRS  84

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVD WWG+VE++GP +Y+WEGYA LV+MV+  GL+LQ+VMSFHQCGGNVGDSC+
Sbjct  85    AGVEGVMVDVWWGVVEREGPGRYDWEGYAELVRMVERAGLRLQMVMSFHQCGGNVGDSCN  144

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEE++ +PD+VYTDRSGRRNPEYISLGCD LPVL+GRTPVQVY+DYMRSFR+R
Sbjct  145   IPLPPWVLEELNADPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPVQVYSDYMRSFRDR  204

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F  Y+G VI EVQVG+GPCGELRYPSYPE+NGTW FPGIGEFQCYDKYMRASL A+A A 
Sbjct  205   FAGYLGTVIAEVQVGLGPCGELRYPSYPEANGTWSFPGIGEFQCYDKYMRASLQAAAVAA  264

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             G   WG SGPHDAG+Y QFPE+TGFFRRDGTW TEYG FFL+WYSG LLEHGDR+L AA 
Sbjct  265   GHENWGTSGPHDAGEYKQFPEETGFFRRDGTWSTEYGHFFLKWYSGMLLEHGDRVLAAAE  324

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
              +F GTG  LS K+AGIHWHY TRSHAAEL AGYYNTR  +GY PIA MLA+HG V NFT
Sbjct  325   AIFGGTGVTLSAKVAGIHWHYRTRSHAAELTAGYYNTRHHDGYEPIAQMLARHGTVLNFT  384

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS  1484
             CMEMKD +QPG A CSPE LV+QV+ A + A  ELAGENALERYD + + QV AT+ +  
Sbjct  385   CMEMKDEQQPGHAGCSPELLVQQVRAAARAARVELAGENALERYDEQAFAQVAATAEA--  442

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRN  1664
               GLSAFTYLRMN+NLF+ +NWR+ V FVK+M++GG  T LP CD+  +DLYVG +    
Sbjct  443   -AGLSAFTYLRMNRNLFDGDNWRRFVAFVKTMADGGARTTLPRCDTGHSDLYVGFVDAAK  501

Query  1665  AKNANEA  1685
              + A E+
Sbjct  502   EQRAPES  508



>ref|XP_001768786.1| predicted protein [Physcomitrella patens]
 gb|EDQ66339.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/456 (64%), Positives = 358/456 (79%), Gaps = 10/456 (2%)
 Frame = +3

Query  303   RVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             RVPVF+MLPLD++ M   LN+ R++NASLMAL+SAG+EG+M+D WWG+VEKD PL YNW 
Sbjct  35    RVPVFVMLPLDSVNMNNTLNRRRALNASLMALKSAGIEGIMMDVWWGIVEKDAPLNYNWS  94

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
              Y  L++M ++HGLK+Q VMSFHQCGGNVGDSC+IPLPPWVLEEI KNPDL YTD+SGRR
Sbjct  95    AYRELIEMARKHGLKVQAVMSFHQCGGNVGDSCNIPLPPWVLEEIQKNPDLAYTDKSGRR  154

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EYI LG D +P L+GRTPVQ YAD+MRSFR+ F++ +G+VI+E+Q GMGP GELRYPS
Sbjct  155   NAEYICLGADNVPALKGRTPVQCYADFMRSFRDNFEDLLGDVIIEIQCGMGPAGELRYPS  214

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPES G WRFPGIGEFQCYDKYM A L ASAEA G   WG SGPHDAG YNQ+P+DTGFF
Sbjct  215   YPESEGRWRFPGIGEFQCYDKYMLAGLKASAEAVGMPAWGTSGPHDAGNYNQWPDDTGFF  274

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             R+DGTW T+YGQFF+EWYS  LL HG+RIL+ A G+F+ T A +SGK+AGIHWHY TRSH
Sbjct  275   RKDGTWSTDYGQFFMEWYSEMLLAHGERILSVATGIFRDTEAVISGKVAGIHWHYGTRSH  334

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             AAEL AGYYNTR R+GY PIA + AK+GV  NFTC EM+D EQP  A CSPEGLV+QV  
Sbjct  335   AAELTAGYYNTRTRDGYAPIAQLFAKYGVTLNFTCFEMRDLEQPSHALCSPEGLVKQVAF  394

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSR---------SDSGNGLSAFTYLRMNKNLF  1535
             AT+ AG  +AGENAL R+DS  +EQ++ +SR               ++AFT+LRM++++F
Sbjct  395   ATRTAGTPMAGENALPRFDSSAHEQIITSSRLRMPVEGDCHQDYEPMAAFTFLRMSESMF  454

Query  1536  EPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYV  1643
               ENWR  V FV+ M E GR+ +  E +  RT+ +V
Sbjct  455   HSENWRLFVPFVRHMEE-GRTFQPWEEEHQRTETHV  489



>ref|XP_001756520.1| predicted protein [Physcomitrella patens]
 gb|EDQ78474.1| predicted protein [Physcomitrella patens]
Length=483

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/451 (66%), Positives = 362/451 (80%), Gaps = 10/451 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+MLPLDT++M   LN+ R+++ASL+AL+SAGVEGVM+D WWG+VEKDGP +YNW  
Sbjct  14    VPVFVMLPLDTVSMNNTLNRRRALDASLLALKSAGVEGVMMDVWWGIVEKDGPQQYNWSA  73

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L+ MV++HGLK+Q VMSFHQCGGNVGDSC+IPLPPWVLEE+ KNPDL YTD++GRRN
Sbjct  74    YQELIDMVRKHGLKVQAVMSFHQCGGNVGDSCNIPLPPWVLEEVRKNPDLAYTDKAGRRN  133

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLG D +P L+GRTPVQ YAD+MRSFR+ F +++G+ IVE+Q GMGP GELRYPSY
Sbjct  134   SEYISLGADNVPALKGRTPVQCYADFMRSFRDNFDDFLGDFIVEIQCGMGPAGELRYPSY  193

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PES G WRFPGIGEFQ YDKYM ASL A+A+  GK  WG SGPHDAG YNQ+PE+ GFF+
Sbjct  194   PESEGRWRFPGIGEFQSYDKYMIASLKANAQKVGKPAWGFSGPHDAGSYNQWPEEAGFFK  253

Query  1026  RDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHA  1205
             +DGTW +EYGQFFLEWYS  LL HG+RIL+ A G+F+GTGA +SGK+AGIHWHY TRSHA
Sbjct  254   KDGTWSSEYGQFFLEWYSEMLLAHGERILSQATGIFRGTGAIISGKVAGIHWHYGTRSHA  313

Query  1206  AELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVA  1385
             AEL AGYYNTR R+GY PIA M AK+GV  NFTC+EM+D EQP  A CSPEGLVRQV +A
Sbjct  314   AELTAGYYNTRTRDGYSPIAQMFAKYGVTLNFTCIEMRDFEQPSHALCSPEGLVRQVALA  373

Query  1386  TKDagaelagenaleRYDSRGYEQVLATSR---SDSGNG------LSAFTYLRMNKNLFE  1538
             T+ AG  +AGENAL R+D+  +EQ++  SR   ++ G+       +SAFT+LRM ++LF 
Sbjct  374   TRKAGISMAGENALPRFDNSAHEQIVRKSRLQMNEKGDCQEEYEPMSAFTFLRMCESLFH  433

Query  1539  PENWRKLVEFVKSMSEGGRSTRLPECDSSRT  1631
              ENWR  V FV+ M E GR+ +  E +S RT
Sbjct  434   SENWRLFVPFVRHMEE-GRTFQPWEEESHRT  463



>ref|XP_001782016.1| predicted protein [Physcomitrella patens]
 gb|EDQ53159.1| predicted protein [Physcomitrella patens]
Length=465

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/446 (66%), Positives = 355/446 (80%), Gaps = 10/446 (2%)
 Frame = +3

Query  321   MLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALV  500
             MLPLD++ M   LN+ R+MNASL+AL+SAGVEG+M+D WWG+VEKDGP +YNW  Y  L+
Sbjct  1     MLPLDSVNMNNTLNRRRAMNASLLALKSAGVEGIMMDVWWGIVEKDGPHQYNWSAYRELI  60

Query  501   KMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYIS  680
              MV+ HGLK+Q VMSFHQCGGNVGDSC++PLPPWVLEE+ KNPDL YTDR GRRN EYIS
Sbjct  61    DMVRNHGLKVQAVMSFHQCGGNVGDSCNVPLPPWVLEEVRKNPDLAYTDRVGRRNAEYIS  120

Query  681   LGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNG  860
             LG D +P L+GRTPVQ YAD+MRSFR+ FK+ +G+VI+E+Q GMGP GELRYPSYPES G
Sbjct  121   LGADNVPALQGRTPVQCYADFMRSFRDNFKDLLGDVIIEIQCGMGPAGELRYPSYPESEG  180

Query  861   TWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTW  1040
              WRFPGIGEFQ YDKYM ASL ASA A GK  WG  GPHD+G YNQ+PE+TGFF++DGTW
Sbjct  181   RWRFPGIGEFQSYDKYMIASLKASAHAVGKPAWGSGGPHDSGSYNQWPEETGFFKKDGTW  240

Query  1041  KTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNA  1220
              TEYGQFF+EWYS  LL HG+RIL+ A G+F+GTGA +SGK+AGIHWHY TRSHAAEL A
Sbjct  241   STEYGQFFMEWYSEMLLAHGERILSEATGIFRGTGAVISGKVAGIHWHYGTRSHAAELTA  300

Query  1221  GYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDag  1400
             GYYNTR R+GYLPIA M AK+GV  NFTC+EM+D EQP  A CSPEGLVRQV +AT+  G
Sbjct  301   GYYNTRSRDGYLPIAQMFAKYGVTLNFTCIEMRDFEQPAHALCSPEGLVRQVALATRKTG  360

Query  1401  aelagenaleRYDSRGYEQVLATSR---SDSGNG------LSAFTYLRMNKNLFEPENWR  1553
               +AGENAL R+DS  +EQ++  SR   ++ G+       +SAFT+LRM ++LF  ENWR
Sbjct  361   IPMAGENALPRFDSSAHEQIVRKSRLQMNEKGDCQEHYEPMSAFTFLRMCESLFHSENWR  420

Query  1554  KLVEFVKSMSEGGRSTRLPECDSSRT  1631
               V FV+ M E GR+ +  E +S RT
Sbjct  421   LFVPFVRHMEE-GRTFQPWEEESHRT  445



>ref|NP_001065418.2| Os10g0565200 [Oryza sativa Japonica Group]
 dbj|BAF27255.2| Os10g0565200 [Oryza sativa Japonica Group]
Length=522

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/538 (61%), Positives = 385/538 (72%), Gaps = 32/538 (6%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLR-AKSSMQEAALLSQPL  230
             MALTLRSSTSF  L  +      +D P              RLR A+++  E A +    
Sbjct  1     MALTLRSSTSF--LSPLDPSSKREDAPPCCVVPMPAPGSGGRLRLARAAPVEHATME---  55

Query  231   EGRVNEKRERLH-GLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
             E    E    LH G    Q         V++MLPL+T+  GG + + R++ ASL ALRS 
Sbjct  56    EMASPEAATLLHHGGGGGQGQRRGKGTAVYVMLPLETVGAGGKVARARALAASLAALRSG  115

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEGVMVD WWG+VE++GP +Y+WEGY  LV+MV+  GL+LQ+VMSFHQCGGNVGDSC+I
Sbjct  116   GVEGVMVDVWWGVVEREGPRRYDWEGYGELVRMVERAGLRLQMVMSFHQCGGNVGDSCNI  175

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLP WVLEE+  NPD+VYTDRSGRRNPEYISLGCD LPVL+GRTP+Q             
Sbjct  176   PLPGWVLEEMKSNPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPIQ-------------  222

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
                      E+QVG+GPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL  +A A G
Sbjct  223   ---------EIQVGLGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLQQAAAAAG  273

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
               EWGR GPHDAG+Y QFPE+TGFFRRDGTW TEYG FFL WYSG LLEHGDR+L AA  
Sbjct  274   HEEWGRGGPHDAGEYKQFPEETGFFRRDGTWCTEYGDFFLGWYSGMLLEHGDRVLAAAEA  333

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             VF+GTGA LS K+AGIHWHY TRSHAAEL AGYYNTR R+GY P+A MLA+ G V NFTC
Sbjct  334   VFRGTGAALSAKVAGIHWHYRTRSHAAELTAGYYNTRRRDGYAPVAAMLARRGAVLNFTC  393

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG  1487
             MEM+D +QP  A CSPE LVRQV+ A + A   LAGENALERYD   + QV+AT+ S   
Sbjct  394   MEMRDEQQPEHAGCSPEQLVRQVRSAARAARVGLAGENALERYDEAAFAQVVATAAS---  450

Query  1488  NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKR  1661
              GL AFTYLRMNK LF+ +NWR+ V FV++M++GG    LP CD+ ++DLYVG ++KR
Sbjct  451   AGLGAFTYLRMNKKLFDGDNWRQFVSFVRAMADGGERAALPSCDTEQSDLYVGFLEKR  508



>ref|XP_002314522.2| hypothetical protein POPTR_0010s07340g [Populus trichocarpa]
 gb|EEF00693.2| hypothetical protein POPTR_0010s07340g [Populus trichocarpa]
Length=586

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/439 (65%), Positives = 346/439 (79%), Gaps = 6/439 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TMG  LN+ ++MNASL AL+SAGVEG+MVD WWGLVE+D P  YNW G
Sbjct  119   VPVYVMMPLDSVTMGNTLNRKKAMNASLQALKSAGVEGLMVDVWWGLVERDAPGVYNWGG  178

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M + HGLK+Q VMSFHQCGGNVGDSC+IPLP W +EEI K+ DL YTD+ GRRN
Sbjct  179   YTELLEMAKRHGLKVQAVMSFHQCGGNVGDSCTIPLPKWAVEEIDKDQDLAYTDQWGRRN  238

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLGCD LPVL+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  239   HEYISLGCDTLPVLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  298

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTWRFPGIG FQCYDKYM +SL A+AEA GK EWG +GP DAG+YN +PEDT FFR
Sbjct  299   PEQNGTWRFPGIGAFQCYDKYMLSSLKAAAEAAGKPEWGSTGPTDAGEYNNWPEDTQFFR  358

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W + YG+FFL WYS  LL+HG+RIL++A   F+  G K+S KIAGIHWHY TRSH
Sbjct  359   KEGGGWTSPYGEFFLTWYSQMLLDHGERILSSAKATFENIGVKISVKIAGIHWHYGTRSH  418

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LVRQV +
Sbjct  419   APELTAGYYNTRFRDGYLPIARMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVAL  478

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATS-----RSDSGNGLSAFTYLRMNKNLFEPEN  1547
             AT++A   LAGENAL RYD   +EQ+L  S      S     + AFTYLRMN +LF+P+N
Sbjct  479   ATREADIPLAGENALPRYDEYAHEQILQASSLNIDESSDDKEMCAFTYLRMNPHLFQPDN  538

Query  1548  WRKLVEFVKSMSEGGRSTR  1604
             WR+ V FVK M EG  + R
Sbjct  539   WRRFVAFVKKMKEGKSTDR  557



>ref|XP_001778149.1| predicted protein [Physcomitrella patens]
 gb|EDQ57039.1| predicted protein [Physcomitrella patens]
Length=507

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/455 (64%), Positives = 363/455 (80%), Gaps = 10/455 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+MLPLD++ +   L + R++NASL+AL+SAGVEGVM+D WWG+VEK+GP  YNW  
Sbjct  39    VPVFVMLPLDSVNINNTLKRRRALNASLLALKSAGVEGVMMDVWWGIVEKEGPRNYNWSA  98

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L+ MV++HGLK+Q VMSFHQCGGNVGDSC+IPLPPWVLEE+ KNPDL YTD++G+RN
Sbjct  99    YRELIDMVRKHGLKVQAVMSFHQCGGNVGDSCNIPLPPWVLEEVQKNPDLAYTDKAGKRN  158

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLG D +P L+GRTPVQ YAD+MRSFR+ FK+ +G+VI+E+Q GMGP GELRYPSY
Sbjct  159   AEYISLGADNVPALKGRTPVQCYADFMRSFRDNFKDLLGDVIIEIQCGMGPAGELRYPSY  218

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PES G WRFPGIGEFQCYDKYM ASL A+A+A GK  WG  GP DAG YNQ+P++TGFF 
Sbjct  219   PESEGRWRFPGIGEFQCYDKYMLASLKANAQALGKPAWGHGGPCDAGNYNQWPDETGFFH  278

Query  1026  RDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHA  1205
             RDG+W +EYGQFF+EWYS  +L HG+R+L +A+G+F+GTGA +SGK+AGIHWHY TRSHA
Sbjct  279   RDGSWCSEYGQFFMEWYSEMILAHGERLLASASGIFKGTGAVISGKVAGIHWHYGTRSHA  338

Query  1206  AELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVA  1385
             AEL AGYYNTR R+GY  IA M AK+GV  NFTC+EM+D EQP  A+CSPEGLVRQV +A
Sbjct  339   AELTAGYYNTRTRDGYATIAQMFAKYGVTLNFTCIEMRDYEQPSQASCSPEGLVRQVALA  398

Query  1386  TKDagaelagenaleRYDSRGYEQVLATSR---SDSGNG------LSAFTYLRMNKNLFE  1538
             T+ AG  +AGENAL R+DS  +EQ++  SR   ++ G+       ++AFT+LRM ++LF 
Sbjct  399   TRRAGIPMAGENALPRFDSSAHEQIVRKSRLRMNEHGDCHEEYEPMAAFTFLRMCESLFH  458

Query  1539  PENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYV  1643
              ENW+  V FV+ M E GR+ +  E +  RT+ +V
Sbjct  459   SENWKLFVPFVRHMEE-GRTFQPWEEEHHRTETHV  492



>gb|AII99838.1| beta-amylase [Nicotiana tabacum]
Length=576

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/498 (60%), Positives = 369/498 (74%), Gaps = 12/498 (2%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNL  359
             +R   S+   AL+  P E    EK  RL G++  +       VPVF+M+PLD++ M   +
Sbjct  73    MRPDLSVACQALMEAPAE-TAEEKEHRL-GISPEKGKG----VPVFVMMPLDSVKMDHTV  126

Query  360   NKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVV  539
             N+ ++MNASL AL+SAGVEG+M+D WWGLVE+D P +YNW GYA L++M ++HGLK+Q V
Sbjct  127   NRKKAMNASLQALKSAGVEGIMMDVWWGLVERDAPGEYNWGGYAELLEMAKKHGLKVQAV  186

Query  540   MSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRT  719
             MSFHQCGGNVGDSC+IPLP WV+EE+ K+PDL YTD+ GRRN EY+SLGCD LPVL+GRT
Sbjct  187   MSFHQCGGNVGDSCTIPLPRWVVEEMEKDPDLAYTDQWGRRNYEYVSLGCDTLPVLKGRT  246

Query  720   PVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCY  899
             PVQ Y+D+MR FR+RF+  +G+ IVE+QVGMGP GELRYPSYPE +GTW+FPGIG FQCY
Sbjct  247   PVQCYSDFMRGFRDRFENLLGDTIVEIQVGMGPAGELRYPSYPEQDGTWKFPGIGAFQCY  306

Query  900   DKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWY  1076
             DKYM +SL A+AEA GK EWGR+GP DAG YN +PEDT FFR++ G W  +YG+FFL WY
Sbjct  307   DKYMISSLKAAAEAFGKPEWGRTGPTDAGHYNNWPEDTNFFRKEGGGWDGQYGEFFLTWY  366

Query  1077  SGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYL  1256
             S  LL HG+RIL +A  +F   G K+S KIAGIHWHY TRSHA EL AGYYNTR R+GYL
Sbjct  367   SQMLLNHGERILQSAKAIFDDKGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYL  426

Query  1257  PIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRY  1436
             PIA MLA+HG +FNFTC+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL RY
Sbjct  427   PIAQMLARHGAIFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEARVPLAGENALPRY  486

Query  1437  DSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRST  1601
             D   +EQ+L  S        S   + AFTYLRMN +LF P+NWR+ V FVK M EG  + 
Sbjct  487   DDYAHEQILQASSLNIDDQSSDREMCAFTYLRMNPDLFHPDNWRRFVAFVKKMKEGKDAH  546

Query  1602  RLPECDSSRTDLYVGLIK  1655
             R  E      + +V + +
Sbjct  547   RCQEQLEQEAEHFVHITQ  564



>gb|AFQ33620.1| beta-amylase 8 [Citrus trifoliata]
Length=373

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/371 (78%), Positives = 330/371 (89%), Gaps = 0/371 (0%)
 Frame = +3

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             SIPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +P+LRGRTP+QVY+DYMRSFR+
Sbjct  3     SIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRD  62

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF++Y+G+V+ E+QVG+GPCGELRYP+YPESNGTW+FPGIGEFQCYDKYMRASL ASAEA
Sbjct  63    RFRDYLGDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEA  122

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
              G  +WGRSGPHD+GQYNQFPEDTGFFRRDGTW +EYG+FF+EWYSGKL++HGDRIL AA
Sbjct  123   SGNEDWGRSGPHDSGQYNQFPEDTGFFRRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAA  182

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
               +FQGTG+KLSGK+AGIHWHY +RSHAAEL AGYYNTR  +GY+PIA MLAKHGV+ NF
Sbjct  183   KEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYNTRYCDGYIPIARMLAKHGVILNF  242

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEM+D EQPG+ANCSPEGLVRQVK+AT+ AG ELAGENALERYD+  Y QVLATS  D
Sbjct  243   TCMEMRDREQPGNANCSPEGLVRQVKMATRTAGVELAGENALERYDADAYAQVLATSNLD  302

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKR  1661
             +GNGLSAFTYLRMNK LFE ENWR LVEFV+ MS  GR  RLPE DS+ +DLYVG +K +
Sbjct  303   AGNGLSAFTYLRMNKKLFESENWRNLVEFVQRMSSEGRRPRLPEWDSTGSDLYVGFVKGK  362

Query  1662  NAKNANEAVLV  1694
             N K   EA LV
Sbjct  363   NGKKNKEAALV  373



>gb|KDP33360.1| hypothetical protein JCGZ_12909 [Jatropha curcas]
Length=583

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/498 (60%), Positives = 373/498 (75%), Gaps = 10/498 (2%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQ--PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGG  353
             +RA  S+   A +++   LE  +    ER++             VPVF+M+PLD++TMG 
Sbjct  74    IRADLSVACRAFVTETSALETAIEGLEERMY--RGGSGKEKGKGVPVFVMMPLDSVTMGN  131

Query  354   NLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQ  533
              +N+ ++MNASL AL+SAGVEGVM+D WWGLVE++ P  YNW GYA L +M + HGLK+Q
Sbjct  132   TVNRRKAMNASLQALKSAGVEGVMMDVWWGLVEREAPGSYNWGGYAELFEMAKRHGLKVQ  191

Query  534   VVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRG  713
              VMSFHQCGGNVGDSC+IPLP WV+EEI+K+PDL YTD+ GRRN EY+SLGCD LPVL+G
Sbjct  192   AVMSFHQCGGNVGDSCTIPLPQWVVEEINKDPDLAYTDQWGRRNHEYLSLGCDTLPVLKG  251

Query  714   RTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQ  893
             RTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSYPE NGTW+FPGIG FQ
Sbjct  252   RTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWKFPGIGAFQ  311

Query  894   CYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLE  1070
             CYDKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FFR++ G W + YG+FFL 
Sbjct  312   CYDKYMLSSLKAAAEAAGKPEWGSTGPTDAGHYNNWPEDTQFFRKENGGWTSPYGEFFLN  371

Query  1071  WYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNG  1250
             WYS  L++HG+RIL+++  +F+ TG K+S K+AGIHWHY TRSHA EL AGYYNTR R+G
Sbjct  372   WYSQMLIDHGERILSSSKAIFENTGVKISVKVAGIHWHYGTRSHAPELTAGYYNTRFRDG  431

Query  1251  YLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenale  1430
             YLPIA MLA+HG VFNFTC+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL 
Sbjct  432   YLPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVRQVALATQEAQVPLAGENALP  491

Query  1431  RYDSRGYEQVL-ATSRSDSGNG----LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGR  1595
             RYD   +EQ+L A+S S   N     + AFTYLRMN +LF+ +NWR+ V FVK M EG  
Sbjct  492   RYDDYAHEQILRASSLSIDENSDDREMCAFTYLRMNPHLFQEDNWRRFVAFVKKMKEGKN  551

Query  1596  STRLPECDSSRTDLYVGL  1649
             + +  E      + +V L
Sbjct  552   AKQCREQVEREAEHFVHL  569



>ref|NP_001234556.1| beta-amylase [Solanum lycopersicum]
 gb|ADK97800.1| beta-amylase [Solanum lycopersicum]
Length=580

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/482 (60%), Positives = 364/482 (76%), Gaps = 8/482 (2%)
 Frame = +3

Query  228   LEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
             +E +V E  ER + +    S      VPVF+M+PLD++     +N+ ++MNASL AL+SA
Sbjct  89    MEAQVEEVVEREYKV--RNSSEKEKGVPVFVMMPLDSVKTDHTVNRKKAMNASLQALKSA  146

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEG+M+D WWGLVE+D P +YNW GYA L++M ++HGLK+Q VMSFHQCGGNVGDSC+I
Sbjct  147   GVEGIMMDVWWGLVERDAPGEYNWGGYAELMEMAKKHGLKVQAVMSFHQCGGNVGDSCTI  206

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLP WV+EE+ K+PDL YTD+ GRRN EY+SLGCD LPVL+GRTPVQ Y+D+MR FR+RF
Sbjct  207   PLPRWVVEEMEKDPDLAYTDQWGRRNFEYVSLGCDTLPVLKGRTPVQCYSDFMRGFRDRF  266

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
             +  +G+ IVE+QVGMGP GELRYPSYPE +G W+FPGIG FQCYDKYM +SL  +AEA G
Sbjct  267   ENLLGDTIVEIQVGMGPAGELRYPSYPEKDGIWKFPGIGAFQCYDKYMISSLQGAAEAFG  326

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             K EWG +GP DAGQYN +PEDT FF+++ G W ++YG+FFL WYS  LL HG+RIL +A 
Sbjct  327   KPEWGHTGPTDAGQYNNWPEDTNFFKKEGGGWDSQYGEFFLTWYSEMLLNHGERILQSAK  386

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
              +F+  G K+S KIAGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+HG VFNFT
Sbjct  387   AIFEDKGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRNRDGYLPIAQMLARHGAVFNFT  446

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATS----  1472
             C+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL RYD   +EQ+L  S    
Sbjct  447   CVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPLAGENALPRYDDYAHEQILQASSLSI  506

Query  1473  RSDSGN-GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGL  1649
                SG+  +SAFTYLRMN +LF P+NWR+ V FVK M EG  + +  E      + +V +
Sbjct  507   NDQSGDREMSAFTYLRMNPDLFHPDNWRRFVAFVKKMKEGKDANKCREQVEREAEHFVHI  566

Query  1650  IK  1655
              +
Sbjct  567   TQ  568



>gb|KDO35878.1| hypothetical protein CISIN_1g017328mg [Citrus sinensis]
Length=373

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 327/371 (88%), Gaps = 0/371 (0%)
 Frame = +3

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             SIPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +P+LRGRTP+QVY+DYMRSFR+
Sbjct  3     SIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDTIPLLRGRTPIQVYSDYMRSFRD  62

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
             RF++Y+G+V+ E+QVG+GPCGELRYP+YPESNGTW+FPGIGEFQCYDKYMRASL ASAEA
Sbjct  63    RFRDYLGDVVQEIQVGLGPCGELRYPAYPESNGTWKFPGIGEFQCYDKYMRASLKASAEA  122

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
                 +WGRSGPHD+GQYNQFPEDTGFFRRDGTW +EYG+FF+EWYSGKL++HGDRIL AA
Sbjct  123   SSNEDWGRSGPHDSGQYNQFPEDTGFFRRDGTWNSEYGRFFMEWYSGKLIQHGDRILAAA  182

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
               +FQGTG+KLSGK+AGIHWHY +RSHAAEL AGYYNTR  +GY+PIA MLAKHG + NF
Sbjct  183   KEIFQGTGSKLSGKVAGIHWHYRSRSHAAELTAGYYNTRYCDGYIPIARMLAKHGAILNF  242

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TCMEM+D EQPG+ANCSPEGLV+QVK+AT+ AG ELAGENALERYD+  Y QVLATS  D
Sbjct  243   TCMEMRDREQPGNANCSPEGLVQQVKMATRTAGVELAGENALERYDADAYAQVLATSNLD  302

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKR  1661
             +GNGL AFTYLRM+K LFE +NWR LVEFV+ MS  GR  RLPE DS+ +DLYVG +K +
Sbjct  303   AGNGLGAFTYLRMHKKLFESDNWRNLVEFVQRMSSEGRRPRLPEWDSTGSDLYVGFVKGK  362

Query  1662  NAKNANEAVLV  1694
             N K   EA +V
Sbjct  363   NGKKTKEAAVV  373



>gb|AAY89374.1| beta-amylase 1 [Nicotiana langsdorffii x Nicotiana sanderae]
Length=576

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/484 (61%), Positives = 360/484 (74%), Gaps = 12/484 (2%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNL  359
             +R   S+   AL+  P E       ER H L    S      VPVF+M+PLD++ M   +
Sbjct  73    MRPDLSVACQALMEAPAETAA----EREHRLG--NSPEKGKGVPVFVMMPLDSVKMDHTV  126

Query  360   NKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVV  539
             N+ ++MNASL AL+SAGVEG+M+D WWGLVE+D P +YNW GYA L++M ++HGLK+Q V
Sbjct  127   NRKKAMNASLQALKSAGVEGIMMDVWWGLVERDSPGEYNWGGYAELLEMAKKHGLKVQAV  186

Query  540   MSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRT  719
             MSFHQCGGNVGDSC+IPLP WV+EE+ K+PDL YTD+ GRRN EY+SLGCD LPVL+GR+
Sbjct  187   MSFHQCGGNVGDSCTIPLPRWVVEEMEKDPDLAYTDQWGRRNYEYVSLGCDTLPVLKGRS  246

Query  720   PVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCY  899
             PVQ Y+D+MR FR+RF+  +G+ IVE+QVGMGP GELRYPSYPE +GTW+FPGIG FQCY
Sbjct  247   PVQCYSDFMRGFRDRFENLLGDTIVEIQVGMGPAGELRYPSYPEQDGTWKFPGIGAFQCY  306

Query  900   DKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWY  1076
             DKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FFR++ G W  EYG+FFL WY
Sbjct  307   DKYMISSLKAAAEAFGKPEWGHTGPTDAGHYNNWPEDTNFFRKEGGGWDGEYGEFFLTWY  366

Query  1077  SGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYL  1256
             S  LL HG+RIL +A  +F   G K+S KIAGIHWHY TRSHA EL AGYYNTR R+GYL
Sbjct  367   SQMLLNHGERILQSAKAIFDDKGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYL  426

Query  1257  PIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRY  1436
             PIA MLA+HG +FNFTC+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL RY
Sbjct  427   PIAQMLARHGAIFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPLAGENALPRY  486

Query  1437  DSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRST  1601
             D   +EQ+L  S        S   + AFTYLRMN +LF P+NWR+ V FVK M EG  + 
Sbjct  487   DDYAHEQILQASSLNIDDQSSDREMCAFTYLRMNPDLFHPDNWRRFVAFVKKMKEGKDAH  546

Query  1602  RLPE  1613
             R  E
Sbjct  547   RCQE  550



>ref|XP_009785196.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana sylvestris]
Length=576

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/498 (59%), Positives = 365/498 (73%), Gaps = 12/498 (2%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNL  359
             +R   S+   AL+  P E       ER H L    S      VPVF+M+PLD++ M   +
Sbjct  73    MRPDLSVACQALMEAPAETAA----EREHRLG--NSPEKGKGVPVFVMMPLDSVKMDHTV  126

Query  360   NKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVV  539
             N+ ++MNASL AL+SAGVEG+M+D WWGLVE+D P +YNW GYA L++M ++HGLK+Q V
Sbjct  127   NRKKAMNASLQALKSAGVEGIMMDVWWGLVERDAPGEYNWGGYAELLEMAKKHGLKVQAV  186

Query  540   MSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRT  719
             MSFHQCGGNVGDSC+IPLP WV+EE+ K+PDL YTD+ GRRN EY+SLGCD LPVL+GR+
Sbjct  187   MSFHQCGGNVGDSCTIPLPRWVVEEMEKDPDLAYTDQWGRRNYEYVSLGCDTLPVLKGRS  246

Query  720   PVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCY  899
             PVQ Y+D+MR FR+RF+  +G+ I+E+QVGMGP GELRYPSYPE +GTW+FPGIG FQCY
Sbjct  247   PVQCYSDFMRGFRDRFENLLGDTIMEIQVGMGPAGELRYPSYPEQDGTWKFPGIGAFQCY  306

Query  900   DKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWY  1076
             DKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FFR++ G W  EYG+FFL WY
Sbjct  307   DKYMISSLKAAAEAFGKPEWGHTGPTDAGHYNNWPEDTNFFRKEGGGWDGEYGEFFLTWY  366

Query  1077  SGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYL  1256
             S  LL HG+RIL +A  +F   G K+S KIAGIHWHY TRSHA EL AGYYNTR R+GYL
Sbjct  367   SQMLLNHGERILQSAKAIFHDKGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYL  426

Query  1257  PIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRY  1436
             PIA MLA+HG +FNFTC+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL RY
Sbjct  427   PIAQMLARHGAIFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPLAGENALPRY  486

Query  1437  DSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRST  1601
             D   +EQ+L  S        S   + AFTYLRMN +LF P+NWR+ V FVK M EG  + 
Sbjct  487   DDYAHEQILQASSLNIDDQSSDREMCAFTYLRMNPDLFHPDNWRRFVAFVKKMKEGKDAH  546

Query  1602  RLPECDSSRTDLYVGLIK  1655
             R  E      + +V + +
Sbjct  547   RCQEQLEQEAEHFVHITQ  564



>ref|XP_009596880.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana tomentosiformis]
Length=576

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/476 (62%), Positives = 360/476 (76%), Gaps = 12/476 (3%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNL  359
             +R   S+   AL+  P E    EK  RL G++  +       VPVF+M+PLD++ M   +
Sbjct  73    MRPDLSVACQALMEAPAE-TAEEKEHRL-GISPEKGKG----VPVFVMMPLDSVKMDHTV  126

Query  360   NKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVV  539
             N+ ++MNASL AL+SAGVEG+M+D WWGLVE+D P +YNW GYA L++M ++HGLK+Q V
Sbjct  127   NRKKAMNASLQALKSAGVEGIMMDVWWGLVERDAPGEYNWGGYAELLEMAKKHGLKVQAV  186

Query  540   MSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRT  719
             MSFHQCGGNVGDSC+IPLP WV+EE+ K+PDL YTD+ GRRN EY+SLGCD LPVL+GRT
Sbjct  187   MSFHQCGGNVGDSCTIPLPRWVVEEMEKDPDLAYTDQWGRRNYEYVSLGCDTLPVLKGRT  246

Query  720   PVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCY  899
             PVQ Y+D+MR FR+RF+  +G+ IVE+QVGMGP GELRYPSYPE +GTW+FPGIG FQCY
Sbjct  247   PVQCYSDFMRGFRDRFENLLGDTIVEIQVGMGPAGELRYPSYPEQDGTWKFPGIGAFQCY  306

Query  900   DKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWY  1076
             DKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FFR++ G W  +YG+FFL WY
Sbjct  307   DKYMISSLKAAAEAFGKPEWGHTGPTDAGHYNNWPEDTNFFRKEGGGWDGQYGEFFLTWY  366

Query  1077  SGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYL  1256
             S  LL HG+RIL +A  +F   G K+S KIAGIHWHY TRSHA EL AGYYNTR R+GYL
Sbjct  367   SQMLLNHGERILQSAKAIFDDKGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYL  426

Query  1257  PIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRY  1436
             PIA MLA+HG +FNFTC+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL RY
Sbjct  427   PIAQMLARHGAIFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPLAGENALPRY  486

Query  1437  DSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
             D   +EQ+L  S        S   + AFTYLRMN +LF P+NWR+ V FVK M EG
Sbjct  487   DDYAHEQILQASSLNINDQSSDREMCAFTYLRMNPDLFHPDNWRRFVAFVKKMKEG  542



>ref|XP_011029718.1| PREDICTED: beta-amylase 1, chloroplastic-like [Populus euphratica]
Length=582

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/433 (65%), Positives = 349/433 (81%), Gaps = 6/433 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TMG  +N+ ++MNASL AL+SAGVEGVM+D WWGLVE+D P  YNW G
Sbjct  115   VPVYVMMPLDSVTMGNTVNRRKAMNASLQALKSAGVEGVMMDVWWGLVERDTPGVYNWGG  174

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M + HGLK+Q VMSFHQCGGNVGDSC++PLP WV+EE+ K+ DL YTD+ GRRN
Sbjct  175   YTELLEMAKRHGLKVQAVMSFHQCGGNVGDSCTVPLPKWVVEEVHKDQDLAYTDQWGRRN  234

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLGCD +PVL+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  235   YEYVSLGCDSIPVLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEMQVGMGPAGELRYPSY  294

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTWRFPGIG FQCYDKYM +SL A+AEA GK EWG +GP DAG+YN +PEDT FFR
Sbjct  295   PEQNGTWRFPGIGAFQCYDKYMLSSLKAAAEAAGKPEWGSTGPTDAGEYNSWPEDTRFFR  354

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W   YG+FFL WYS  LL+H +RIL++A  +F+ TG K+S KIAGIHWHY TRSH
Sbjct  355   KEGGGWTCPYGEFFLSWYSQMLLDHAERILSSAKAIFENTGVKISVKIAGIHWHYGTRSH  414

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LVRQV +
Sbjct  415   APELTAGYYNTRNRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVAL  474

Query  1383  ATKDagaelagenaleRYDSRGYEQVL-ATSRSDSGNG----LSAFTYLRMNKNLFEPEN  1547
             AT++A   LAGENAL RYD   +EQ+L A+S +  GN     + AFTYLRMN +LF+P+N
Sbjct  475   ATREAEVPLAGENALPRYDENAHEQILQASSLNIDGNSKDREMCAFTYLRMNPHLFQPDN  534

Query  1548  WRKLVEFVKSMSE  1586
             WR+ V FVK M+E
Sbjct  535   WRRFVGFVKKMNE  547



>ref|XP_006340896.1| PREDICTED: beta-amylase 1, chloroplastic-like [Solanum tuberosum]
Length=579

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/482 (60%), Positives = 364/482 (76%), Gaps = 8/482 (2%)
 Frame = +3

Query  228   LEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSA  407
             +E +V+E  ER + +    S      VPVF+M+PLD++ M   +N+ ++MNASL AL+SA
Sbjct  88    MEAQVDEVVEREYKV--RNSSEKEKGVPVFVMMPLDSVKMDHTVNRKKAMNASLQALKSA  145

Query  408   GVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSI  587
             GVEG+M+D WWGLVE+D P +YNW GYA L++M ++HGLK+Q VMSFHQCGGNVGDSC+I
Sbjct  146   GVEGIMMDVWWGLVERDAPGEYNWGGYAELMEMAKKHGLKVQAVMSFHQCGGNVGDSCTI  205

Query  588   PLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERF  767
             PLP WV+EE+ K+ DL YTD+ GRRN EY+SLGCD LPVL+GRTPVQ Y+D+MR FR+RF
Sbjct  206   PLPRWVVEEMEKDSDLAYTDQWGRRNFEYVSLGCDTLPVLKGRTPVQCYSDFMRGFRDRF  265

Query  768   KEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHG  947
             +  +G+ IVE+QVGMGP GELRYPSYPE +G W+FPGIG FQCYDKYM +SL  +AEA G
Sbjct  266   ENLLGDTIVEIQVGMGPAGELRYPSYPEKDGVWKFPGIGAFQCYDKYMISSLQGAAEAFG  325

Query  948   KSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             K EWG +GP DAGQYN +PEDT FF+++ G W ++YG+FFL WYS  LL HG+RIL +A 
Sbjct  326   KPEWGHTGPTDAGQYNNWPEDTNFFKKEGGGWDSQYGEFFLTWYSEMLLNHGERILQSAK  385

Query  1125  GVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFT  1304
              +F+  G K+S KIAGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+HG VFNFT
Sbjct  386   AIFEDKGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRNRDGYLPIAQMLARHGAVFNFT  445

Query  1305  CMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATS----  1472
             C+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL RYD   +EQ+L  S    
Sbjct  446   CVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVPLAGENALPRYDDYAHEQILQASSLNI  505

Query  1473  RSDSGN-GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGL  1649
                SG+  + AFTYLRMN +LF P+NWR+ V FVK M EG  + +  E      + +V +
Sbjct  506   NDQSGDREMCAFTYLRMNPDLFHPDNWRRFVAFVKKMKEGKDANKCREQVEREAEHFVHI  565

Query  1650  IK  1655
              +
Sbjct  566   TQ  567



>ref|XP_011091372.1| PREDICTED: beta-amylase 1, chloroplastic [Sesamum indicum]
Length=580

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/477 (61%), Positives = 364/477 (76%), Gaps = 10/477 (2%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSR-VPVFIMLPLDTITMGGN  356
             LR   S+   AL+S P+     + RE + G     SH    + VPV++M+PLD++T    
Sbjct  73    LRPDLSVAAQALMSAPVTTEDVQDREYVVG---GVSHKEDKKGVPVYVMMPLDSVTWNHT  129

Query  357   LNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQV  536
             +N+ ++MNASL AL+SAGVEG+M+D WWGLVE + P +YNW GY+ L++M ++HGLK+Q 
Sbjct  130   VNRKKAMNASLQALKSAGVEGIMMDVWWGLVEGEKPGEYNWGGYSELLEMAKKHGLKVQA  189

Query  537   VMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGR  716
             VMSFHQCGGNVGDSC+IPLP WV+EEI K+PDL YTD+ GRRN EY+SLGCD LP L+GR
Sbjct  190   VMSFHQCGGNVGDSCTIPLPKWVVEEIDKDPDLAYTDQWGRRNYEYLSLGCDTLPALKGR  249

Query  717   TPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQC  896
             TPVQ Y+D+MR+FR+ F+  +G+ IVE+QVGMGP GELRYPSYPE +GTW+FPGIG FQC
Sbjct  250   TPVQCYSDFMRAFRDTFEHLLGDTIVEIQVGMGPAGELRYPSYPEQDGTWKFPGIGAFQC  309

Query  897   YDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEW  1073
             YDKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FFR++ G W T YG+FFL W
Sbjct  310   YDKYMISSLKAAAEAIGKPEWGSTGPTDAGHYNNWPEDTNFFRKEGGGWNTPYGEFFLSW  369

Query  1074  YSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGY  1253
             YS  L++HG+RIL +A  +F+  G K+S KIAGIHWHY TRSHA EL AGYYNTR R+GY
Sbjct  370   YSQMLIDHGERILQSAKSLFENKGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGY  429

Query  1254  LPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleR  1433
             LPIA MLA+HG VFNFTC+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL R
Sbjct  430   LPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVRQVALATQEAQVPLAGENALPR  489

Query  1434  YDSRGYEQVLATSRSD-SGNG----LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
             YD   +EQ+L  S  D  GN     + AFTYLRMN +LF+P+NWR+ V FVK M EG
Sbjct  490   YDDYAHEQILQASALDIDGNSADREMCAFTYLRMNPDLFQPDNWRRFVAFVKKMKEG  546



>gb|KHG16283.1| Beta-amylase 1, chloroplastic -like protein [Gossypium arboreum]
Length=587

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/439 (64%), Positives = 347/439 (79%), Gaps = 6/439 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++T G  +N+ ++MNASL AL+SAGVEG+M+D WWGLVE++ P  YNW G
Sbjct  120   VPVYVMMPLDSVTNGNTVNRKKAMNASLHALKSAGVEGIMIDVWWGLVEREAPGAYNWGG  179

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             YA L++M ++HGLK+Q VMSFHQCGGNVGDSC+IPLP WV EEI K+PDL YTD+ GRRN
Sbjct  180   YAELLEMAKKHGLKVQAVMSFHQCGGNVGDSCTIPLPKWVTEEIEKDPDLAYTDQWGRRN  239

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLGCD LPVL+GRTPVQ YAD+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  240   YEYLSLGCDTLPVLKGRTPVQCYADFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  299

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE+NGTW+FPGIG FQC+DKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FF+
Sbjct  300   PEANGTWKFPGIGAFQCFDKYMLSSLKAAAEAAGKPEWGSTGPTDAGHYNNWPEDTPFFK  359

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W T YG+FFL WYS  LL+HG+RIL++A  +F G G K+S K+AGIHWHY TRSH
Sbjct  360   KEGGGWNTPYGEFFLTWYSQMLLDHGERILSSATSIFDGAGVKISVKVAGIHWHYGTRSH  419

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+HG VFNFTC+EM+D EQP  A C+PE LV+QV +
Sbjct  420   APELTAGYYNTRYRDGYLPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVKQVAL  479

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSRSDSGN-----GLSAFTYLRMNKNLFEPEN  1547
             AT  A   LAGENAL RYD   +EQ+L  S  +  +      + AFTYLRMN +LF P+N
Sbjct  480   ATGAAQVPLAGENALPRYDEYAHEQILQASSLNVDDLPVDREMCAFTYLRMNPSLFHPDN  539

Query  1548  WRKLVEFVKSMSEGGRSTR  1604
             WR+ V FVK M EG  + R
Sbjct  540   WRRFVAFVKKMKEGKGARR  558



>ref|XP_007035340.1| Beta-amylase 1 isoform 1 [Theobroma cacao]
 gb|EOY06266.1| Beta-amylase 1 isoform 1 [Theobroma cacao]
Length=652

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/439 (65%), Positives = 348/439 (79%), Gaps = 6/439 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++T G  LN+ ++MNASL AL+SAGVEG+MVD WWGLVE++ P  YNW G
Sbjct  185   VPVYVMMPLDSVTYGNTLNRKKAMNASLHALKSAGVEGIMVDVWWGLVEREAPGAYNWGG  244

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             YA L++M ++HGLK+Q VMSFHQCGGNVGDSC+IPLP WV+EEI K+PD+ YTD+ GRRN
Sbjct  245   YAELLEMAKKHGLKVQAVMSFHQCGGNVGDSCTIPLPKWVVEEIDKDPDIAYTDQWGRRN  304

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLGCD LPVL+GRT VQ YAD+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  305   YEYVSLGCDTLPVLKGRTSVQCYADFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  364

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE +GTWRFPGIG FQCYDKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FF+
Sbjct  365   PEQDGTWRFPGIGAFQCYDKYMLSSLKAAAEAVGKPEWGSTGPTDAGHYNYWPEDTPFFK  424

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W + YG+FFL WYS  LL+HG+RIL++A  VF+G G K+S K+AGIHWHY TRSH
Sbjct  425   KEGGGWNSRYGEFFLSWYSQMLLDHGERILSSATSVFEGAGVKISVKVAGIHWHYGTRSH  484

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+HG VFNFTC+EM+D EQP  A C+PE LVRQV +
Sbjct  485   APELTAGYYNTRFRDGYLPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVRQVAL  544

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPEN  1547
             AT  A   LAGENAL RYD   ++Q+L  S      S     + AFTYLRMN +LF+PEN
Sbjct  545   ATAAAQVPLAGENALPRYDEYAHDQILQASSLNIDGSSDDREMCAFTYLRMNPSLFQPEN  604

Query  1548  WRKLVEFVKSMSEGGRSTR  1604
             WR+ V FVK M+EG  + R
Sbjct  605   WRRFVAFVKKMNEGKDAYR  623



>ref|XP_010264799.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nelumbo nucifera]
Length=594

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/460 (63%), Positives = 353/460 (77%), Gaps = 8/460 (2%)
 Frame = +3

Query  246   EKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVM  425
             E RE   G  A  +      VPV++M+PLD++TM   +N+ ++MN S+MAL+SAGVEGVM
Sbjct  107   EVREYREG-GAGSAQVRGKGVPVYVMMPLDSVTMSNGVNRRKAMNVSMMALKSAGVEGVM  165

Query  426   VDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWV  605
             +D WWGLVE+D P  YNW GY  L++M ++HGLK+Q VMSFHQCGGNVGDSC+IPLP WV
Sbjct  166   MDVWWGLVERDAPGAYNWGGYTELLEMARKHGLKVQAVMSFHQCGGNVGDSCTIPLPRWV  225

Query  606   LEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGN  785
             +EEI+K+PDL YTD+ GRRN EY+SLGCD LPVL+GRTPVQ YAD MR+FR+ FK  +G+
Sbjct  226   VEEINKDPDLAYTDQWGRRNYEYVSLGCDNLPVLKGRTPVQCYADLMRAFRDNFKHLLGD  285

Query  786   VIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGR  965
              +VE+QVGMGP GELRYPSYPE NGTWRFPGIG FQC+DKYM +SL A+AEA GK EWG 
Sbjct  286   TVVEIQVGMGPAGELRYPSYPEQNGTWRFPGIGAFQCFDKYMISSLKAAAEAVGKPEWGH  345

Query  966   SGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGT  1142
              GP DAG YN +PE T FFR++ G W + YG+FFL WYS  LL+HG+ IL++A  +F GT
Sbjct  346   GGPTDAGHYNSWPEGTQFFRKEGGGWNSPYGEFFLTWYSQMLLDHGEAILSSAKSIFXGT  405

Query  1143  GAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKD  1322
             G K+S K+AGIHWHY TRSHAAEL AGYYNTR R+GYLPIA MLA+HG +FNFTC+EM+D
Sbjct  406   GVKISAKVAGIHWHYGTRSHAAELTAGYYNTRFRDGYLPIARMLARHGTIFNFTCIEMRD  465

Query  1323  GEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR------SDS  1484
              EQP  A C+PE LVRQV +AT++AG  LAGENAL RYD   + Q+L  +        D 
Sbjct  466   YEQPQDAQCAPEKLVRQVVLATREAGVPLAGENALPRYDEMAHLQILHAASLNLNDGKDD  525

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
             G  + AFTYLRMN NLF+ +NWRK V FVK M+EG    R
Sbjct  526   GREMCAFTYLRMNPNLFQADNWRKFVAFVKKMNEGKSGNR  565



>emb|CDP20299.1| unnamed protein product [Coffea canephora]
Length=582

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/451 (63%), Positives = 352/451 (78%), Gaps = 6/451 (1%)
 Frame = +3

Query  255   ERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDA  434
             E++H    + +      VPVF+M+PLD++ M   +N+ ++MNASL AL+SAGVEG+M+D 
Sbjct  98    EKVHRFPESSTQKKEKGVPVFVMMPLDSVKMDNTVNRRKAMNASLQALKSAGVEGIMMDV  157

Query  435   WWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEE  614
             WWGLVE+D P KYN+ GY  L++M ++HGLK+Q VMSFHQCGGNVGDSC+IPLP WV EE
Sbjct  158   WWGLVERDEPGKYNFGGYVELLEMAKKHGLKVQAVMSFHQCGGNVGDSCTIPLPRWVTEE  217

Query  615   ISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV  794
             I K+P L YTD+ GRRN EYISLGCD LPVL+GRTPVQ Y+D+M +FR++F+  +G+ IV
Sbjct  218   IDKDPGLAYTDQWGRRNYEYISLGCDTLPVLKGRTPVQCYSDFMLAFRDKFEHLLGDTIV  277

Query  795   EVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGP  974
             E+QVGMGP GELRYPSYPE NGTW+FPGIG FQCYDKYM +SL A+AEA+GK EWG +GP
Sbjct  278   EIQVGMGPAGELRYPSYPEQNGTWKFPGIGAFQCYDKYMLSSLKAAAEAYGKPEWGSTGP  337

Query  975   HDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAK  1151
              DAG YN +P+DT FFR++ G W +EYG+FFL WYS  LL+HG+RIL +A  +F+  G K
Sbjct  338   TDAGHYNNWPDDTNFFRKEGGGWDSEYGEFFLTWYSKMLLDHGERILQSAKAIFENGGVK  397

Query  1152  LSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQ  1331
             +S KIAGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+HG +FNFTC+EM+D EQ
Sbjct  398   ISVKIAGIHWHYGTRSHAPELTAGYYNTRLRDGYLPIAQMLARHGAIFNFTCIEMRDHEQ  457

Query  1332  PGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD-SGNG----L  1496
             P  A C+PE LVRQV +AT+ A   LAGENAL RYD   +EQ+L T+  +  GN     +
Sbjct  458   PQDALCAPEKLVRQVALATQQAQVPLAGENALPRYDEYAHEQILKTAALNIDGNSTNREM  517

Query  1497  SAFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
              AFTYLRMN +LF P+NWR+ V FVK M EG
Sbjct  518   CAFTYLRMNPDLFHPDNWRRFVAFVKKMKEG  548



>ref|XP_008438436.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis melo]
Length=577

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/434 (66%), Positives = 340/434 (78%), Gaps = 6/434 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TMG  +N+ ++MNASL AL+SAGVEG+M+D WWGLVE+D P  YNW G
Sbjct  110   VPVYVMMPLDSVTMGNTVNRRKAMNASLQALKSAGVEGIMMDVWWGLVERDSPGSYNWGG  169

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++HGLK+Q VMSFHQCGGNVGDS +IPLP W +EE+ K+PDL YTD+ GRRN
Sbjct  170   YTELLEMAKKHGLKVQAVMSFHQCGGNVGDSVTIPLPKWAVEEMDKDPDLAYTDQWGRRN  229

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLGCD LPVL+GRTPVQ YAD+MR+F++ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  230   YEYISLGCDTLPVLKGRTPVQCYADFMRAFKDNFKHLLGDTIVEIQVGMGPAGELRYPSY  289

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTWRFPGIG FQC+DKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FFR
Sbjct  290   PEQNGTWRFPGIGAFQCFDKYMLSSLKAAAEASGKPEWGSTGPTDAGGYNNWPEDTPFFR  349

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             +D G W + YG+FFL WYS  LL+HG+RILTAA   F+ TG K+S KIAGIHWHY  RSH
Sbjct  350   KDGGGWNSTYGEFFLTWYSQMLLDHGERILTAATSTFENTGVKISVKIAGIHWHYGHRSH  409

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LVRQV  
Sbjct  410   APELTAGYYNTRYRDGYLPIARMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVAQ  469

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATS-----RSDSGNGLSAFTYLRMNKNLFEPEN  1547
             AT  A   LAGENAL RYD   +EQ+L  S          + + AFTYLRMN +LFE EN
Sbjct  470   ATHKAQVPLAGENALPRYDEFAHEQILQASSFIGDEDSEESEMCAFTYLRMNPHLFEAEN  529

Query  1548  WRKLVEFVKSMSEG  1589
             WR+ V FVK M EG
Sbjct  530   WRRFVAFVKKMKEG  543



>ref|XP_002311706.1| beta-amylase family protein [Populus trichocarpa]
 gb|EEE89073.1| beta-amylase family protein [Populus trichocarpa]
Length=562

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/433 (65%), Positives = 348/433 (80%), Gaps = 6/433 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TM   LN+ ++MNASL AL+SAGVEGVM+D WWGLVE+D P  YNW G
Sbjct  95    VPVYVMMPLDSVTMSNTLNRRKAMNASLQALKSAGVEGVMMDVWWGLVERDTPGVYNWGG  154

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M + HGLK+Q VMSFHQCGGNVGDSC++PLP WV+EE+ K+ DL YTD+ GRRN
Sbjct  155   YTELLEMAKRHGLKVQAVMSFHQCGGNVGDSCTVPLPKWVVEEVHKDQDLAYTDQWGRRN  214

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLGCD +PVL+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  215   YEYVSLGCDSIPVLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  274

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTWRFPGIG FQCYDKYM +SL A+AEA GK EWG +GP DAG+YN +PEDT FFR
Sbjct  275   PEQNGTWRFPGIGAFQCYDKYMLSSLKAAAEAAGKPEWGSTGPTDAGEYNNWPEDTRFFR  334

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W   YG+FFL WYS  LL+H +RIL++A  +++ TG K+S KIAGIHWHY TRSH
Sbjct  335   KEGGGWTCPYGEFFLSWYSQMLLDHAERILSSAKAIYENTGVKISVKIAGIHWHYGTRSH  394

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA++G +FNFTC+EM+D EQP  A C+PE LVRQV +
Sbjct  395   APELTAGYYNTRNRDGYLPIAQMLARYGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVAL  454

Query  1383  ATKDagaelagenaleRYDSRGYEQVL-ATSRSDSGNG----LSAFTYLRMNKNLFEPEN  1547
             AT++A   LAGENAL RYD   +EQ+L A+S +  GN     + AFTYLRMN +LF+P+N
Sbjct  455   ATREAEVPLAGENALPRYDENAHEQILQASSLNIDGNSKDSEMCAFTYLRMNPHLFQPDN  514

Query  1548  WRKLVEFVKSMSE  1586
             WR+ V FVK M+E
Sbjct  515   WRRFVGFVKKMNE  527



>ref|XP_009350111.1| PREDICTED: beta-amylase 1, chloroplastic [Pyrus x bretschneideri]
Length=571

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/441 (64%), Positives = 347/441 (79%), Gaps = 6/441 (1%)
 Frame = +3

Query  288   HSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPL  467
             H   + VPV++M+PLD++TM  ++N+ ++MNASL AL+SAGVEGVM+D WWGLVE+D P 
Sbjct  99    HYKGTGVPVYVMMPLDSVTMHNSVNRKKAMNASLQALKSAGVEGVMMDVWWGLVERDAPG  158

Query  468   KYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTD  647
              YNW GYA L++M ++HGLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+PDL YTD
Sbjct  159   AYNWGGYAELLEMARKHGLKVQAVMSFHQCGGNVGDSVTIPLPKWVVEEVDKDPDLAYTD  218

Query  648   RSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGE  827
             + G+RN EY+SLG D LPVL+GRTPVQ YAD+MR+FR+ FK  +G+ +VE+QVGMGP GE
Sbjct  219   QWGKRNCEYLSLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGDTVVEIQVGMGPAGE  278

Query  828   LRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPE  1007
             LRYPSYPESNGTW+FPGIG FQC+DKYM +SL A+AEA GK EWG +GP DAG Y  +PE
Sbjct  279   LRYPSYPESNGTWQFPGIGAFQCFDKYMLSSLKAAAEAAGKPEWGSTGPTDAGHYKNWPE  338

Query  1008  DTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWH  1184
             DT FFR++ G W T YG+FFL WYS  LL+HG+RILT+A  +F+  G K+S K+AGIHWH
Sbjct  339   DTPFFRKEGGGWNTAYGEFFLGWYSQMLLDHGERILTSAKSIFEEAGVKISVKVAGIHWH  398

Query  1185  YNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGL  1364
             Y TRSHA EL AGYYNTR R+GY+PIA MLA+HG +FNFTC+EM+D EQP  A C PE L
Sbjct  399   YGTRSHAPELTAGYYNTRFRDGYIPIAQMLARHGAIFNFTCVEMRDQEQPQEAQCLPEKL  458

Query  1365  VRQVKVATKDagaelagenaleRYDSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKN  1529
             VRQV +AT+     LAGENAL RYD   +EQ+L  S      +  GN + AFTYLRMN +
Sbjct  459   VRQVAMATQKVNVPLAGENALPRYDDYAHEQILEASSLNVEGNTQGNQMCAFTYLRMNPH  518

Query  1530  LFEPENWRKLVEFVKSMSEGG  1592
             LF+P+NWR+ V FVK M E G
Sbjct  519   LFQPDNWRRFVAFVKKMKEKG  539



>ref|XP_011041480.1| PREDICTED: beta-amylase 1, chloroplastic-like [Populus euphratica]
Length=586

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/439 (65%), Positives = 344/439 (78%), Gaps = 6/439 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TMG  LN+ ++MNASL AL+SAGVEG+MVD WWGLVE+D P  YNW G
Sbjct  119   VPVYVMMPLDSVTMGNTLNRKKAMNASLQALKSAGVEGLMVDVWWGLVERDAPGVYNWGG  178

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M + HGLK+Q VMSFHQCGGNVGDSC+IPLP W +EEI K+ DL YTD+ GRRN
Sbjct  179   YTELLEMAKRHGLKVQAVMSFHQCGGNVGDSCTIPLPKWAVEEIDKDQDLAYTDQWGRRN  238

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLGCD LPVL+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  239   YEYISLGCDTLPVLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  298

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTWRFPGIG FQCYDKYM +SL A+AEA GK EWG +GP DAG+YN +PEDT FFR
Sbjct  299   PEQNGTWRFPGIGAFQCYDKYMLSSLKAAAEAAGKPEWGSTGPTDAGEYNNWPEDTQFFR  358

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W + YG+FFL WYS  LL+HG+RIL++A   F+  G K+S KIAGIHWHY TRSH
Sbjct  359   KEGGGWTSPYGEFFLTWYSQMLLDHGERILSSAKATFENIGVKISVKIAGIHWHYGTRSH  418

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LV Q  +
Sbjct  419   APELTAGYYNTRFRDGYLPIARMLARHGAIFNFTCIEMRDHEQPQDALCAPERLVSQGTL  478

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPEN  1547
             AT++A   LAGENAL R+D   +EQ+L  S      S     + AFTYLRMN +LF+P+N
Sbjct  479   ATREADVPLAGENALPRFDEYAHEQILQASSLNIDGSSDDKEMCAFTYLRMNPHLFQPDN  538

Query  1548  WRKLVEFVKSMSEGGRSTR  1604
             WR+ V FVK M EG  + R
Sbjct  539   WRRFVAFVKKMKEGKGADR  557



>ref|XP_006851336.1| hypothetical protein AMTR_s00050p00205080 [Amborella trichopoda]
 gb|ERN12917.1| hypothetical protein AMTR_s00050p00205080 [Amborella trichopoda]
Length=587

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/466 (62%), Positives = 353/466 (76%), Gaps = 2/466 (0%)
 Frame = +3

Query  249   KRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMV  428
             K+ER HG   ++ +     +PVF+MLPLD++T    +N+ R+MNASL AL+SAGVEG+M+
Sbjct  106   KQEREHGSLKSKENGKGG-IPVFVMLPLDSVTQNHGMNRKRAMNASLQALKSAGVEGIML  164

Query  429   DAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVL  608
             D WWGLVE+D P  YNW GY  L +M ++HGLK+Q VMSFHQCGGNVGDSC+IPLP WVL
Sbjct  165   DVWWGLVERDEPGNYNWGGYTELFEMARKHGLKVQAVMSFHQCGGNVGDSCTIPLPKWVL  224

Query  609   EEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNV  788
             EE  K+PDL YTD+  RRN E +SLGCD+LPVL+GR+P Q Y+D+MR+FR+ FK+ +G  
Sbjct  225   EETEKDPDLAYTDQWRRRNYECVSLGCDELPVLKGRSPAQCYSDFMRAFRDNFKDLLGET  284

Query  789   IVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRS  968
             IVE+QVGMGP GELRYPSYPE NGTW+FPGIG FQCYDKYM +SL A+AE  GKSEWG  
Sbjct  285   IVEIQVGMGPAGELRYPSYPELNGTWKFPGIGAFQCYDKYMLSSLKAAAEEAGKSEWGHG  344

Query  969   GPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGA  1148
             GP DAG YN +PED  FF+RDG W + YG+FFL WYS  LL+HG+ ILTAA  +F G+GA
Sbjct  345   GPSDAGHYNNWPEDAPFFKRDGGWSSPYGEFFLSWYSQMLLDHGELILTAAETIFDGSGA  404

Query  1149  KLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGE  1328
             KLSGK+AGIHWHY TRSHA EL AGYYNTR R+GYLPIA + A+HGVVFNFTC+EMKD E
Sbjct  405   KLSGKVAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPIARLFARHGVVFNFTCIEMKDYE  464

Query  1329  QPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVL-ATSRSDSGNGLSAF  1505
             QP  A CSPE LV QV +AT++A   LAGENAL RYD     Q+L A+S   S   + AF
Sbjct  465   QPQDAQCSPERLVHQVVLATREAKVPLAGENALPRYDEGALNQILNASSLEGSEEAMCAF  524

Query  1506  TYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYV  1643
             TYLRM+ +LF  ENWR  V FV+ M +G  + R  E     T+ +V
Sbjct  525   TYLRMSPDLFRHENWRLFVAFVRKMGQGKEAARSWEQLHGDTESFV  570



>ref|XP_007152599.1| hypothetical protein PHAVU_004G143600g [Phaseolus vulgaris]
 gb|ESW24593.1| hypothetical protein PHAVU_004G143600g [Phaseolus vulgaris]
Length=568

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/482 (60%), Positives = 362/482 (75%), Gaps = 8/482 (2%)
 Frame = +3

Query  186   AKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNK  365
             A++   + + + + L   V    E+ H  A        S VPVF+M+PLD++T G  +N+
Sbjct  64    ARAVRADLSAVCKALATEVEVAEEKEH--AEGGKKGEGSGVPVFVMMPLDSVTAGNTVNR  121

Query  366   PRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMS  545
              +++NA++ AL+SAGVEGVM+D WWGLVE++ P +YNW GY  L++M ++HGLK+Q VMS
Sbjct  122   RKAVNAAMAALKSAGVEGVMMDVWWGLVEREKPGEYNWGGYVELMEMAKKHGLKVQAVMS  181

Query  546   FHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPV  725
             FHQCGGNVGDSC+IPLP WV+EEI+ + DL YTD+ GRRN EY+SLGCD LPVL+GRTPV
Sbjct  182   FHQCGGNVGDSCTIPLPKWVVEEINNDQDLAYTDQWGRRNYEYVSLGCDTLPVLKGRTPV  241

Query  726   QVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDK  905
             Q YAD+M SFR+ FK  +G+ IVE+QVGMGP GELRYPSYPE NGTW+FPGIG FQC+DK
Sbjct  242   QCYADFMHSFRDTFKHLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWKFPGIGAFQCFDK  301

Query  906   YMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSG  1082
             YM  SL A+AEA GK EWG +GP DAG YN +PEDT FFR++ G W + YG+FFL WYS 
Sbjct  302   YMLGSLKAAAEAEGKPEWGSTGPTDAGHYNNWPEDTPFFRKEGGGWNSHYGEFFLTWYSQ  361

Query  1083  KLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPI  1262
              LL HGDRILT+A  +F  TG K+S KIAGIHWHY +RSHA EL AGYYNTR  +GYLPI
Sbjct  362   MLLNHGDRILTSAKSIFDNTGVKISVKIAGIHWHYGSRSHAPELTAGYYNTRFHDGYLPI  421

Query  1263  AHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDS  1442
             A MLA+HG +FNFTC+EM+D EQP  A C+PE LV+QV +AT+ A   LAGENAL R+D 
Sbjct  422   AQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVALATQKAQVALAGENALPRFDD  481

Query  1443  RGYEQVLATSR----SDSGN-GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRL  1607
               +EQ++  S+     DSG+  + AFTYLRMN +LFE +NWRK V FVK M EG R+ + 
Sbjct  482   YAHEQIIRASQLDVDGDSGDREMCAFTYLRMNPHLFEADNWRKFVAFVKKMKEGKRANKC  541

Query  1608  PE  1613
              E
Sbjct  542   WE  543



>ref|XP_010263970.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X2 [Nelumbo 
nucifera]
Length=568

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/441 (64%), Positives = 345/441 (78%), Gaps = 8/441 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TM   +NK ++MNASLMAL+SAGVEGVMVD WWGLVE+D P  YNW G
Sbjct  99    VPVYVMMPLDSVTMSNGVNKRKAMNASLMALKSAGVEGVMVDVWWGLVERDAPGVYNWGG  158

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M +EHGLK+Q VMSFHQCGGNVGDSC+IPLP WV+EEI ++PDL Y D+ G RN
Sbjct  159   YTELLQMAREHGLKVQAVMSFHQCGGNVGDSCTIPLPKWVVEEIDRDPDLAYKDQWGNRN  218

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              E++SLGCD LPVL+GRTPVQ Y D+M++FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  219   YEFVSLGCDNLPVLKGRTPVQCYTDFMQTFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  278

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTWRFPGIG FQC+DKYM  SL A+AEA GK EWG SGP DAG YN +PEDT FFR
Sbjct  279   PEQNGTWRFPGIGAFQCFDKYMVNSLKAAAEAAGKPEWGHSGPTDAGHYNNWPEDTQFFR  338

Query  1026  RDGT-WKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             RDG  W + YG+FFL WYS  LL+H + +L++A  +FQGTG K+S KIAGIHWHY +RSH
Sbjct  339   RDGAGWNSPYGEFFLTWYSQLLLDHCEMMLSSADSIFQGTGVKISVKIAGIHWHYGSRSH  398

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA +LA+HG +FNFTC+EM+D EQP  A C+PE LVRQV +
Sbjct  399   APELTAGYYNTRFRDGYLPIARLLARHGAIFNFTCIEMRDYEQPQDARCAPEKLVRQVAL  458

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-------LSAFTYLRMNKNLFEP  1541
             AT +AG  LAGENAL RYD   +EQ+L  +  D  +G       + AFTYLRM+ +LF+ 
Sbjct  459   ATLEAGVPLAGENALPRYDEMAHEQILRAASLDLDDGNDSDGREMCAFTYLRMSPDLFQA  518

Query  1542  ENWRKLVEFVKSMSEGGRSTR  1604
             +NW + V FVK M EG R  R
Sbjct  519   DNWTRFVAFVKKMKEGKRGNR  539



>gb|KDO55739.1| hypothetical protein CISIN_1g008030mg [Citrus sinensis]
Length=580

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/482 (60%), Positives = 363/482 (75%), Gaps = 4/482 (1%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQ-PLEGRVNEKRERLHGLAANQS--HSSSSRVPVFIMLPLDTITMG  350
             +RA  S+   A  ++ P    V E  E + G    Q       + VPVF+M+PLD++TM 
Sbjct  73    MRADLSVACRAFATESPTAAAVTEFSEEVGGEMYKQGGLQEKGNGVPVFVMMPLDSVTMS  132

Query  351   GNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKL  530
               +N+ ++++ASL AL+SAGVEGVM+D WWGLVE+D P  YNW GY+ L++M + HGLK+
Sbjct  133   NTVNRKKAIDASLRALKSAGVEGVMMDVWWGLVERDQPGHYNWGGYSDLLEMAKRHGLKV  192

Query  531   QVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLR  710
             Q VMSFHQCGGNVGDS SIPLP WV+EE+ K+ DLVYTD+ G RN EYISLGCD +PVL+
Sbjct  193   QAVMSFHQCGGNVGDSVSIPLPKWVVEEVDKDQDLVYTDQWGMRNYEYISLGCDTIPVLK  252

Query  711   GRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEF  890
             GRTPVQ Y+D+MR+F+++FK+ +G+ IVE+QVGMGP GELRYPSYPE NGTW+FPGIG F
Sbjct  253   GRTPVQCYSDFMRAFKDKFKDLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWKFPGIGAF  312

Query  891   QCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFL  1067
             QCYDKYM +SL A+AE+ GK EWG +GP DAG YN +PEDT FFR++ G W + YG+FFL
Sbjct  313   QCYDKYMLSSLKAAAESAGKPEWGSTGPTDAGHYNNWPEDTQFFRKENGGWCSPYGEFFL  372

Query  1068  EWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERN  1247
              WYS  LL+HG+RIL++A  +F  TG K+S K+AGIHWHY +RSHA EL AGYYNTR R+
Sbjct  373   SWYSQMLLDHGERILSSAKAIFDATGVKISVKVAGIHWHYGSRSHAPELTAGYYNTRFRD  432

Query  1248  GYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenal  1427
             GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LV+QV  AT+ A   LAGENAL
Sbjct  433   GYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVASATQKAHVPLAGENAL  492

Query  1428  eRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRL  1607
              RYD   +EQ+L  +  D    + AFTYLRMN +LF+P+NWR+ V FVK M+EG    R 
Sbjct  493   PRYDEYAHEQILRAASLDVDKQMCAFTYLRMNPHLFQPDNWRQFVAFVKKMNEGKDVHRC  552

Query  1608  PE  1613
              E
Sbjct  553   LE  554



>ref|XP_002518196.1| Beta-amylase, putative [Ricinus communis]
 gb|EEF44329.1| Beta-amylase, putative [Ricinus communis]
Length=574

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/442 (64%), Positives = 351/442 (79%), Gaps = 6/442 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TM   +N+ ++MNASL AL+SAGVEG+M+D WWGLVE++GP  YNW G
Sbjct  107   VPVYVMMPLDSVTMNNGVNRRKAMNASLQALKSAGVEGIMMDVWWGLVEREGPGVYNWGG  166

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M + HGLK+Q VMSFHQCGGNVGDSC+IPLP WV+EEI ++ DL YTD+ GRRN
Sbjct  167   YIELLEMAKRHGLKVQAVMSFHQCGGNVGDSCTIPLPKWVVEEIDRDVDLAYTDQWGRRN  226

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLGCD LPVL+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  227   YEYLSLGCDTLPVLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  286

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTWRFPGIG FQCYDKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FF+
Sbjct  287   PEQNGTWRFPGIGAFQCYDKYMLSSLKAAAEAAGKPEWGSTGPTDAGHYNNWPEDTPFFK  346

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             +D G W + YG+FFL WYS  LL+HG+RIL++A  +F+ TG K+S K+AGIHWHY TRSH
Sbjct  347   KDGGGWNSIYGEFFLGWYSQMLLDHGERILSSATAIFENTGVKISVKVAGIHWHYGTRSH  406

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA ML +HG +FNFTC+EM+D EQP  A C+PE LVRQV +
Sbjct  407   APELTAGYYNTRFRDGYLPIAQMLGRHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVAL  466

Query  1383  ATKDagaelagenaleRYDSRGYEQVL-ATSRSDSGNG----LSAFTYLRMNKNLFEPEN  1547
             AT++A   LAGENAL RYD   +EQ+L A+S S +G+     + AFTYLRMN +LF+ +N
Sbjct  467   ATQEAQVPLAGENALPRYDDFAHEQILQASSLSINGDSDDREMCAFTYLRMNPHLFQEDN  526

Query  1548  WRKLVEFVKSMSEGGRSTRLPE  1613
             WR+ V FVK M EG    R  E
Sbjct  527   WRRFVAFVKKMKEGKNVDRCRE  548



>ref|XP_006420416.1| hypothetical protein CICLE_v10004620mg [Citrus clementina]
 gb|ESR33656.1| hypothetical protein CICLE_v10004620mg [Citrus clementina]
Length=580

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/482 (60%), Positives = 362/482 (75%), Gaps = 4/482 (1%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQ-PLEGRVNEKRERLHGLAANQS--HSSSSRVPVFIMLPLDTITMG  350
             +RA  S+   A  ++ P    V E  E + G    Q       + VPVF+M+PLD++TM 
Sbjct  73    MRADLSVACRAFATESPTAAAVTEFSEEVGGEMYKQGGLQEKGNGVPVFVMMPLDSVTMS  132

Query  351   GNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKL  530
               +N+ ++M+ASL AL+SAGVEGVM+D WWGLVE+D P  YNW GY+ L++M + HGLK+
Sbjct  133   NTVNRKKAMDASLRALKSAGVEGVMMDVWWGLVERDQPGHYNWGGYSDLLEMAKRHGLKV  192

Query  531   QVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLR  710
             Q VMSFHQCGGNVGDS SIPLP WV+EE+ K+ DLVYTD+ G RN EYISLGCD +PVL+
Sbjct  193   QAVMSFHQCGGNVGDSVSIPLPKWVVEEVDKDQDLVYTDQWGMRNYEYISLGCDTIPVLK  252

Query  711   GRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEF  890
             GR PVQ Y+D+MR+F+++FK+ +G+ IVE+QVGMGP GELRYPSYPE NGTW+FPGIG F
Sbjct  253   GRMPVQCYSDFMRAFKDKFKDLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWKFPGIGAF  312

Query  891   QCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFL  1067
             QCYDKYM +SL A+AE+ GK EWG +GP DAG YN +PEDT FFR++ G W + YG+FFL
Sbjct  313   QCYDKYMLSSLKAAAESAGKPEWGSTGPTDAGHYNNWPEDTQFFRKENGGWCSPYGEFFL  372

Query  1068  EWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERN  1247
              WYS  LL+HG+RIL++A  +F  TG K+S K+AGIHWHY +RSHA EL AGYYNTR R+
Sbjct  373   SWYSQMLLDHGERILSSAKAIFDATGVKISVKVAGIHWHYGSRSHAPELTAGYYNTRFRD  432

Query  1248  GYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenal  1427
             GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LV+QV  AT+ A   LAGENAL
Sbjct  433   GYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVASATQKAHVPLAGENAL  492

Query  1428  eRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRL  1607
              RYD   +EQ+L  +  D    + AFTYLRMN +LF+P+NWR+ V FVK M+EG    R 
Sbjct  493   PRYDEYAHEQILRAASLDVDKQMCAFTYLRMNPHLFQPDNWRQFVAFVKKMNEGKDVHRC  552

Query  1608  PE  1613
              E
Sbjct  553   LE  554



>ref|XP_006493994.1| PREDICTED: beta-amylase 1, chloroplastic-like [Citrus sinensis]
Length=580

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/474 (61%), Positives = 359/474 (76%), Gaps = 4/474 (1%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQ-PLEGRVNEKRERLHGLAANQS--HSSSSRVPVFIMLPLDTITMG  350
             +RA  S+   A  ++ P    V E  E + G    Q         VPVF+M+PLD++TM 
Sbjct  73    MRADLSVACRAFATESPTAAAVTEFSEEVGGEMYKQGGLQEKGKGVPVFVMMPLDSVTMS  132

Query  351   GNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKL  530
               +N+ ++++ASL AL+SAGVEGVM+D WWGLVE+D P  YNW GY+ L++M + HGLK+
Sbjct  133   NTVNRKKAIDASLRALKSAGVEGVMMDVWWGLVERDQPGHYNWGGYSDLLEMAKRHGLKV  192

Query  531   QVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLR  710
             Q VMSFHQCGGNVGDS SIPLP WV+EE+ K+ DLVYTD+ G RN EYISLGCD +PVL+
Sbjct  193   QAVMSFHQCGGNVGDSVSIPLPKWVVEEVDKDQDLVYTDQWGMRNYEYISLGCDTIPVLK  252

Query  711   GRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEF  890
             GRTPVQ Y+D+MR+F+++FK+ +G+ IVE+QVGMGP GELRYPSYPE NGTW+FPGIG F
Sbjct  253   GRTPVQCYSDFMRAFKDKFKDLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWKFPGIGAF  312

Query  891   QCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFL  1067
             QCYDKYM +SL A+AE+ GK EWG +GP DAG YN +PEDT FFR++ G W + YG+FFL
Sbjct  313   QCYDKYMLSSLKAAAESAGKPEWGSTGPTDAGHYNNWPEDTQFFRKENGGWCSPYGEFFL  372

Query  1068  EWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERN  1247
              WYS  LL+HG+RIL +A  +F  TG K+S KIAGIHWHY +RSHA EL AGYYNTR R+
Sbjct  373   SWYSQMLLDHGERILASAKSIFDATGVKISVKIAGIHWHYGSRSHAPELTAGYYNTRFRD  432

Query  1248  GYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenal  1427
             GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LV+QV  AT+ A   LAGENAL
Sbjct  433   GYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVASATQTAHVPLAGENAL  492

Query  1428  eRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
              RYD   +EQ+L  +  D    + AFTYLRMN +LF+P+NWR+ V FVK M+EG
Sbjct  493   PRYDEYAHEQILRAASLDVDKQMCAFTYLRMNPHLFQPDNWRQFVAFVKKMNEG  546



>ref|XP_004515248.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cicer arietinum]
Length=573

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/456 (62%), Positives = 353/456 (77%), Gaps = 12/456 (3%)
 Frame = +3

Query  273   AANQSHSSSSR------VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDA  434
             A  + H + SR      VPV++M+PLD++TM  ++N+ +++NA++ AL+SAGVEGVM+D 
Sbjct  90    AVEKEHKAGSRSVKGNGVPVYVMMPLDSVTMTNSVNRKKAVNAAMAALKSAGVEGVMMDV  149

Query  435   WWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEE  614
             WWGLVE++   +YNW GY  L++M ++HGLK+Q VMSFHQCGGNVGDS +IPLP W +EE
Sbjct  150   WWGLVEREKAGEYNWGGYVELMEMAKKHGLKVQAVMSFHQCGGNVGDSVTIPLPKWAVEE  209

Query  615   ISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV  794
             ++K+PDL YTD+ GRRN EY+SLGCD LPVL+GRTPVQ YAD+MR+FR+ FK  +G+ IV
Sbjct  210   MNKDPDLAYTDQWGRRNYEYVSLGCDTLPVLKGRTPVQCYADFMRAFRDNFKHLLGDTIV  269

Query  795   EVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGP  974
             E+QVGMGP GELRYPSYPE NGTW+FPGIG FQCYDKYM +SL A+AEA  K  WG +GP
Sbjct  270   EIQVGMGPAGELRYPSYPEQNGTWKFPGIGAFQCYDKYMLSSLQAAAEAANKHNWGSTGP  329

Query  975   HDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAK  1151
              DAG YN +PEDT FFR++ G W +EYG+FFL WYS  LL HG+RILT+A  +F  TG K
Sbjct  330   TDAGHYNNWPEDTNFFRKEGGGWDSEYGEFFLTWYSQMLLNHGERILTSAKSIFDNTGVK  389

Query  1152  LSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQ  1331
             +S K+AGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+H  VFNFTC+EM+D EQ
Sbjct  390   ISVKVAGIHWHYGTRSHAPELTAGYYNTRNRDGYLPIAQMLARHNAVFNFTCIEMRDHEQ  449

Query  1332  PGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD-SGNG----L  1496
             P  A C+PE LV+QV +AT+ A   LAGENAL RYD   +EQ+L  S+ +  GN     +
Sbjct  450   PQDALCAPEKLVKQVALATQKAKVHLAGENALPRYDEHAHEQILKASQLNVEGNSDDAEM  509

Query  1497  SAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
              AFTYLRMN+ LF+P+NWRK V FVK M EG  + +
Sbjct  510   CAFTYLRMNQELFQPDNWRKFVSFVKKMKEGKSANK  545



>gb|EPS66628.1| beta-amylase 1, chloroplastic [Genlisea aurea]
Length=580

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/505 (57%), Positives = 367/505 (73%), Gaps = 8/505 (2%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNL  359
             +R   S+   AL+   L    + ++ER HG  +      S  VPVF+M+PLD++T    +
Sbjct  73    VRPDLSVAAQALMMPSLAAEEDSRQEREHGGGSAHGEGRSG-VPVFVMMPLDSVTFDHTV  131

Query  360   NKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVV  539
             N+ ++MNASL AL++AGVEG+M+D WWGLVE + P KYNW GY+ L++M ++HGLK+Q V
Sbjct  132   NRKKAMNASLQALKTAGVEGIMMDVWWGLVEGESPGKYNWGGYSDLLEMAKKHGLKVQAV  191

Query  540   MSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRT  719
             MSFHQCGGNVGDSC+IPLP W +EEI K+PD+ YTD+ GRRN EYISLGCD LPVL+GRT
Sbjct  192   MSFHQCGGNVGDSCTIPLPRWAVEEIDKDPDIAYTDQWGRRNYEYISLGCDALPVLKGRT  251

Query  720   PVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCY  899
             PVQ Y+D+MR+FR+ F   +GN IVE+QVGMGP GELRYPSYPE NGTW+FPGIG FQCY
Sbjct  252   PVQCYSDFMRAFRDTFSHLLGNTIVEIQVGMGPAGELRYPSYPEQNGTWKFPGIGAFQCY  311

Query  900   DKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWY  1076
             DKYMR SL ++AEA GK EWG SGP DAG YN +PEDT FF+R+ G W ++YG+FFL WY
Sbjct  312   DKYMRQSLKSAAEAIGKPEWGHSGPTDAGHYNNWPEDTNFFKRENGGWNSQYGEFFLSWY  371

Query  1077  SGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYL  1256
             S  LL+HG+RIL ++   F  TG K+S K+AGIHWHY TRSHA EL AGYYNTR R+GY 
Sbjct  372   SQSLLDHGERILRSSNAAFGNTGVKISVKVAGIHWHYGTRSHAPELTAGYYNTRLRDGYA  431

Query  1257  PIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRY  1436
             P+A ML++HG V NFTC+EM+D EQP  A C+PE LVRQV +A + A   LAGENAL R+
Sbjct  432   PVAEMLSRHGAVLNFTCIEMRDHEQPQDAQCAPEKLVRQVALAAQKAQVPLAGENALPRF  491

Query  1437  DSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRST  1601
             D   + Q+L ++      +  G  + AFTYLRMN +LF+PENW K V FV  M E GR  
Sbjct  492   DEYAHGQILRSAAPVVEGNSEGKKMCAFTYLRMNPDLFQPENWSKFVCFVNRMGEAGREK  551

Query  1602  RLPECDSSRTDLYVGLIKKRNAKNA  1676
                E +     L+V +++ + A  A
Sbjct  552   CREEVE-REAKLFVHVMQPQGAPMA  575



>gb|AFQ33614.1| beta-amylase 2 [Citrus trifoliata]
Length=580

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/474 (60%), Positives = 359/474 (76%), Gaps = 4/474 (1%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQ-PLEGRVNEKRERLHGLAANQS--HSSSSRVPVFIMLPLDTITMG  350
             +RA  S+   A  ++ P    V E  E + G    Q         VPVF+M+PLD++TM 
Sbjct  73    MRADLSVACRAFATESPTAAAVTEFSEEVGGEMHKQGGLQEKGKGVPVFVMMPLDSVTMS  132

Query  351   GNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKL  530
               +N+ ++M+ASL AL+SAGVEGVM+D WWGLVE+D P  YNW GY+ L++M + HGLK+
Sbjct  133   NTVNRKKAMDASLRALKSAGVEGVMMDVWWGLVERDQPGHYNWGGYSDLLEMAKRHGLKV  192

Query  531   QVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLR  710
             Q VMSFHQCGGNVGDS SIPLP WV+EE+ K+ DLVYTD+ G RN EYISLGCD +PVL+
Sbjct  193   QAVMSFHQCGGNVGDSVSIPLPKWVVEEVDKDQDLVYTDQWGMRNYEYISLGCDTIPVLK  252

Query  711   GRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEF  890
             GRTPVQ Y+D+MR+F+++FK+ +G+ IVE+QVGMGP GELRYPSYPE NGTW+FPGIG F
Sbjct  253   GRTPVQCYSDFMRAFKDKFKDLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWKFPGIGAF  312

Query  891   QCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFL  1067
             QCYDKYM +SL A+AE+ GK +WG +GP DAG YN +PEDT FFR++ G W + YG+FFL
Sbjct  313   QCYDKYMLSSLKAAAESAGKPDWGSTGPTDAGHYNNWPEDTQFFRKENGGWCSPYGEFFL  372

Query  1068  EWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERN  1247
              WYS  LL+HG+RIL++A  +   TG K+S K+AGIHWHY +RSHA EL AGYYNTR R+
Sbjct  373   SWYSQMLLDHGERILSSAKAILDATGVKISVKVAGIHWHYGSRSHAPELTAGYYNTRFRD  432

Query  1248  GYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenal  1427
             GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LV+QV  AT+ A   LAGENAL
Sbjct  433   GYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVASATQKAHVPLAGENAL  492

Query  1428  eRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
              RYD   +EQ+L  +  D    + AFTYLRMN +LF+P+NWR+ V FVK M+EG
Sbjct  493   PRYDEYAHEQILRAASLDVDKQMCAFTYLRMNPHLFQPDNWRQFVAFVKKMNEG  546



>emb|CAN71375.1| hypothetical protein VITISV_002992 [Vitis vinifera]
Length=570

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/482 (60%), Positives = 367/482 (76%), Gaps = 10/482 (2%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNL  359
             +RA  S+   A  ++ +E    E+  R+ G  A         VPV++M+PLD++TMG  +
Sbjct  69    MRADLSVACQAFATE-IEAAPAEREYRVGGTKAK-----GKGVPVYVMMPLDSVTMGNGV  122

Query  360   NKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVV  539
             N+ ++M AS+ AL+SAGVEGVM+D WWGLVE+D P  YNW GYA L++M ++HGLK+Q V
Sbjct  123   NRRKAMKASMQALKSAGVEGVMMDVWWGLVERDSPGAYNWGGYAELLEMAKQHGLKVQAV  182

Query  540   MSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRT  719
             MSFHQCGGNVGDSC+IPLP WV+EEI+K+PDL YTD+ GRRN EY+SLG D LPVL+GRT
Sbjct  183   MSFHQCGGNVGDSCTIPLPNWVVEEINKDPDLAYTDQWGRRNYEYVSLGSDTLPVLKGRT  242

Query  720   PVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCY  899
             PVQ YAD+MR+F++ FK  +G+ IVE+QVGMGP GE RYPSYPE +GTW+FPGIG FQCY
Sbjct  243   PVQCYADFMRAFKDNFKHLLGDTIVEIQVGMGPAGEFRYPSYPEQDGTWKFPGIGAFQCY  302

Query  900   DKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWY  1076
             DKYM +SL A+AEA GK EWG +GP DAG YN +PED  FFRR+ G W + YG+FFL WY
Sbjct  303   DKYMLSSLKAAAEAAGKPEWGSTGPTDAGHYNNWPEDARFFRREGGGWTSPYGEFFLNWY  362

Query  1077  SGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYL  1256
             S  LL+HG+RIL++A  +FQ  G K+S K++GIHWHY T+SHA EL AGYYNTR R+GY+
Sbjct  363   SQMLLDHGERILSSAKSIFQDMGVKISVKVSGIHWHYGTQSHAPELTAGYYNTRFRDGYI  422

Query  1257  PIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRY  1436
             PIA MLA+HG + NFTC+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL RY
Sbjct  423   PIAQMLARHGAILNFTCIEMRDHEQPQDALCAPEKLVRQVALATREAQVPLAGENALPRY  482

Query  1437  DSRGYEQVL-ATSRSDSG--NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRL  1607
             D   +EQ+L A+S +  G  + + AFTYLRMN +LF+P+NWR+ V FVK M EG  S + 
Sbjct  483   DETAHEQILGASSLNIDGEESDMCAFTYLRMNPDLFQPDNWRRFVAFVKKMKEGKDSHKC  542

Query  1608  PE  1613
              E
Sbjct  543   RE  544



>ref|XP_002285569.1| PREDICTED: beta-amylase 1, chloroplastic [Vitis vinifera]
Length=573

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/482 (60%), Positives = 367/482 (76%), Gaps = 10/482 (2%)
 Frame = +3

Query  180   LRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNL  359
             +RA  S+   A  ++ +E    E+  R+ G  A         VPV++M+PLD++TMG  +
Sbjct  72    MRADLSVACQAFATE-IEAAPAEREYRVGGTKAK-----GKGVPVYVMMPLDSVTMGNGV  125

Query  360   NKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVV  539
             N+ ++M AS+ AL+SAGVEGVM+D WWGLVE+D P  YNW GYA L++M ++HGLK+Q V
Sbjct  126   NRRKAMKASMQALKSAGVEGVMMDVWWGLVERDSPGTYNWGGYAELLEMAKQHGLKVQAV  185

Query  540   MSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRT  719
             MSFHQCGGNVGDSC+IPLP WV+EEI+K+PDL YTD+ GRRN EY+SLG D LPVL+GRT
Sbjct  186   MSFHQCGGNVGDSCTIPLPNWVVEEINKDPDLAYTDQWGRRNYEYVSLGSDTLPVLKGRT  245

Query  720   PVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCY  899
             PVQ YAD+MR+F++ FK  +G+ IVE+QVGMGP GE RYPSYPE +GTW+FPGIG FQCY
Sbjct  246   PVQCYADFMRAFKDNFKHLLGDTIVEIQVGMGPAGEFRYPSYPEQDGTWKFPGIGAFQCY  305

Query  900   DKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWY  1076
             DKYM +SL A+AEA GK EWG +GP DAG YN +PED  FFRR+ G W + YG+FFL WY
Sbjct  306   DKYMLSSLKAAAEAAGKPEWGSTGPTDAGHYNNWPEDARFFRREGGGWTSPYGEFFLNWY  365

Query  1077  SGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYL  1256
             S  LL+HG+RIL++A  +FQ  G K+S K++GIHWHY T+SHA EL AGYYNTR R+GY+
Sbjct  366   SQMLLDHGERILSSAKSIFQDMGVKISVKVSGIHWHYGTQSHAPELTAGYYNTRFRDGYI  425

Query  1257  PIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRY  1436
             PIA MLA+HG + NFTC+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL RY
Sbjct  426   PIAQMLARHGAILNFTCIEMRDHEQPQDALCAPEKLVRQVALATREAQVPLAGENALPRY  485

Query  1437  DSRGYEQVL-ATSRSDSG--NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRL  1607
             D   +EQ+L A+S +  G  + + AFTYLRMN +LF+P+NWR+ V FVK M EG  S + 
Sbjct  486   DETAHEQILGASSLNIDGEESDMCAFTYLRMNPDLFQPDNWRRFVAFVKKMKEGKDSHKC  545

Query  1608  PE  1613
              E
Sbjct  546   RE  547



>ref|XP_008391283.1| PREDICTED: beta-amylase 1, chloroplastic-like [Malus domestica]
Length=571

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/442 (64%), Positives = 346/442 (78%), Gaps = 6/442 (1%)
 Frame = +3

Query  285   SHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGP  464
             +H   + VPV++M+PLD++TM  ++N+ ++MNASL AL+SAGVEGVM+D WWGLVE+D P
Sbjct  98    AHDKGTGVPVYVMMPLDSVTMHNSVNRKKAMNASLQALKSAGVEGVMMDVWWGLVERDAP  157

Query  465   LKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYT  644
               YNW GYA L++M ++HGLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+ DL YT
Sbjct  158   GAYNWGGYAELLEMARKHGLKVQAVMSFHQCGGNVGDSVTIPLPKWVVEEVDKDRDLAYT  217

Query  645   DRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCG  824
             D+ G+RN EY+SLG D LPVL+GRTPVQ YAD MR+FR+ FK  +G+ IVE+QVGMGP G
Sbjct  218   DQWGKRNCEYLSLGADTLPVLKGRTPVQCYADXMRAFRDNFKHLLGDTIVEIQVGMGPAG  277

Query  825   ELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFP  1004
             ELRYPSYPESNGTW+FPGIG FQC+DKYM +SL A+AEA GK EWG +GP DAG YN +P
Sbjct  278   ELRYPSYPESNGTWQFPGIGAFQCFDKYMLSSLKAAAEAAGKPEWGSTGPTDAGHYNNWP  337

Query  1005  EDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHW  1181
             EDT FFR++ G W T YG+FFL WYS  LL+HG+RILT+A  +F+  G K+S K+AGIHW
Sbjct  338   EDTPFFRKEGGGWNTTYGEFFLGWYSQMLLDHGERILTSAKSIFEEAGVKISVKVAGIHW  397

Query  1182  HYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEG  1361
             HY TRSHA EL AGYYNTR R+GY+PIA MLA+HG +FNFTC+EM+D EQP  A C PE 
Sbjct  398   HYGTRSHAPELTAGYYNTRFRDGYIPIAQMLARHGAIFNFTCVEMRDHEQPQEAQCLPEK  457

Query  1362  LVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR-----SDSGNGLSAFTYLRMNK  1526
             LVRQV +AT+     LAGENAL RYD   + Q+L  S      +  GN + AFTYLRMN 
Sbjct  458   LVRQVAMATQKVNVPLAGENALPRYDDYAHXQILEASSLNVEGNTQGNQMCAFTYLRMNP  517

Query  1527  NLFEPENWRKLVEFVKSMSEGG  1592
             +LF+P+NWR+ V FVK M E G
Sbjct  518   HLFQPDNWRRFVAFVKKMKEKG  539



>ref|XP_004166730.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis sativus]
Length=577

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/434 (65%), Positives = 341/434 (79%), Gaps = 6/434 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TMG  +N+ ++MNASL AL+SAGVEG+M+D WWGLVE+D P  YNW G
Sbjct  110   VPVYVMMPLDSVTMGNTVNRRKAMNASLQALKSAGVEGIMMDVWWGLVERDSPGSYNWGG  169

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++HGLK+Q VMSFHQCGGNVGDS +IPLP W +EE+ K+PDL YTD+ GRRN
Sbjct  170   YTELLEMAKKHGLKVQAVMSFHQCGGNVGDSVTIPLPKWAVEEMDKDPDLAYTDQWGRRN  229

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLGCD LPVL+GRTPVQ YAD+MR+F++ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  230   YEYISLGCDTLPVLKGRTPVQCYADFMRAFKDNFKHLLGDTIVEIQVGMGPAGELRYPSY  289

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTW+FPGIG FQC+DKYM +SL A+AEA GK EWG +GP DAG Y+ +PED  FFR
Sbjct  290   PEQNGTWKFPGIGAFQCFDKYMLSSLKAAAEASGKPEWGSTGPTDAGGYHSWPEDNPFFR  349

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W + YG+FFL WYS  LL+HGDRILTAA  +F+ TG K+S KIAGIHWHY  RSH
Sbjct  350   KEGGGWNSTYGEFFLTWYSQMLLDHGDRILTAATSIFEKTGVKISVKIAGIHWHYGHRSH  409

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LVRQV  
Sbjct  410   APELTAGYYNTRYRDGYLPIARMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVAQ  469

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSR----SDSGNG-LSAFTYLRMNKNLFEPEN  1547
             AT  A   LAGENAL RYD   +EQ+L  S      DS    + AFTYLRMN +LFE EN
Sbjct  470   ATHKAQVPLAGENALPRYDEFAHEQILQASSFVGDEDSKESEMCAFTYLRMNPHLFEAEN  529

Query  1548  WRKLVEFVKSMSEG  1589
             WR+ V FVK M EG
Sbjct  530   WRRFVAFVKKMKEG  543



>gb|EAZ17007.1| hypothetical protein OsJ_32492 [Oryza sativa Japonica Group]
Length=502

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/406 (72%), Positives = 337/406 (83%), Gaps = 3/406 (1%)
 Frame = +3

Query  321   MLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALV  500
             MLPL+T+  GG + + R++ ASL ALRS GVEGVMVD WWG+VE++GP +Y+WEGY  LV
Sbjct  1     MLPLETVGAGGKVARARALAASLAALRSGGVEGVMVDVWWGVVEREGPRRYDWEGYGELV  60

Query  501   KMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYIS  680
             +MV+  GL+LQ+VMSFHQCGGNVGDSC+IPLP WVLEE+  NPD+VYTDRSGRRNPEYIS
Sbjct  61    RMVERAGLRLQMVMSFHQCGGNVGDSCNIPLPGWVLEEMKSNPDIVYTDRSGRRNPEYIS  120

Query  681   LGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNG  860
             LGCD LPVL+GRTP+QVY+DYMRSFR+ F  Y+GN IVE+QVG+GPCGELRYPSYPE+NG
Sbjct  121   LGCDTLPVLKGRTPIQVYSDYMRSFRDTFCGYLGNTIVEIQVGLGPCGELRYPSYPEANG  180

Query  861   TWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTW  1040
             TWRFPGIGEFQCYDKYMRASL  +A A G  EWGR GPHDAG+Y QFPE+TGFFRRDGTW
Sbjct  181   TWRFPGIGEFQCYDKYMRASLQQAAAAAGHEEWGRGGPHDAGEYKQFPEETGFFRRDGTW  240

Query  1041  KTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNA  1220
              TEYG FFL WYSG LLEHGDR+L AA  VF+GTGA LS K+AGIHWHY TRSHAAEL A
Sbjct  241   CTEYGDFFLGWYSGMLLEHGDRVLAAAEAVFRGTGAALSAKVAGIHWHYRTRSHAAELTA  300

Query  1221  GYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDag  1400
             GYYNTR R+GY P+A MLA+ G V NFTCMEM+D +QP  A CSPE LVRQV+ A + A 
Sbjct  301   GYYNTRRRDGYAPVAAMLARRGAVLNFTCMEMRDEQQPEHAGCSPEQLVRQVRSAARAAR  360

Query  1401  aelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFE  1538
               LAGENALERYD   + QV+AT+ S    GL AFTYLRMNK LF+
Sbjct  361   VGLAGENALERYDEAAFAQVVATAAS---AGLGAFTYLRMNKKLFD  403



>ref|XP_009400488.1| PREDICTED: beta-amylase 1, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=590

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/430 (67%), Positives = 341/430 (79%), Gaps = 2/430 (0%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++MLPLDT+  GG LN+ ++MNASLMAL+SAGVEGVMVD WWGLVE++ P +Y W G
Sbjct  125   VPVYVMLPLDTVRPGGGLNRRKAMNASLMALKSAGVEGVMVDVWWGLVERERPGEYEWGG  184

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M +  GLK+Q VMSFHQCGGNVGDSC+IPLP WVLEE+ K+PDL YTD+ GRRN
Sbjct  185   YDDLMEMARRIGLKVQAVMSFHQCGGNVGDSCTIPLPQWVLEEMDKDPDLAYTDQWGRRN  244

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLGCD LPVL+GRTP+Q YAD+MR+FR+ F+  +G+ IVE+QVGMGP GELRYPSY
Sbjct  245   YEYVSLGCDMLPVLKGRTPIQCYADFMRAFRDHFRHLLGSTIVEIQVGMGPAGELRYPSY  304

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE +GTW+FPGIG FQCYDKYM +SL A+A   GK EWG  GP DAG YN +PEDT FFR
Sbjct  305   PELHGTWKFPGIGAFQCYDKYMLSSLKAAALEAGKPEWGHGGPTDAGGYNNWPEDTTFFR  364

Query  1026  RDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHA  1205
              DG W   YG+FFL WYS  LLEHG+RIL++A  VF  TG K+S K+AGIHWHY TRSHA
Sbjct  365   HDGGWNGPYGEFFLSWYSQMLLEHGERILSSATSVFDSTGVKISVKVAGIHWHYGTRSHA  424

Query  1206  AELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVA  1385
              EL AGYYNTR R+GYLPIA ML +HG VFNFTC+EM+DGEQP  A C PEGLV QV  A
Sbjct  425   PELTAGYYNTRFRDGYLPIARMLGRHGAVFNFTCVEMRDGEQPAEACCRPEGLVNQVAAA  484

Query  1386  TKDagaelagenaleRYDSRGYEQVLATSRSDSG--NGLSAFTYLRMNKNLFEPENWRKL  1559
              K+AG  LAGENAL RYD   +EQ++ T+ ++ G    ++AFTYLRM   LF+PENWR+ 
Sbjct  485   AKEAGVALAGENALPRYDEMAHEQIVNTATAEEGGEEKMAAFTYLRMGPELFQPENWRRF  544

Query  1560  VEFVKSMSEG  1589
             V FVK M+EG
Sbjct  545   VAFVKKMAEG  554



>ref|XP_010666969.1| PREDICTED: beta-amylase 1, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=579

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/485 (59%), Positives = 361/485 (74%), Gaps = 9/485 (2%)
 Frame = +3

Query  168   CHHRLRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITM  347
             C   LRA  +    A  +   +  +  ++E  + +AA    +    VPV++M+PLD++ M
Sbjct  69    CRSPLRADLTAACQAFTTTMSQSDIATEKE--YAVAAKDKEAKKG-VPVYVMMPLDSVKM  125

Query  348   GGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLK  527
                +N+ ++MNASL+AL+SAGVEG+M+D WWGLVE+D P +YNW GY  L++M  +HGLK
Sbjct  126   DNTINRRKAMNASLLALKSAGVEGIMMDVWWGLVERDNPGEYNWGGYVELLEMAHKHGLK  185

Query  528   LQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVL  707
             +Q VMSFHQCGGNVGDS +IPLP W +EE+ K+PDL YTD+ GRRN EYISLGCD LPVL
Sbjct  186   VQAVMSFHQCGGNVGDSVTIPLPKWAVEEMHKDPDLAYTDQWGRRNFEYISLGCDTLPVL  245

Query  708   RGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGE  887
             +GRTPVQ YAD+MR+FR++F+  +G  IVE+QVGMGP GELRYPSYPE +GTW+FPGIG 
Sbjct  246   KGRTPVQCYADFMRAFRDQFEHLLGETIVEIQVGMGPAGELRYPSYPEQDGTWKFPGIGA  305

Query  888   FQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFF  1064
             FQC+DKYM +SL A+AEA GK EWG SGP DAG+YN +PEDT FF ++ G W + YG+FF
Sbjct  306   FQCFDKYMDSSLKAAAEAAGKPEWGHSGPTDAGEYNNWPEDTQFFCKEGGGWSSSYGEFF  365

Query  1065  LEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRER  1244
             L WYS  LL+HG+RIL+AA  +F+  G K+S KIAGIHWHY TRSHA EL AGYYNTR R
Sbjct  366   LTWYSQMLLDHGERILSAATEIFKDKGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFR  425

Query  1245  NGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagena  1424
             +GYLPIA MLA++G +FNFTC+EM+D EQP  A C+PE LVRQV  AT+ A   LAGENA
Sbjct  426   DGYLPIAQMLARYGAIFNFTCIEMRDQEQPQDALCAPEKLVRQVVSATQRAQVPLAGENA  485

Query  1425  leRYDSRGYEQVLATS--RSDSGNG---LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
             L RYD   +EQ+L  S    D  +G   + AFTYLRMN +LF+ +NWRK V FVK M EG
Sbjct  486   LPRYDEHAHEQILNASALNVDENSGEREMCAFTYLRMNPDLFQADNWRKFVAFVKKMKEG  545

Query  1590  GRSTR  1604
                 R
Sbjct  546   KDVNR  550



>gb|EPS61951.1| beta-amylase [Genlisea aurea]
Length=560

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/438 (64%), Positives = 345/438 (79%), Gaps = 4/438 (1%)
 Frame = +3

Query  279   NQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKD  458
             ++     S VPVF+M+PLD++T    +N+ ++MNASL AL+SAGVEG+M+D WWGLVE +
Sbjct  92    DEQQERRSGVPVFVMMPLDSVTWNHAVNRKKAMNASLQALKSAGVEGIMMDVWWGLVEGE  151

Query  459   GPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLV  638
              P +YNW GY+ L++M ++HGLK+Q VMSFHQCGGNVGDSC+IPLP W +EEI K+PDL 
Sbjct  152   KPGEYNWGGYSELLEMAKKHGLKVQAVMSFHQCGGNVGDSCTIPLPKWAVEEIDKDPDLA  211

Query  639   YTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGP  818
             YTD+ GRRN EY+SLGCD LPVL+GRTPVQ Y+D+MR+FR+ F   +G+ IVE+QVGMGP
Sbjct  212   YTDQWGRRNYEYVSLGCDTLPVLKGRTPVQCYSDFMRAFRDAFSHLLGDTIVEIQVGMGP  271

Query  819   CGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQ  998
              GELRYPSYPE NGTW+FPGIG FQC+DKYMR SL A+AE+ GK EWG SGP DAGQYN 
Sbjct  272   AGELRYPSYPEQNGTWKFPGIGAFQCFDKYMRHSLRAAAESIGKPEWGHSGPTDAGQYNN  331

Query  999   FPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGI  1175
             +PEDT FF++D G W ++YG+FFL WYS  LL+HGDRIL +A  +++    K+S K+AGI
Sbjct  332   WPEDTNFFKKDGGGWNSQYGEFFLSWYSQMLLDHGDRILQSAMALYENRAVKISVKVAGI  391

Query  1176  HWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSP  1355
             HWHY TRSHA EL AGYYNTR R+GYLPIA ML++HG VFNFTC+EMKD EQP  A C+P
Sbjct  392   HWHYGTRSHAPELTAGYYNTRFRDGYLPIAKMLSRHGAVFNFTCIEMKDNEQPQDALCAP  451

Query  1356  EGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLF  1535
             E LV+QV  A + A   LAGENAL RYD   ++Q+L T+  D    + AFTYLRMN +LF
Sbjct  452   EKLVKQVGEACRRANVPLAGENALPRYDGGAHDQILRTAALDE---MCAFTYLRMNPDLF  508

Query  1536  EPENWRKLVEFVKSMSEG  1589
             +PENWR+ V FVK M EG
Sbjct  509   QPENWRRFVAFVKRMGEG  526



>ref|XP_004134029.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis sativus]
 gb|KGN56795.1| hypothetical protein Csa_3G133950 [Cucumis sativus]
Length=577

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/434 (65%), Positives = 340/434 (78%), Gaps = 6/434 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TM   +N+ ++MNASL AL+SAGVEG+M+D WWGLVE+D P  YNW G
Sbjct  110   VPVYVMMPLDSVTMENTVNRRKAMNASLQALKSAGVEGIMMDVWWGLVERDSPGSYNWGG  169

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++HGLK+Q VMSFHQCGGNVGDS +IPLP W +EE+ K+PDL YTD+ GRRN
Sbjct  170   YTELLEMAKKHGLKVQAVMSFHQCGGNVGDSVTIPLPKWAVEEMDKDPDLAYTDQWGRRN  229

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLGCD LPVL+GRTPVQ YAD+MR+F++ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  230   YEYISLGCDTLPVLKGRTPVQCYADFMRAFKDNFKHLLGDTIVEIQVGMGPAGELRYPSY  289

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTW+FPGIG FQC+DKYM +SL A+AEA GK EWG +GP DAG Y+ +PED  FFR
Sbjct  290   PEQNGTWKFPGIGAFQCFDKYMLSSLKAAAEASGKPEWGSTGPTDAGGYHSWPEDNPFFR  349

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W + YG+FFL WYS  LL+HGDRILTAA  +F+ TG K+S KIAGIHWHY  RSH
Sbjct  350   KEGGGWNSTYGEFFLTWYSQMLLDHGDRILTAATSIFEKTGVKISVKIAGIHWHYGHRSH  409

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LVRQV  
Sbjct  410   APELTAGYYNTRYRDGYLPIARMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVAQ  469

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSR----SDSGNG-LSAFTYLRMNKNLFEPEN  1547
             AT  A   LAGENAL RYD   +EQ+L  S      DS    + AFTYLRMN +LFE EN
Sbjct  470   ATHKAQVPLAGENALPRYDEFAHEQILQASSFVGDEDSKESEMCAFTYLRMNPHLFEAEN  529

Query  1548  WRKLVEFVKSMSEG  1589
             WR+ V FVK M EG
Sbjct  530   WRRFVAFVKKMKEG  543



>ref|XP_004985750.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X2 [Setaria 
italica]
Length=563

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/463 (63%), Positives = 353/463 (76%), Gaps = 4/463 (1%)
 Frame = +3

Query  216   LSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGN-LNKPRSMNASLM  392
             L+   +  V    E  H   A +  S +  VPVF+M+PLDT+   GN LN+ R++ ASL 
Sbjct  70    LAMACQALVEAAPEAEHADVAAELKSKAG-VPVFVMMPLDTVRKDGNSLNRRRAVEASLA  128

Query  393   ALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVG  572
             AL+SAGVEG+MVD WWG+ E +GP +YN+ GY  L++M +++GLK+Q VMSFHQCGGNVG
Sbjct  129   ALKSAGVEGIMVDVWWGIAEAEGPGQYNFNGYMELMEMARKNGLKVQAVMSFHQCGGNVG  188

Query  573   DSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRS  752
             DS +IPLP WVLEE+ K+ DL YTDRSGRRN EY+SLGCD LPVL+GRTP+Q YAD+MR+
Sbjct  189   DSVTIPLPKWVLEEMDKDQDLAYTDRSGRRNYEYVSLGCDALPVLKGRTPIQCYADFMRA  248

Query  753   FRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAAS  932
             FR+ F  YMGN IVE+QVGMGP GELRYPSYPESNGTW FPGIGEFQCYD+YM +SL A+
Sbjct  249   FRDHFATYMGNTIVEIQVGMGPAGELRYPSYPESNGTWSFPGIGEFQCYDRYMLSSLKAA  308

Query  933   AEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRIL  1112
             AEA GK EWG +GP D+G Y  +PEDT FFRR+G W TEYGQFF+ WYS  LLEHG+RIL
Sbjct  309   AEAVGKPEWGNAGPGDSGSYKDWPEDTPFFRREGGWNTEYGQFFMSWYSQMLLEHGERIL  368

Query  1113  TAAAGVFQGT-GAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGV  1289
             +AA GVF  + G K+S K+AGIHWHY TRSHAAEL AGYYNTR  +GY PIA ML +HG 
Sbjct  369   SAATGVFTASPGVKISVKVAGIHWHYGTRSHAAELTAGYYNTRHHDGYQPIARMLGRHGA  428

Query  1290  VFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLAT  1469
             V NFTC+EM+D EQP  A C PE LV+QV +A +DAG  LAGENAL RYD   ++QV+AT
Sbjct  429   VLNFTCVEMRDHEQPQDAQCRPEALVQQVALAARDAGVGLAGENALPRYDETAHDQVVAT  488

Query  1470  SRSDSGNG-LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGR  1595
             +   +    + AFTYLRM  +LF+P+NWR+   FVK MS  G+
Sbjct  489   AAEKAEEERMVAFTYLRMGPDLFQPDNWRRFAAFVKRMSGAGK  531



>ref|XP_008224054.1| PREDICTED: beta-amylase 1, chloroplastic [Prunus mume]
Length=569

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/435 (64%), Positives = 343/435 (79%), Gaps = 6/435 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TM  ++N+ ++MNASL AL+SAGVEGVM+D WWGLVE++ P  YNW G
Sbjct  104   VPVYVMMPLDSVTMNNSVNRKKAMNASLQALKSAGVEGVMMDVWWGLVEREAPGAYNWGG  163

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             YA L++M ++HGLK+Q VMSFH+CGGNVGDS +IPLP WV+EE+ K+PDL YTD+ GRRN
Sbjct  164   YAELLEMAKKHGLKVQAVMSFHKCGGNVGDSVTIPLPKWVVEEVDKDPDLAYTDQWGRRN  223

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLG D LPVL+GRTPVQ YAD+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  224   CEYLSLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  283

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTWRFPGIG FQC+DKYM + L A+AEA GK EWG +GP DAG+YN++PEDT FFR
Sbjct  284   PEQNGTWRFPGIGAFQCFDKYMLSGLKAAAEAAGKPEWGSTGPTDAGEYNKWPEDTPFFR  343

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             +D G W + YG+FFL WYS  LL+HG+RILT+A  +F+    K+S KIAGIHWHY TRSH
Sbjct  344   KDGGGWNSTYGEFFLSWYSQMLLDHGERILTSAKSIFENHSVKISVKIAGIHWHYGTRSH  403

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GY+PIA MLA+ G +FNFTC+EM+D EQP  A C PE LVRQV +
Sbjct  404   APELTAGYYNTRFRDGYIPIAQMLARKGAIFNFTCIEMRDHEQPQEAQCLPEKLVRQVAM  463

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPEN  1547
             AT  A   LAGENAL RYD   ++Q+L  S      +  GN + AFTYLRMN +LF+P+N
Sbjct  464   ATLKANVPLAGENALPRYDDYAHKQILEASSLNIEGNTEGNQMCAFTYLRMNPHLFQPDN  523

Query  1548  WRKLVEFVKSMSEGG  1592
             WR  V FVK M E G
Sbjct  524   WRHFVAFVKKMKEKG  538



>ref|XP_010263969.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X1 [Nelumbo 
nucifera]
Length=576

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/449 (63%), Positives = 345/449 (77%), Gaps = 16/449 (4%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TM   +NK ++MNASLMAL+SAGVEGVMVD WWGLVE+D P  YNW G
Sbjct  99    VPVYVMMPLDSVTMSNGVNKRKAMNASLMALKSAGVEGVMVDVWWGLVERDAPGVYNWGG  158

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M +EHGLK+Q VMSFHQCGGNVGDSC+IPLP WV+EEI ++PDL Y D+ G RN
Sbjct  159   YTELLQMAREHGLKVQAVMSFHQCGGNVGDSCTIPLPKWVVEEIDRDPDLAYKDQWGNRN  218

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV--------EVQVGMGPC  821
              E++SLGCD LPVL+GRTPVQ Y D+M++FR+ FK  +G+ IV        E+QVGMGP 
Sbjct  219   YEFVSLGCDNLPVLKGRTPVQCYTDFMQTFRDNFKHLLGDTIVLGIGLFVQEIQVGMGPA  278

Query  822   GELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQF  1001
             GELRYPSYPE NGTWRFPGIG FQC+DKYM  SL A+AEA GK EWG SGP DAG YN +
Sbjct  279   GELRYPSYPEQNGTWRFPGIGAFQCFDKYMVNSLKAAAEAAGKPEWGHSGPTDAGHYNNW  338

Query  1002  PEDTGFFRRDGT-WKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIH  1178
             PEDT FFRRDG  W + YG+FFL WYS  LL+H + +L++A  +FQGTG K+S KIAGIH
Sbjct  339   PEDTQFFRRDGAGWNSPYGEFFLTWYSQLLLDHCEMMLSSADSIFQGTGVKISVKIAGIH  398

Query  1179  WHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPE  1358
             WHY +RSHA EL AGYYNTR R+GYLPIA +LA+HG +FNFTC+EM+D EQP  A C+PE
Sbjct  399   WHYGSRSHAPELTAGYYNTRFRDGYLPIARLLARHGAIFNFTCIEMRDYEQPQDARCAPE  458

Query  1359  GLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-------LSAFTYLR  1517
              LVRQV +AT +AG  LAGENAL RYD   +EQ+L  +  D  +G       + AFTYLR
Sbjct  459   KLVRQVALATLEAGVPLAGENALPRYDEMAHEQILRAASLDLDDGNDSDGREMCAFTYLR  518

Query  1518  MNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
             M+ +LF+ +NW + V FVK M EG R  R
Sbjct  519   MSPDLFQADNWTRFVAFVKKMKEGKRGNR  547



>ref|XP_007223114.1| hypothetical protein PRUPE_ppa005431mg [Prunus persica]
 gb|EMJ24313.1| hypothetical protein PRUPE_ppa005431mg [Prunus persica]
Length=461

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/430 (65%), Positives = 341/430 (79%), Gaps = 6/430 (1%)
 Frame = +3

Query  321   MLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALV  500
             M+PLD++TM  ++N+ ++MNASL AL+SAGVEGVM+D WWGLVE++ P  YNW GYA L+
Sbjct  1     MMPLDSVTMNNSVNRKKAMNASLQALKSAGVEGVMMDVWWGLVEREAPGGYNWGGYAELL  60

Query  501   KMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYIS  680
             +M ++HGLK+Q VMSFH+CGGNVGDS +IPLP WV+EE+ K+PDL YTD+ GRRN EY+S
Sbjct  61    EMAKKHGLKVQAVMSFHKCGGNVGDSVTIPLPKWVVEEVDKDPDLAYTDQWGRRNCEYLS  120

Query  681   LGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNG  860
             LG D LPVL+GRTPVQ YAD+MR+FR+ FK ++G+ IVE+QVGMGP GELRYPSYPE NG
Sbjct  121   LGADTLPVLKGRTPVQCYADFMRAFRDNFKHFLGDTIVEIQVGMGPAGELRYPSYPEQNG  180

Query  861   TWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GT  1037
             TWRFPGIG FQC+DKYM + L A+AEA GK EWG +GP DAG+YN++PEDT FFR+D G 
Sbjct  181   TWRFPGIGAFQCFDKYMLSGLKAAAEAAGKPEWGSTGPTDAGEYNKWPEDTPFFRKDGGG  240

Query  1038  WKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELN  1217
             W + YG+FFL WYS  LL+HG+RILT+A  +F+  G K+S KIAGIHWHY TRSHA EL 
Sbjct  241   WNSTYGEFFLGWYSQMLLDHGERILTSAKSIFENHGVKISVKIAGIHWHYGTRSHAPELT  300

Query  1218  AGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDa  1397
             AGYYNTR R+GY+PIA MLA+HG +FNFTC+EM+D EQP  A C PE LVRQV +AT  A
Sbjct  301   AGYYNTRFRDGYIPIAQMLARHGAIFNFTCIEMRDHEQPQEAQCLPEKLVRQVAMATLKA  360

Query  1398  gaelagenaleRYDSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPENWRKLV  1562
                LAGENAL RYD   ++Q+L  S      +  GN + AFTYLRMN +LF+P+NWR  V
Sbjct  361   NVPLAGENALPRYDDYAHKQILEASSLNIEGNTEGNQMCAFTYLRMNPHLFQPDNWRHFV  420

Query  1563  EFVKSMSEGG  1592
              FVK M E G
Sbjct  421   AFVKKMKEKG  430



>ref|XP_003534086.1| PREDICTED: beta-amylase 1, chloroplastic [Glycine max]
Length=569

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/434 (66%), Positives = 347/434 (80%), Gaps = 6/434 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+M+PLD++T G  +N+ ++MNA++ AL+SAGVEGVM+D WWGLVE++ P +YNW G
Sbjct  103   VPVFVMMPLDSVTAGNAVNRKKAMNAAMAALKSAGVEGVMMDVWWGLVEREKPGEYNWGG  162

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++HGLK+Q VMSFHQCGGNVGDSC+IPLP WV+EEI  + DL YTD+ GRRN
Sbjct  163   YVELMEMAKKHGLKVQAVMSFHQCGGNVGDSCTIPLPKWVVEEIDNDHDLAYTDQWGRRN  222

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLGCD LPVL+GR+PVQ YAD+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  223   YEYISLGCDTLPVLKGRSPVQCYADFMRAFRDTFKHLLGDTIVEIQVGMGPAGELRYPSY  282

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTW+FPGIG FQCYDKYM +SL A+AEAHGK EWG +GP DAG YN +PEDT FFR
Sbjct  283   PEQNGTWKFPGIGAFQCYDKYMLSSLKAAAEAHGKPEWGSTGPTDAGHYNNWPEDTQFFR  342

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W   YG+FFL WYS  LLEHGDRIL++A  +F  TG K+S K+AGIHWHY TRSH
Sbjct  343   KEGGGWDGPYGEFFLTWYSQMLLEHGDRILSSATSIFDNTGVKISVKVAGIHWHYGTRSH  402

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+HG +FNFTC+EM+D EQP  A C+PE LV+QV +
Sbjct  403   APELTAGYYNTRFRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQEALCAPEKLVKQVAL  462

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSRSD----SGN-GLSAFTYLRMNKNLFEPEN  1547
             AT+ A   LAGENAL RYD   +EQ++  S+ D    SG+  + AFTYLRMN +LFEP N
Sbjct  463   ATQKAQVPLAGENALPRYDEYAHEQIIRASQLDVDGESGDREMCAFTYLRMNPHLFEPNN  522

Query  1548  WRKLVEFVKSMSEG  1589
             WRK V FVK M EG
Sbjct  523   WRKFVGFVKKMKEG  536



>ref|XP_009777267.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana sylvestris]
Length=565

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/533 (55%), Positives = 376/533 (71%), Gaps = 23/533 (4%)
 Frame = +3

Query  54    MALTLRSSTSFIN----LKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQ------  203
             MA++LR     ++      E + V       + +  S  +R+    LR   SMQ      
Sbjct  1     MAMSLRHQIGALSGTAISSETESVSGEAPAKTTLTTSALRRASVTNLRV--SMQNSGTEA  58

Query  204   EAALLSQPLE----GRVNEKRERLHGLAANQSHSSSSR-VPVFIMLPLDTITMGGNLNKP  368
             +  L S PL       + E R+ L   A  +      + VPV++M+PLD++ M   +N+ 
Sbjct  59    DKVLTSPPLSPVTCHALAEARDALAETAEVEKEDKLGKGVPVYVMMPLDSVKMDNTVNRK  118

Query  369   RSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSF  548
             ++M ASL AL+SAGVEG+M+D WWGLVE+D P +YNW GY  L++M ++ GLK+Q VMSF
Sbjct  119   KAMKASLQALKSAGVEGIMMDVWWGLVERDAPGEYNWGGYTELLEMAKKQGLKVQAVMSF  178

Query  549   HQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQ  728
             HQCGGNVGDSCSIPLP WV+EEI K+PDL YTD+ GRRN EYISLGCD LPVL+GRTPV+
Sbjct  179   HQCGGNVGDSCSIPLPGWVVEEIDKDPDLAYTDQWGRRNHEYISLGCDTLPVLKGRTPVE  238

Query  729   VYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKY  908
              Y+D+MR+FR+RF+  +G+ IVE+QVGMGP GELRYPSYPE +G W+FPGIG FQCYDKY
Sbjct  239   CYSDFMRAFRDRFENLLGDTIVEIQVGMGPAGELRYPSYPEKDGIWKFPGIGAFQCYDKY  298

Query  909   MRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGK  1085
             M +SL  +AE  GK EWG +GP DAG+YN +PEDT FF+++ G W   YGQFFL WYS  
Sbjct  299   MLSSLKVAAEEAGKPEWGYTGPTDAGEYNNWPEDTTFFKKESGGWDCPYGQFFLTWYSQM  358

Query  1086  LLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIA  1265
             LL+HG+RIL +   +F+  G K+S K+AGIHWHY TRSHA EL AGYYNTR R+GYLPIA
Sbjct  359   LLDHGERILQSTKAIFENKGVKISVKVAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPIA  418

Query  1266  HMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSR  1445
              MLA+H  +FNFTC+EM+D EQP  A C+PE LVRQV +AT++A   LAGENAL RYD  
Sbjct  419   QMLARHDAIFNFTCIEMRDHEQPQDARCAPEKLVRQVALATREAQVPLAGENALPRYDEF  478

Query  1446  GYEQVLATSR----SDSGN-GLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
              +EQ+L  S     S S N  + AFTYLRMN +LF P+NW++ + FVK M++G
Sbjct  479   AHEQILQASSLNIDSQSDNRQMCAFTYLRMNPDLFHPDNWKRFIAFVKKMNDG  531



>ref|XP_004296549.1| PREDICTED: beta-amylase 1, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=578

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/480 (59%), Positives = 357/480 (74%), Gaps = 22/480 (5%)
 Frame = +3

Query  192   SSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPR  371
             + ++ A +L   L G V    E+++G            VPVF+M+PLD++TM   +N+ +
Sbjct  89    TEVEAAPVLEHELRGHV----EKING------------VPVFVMMPLDSVTMNHTVNRKK  132

Query  372   SMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFH  551
             +MNASL AL+SAGVEG+M+D WWGLVE+D P  YNW GY  L++M ++HGLK+Q VMSFH
Sbjct  133   AMNASLQALKSAGVEGIMMDVWWGLVERDAPGAYNWGGYNELLEMAKKHGLKVQAVMSFH  192

Query  552   QCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQV  731
             QCGGNVGDSC+IPLP WV+EE++ +PDL YTD+ G+RN EY+SLG D LPVL+GRTPVQ 
Sbjct  193   QCGGNVGDSCTIPLPNWVVEEVNNDPDLAYTDQWGKRNYEYLSLGVDTLPVLKGRTPVQC  252

Query  732   YADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM  911
             YAD+MR+FR+ FK  +G+ IVEVQVGMGP GELRYPSYPE +GTW FPGIG FQC+DKYM
Sbjct  253   YADFMRAFRDNFKHLLGDTIVEVQVGMGPAGELRYPSYPEGDGTWSFPGIGAFQCFDKYM  312

Query  912   RASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKL  1088
              +SL A  E+ GK EWG +GP DAG YN +PEDT FFR++ G W + YG+FFL WYS  L
Sbjct  313   LSSLKAYCESEGKPEWGSTGPTDAGHYNNWPEDTPFFRKEGGGWNSTYGEFFLGWYSQML  372

Query  1089  LEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAH  1268
             L+HG+RIL++A  +++  G K+S K+AGIHWHY TRSHA EL AGYYNTR R+GYLPIA 
Sbjct  373   LDHGERILSSAKAIYENEGVKISVKVAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPIAQ  432

Query  1269  MLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRG  1448
             M A+HG +FNFTC+EM D EQP  A CSPEGLVRQV +AT+ AG  LAGENAL RYD   
Sbjct  433   MFARHGAIFNFTCIEMHDHEQPQDAQCSPEGLVRQVALATQKAGVPLAGENALPRYDDYA  492

Query  1449  YEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPE  1613
             +EQ+L  S      +  G  + AFTYLRMN  LF+ +NWR+ V FVK M EG  + +  E
Sbjct  493   HEQILQASALNIKGNTEGKQMCAFTYLRMNPQLFQADNWRRFVSFVKKMKEGKNTHKCRE  552



>ref|XP_011073736.1| PREDICTED: beta-amylase 1, chloroplastic-like [Sesamum indicum]
Length=583

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/493 (59%), Positives = 365/493 (74%), Gaps = 7/493 (1%)
 Frame = +3

Query  195   SMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRS  374
             S+   AL+S P+       RE + G  A +     + VPV++M+PLD++T    +N+ ++
Sbjct  80    SLAAEALMSAPISTGDVPDREYIAGGNA-RGEEKKNGVPVYVMMPLDSVTWNHTVNRKKA  138

Query  375   MNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQ  554
             MNASL ALRSAGVEG+M+D WWGLVE + P +YNW GY+ L++M ++HGLK+Q VMSFHQ
Sbjct  139   MNASLQALRSAGVEGIMMDVWWGLVEGEKPGEYNWAGYSELLEMAKKHGLKVQAVMSFHQ  198

Query  555   CGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVY  734
             CGGNVGDSC+IPLP WV+EEI+K+ DL YTD+ GRRN EYISLGCD LP L+GRTPVQ Y
Sbjct  199   CGGNVGDSCTIPLPNWVVEEINKDHDLAYTDQWGRRNYEYISLGCDTLPALKGRTPVQCY  258

Query  735   ADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMR  914
             +D+MR+F   F+  +G+ IVE+QVGMGP GELRYPSYPE NGTWRFPGIG FQCYDKYM 
Sbjct  259   SDFMRAFSNEFEHLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWRFPGIGAFQCYDKYML  318

Query  915   ASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLL  1091
             ++L ++AEA GK EWG +GP DAG YN +PEDT FF+++ G W + YGQFFL WYS  LL
Sbjct  319   SNLKSAAEAIGKPEWGATGPTDAGNYNSWPEDTNFFKKEGGGWNSPYGQFFLSWYSQMLL  378

Query  1092  EHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHM  1271
              HG+RIL +A  +F+    KLS KIAGIHWHY TRSHA EL AGYYNTR R+GY PIA M
Sbjct  379   NHGERILQSAKTIFKNKSVKLSAKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYRPIAQM  438

Query  1272  LAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGY  1451
             LA++G +FNFTC+EM+D EQP  A C+PE LVRQV +AT++AG  LAGENAL RYD   +
Sbjct  439   LARNGAIFNFTCIEMRDHEQPQDALCAPEKLVRQVALATQEAGVPLAGENALPRYDGCAH  498

Query  1452  EQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPEC  1616
             EQ+L  S      + +G  + AFTYLRMN +LF+P+NWR+ V+FVK M EG    R  E 
Sbjct  499   EQILQASALNVEGNSTGREMCAFTYLRMNPDLFQPDNWRRFVDFVKKMREGKDVQRCWEQ  558

Query  1617  DSSRTDLYVGLIK  1655
                  + +V + +
Sbjct  559   VEREAEHFVHVTR  571



>ref|XP_008342553.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 1, chloroplastic 
[Malus domestica]
Length=571

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/435 (63%), Positives = 342/435 (79%), Gaps = 6/435 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++TM  ++N+ ++MNASL AL+SAG EGVM+D WWGLVE++ P  YNW G
Sbjct  105   VPVYVMMPLDSVTMNNSVNRKKAMNASLQALKSAGAEGVMMDVWWGLVEREVPGAYNWGG  164

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             YA L++M ++HGLK+Q VMSFH+CGGNVGDS +IPLP WV+EE+ K+PDL YTD+ GR+N
Sbjct  165   YAELLEMAKKHGLKVQAVMSFHRCGGNVGDSVTIPLPKWVVEEVEKDPDLAYTDQWGRKN  224

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLG D LPVL+GRTPVQ YAD+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  225   CEYLSLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  284

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PESNGTW+FPGIG FQC+DKY+   L A+AEA GK EWG +GP DAG YN +PEDT FFR
Sbjct  285   PESNGTWKFPGIGAFQCFDKYILGGLKAAAEAAGKPEWGSTGPTDAGHYNNWPEDTPFFR  344

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             +D G W + YG+FFL WYS  LL+HG+RILT+A  +F+  G K+S K+AGIHWHY TRSH
Sbjct  345   KDGGGWNSTYGEFFLGWYSQMLLDHGERILTSAKSIFEEAGVKISVKVAGIHWHYGTRSH  404

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GY+PIA MLA+HG +FNFTC+EM D EQP  A C PE LVRQV +
Sbjct  405   APELTAGYYNTRFRDGYVPIAQMLARHGAIFNFTCVEMHDHEQPQDAQCLPEKLVRQVAM  464

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNLFEPEN  1547
             AT+     LAGENAL RYD   ++Q+L  S      +  GN + AFTYLRMN +LF+P+N
Sbjct  465   ATQKTNVPLAGENALPRYDDYAHKQILEASSLKVEGNTEGNQMCAFTYLRMNPHLFQPDN  524

Query  1548  WRKLVEFVKSMSEGG  1592
             WR+ V FVK M E G
Sbjct  525   WRRFVGFVKKMKEKG  539



>ref|XP_002968794.1| hypothetical protein SELMODRAFT_145994 [Selaginella moellendorffii]
 gb|EFJ29910.1| hypothetical protein SELMODRAFT_145994 [Selaginella moellendorffii]
Length=464

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/452 (62%), Positives = 345/452 (76%), Gaps = 11/452 (2%)
 Frame = +3

Query  321   MLPLDTITMGGN-LNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAAL  497
             MLPLD+I  G N +N+ R+MNAS  AL+SAGVEGVMVD WWG+VEKDGP  YNW GY  L
Sbjct  1     MLPLDSINSGNNQVNRARAMNASFQALKSAGVEGVMVDVWWGIVEKDGPCNYNWSGYREL  60

Query  498   VKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYI  677
             ++M ++HGLK+Q VMSFHQCGGNVGDS  IPLP WV+EE   NPD+VYTDR G RN EY+
Sbjct  61    LEMAKKHGLKVQAVMSFHQCGGNVGDSAFIPLPWWVVEEAKNNPDMVYTDRYGNRNFEYL  120

Query  678   SLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESN  857
             SLGCD LPVL+GRTPVQ Y+D+MRSF+E F + +G+VIVE+QVGMGP GELRYP YPE +
Sbjct  121   SLGCDHLPVLKGRTPVQAYSDFMRSFKESFSDMLGDVIVEIQVGMGPAGELRYPGYPERD  180

Query  858   GTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGT  1037
             G W+FPG+GEFQC+D YM ASL ASAE+ GK +WG   P DAG YNQ+PED+ FF+RDG 
Sbjct  181   GIWKFPGVGEFQCHDNYMLASLKASAESIGKPDWG-CAPSDAGHYNQWPEDSIFFKRDGG  239

Query  1038  WKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELN  1217
             W T+YG+FFLEWYSGKL+EHG+ +LTAA G+F+G+  +LS K+AGIHWHY TRSHA EL 
Sbjct  240   WNTDYGRFFLEWYSGKLIEHGESVLTAAEGIFRGSPVRLSAKVAGIHWHYGTRSHAPELT  299

Query  1218  AGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDa  1397
             AGYYNTR R+GYLP+A M  +HGV FNFTC EM+D EQP +A CSPEGL++QV  A K A
Sbjct  300   AGYYNTRFRDGYLPLARMFGRHGVTFNFTCFEMRDVEQPAAAQCSPEGLLKQVVAAAKSA  359

Query  1398  gaelagenaleRYDSRGYEQVLATSRSD---------SGNGLSAFTYLRMNKNLFEPENW  1550
             G  LAGENAL RYD   Y Q++  SR +         +   +  FT+LRMN+ LF PENW
Sbjct  360   GVPLAGENALPRYDEGAYHQIVMKSRLEVEGEESMERAYEPMCCFTFLRMNERLFHPENW  419

Query  1551  RKLVEFVKSMSEGGRSTRLPECDSSRTDLYVG  1646
             R+ V+FVK + +G  S+   E +   ++L V 
Sbjct  420   RRFVQFVKEIGDGKGSSSSREHEHRASELLVA  451



>gb|AGT17079.1| beta-amylase [Saccharum hybrid cultivar R570]
Length=560

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/436 (65%), Positives = 349/436 (80%), Gaps = 3/436 (1%)
 Frame = +3

Query  294   SSSRVPVFIMLPLDTITMGGN-LNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLK  470
             S + VPVF+M+PLDT+   GN LN+ +++ ASL AL+SAGVEG+MVD WWG+ E DGP +
Sbjct  92    SKAGVPVFVMMPLDTVRKDGNSLNRRKAVEASLAALKSAGVEGIMVDVWWGIAEADGPGQ  151

Query  471   YNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDR  650
             YN+ GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+ DL YTDR
Sbjct  152   YNFNGYMELMEMARKTGLKVQAVMSFHQCGGNVGDSVTIPLPRWVVEEMDKDQDLAYTDR  211

Query  651   SGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGEL  830
             SGRRN EY+SLGCD LPVL+GRTP+Q YAD+MR+FR+RF  +MGN IVE+QVGMGP GEL
Sbjct  212   SGRRNYEYVSLGCDALPVLKGRTPIQCYADFMRAFRDRFATFMGNTIVEIQVGMGPAGEL  271

Query  831   RYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPED  1010
             RYPSYPESNGTW FPGIGEFQCYD+YM +SL A+AEA GK EWG +GP D+G Y  +PED
Sbjct  272   RYPSYPESNGTWSFPGIGEFQCYDRYMLSSLKAAAEAVGKPEWGNAGPGDSGGYKDWPED  331

Query  1011  TGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGT-GAKLSGKIAGIHWHY  1187
             TGFFRR+G W TEYGQFF+ WYS  LLEHG+RIL+AA GV+ G+ G K+S K+AGIHWHY
Sbjct  332   TGFFRREGGWSTEYGQFFMSWYSQMLLEHGERILSAATGVYTGSPGVKISVKVAGIHWHY  391

Query  1188  NTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLV  1367
              TRSHAAEL AGYYNTR+ +GY P+A MLA+HG V NFTC+EM+D EQP  A C PE LV
Sbjct  392   GTRSHAAELTAGYYNTRQHDGYAPVARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALV  451

Query  1368  RQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG-NGLSAFTYLRMNKNLFEPE  1544
             +QV  A ++AG  LAGENAL RYD   ++QV+AT+   +  + + AFTYLRM  +LF+P+
Sbjct  452   QQVAAAAREAGVGLAGENALPRYDETAHDQVVATAADRAAEDRMVAFTYLRMGPDLFQPD  511

Query  1545  NWRKLVEFVKSMSEGG  1592
             NWR+   FVK MS+ G
Sbjct  512   NWRRFAAFVKRMSQPG  527



>emb|CDY45566.1| BnaC09g21440D [Brassica napus]
Length=564

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/444 (64%), Positives = 342/444 (77%), Gaps = 8/444 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAGVEG+M+D WWGLVE++ P  YNW G
Sbjct  95    VPVFVMMPLDSVTMGNTVNRRKAMRASLQALKSAGVEGIMIDVWWGLVEREAPGAYNWGG  154

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+PDL YTD+ GRRN
Sbjct  155   YNELLEMAKKVGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRN  214

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLG D LPVL+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  215   HEYISLGADTLPVLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  274

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE +GTWRFPGIG FQCYDKY  +SL A+AEA+GK EWG +GP DAG YN +PEDT FF+
Sbjct  275   PEQDGTWRFPGIGAFQCYDKYSLSSLKAAAEAYGKPEWGGTGPTDAGHYNNWPEDTQFFK  334

Query  1026  R-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             + DG W TEYG+FFL WYS  LL+HG+RIL++A  +FQ T  K+S KIAGIHWHY TRSH
Sbjct  335   KEDGGWNTEYGEFFLTWYSQMLLDHGERILSSAKSIFQDTSVKISVKIAGIHWHYGTRSH  394

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+H  +FNFTC+EM+D EQP  A C+PE LV QV +
Sbjct  395   APELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVAL  454

Query  1383  ATKDagaelagenaleRYDSRGYEQVL---ATSRSDSGNG----LSAFTYLRMNKNLFEP  1541
             AT  A   LAGENAL RYD   +EQ+L   A S   +  G    + AFTYLRMN  LF+ 
Sbjct  455   ATLAAEVPLAGENALPRYDDHAHEQILKASALSFDQNSEGENREMCAFTYLRMNPELFKA  514

Query  1542  ENWRKLVEFVKSMSEGGRSTRLPE  1613
             +NW K V FVK M EG  S R  E
Sbjct  515   DNWGKFVGFVKKMGEGRDSDRCQE  538



>ref|XP_009102529.1| PREDICTED: beta-amylase 1, chloroplastic [Brassica rapa]
Length=570

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/444 (64%), Positives = 343/444 (77%), Gaps = 8/444 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAGVEG+M+D WWGLVE++ P  YNW G
Sbjct  101   VPVFVMMPLDSVTMGNTVNRRKAMRASLQALKSAGVEGIMIDVWWGLVEREAPGAYNWGG  160

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+PDL YTD+ GRRN
Sbjct  161   YNELLEMAKKVGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRN  220

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLG D LPVL+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  221   HEYISLGADTLPVLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  280

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE +GTWRFPGIG FQCYDKY  +SL A+AEA+GK EWG +GP DAG YN +PEDT FF+
Sbjct  281   PEQDGTWRFPGIGAFQCYDKYSLSSLKAAAEAYGKPEWGGTGPTDAGHYNNWPEDTQFFK  340

Query  1026  R-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             + DG W TEYG+FFL WYS  LL+HG+RIL++A  +FQ TG K+S K+AGIHWHY TRSH
Sbjct  341   KEDGGWNTEYGEFFLTWYSQMLLDHGERILSSAKSIFQDTGVKISVKVAGIHWHYGTRSH  400

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+H  +FNFTC+EM+D EQP  A C+PE LV QV +
Sbjct  401   APELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVAL  460

Query  1383  ATKDagaelagenaleRYDSRGYEQVL---ATSRSDSGNG----LSAFTYLRMNKNLFEP  1541
             AT  A   LAGENAL RYD   +EQ+L   A S   +  G    + AFTYLRMN  LF+ 
Sbjct  461   ATLAAEVPLAGENALPRYDDYAHEQILKASALSFDQNSEGENREMCAFTYLRMNPELFKA  520

Query  1542  ENWRKLVEFVKSMSEGGRSTRLPE  1613
             +NW K V FVK M EG  S R  E
Sbjct  521   DNWGKFVGFVKKMGEGRDSDRCRE  544



>emb|CDX77441.1| BnaA07g05790D [Brassica napus]
Length=570

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/444 (64%), Positives = 343/444 (77%), Gaps = 8/444 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAGVEG+M+D WWGLVE++ P  YNW G
Sbjct  101   VPVFVMMPLDSVTMGNTVNRRKAMRASLQALKSAGVEGIMIDVWWGLVEREAPGAYNWGG  160

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+PDL YTD+ GRRN
Sbjct  161   YNELLEMAKKVGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRN  220

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLG D LPVL+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  221   HEYISLGADTLPVLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  280

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE +GTWRFPGIG FQCYDKY  +SL A+AEA+GK EWG +GP DAG YN +PEDT FF+
Sbjct  281   PEQDGTWRFPGIGAFQCYDKYSLSSLKAAAEAYGKPEWGGTGPTDAGHYNNWPEDTQFFK  340

Query  1026  R-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             + DG W TEYG+FFL WYS  LL+HG+RIL++A  +FQ TG K+S K+AGIHWHY TRSH
Sbjct  341   KEDGGWNTEYGEFFLTWYSQMLLDHGERILSSAKSIFQDTGVKISVKVAGIHWHYGTRSH  400

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+H  +FNFTC+EM+D EQP  A C+PE LV QV +
Sbjct  401   APELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVAL  460

Query  1383  ATKDagaelagenaleRYDSRGYEQVL---ATSRSDSGNG----LSAFTYLRMNKNLFEP  1541
             AT  A   LAGENAL RYD   +EQ+L   A S   +  G    + AFTYLRMN  LF+ 
Sbjct  461   ATLAAEVPLAGENALPRYDDYAHEQILKASALSFDQNSEGENREMCAFTYLRMNPELFKA  520

Query  1542  ENWRKLVEFVKSMSEGGRSTRLPE  1613
             +NW K V FVK M EG  S R  E
Sbjct  521   DNWGKFVGFVKKMGEGRDSDRCRE  544



>ref|XP_006418770.1| hypothetical protein EUTSA_v10002460mg [Eutrema salsugineum]
 gb|ESQ37206.1| hypothetical protein EUTSA_v10002460mg [Eutrema salsugineum]
Length=582

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/441 (64%), Positives = 343/441 (78%), Gaps = 8/441 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAGVEG+M+D WWGLVE++ P  YNW G
Sbjct  113   VPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVERESPGAYNWGG  172

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y+ L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+PDL YTD+ GRRN
Sbjct  173   YSELLEMAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRN  232

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLG D LPVL+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  233   HEYISLGADTLPVLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  292

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTW+FPGIG FQCYDKY  +SL A+AEA+GK EWG +GP DAG YN +PEDT FF+
Sbjct  293   PEQNGTWKFPGIGAFQCYDKYSLSSLKAAAEAYGKPEWGGTGPTDAGHYNNWPEDTQFFK  352

Query  1026  R-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             + DG W TEYG+FFL WYS  LL+HG+RIL++A  +F+  G K+S KIAGIHWHY TRSH
Sbjct  353   KEDGGWNTEYGEFFLTWYSQMLLDHGERILSSAKSIFENRGVKISVKIAGIHWHYGTRSH  412

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+H  +FNFTC+EM+D EQP  A C+PE LV QV +
Sbjct  413   APELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVAL  472

Query  1383  ATKDagaelagenaleRYDSRGYEQVL---ATSRSDSGNG----LSAFTYLRMNKNLFEP  1541
             AT  A   LAGENAL RYD   +EQ+L   A S   +  G    + AFTYLRMN  LF+ 
Sbjct  473   ATLAAEVPLAGENALPRYDDYAHEQILKASALSFDQNSEGENREMCAFTYLRMNPELFQA  532

Query  1542  ENWRKLVEFVKSMSEGGRSTR  1604
             +NW K V FVK MSEG  S R
Sbjct  533   DNWGKFVGFVKKMSEGRDSHR  553



>dbj|BAJ96121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/432 (64%), Positives = 339/432 (78%), Gaps = 3/432 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGN-LNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPVF+M+PLDT+   G+ LN+ +++ AS+ AL+SAG  G+MVD WWG+ E +GP +YN+ 
Sbjct  87    VPVFVMMPLDTVRKDGSALNRRKAVQASMAALKSAGAAGIMVDVWWGIAESEGPGQYNFA  146

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP W LEE+ K+ DL YTDRSGRR
Sbjct  147   GYIELMEMAKKAGLKVQAVMSFHQCGGNVGDSVTIPLPKWALEEMDKDQDLAYTDRSGRR  206

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EYISLG D LP L+GRTPVQ YAD+MR+FR+    YMGN I E+QVGMGP GELRYPS
Sbjct  207   NYEYISLGADALPALKGRTPVQCYADFMRAFRDHLAPYMGNTICEIQVGMGPAGELRYPS  266

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPESNGTW FPGIGEFQCYD+YMR+SL A+AEA G+ EWG +GP D+G YNQ+PEDTGFF
Sbjct  267   YPESNGTWSFPGIGEFQCYDRYMRSSLKAAAEAVGRPEWGNAGPEDSGTYNQWPEDTGFF  326

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGT-GAKLSGKIAGIHWHYNTRS  1199
             RR+G W T+YGQFF+ WYS  LLEHG+RIL+A + VF GT G K+S K+AGIHWHY TRS
Sbjct  327   RREGGWNTDYGQFFMSWYSQMLLEHGERILSACSSVFTGTPGVKVSVKVAGIHWHYGTRS  386

Query  1200  HAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVK  1379
             HA EL AGYYNTR  +GYLPIA ML +HG V NFTC+EM++ EQP  A C PE LV+QV 
Sbjct  387   HAPELTAGYYNTRNHDGYLPIARMLGRHGAVLNFTCVEMRNHEQPQDAQCMPEALVQQVA  446

Query  1380  VATKDagaelagenaleRYDSRGYEQVLATSRSDS-GNGLSAFTYLRMNKNLFEPENWRK  1556
              A KDAG  LAGENAL RYD   ++QV+AT+   +  + + AFTYLRM  +LF+P+NWR+
Sbjct  447   NAAKDAGVGLAGENALPRYDETAHDQVIATAAEKAEEDRMVAFTYLRMGPDLFQPDNWRR  506

Query  1557  LVEFVKSMSEGG  1592
                FVK M+E G
Sbjct  507   FAAFVKRMTETG  518



>ref|XP_002974185.1| hypothetical protein SELMODRAFT_149606, partial [Selaginella 
moellendorffii]
 gb|EFJ25140.1| hypothetical protein SELMODRAFT_149606, partial [Selaginella 
moellendorffii]
Length=432

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/433 (64%), Positives = 337/433 (78%), Gaps = 11/433 (3%)
 Frame = +3

Query  321   MLPLDTITMGGN-LNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAAL  497
             MLPLD+I  G N +N+ R+MNAS  AL+SAGVEGVMVD WWG+VEKDGP  YNW GY  L
Sbjct  1     MLPLDSINSGNNQVNRARAMNASFQALKSAGVEGVMVDVWWGIVEKDGPCNYNWSGYREL  60

Query  498   VKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYI  677
             ++M ++HGLK+Q VMSFHQCGGNVGDS  IPLP W++EE   NPD+VYTDR G RN EY+
Sbjct  61    LEMAKKHGLKVQAVMSFHQCGGNVGDSAFIPLPWWIVEEAKNNPDMVYTDRYGNRNFEYL  120

Query  678   SLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESN  857
             SLGCD LPVL+GRTPVQ Y+D+MRSF+E F + +G+VIVE+QVGMGP GELRYP YPE +
Sbjct  121   SLGCDHLPVLKGRTPVQAYSDFMRSFKESFSDMLGDVIVEIQVGMGPAGELRYPGYPERD  180

Query  858   GTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGT  1037
             G W+FPG+GEFQC+D YM ASL ASAEA GK +WG   P DAG YNQ+PED+ FF+RDG 
Sbjct  181   GIWKFPGVGEFQCHDNYMLASLKASAEAIGKPDWG-CAPSDAGHYNQWPEDSIFFKRDGG  239

Query  1038  WKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELN  1217
             W T+YG+FFLEWYSGKL+EHG+ +LTAA G+F+G+  +LS K+AGIHWHY TRSHA EL 
Sbjct  240   WNTDYGRFFLEWYSGKLIEHGESVLTAAEGIFRGSPVRLSAKVAGIHWHYGTRSHAPELT  299

Query  1218  AGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDa  1397
             AGYYNTR R+GYLP+A M  +HGV FNFTC EM+D EQP +A CSPEGL++QV  A K A
Sbjct  300   AGYYNTRFRDGYLPLARMFGRHGVTFNFTCFEMRDVEQPAAAQCSPEGLLKQVVAAAKSA  359

Query  1398  gaelagenaleRYDSRGYEQVLATSRSD---------SGNGLSAFTYLRMNKNLFEPENW  1550
             G  LAGENAL RYD   Y Q++  SR +         +   +  FT+LRMN+ LF PENW
Sbjct  360   GVPLAGENALPRYDEGAYHQIVMKSRLEVEGEESMERAYEPMCCFTFLRMNERLFHPENW  419

Query  1551  RKLVEFVKSMSEG  1589
             R+ V+FVK + +G
Sbjct  420   RRFVQFVKEIGDG  432



>ref|XP_010513371.1| PREDICTED: beta-amylase 1, chloroplastic-like [Camelina sativa]
Length=576

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/466 (62%), Positives = 348/466 (75%), Gaps = 21/466 (5%)
 Frame = +3

Query  231   EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
             EG + EKRE                VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAG
Sbjct  95    EGGIVEKRE-------------GGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAG  141

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEG+M+D WWGLVEK+ P  YNW GY+ L++M ++ GLK+Q VMSFHQCGGNVGDS +IP
Sbjct  142   VEGIMIDVWWGLVEKESPGTYNWGGYSELLEMAKKLGLKVQAVMSFHQCGGNVGDSVTIP  201

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LP WV+EE+ K+P+L YTD+ GRRN EY+SLG D LPVL+GRTPVQ Y D+MR+FR+ FK
Sbjct  202   LPQWVIEEVDKDPELAYTDQWGRRNHEYVSLGADTLPVLKGRTPVQCYGDFMRAFRDNFK  261

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
               +G+ IVE+QVGMGP GELRYPSYPE  GTW+FPGIG FQCYDKY  +SL A+AEA+GK
Sbjct  262   HLLGDTIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAEAYGK  321

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRR-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
              EWG +GP DAG YN +PEDT FF++ DG W TEYG+FFL WYS  LL+HG+RIL++A  
Sbjct  322   PEWGSTGPTDAGHYNNWPEDTQFFKKEDGGWNTEYGEFFLSWYSQMLLDHGERILSSAKS  381

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +F+ TG K+S KIAGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+H  +FNFTC
Sbjct  382   IFESTGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTC  441

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVL-ATSRSDS  1484
             +EM+D EQP  A C+PE LV QV +AT  A   LAGENAL RYD   +EQ+L AT+ S  
Sbjct  442   IEMRDHEQPQDALCAPEKLVNQVALATLAAEVPLAGENALPRYDDYAHEQILKATALSFD  501

Query  1485  GNG------LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
              N       + AFTYLRMN  LF+  NW K V FVK M EG  S R
Sbjct  502   QNSEGEKREMCAFTYLRMNPELFQANNWGKFVAFVKKMGEGRDSHR  547



>ref|XP_002885629.1| beta-amylase 7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61888.1| beta-amylase 7 [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/458 (62%), Positives = 345/458 (75%), Gaps = 8/458 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAGVEG+M+D WWGLVEK+ P  YNW G
Sbjct  103   VPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGSYNWGG  162

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+PDL YTD+ GRRN
Sbjct  163   YNELLEMAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVIEEVDKDPDLAYTDQWGRRN  222

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLG D LPVL+GRTPVQ YAD+MR+FR+ FK  +G  IVE+QVGMGP GELRYPSY
Sbjct  223   CEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSY  282

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE  GTW+FPGIG FQCYDKY  +SL A+AEA+GK EWG +GP DAG YN +PEDT FF+
Sbjct  283   PEQEGTWKFPGIGAFQCYDKYSLSSLKAAAEAYGKPEWGSTGPTDAGHYNNWPEDTQFFK  342

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W TEYG FFL WYS  LL+HG+RIL++A  +F+ TG K+S KIAGIHWHY TRSH
Sbjct  343   KEGGGWNTEYGDFFLSWYSQMLLDHGERILSSAKSIFENTGVKISVKIAGIHWHYGTRSH  402

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+H  +FNFTC+EM+D EQP  A C+PE LV QV +
Sbjct  403   APELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVAL  462

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATS--RSDSGNG-----LSAFTYLRMNKNLFEP  1541
             AT  A   LAGENAL RYD   +EQ+L  S    D  N      + AFTYLRMN  LF+ 
Sbjct  463   ATLAAEVPLAGENALPRYDDYAHEQILKASVLNLDQNNQGEPREMCAFTYLRMNPELFQA  522

Query  1542  ENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLIK  1655
             +NW K V FVK M EG  S R  E     T+ +V + +
Sbjct  523   DNWGKFVAFVKKMVEGRDSHRCWEEVERETEHFVHVTQ  560



>ref|XP_010488521.1| PREDICTED: beta-amylase 1, chloroplastic-like [Camelina sativa]
Length=575

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/466 (62%), Positives = 347/466 (74%), Gaps = 21/466 (5%)
 Frame = +3

Query  231   EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
             EG + EKRE                VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAG
Sbjct  94    EGGIVEKRE-------------GGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAG  140

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEG+M+D WWGLVEK+ P  YNW GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IP
Sbjct  141   VEGIMIDVWWGLVEKESPGTYNWGGYNELLEMAKKLGLKVQAVMSFHQCGGNVGDSVTIP  200

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LP WV+EE+ K+P+L YTD+ GRRN EY+SLG D LPVL+GRTPVQ Y D+MR+FR+ FK
Sbjct  201   LPQWVIEEVDKDPELAYTDQWGRRNHEYVSLGADTLPVLKGRTPVQCYGDFMRAFRDNFK  260

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
               +G+ IVE+QVGMGP GELRYPSYPE  GTW+FPGIG FQCYDKY  +SL A+AEA+GK
Sbjct  261   HLLGDTIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAEAYGK  320

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRR-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
              EWG +GP DAG YN +PEDT FF++ DG W TEYG+FFL WYS  LL+HG+RIL++A  
Sbjct  321   PEWGSTGPTDAGHYNNWPEDTQFFKKEDGGWNTEYGEFFLSWYSQMLLDHGERILSSAKS  380

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +F+ TG K+S KIAGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+H  +FNFTC
Sbjct  381   IFESTGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTC  440

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVL-ATSRSDS  1484
             +EM+D EQP  A C+PE LV QV +AT  A   LAGENAL RYD   +EQ+L AT+ S  
Sbjct  441   IEMRDHEQPQDALCAPEKLVNQVALATLAAEVPLAGENALPRYDDYAHEQILKATALSFD  500

Query  1485  GNG------LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
              N       + AFTYLRMN  LF+  NW K V FVK M EG  S R
Sbjct  501   QNSEGEKREMCAFTYLRMNPELFQANNWGKFVAFVKKMGEGRDSHR  546



>emb|CDX94831.1| BnaC03g43570D [Brassica napus]
Length=545

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/441 (64%), Positives = 340/441 (77%), Gaps = 8/441 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+M+PLD++TMG  +N+ ++M ASL ALRS GVEG+M+D WWGLVE++ P  YNW G
Sbjct  76    VPVFVMMPLDSVTMGNAVNRRKAMRASLQALRSGGVEGIMIDVWWGLVEREAPGGYNWGG  135

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  +++M ++ GLK+Q VMSFHQCGGNVGDS SIPLP WV+EE+ K+PDL YTD+ GRRN
Sbjct  136   YEEVLQMARKVGLKVQAVMSFHQCGGNVGDSVSIPLPQWVVEEVDKDPDLAYTDQWGRRN  195

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLG D LPVLRGRTPVQ ++D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  196   HEYISLGADTLPVLRGRTPVQCFSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  255

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE +GTW FPGIG FQCYDKY  +SL A+AEA+GK EWG +GP DAG YN +PEDT FF+
Sbjct  256   PEQDGTWNFPGIGAFQCYDKYSLSSLKAAAEAYGKPEWGSTGPTDAGHYNNWPEDTHFFK  315

Query  1026  R-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             + DG W TEYG+FFL WYS  LL HG+RIL++A  +F+ T  KLS K+AGIHWHY TRSH
Sbjct  316   KEDGGWNTEYGEFFLTWYSQMLLNHGERILSSAKSIFENTDVKLSAKVAGIHWHYGTRSH  375

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+H  VFNFTC+EM+D EQP  A C+PE LV QV +
Sbjct  376   APELTAGYYNTRLRDGYLPIAQMLARHSAVFNFTCIEMRDHEQPQDALCAPEQLVNQVAL  435

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSR------SDSGN-GLSAFTYLRMNKNLFEP  1541
             AT  A   LAGENAL RYD   +EQ++  S       S+ GN  + AFTYLRMN  LF+ 
Sbjct  436   ATLAAEVPLAGENALPRYDDYAHEQIVKASALSFDQDSEGGNREMCAFTYLRMNPELFKA  495

Query  1542  ENWRKLVEFVKSMSEGGRSTR  1604
             ENWR+ V FVK M EG  S R
Sbjct  496   ENWRRFVWFVKKMGEGRDSHR  516



>gb|KFK39690.1| hypothetical protein AALP_AA3G276400 [Arabis alpina]
Length=569

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/461 (61%), Positives = 347/461 (75%), Gaps = 8/461 (2%)
 Frame = +3

Query  246   EKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVM  425
             E+ +R +             VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAGVEG+M
Sbjct  80    EEEQRTYKEGGIGGEKGKGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIM  139

Query  426   VDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWV  605
             +D WWGLVEK+ P  YNW GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV
Sbjct  140   IDVWWGLVEKESPGSYNWGGYNELLEMAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWV  199

Query  606   LEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGN  785
             +EE+ K+P+L YTD+ GRRN EYISLG D LPVL+GRTPVQ YAD+MR+FR+ FK  +G+
Sbjct  200   VEEVDKDPELAYTDQWGRRNYEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGD  259

Query  786   VIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGR  965
              IVE+QVGMGP GELRYPSYPE +GTW+FPGIG FQCYDKY  +SL A+AEA+GK EWG 
Sbjct  260   TIVEIQVGMGPAGELRYPSYPEQDGTWKFPGIGAFQCYDKYSLSSLKAAAEAYGKPEWGS  319

Query  966   SGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGT  1142
             +GP DAG YN +PEDT FF+++ G W TEYG+FFL WYS  LL+HG+RIL++A  +F+ T
Sbjct  320   TGPTDAGHYNNWPEDTQFFKKEGGGWNTEYGEFFLSWYSQMLLDHGERILSSAKSIFETT  379

Query  1143  GAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKD  1322
             G K+S KIAGIHWHY +RSHA EL AGYYNTR R+GYLPIA MLA+H  +FNFTC+EM+D
Sbjct  380   GVKISVKIAGIHWHYGSRSHAPELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRD  439

Query  1323  GEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVL---ATSRSDSGNG  1493
              EQP  A C+PE LV QV +AT  A   LAGENAL RYD   +EQ+L   A S   +  G
Sbjct  440   HEQPQDALCAPEKLVNQVALATLTAEVPLAGENALPRYDDYAHEQILKASALSLDQNSEG  499

Query  1494  ----LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
                 + AFTYLRMN  LF+ +NW K V FVK M EG  S R
Sbjct  500   ENREMCAFTYLRMNPELFKADNWGKFVGFVKKMGEGRDSQR  540



>ref|XP_003632025.2| PREDICTED: beta-amylase 1, chloroplastic [Vitis vinifera]
Length=459

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/439 (63%), Positives = 344/439 (78%), Gaps = 4/439 (1%)
 Frame = +3

Query  285   SHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGP  464
             + ++   VPV++M+PLD++TMG  +N    M   +  L+SAGVEGVM+D WWGLVE++ P
Sbjct  17    AKATGKGVPVYVMIPLDSVTMGNGVNTWEKMKERMQKLKSAGVEGVMMDVWWGLVEREAP  76

Query  465   LKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYT  644
               YNW GYA L++MV++HGLK+Q VMSFH+CGGNVGDSC+IPLP WV+EEI+K+PDL YT
Sbjct  77    GTYNWGGYAELLEMVKQHGLKVQAVMSFHKCGGNVGDSCTIPLPNWVVEEINKDPDLAYT  136

Query  645   DRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCG  824
             D+ GRRN EY+SLG D L VL+GRTPVQ YAD+MR+FR+ FK  +G+ IVE+QVGMGP G
Sbjct  137   DQWGRRNYEYVSLGSDTLLVLKGRTPVQCYADFMRAFRDNFKHLLGDTIVEIQVGMGPSG  196

Query  825   ELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFP  1004
             ELRYPSYPE NGTW+FPGIG FQCYDKYM +SL A+AEA GK +WG +GP DAG YN +P
Sbjct  197   ELRYPSYPEQNGTWKFPGIGAFQCYDKYMLSSLKAAAEAAGKPKWGSTGPTDAGHYNNWP  256

Query  1005  EDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHW  1181
             EDT FFRR+ G W + YG+FFL WYS  LL+HG+RIL++A  +FQ  G K+S K++GIHW
Sbjct  257   EDTQFFRREGGGWTSPYGEFFLNWYSQMLLDHGERILSSAKSIFQDMGVKISVKVSGIHW  316

Query  1182  HYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEG  1361
             HY TRSHA EL AGYYNTR R+GY+PIA MLA+HG + NFTC+EM+D EQP  A C+PE 
Sbjct  317   HYGTRSHAPELTAGYYNTRFRDGYIPIAQMLARHGAILNFTCIEMRDHEQPQDARCAPEK  376

Query  1362  LVRQVKVATKDagaelagenaleRYDSRGYEQVL-ATSRSDSGN--GLSAFTYLRMNKNL  1532
             LVRQ+ +AT+ A   LAGENAL RYD   +EQ+L A+S +  G    + AFTYLRMN +L
Sbjct  377   LVRQLALATRKAQVPLAGENALPRYDETAHEQILRASSLNFDGEEREMCAFTYLRMNPDL  436

Query  1533  FEPENWRKLVEFVKSMSEG  1589
             F+ +NWR+ V FVK M EG
Sbjct  437   FQADNWRRFVAFVKKMKEG  455



>ref|XP_003548316.1| PREDICTED: beta-amylase 1, chloroplastic-like [Glycine max]
Length=570

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/434 (65%), Positives = 342/434 (79%), Gaps = 6/434 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VP+F+M+PLD++  G  +N+ ++MNA++ AL+SAGVEGVM+D WWGLVE++ P +YNW G
Sbjct  104   VPLFVMMPLDSVKTGNAVNRKKAMNAAMAALKSAGVEGVMMDVWWGLVEREKPGEYNWGG  163

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++HGLK+Q VMSFHQCGGNVGDSC+IPLP WV+EEI  +PDL YTD+ GRRN
Sbjct  164   YVELMEMAKKHGLKVQAVMSFHQCGGNVGDSCTIPLPKWVVEEIDNDPDLAYTDQWGRRN  223

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLGCD  PVL+GRTPVQ YAD+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  224   YEYISLGCDTSPVLKGRTPVQCYADFMRAFRDTFKHLLGDTIVEIQVGMGPAGELRYPSY  283

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTW FPGIG FQCYDKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FFR
Sbjct  284   PEQNGTWNFPGIGGFQCYDKYMLSSLKAAAEAEGKPEWGSTGPTDAGHYNNWPEDTQFFR  343

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W   YG+FFL WYS  LL+HGDRIL++A  +F  TG K+S K+AGIHWHY +RSH
Sbjct  344   KEGGGWDGPYGEFFLTWYSQMLLDHGDRILSSATSIFDNTGVKISVKVAGIHWHYGSRSH  403

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GY+PIA MLA+HG +FNFTC+EM+D EQP  A C+PE LV+QV +
Sbjct  404   APELTAGYYNTRFRDGYIPIAQMLARHGAIFNFTCIEMRDHEQPQDALCAPEKLVKQVAL  463

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSRSD-----SGNGLSAFTYLRMNKNLFEPEN  1547
             AT+ A   LAGENAL RYD   +EQ++  S+ D      G  + AFTYLRMN +LFEP N
Sbjct  464   ATQKAQVPLAGENALPRYDEYAHEQIIRASQLDVDGDSGGREMCAFTYLRMNPHLFEPNN  523

Query  1548  WRKLVEFVKSMSEG  1589
             WRK V FVK M EG
Sbjct  524   WRKFVGFVKKMKEG  537



>ref|XP_006296695.1| hypothetical protein CARUB_v10013332mg [Capsella rubella]
 gb|EOA29593.1| hypothetical protein CARUB_v10013332mg [Capsella rubella]
Length=573

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/466 (62%), Positives = 344/466 (74%), Gaps = 21/466 (5%)
 Frame = +3

Query  231   EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
             EG + EKRE                VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAG
Sbjct  92    EGGIVEKRE-------------GGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAG  138

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEG+M+D WWGLVEK+ P  YNW GY  L++M +  GLK+Q VMSFHQCGGNVGDS +IP
Sbjct  139   VEGIMIDVWWGLVEKESPGTYNWGGYNELLEMAKRLGLKVQAVMSFHQCGGNVGDSVTIP  198

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LP WV+EE+ K+P+L YTD+ GRRN EYISLG D LPVL+GRTPVQ Y D+MR+FR+ FK
Sbjct  199   LPQWVIEEVDKDPELAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYGDFMRAFRDNFK  258

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
               +G+ IVE+QVGMGP GELRYPSYPE  GTW+FPGIG FQCYDKY   SL A+AEA+GK
Sbjct  259   HLLGDTIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLGSLKAAAEAYGK  318

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRR-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
              EWG +GP DAG YN +PEDT FF++ DG W TEYG+FFL WYS  LL+HG+RIL++A  
Sbjct  319   PEWGSTGPTDAGHYNNWPEDTQFFKKEDGGWNTEYGEFFLSWYSQMLLDHGERILSSAKS  378

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +F+ TG K+S KIAGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+H  +FNFTC
Sbjct  379   IFESTGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTC  438

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATS-----  1472
             +EM+D EQP  A C+PE LV QV +AT  A   LAGENAL RYD   +EQ+L  S     
Sbjct  439   IEMRDHEQPQDALCAPEKLVNQVALATLAADVPLAGENALPRYDDYAHEQILKASALSFD  498

Query  1473  -RSDSGNG-LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
               S+  N  + AFTYLRMN  LF+  NW K V FVK M EG  S R
Sbjct  499   QNSEGKNQEMCAFTYLRMNPELFQANNWGKFVAFVKKMGEGRDSHR  544



>gb|ACG29617.1| beta-amylase [Zea mays]
Length=572

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/462 (62%), Positives = 355/462 (77%), Gaps = 4/462 (1%)
 Frame = +3

Query  216   LSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGN-LNKPRSMNASLM  392
             L+   +  V    E  H   A +  S +  VPVF+M+PLDT+   GN LN+ +++ ASL 
Sbjct  79    LAMACQALVEAAPEAEHADVAAELRSRAG-VPVFVMMPLDTVRKDGNSLNRRKAVEASLA  137

Query  393   ALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVG  572
             AL+SAGVEG+MVD WWG+ E DGP +YN+ GY  L++M ++ GLK+Q VMSFHQCGGNVG
Sbjct  138   ALKSAGVEGIMVDVWWGIAEADGPGQYNFNGYMELMEMARKTGLKVQAVMSFHQCGGNVG  197

Query  573   DSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRS  752
             DS +IPLP WVLEE+ K+ DL YTDRSGRRN EY+SLGCD +PVL+GRTP+Q YAD+MR+
Sbjct  198   DSVTIPLPGWVLEEMDKDQDLAYTDRSGRRNYEYVSLGCDAMPVLKGRTPIQCYADFMRA  257

Query  753   FRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAAS  932
             FR+ F  +MGN IVE+QVGMGP GELRYPSYPES+GTW FPGIGEFQCYD++M +SL A+
Sbjct  258   FRDHFATFMGNTIVEIQVGMGPAGELRYPSYPESDGTWSFPGIGEFQCYDRFMLSSLKAA  317

Query  933   AEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRIL  1112
             AEA GK EWG +GP D+G Y  +PEDTGFFRR+G W TEYG+FF+ WYS  LLEHG+RIL
Sbjct  318   AEAVGKPEWGNAGPGDSGSYKDWPEDTGFFRREGGWSTEYGEFFMSWYSQMLLEHGERIL  377

Query  1113  TAAAGVFQGT-GAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGV  1289
             +AA GVF G+ G K+S K+AGIHWHY TRSHAAEL AGYYNTR  +GY PIA MLA+HG 
Sbjct  378   SAATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELTAGYYNTRSHDGYAPIARMLARHGA  437

Query  1290  VFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLAT  1469
             V NFTC+EM+D EQP  A C PE LV+QV  A ++AG  LAGENAL RYD   ++QV+AT
Sbjct  438   VLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREAGVGLAGENALPRYDDTAHDQVVAT  497

Query  1470  SRSDSG-NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGG  1592
             +   +  + + AFTYLRM  +LF+P+NWR+   FVK M+E G
Sbjct  498   AADRAAEDRMVAFTYLRMGPDLFQPDNWRRFAAFVKRMTEPG  539



>tpg|DAA43306.1| TPA: beta-amylase [Zea mays]
Length=573

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/462 (62%), Positives = 355/462 (77%), Gaps = 4/462 (1%)
 Frame = +3

Query  216   LSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGN-LNKPRSMNASLM  392
             L+   +  V    E  H   A +  S +  VPVF+M+PLDT+   GN LN+ +++ ASL 
Sbjct  80    LAMACQALVEAAPEAEHADVAAELRSRAG-VPVFVMMPLDTVRKDGNSLNRRKAVEASLA  138

Query  393   ALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVG  572
             AL+SAGVEG+MVD WWG+ E DGP +YN+ GY  L++M ++ GLK+Q VMSFHQCGGNVG
Sbjct  139   ALKSAGVEGIMVDVWWGIAEADGPGQYNFNGYMELMEMAKKTGLKVQAVMSFHQCGGNVG  198

Query  573   DSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRS  752
             DS +IPLP WVLEE+ K+ DL YTDRSGRRN EY+SLGCD +PVL+GRTP+Q YAD+MR+
Sbjct  199   DSVTIPLPGWVLEEMDKDQDLAYTDRSGRRNYEYVSLGCDAMPVLKGRTPIQCYADFMRA  258

Query  753   FRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAAS  932
             FR+ F  +MGN IVE+QVGMGP GELRYPSYPES+GTW FPGIGEFQCYD++M +SL A+
Sbjct  259   FRDHFATFMGNTIVEIQVGMGPAGELRYPSYPESDGTWSFPGIGEFQCYDRFMLSSLKAA  318

Query  933   AEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRIL  1112
             AEA GK EWG +GP D+G Y  +PEDTGFFRR+G W TEYG+FF+ WYS  LLEHG+RIL
Sbjct  319   AEAVGKPEWGNAGPGDSGSYKDWPEDTGFFRREGGWSTEYGEFFMSWYSQMLLEHGERIL  378

Query  1113  TAAAGVFQGT-GAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGV  1289
             +AA GVF G+ G K+S K+AGIHWHY TRSHAAEL AGYYNTR  +GY PIA MLA+HG 
Sbjct  379   SAATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELTAGYYNTRSHDGYAPIARMLARHGA  438

Query  1290  VFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLAT  1469
             V NFTC+EM+D EQP  A C PE LV+QV  A ++AG  LAGENAL RYD   ++QV+AT
Sbjct  439   VLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREAGVGLAGENALPRYDDTAHDQVVAT  498

Query  1470  SRSDSG-NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGG  1592
             +   +  + + AFTYLRM  +LF+P+NWR+   FVK M+E G
Sbjct  499   AADRAAEDRMVAFTYLRMGPDLFQPDNWRRFAAFVKRMTEPG  540



>ref|XP_010466824.1| PREDICTED: beta-amylase 1, chloroplastic isoform X2 [Camelina 
sativa]
Length=575

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/466 (61%), Positives = 346/466 (74%), Gaps = 21/466 (5%)
 Frame = +3

Query  231   EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
             EG + EKRE                VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAG
Sbjct  94    EGGIGEKRE-------------GGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAG  140

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEG+M+D WWGLVEK+ P  YNW GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IP
Sbjct  141   VEGIMIDVWWGLVEKESPGTYNWGGYNELLEMAKKLGLKVQAVMSFHQCGGNVGDSVTIP  200

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LP WV+EE+ K+P+L YTD+ GRRN EY+SLG D LPVL+GRTPVQ Y D+MR+FR+ FK
Sbjct  201   LPQWVIEEVDKDPELAYTDQWGRRNHEYVSLGADTLPVLKGRTPVQCYGDFMRAFRDNFK  260

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
               +G+ IVE+QVGMGP GELRYPSYPE  GTW+FPGIG FQCYDKY  +SL A+AEA+GK
Sbjct  261   HLLGDTIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAEAYGK  320

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRR-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
              EWG +GP DAG YN +PEDT FF++ DG W TEYG+FFL WYS  LL+HG+RIL++A  
Sbjct  321   PEWGSTGPTDAGHYNNWPEDTQFFKKEDGGWNTEYGEFFLSWYSQMLLDHGERILSSAKS  380

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +F+ TG K+S K+AGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+H  +FNFTC
Sbjct  381   IFESTGVKISVKVAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTC  440

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVL-ATSRSDS  1484
             +EM+D EQP  A C+PE LV QV +AT  A   LAGENAL RYD   +EQ+L AT+ S  
Sbjct  441   IEMRDHEQPQDALCAPEKLVNQVALATLAAEVPLAGENALPRYDDYAHEQILKATALSFD  500

Query  1485  GNG------LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
              N       + AFTYLRMN  LF+  NW K V FVK M E   S R
Sbjct  501   QNSEGENREMCAFTYLRMNPELFQANNWGKFVAFVKKMGEXRDSHR  546



>ref|NP_001148159.1| beta-amylase [Zea mays]
 gb|ACG29973.1| beta-amylase [Zea mays]
Length=573

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/462 (62%), Positives = 354/462 (77%), Gaps = 4/462 (1%)
 Frame = +3

Query  216   LSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGN-LNKPRSMNASLM  392
             L+   +  V    E  H   A +  S +  VPVF+M+PLDT+   GN LN+ +++ ASL 
Sbjct  80    LAMACQALVEAAPEAEHADVAAELRSRAG-VPVFVMMPLDTVRKDGNSLNRRKAVEASLA  138

Query  393   ALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVG  572
             AL+SAGVEG+MVD WWG+ E DGP +YN+ GY  L++M ++ GLK+Q VMSFHQCGGNVG
Sbjct  139   ALKSAGVEGIMVDVWWGIAEADGPGQYNFNGYMELMEMARKTGLKVQAVMSFHQCGGNVG  198

Query  573   DSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRS  752
             DS +IPLP WVLEE+ K+ DL YTDRSGRRN EY+SLGCD +PVL+GRTP+Q YAD+MR+
Sbjct  199   DSVTIPLPGWVLEEMDKDQDLAYTDRSGRRNYEYVSLGCDAMPVLKGRTPIQCYADFMRA  258

Query  753   FRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAAS  932
             FR+ F  +MGN IVE+QVGMGP GELRYPSYPES+GTW FPGIGEFQCYD++M +SL A+
Sbjct  259   FRDHFATFMGNTIVEIQVGMGPAGELRYPSYPESDGTWSFPGIGEFQCYDRFMLSSLKAA  318

Query  933   AEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRIL  1112
             AEA GK EWG +GP D+G Y  +PEDTGFFRR+G W TEYG+FF+ WYS  LLEHG+RIL
Sbjct  319   AEAVGKPEWGNAGPGDSGSYKDWPEDTGFFRREGGWSTEYGEFFMSWYSQMLLEHGERIL  378

Query  1113  TAAAGVFQGT-GAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGV  1289
             +AA GVF G+ G K+S K+AGIHWHY TRSHAAEL AGYYNTR  +GY PIA MLA+HG 
Sbjct  379   SAATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELTAGYYNTRSHDGYAPIARMLARHGA  438

Query  1290  VFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLAT  1469
             V NFTC+EM+D EQP  A C PE LV+QV  A ++AG  LAGENAL RYD   ++QV+AT
Sbjct  439   VLNFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREAGVGLAGENALPRYDDTAHDQVVAT  498

Query  1470  SRSDSG-NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGG  1592
             +   +  + + AFTYLRM  +LF P+NWR+   FVK M+E G
Sbjct  499   AADRAAEDRMVAFTYLRMGPDLFRPDNWRRFAAFVKRMTEPG  540



>ref|XP_010466823.1| PREDICTED: beta-amylase 1, chloroplastic isoform X1 [Camelina 
sativa]
 ref|XP_010466825.1| PREDICTED: beta-amylase 1, chloroplastic isoform X3 [Camelina 
sativa]
Length=575

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/466 (61%), Positives = 346/466 (74%), Gaps = 21/466 (5%)
 Frame = +3

Query  231   EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
             EG + EKRE                VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAG
Sbjct  94    EGGIGEKRE-------------GGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAG  140

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEG+M+D WWGLVEK+ P  YNW GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IP
Sbjct  141   VEGIMIDVWWGLVEKESPGTYNWGGYNELLEMAKKLGLKVQAVMSFHQCGGNVGDSVTIP  200

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LP WV+EE+ K+P+L YTD+ GRRN EY+SLG D LPVL+GRTPVQ Y D+MR+FR+ FK
Sbjct  201   LPQWVIEEVDKDPELAYTDQWGRRNHEYVSLGADTLPVLKGRTPVQCYGDFMRAFRDNFK  260

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
               +G+ IVE+QVGMGP GELRYPSYPE  GTW+FPGIG FQCYDKY  +SL A+AEA+GK
Sbjct  261   HLLGDTIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAEAYGK  320

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRR-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAG  1127
              EWG +GP DAG YN +PEDT FF++ DG W TEYG+FFL WYS  LL+HG+RIL++A  
Sbjct  321   PEWGSTGPTDAGHYNNWPEDTQFFKKEDGGWNTEYGEFFLSWYSQMLLDHGERILSSAKS  380

Query  1128  VFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTC  1307
             +F+ TG K+S K+AGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+H  +FNFTC
Sbjct  381   IFESTGVKISVKVAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTC  440

Query  1308  MEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVL-ATSRSDS  1484
             +EM+D EQP  A C+PE LV QV +AT  A   LAGENAL RYD   +EQ+L AT+ S  
Sbjct  441   IEMRDHEQPQDALCAPEKLVNQVALATLAAEVPLAGENALPRYDDYAHEQILKATALSFD  500

Query  1485  GNG------LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
              N       + AFTYLRMN  LF+  NW K V FVK M E   S R
Sbjct  501   QNSEGENREMCAFTYLRMNPELFQANNWGKFVAFVKKMGERRDSHR  546



>ref|XP_010023784.1| PREDICTED: beta-amylase 1, chloroplastic [Eucalyptus grandis]
 gb|KCW60153.1| hypothetical protein EUGRSUZ_H02879 [Eucalyptus grandis]
Length=584

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/446 (63%), Positives = 350/446 (78%), Gaps = 8/446 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             AA      S  VPVF+M+PLD++TM   +N+ ++MNASL AL+SAGVEG+M+D WWGLVE
Sbjct  106   AAGSREKGSGGVPVFVMMPLDSVTMNNTVNRRKAMNASLQALKSAGVEGIMMDVWWGLVE  165

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
             ++ P  YNW GYA L++M ++HGLK+Q VMSFHQCGGNVGDSCSIPLP W +EE+ K+PD
Sbjct  166   RE-PGSYNWGGYAELLEMAKKHGLKVQAVMSFHQCGGNVGDSCSIPLPKWAVEEVDKDPD  224

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGM  812
             L YTD+ GRRN EYISLGCD LPVL+GRTPVQ YAD+MR+FR+ F+  +G  IVE+QVGM
Sbjct  225   LAYTDQWGRRNYEYISLGCDTLPVLKGRTPVQCYADFMRAFRDNFQHLLGETIVEIQVGM  284

Query  813   GPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQY  992
             GP GELRYPSYPE NGTW+FPGIG FQCYDKYM +SL A+AEA GK+EWG +GP DAG Y
Sbjct  285   GPAGELRYPSYPEQNGTWKFPGIGAFQCYDKYMLSSLKAAAEAAGKAEWGHTGPTDAGHY  344

Query  993   NQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             N +PED  FF+++ G W ++YG+FFL WYS  LL+HG+RIL++A  VF+ TG K+S K+A
Sbjct  345   NNWPEDAPFFKKEGGGWNSQYGEFFLSWYSQMLLDHGERILSSAKSVFENTGTKISVKVA  404

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+HG +FNFTC+EM+D EQP  A C
Sbjct  405   GIHWHYGTRSHAPELTAGYYNTRYRDGYLPIAQMLARHGAIFNFTCIEMRDHEQPQDALC  464

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD------SGNGLSAFTY  1511
             +PE LV+QV +AT+ A   LAGENAL+RYD   +EQ+L ++  +          + AFTY
Sbjct  465   APEKLVKQVALATQKAEVPLAGENALQRYDDYAHEQILRSALLNIDGYPQEDKEMCAFTY  524

Query  1512  LRMNKNLFEPENWRKLVEFVKSMSEG  1589
             LRMN +LF+ +NWR+ V FVK M EG
Sbjct  525   LRMNPDLFQADNWRRFVAFVKKMKEG  550



>ref|XP_008460711.1| PREDICTED: beta-amylase 1, chloroplastic [Cucumis melo]
Length=545

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/436 (63%), Positives = 333/436 (76%), Gaps = 6/436 (1%)
 Frame = +3

Query  300   SRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNW  479
             S V VF+M+ LD++TMG  +N+ ++M  S  A++ AGVEGVMVD WWGLVEK+ P +YN+
Sbjct  88    SGVGVFVMMALDSVTMGNKVNRRKAMEVSFQAMKGAGVEGVMVDVWWGLVEKERPGEYNF  147

Query  480   EGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGR  659
              GY  L+ M  ++GLK+Q VMSFHQCGGNVGDSC+IPLP WV+EE+ K+PDL YTD+ GR
Sbjct  148   GGYEHLLGMAAKYGLKVQAVMSFHQCGGNVGDSCTIPLPKWVVEEMEKDPDLAYTDQWGR  207

Query  660   RNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYP  839
             RN EY+SLGCD LPVL+GRTPVQ YAD+MR+F+  F   +GN IVE+QVGMGP GELRYP
Sbjct  208   RNLEYLSLGCDNLPVLKGRTPVQCYADFMRAFKHNFNHLLGNTIVEIQVGMGPAGELRYP  267

Query  840   SYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGF  1019
             SYPE NGTWRFPGIG FQC+DKYM +SL A+A   GK EWG +GP DAG YN +PEDT F
Sbjct  268   SYPEQNGTWRFPGIGAFQCFDKYMLSSLKAAANVAGKPEWGSTGPTDAGHYNNWPEDTQF  327

Query  1020  FRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTR  1196
             F+++ G W + YG+FFL WYS  LL+HGD IL+ A+ +F+ +  K+S KIAGIHWHY TR
Sbjct  328   FKKEGGGWNSTYGEFFLSWYSQILLDHGDSILSHASSIFKPSSVKISVKIAGIHWHYGTR  387

Query  1197  SHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQV  1376
             SHA EL AGYYNTR R+GY PIA MLA+HG +FNFTC+EM D EQP  A CSPE LVRQV
Sbjct  388   SHAPELTAGYYNTRYRDGYTPIAQMLARHGAIFNFTCIEMHDHEQPQDAQCSPEKLVRQV  447

Query  1377  KVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPENWRK  1556
             K+AT+ A   LAGENAL RYD   YEQ++  SR      + AFTYLRMN  LFE ENWR+
Sbjct  448   KLATQKAQVPLAGENALSRYDEYAYEQIVRASRE-----MCAFTYLRMNTQLFEEENWRR  502

Query  1557  LVEFVKSMSEGGRSTR  1604
              V FV+ M EG    R
Sbjct  503   FVGFVQKMKEGKNGHR  518



>ref|XP_004147196.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis sativus]
 gb|KGN61543.1| hypothetical protein Csa_2G167190 [Cucumis sativus]
Length=545

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/436 (63%), Positives = 334/436 (77%), Gaps = 6/436 (1%)
 Frame = +3

Query  300   SRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNW  479
             S V VF+M+ LD++TMG  +N+ ++M  S  A++ AGVEGVMVD WWGLVEK+ P +YN+
Sbjct  88    SGVGVFVMMALDSVTMGNKVNRRKAMEVSFQAMKGAGVEGVMVDVWWGLVEKERPGEYNF  147

Query  480   EGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGR  659
              GY  L+ M  ++GLK+Q VMSFHQCGGNVGDSC+IPLP WV+EE+ K+PDL YTD+ GR
Sbjct  148   GGYEDLLGMAAKYGLKVQTVMSFHQCGGNVGDSCTIPLPKWVVEEMEKDPDLAYTDQWGR  207

Query  660   RNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYP  839
             RN EY+SLGCD LPVL+GRTPVQ YAD+MR+F+  F   +GN IVE+QVGMGP GELRYP
Sbjct  208   RNLEYLSLGCDNLPVLKGRTPVQCYADFMRAFKHNFNHLLGNTIVEIQVGMGPAGELRYP  267

Query  840   SYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGF  1019
             SYPE NGTWRFPGIG FQC+DKYM +SL A+A   GK EWG +GP DAG YN +PEDT F
Sbjct  268   SYPEQNGTWRFPGIGAFQCFDKYMLSSLKAAANVAGKPEWGSTGPTDAGHYNNWPEDTQF  327

Query  1020  FRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTR  1196
             F+++ G W + YG+FFL WYS  LL+HGD IL+ A+ +F+ +  K+S KIAGIHWHY TR
Sbjct  328   FKKEGGGWNSTYGEFFLSWYSQILLDHGDAILSHASSIFKPSSVKISVKIAGIHWHYGTR  387

Query  1197  SHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQV  1376
             SHA EL AGYYNTR R+GY PIA MLA+HG +FNFTC+EM D EQP +A CSPE LVRQV
Sbjct  388   SHAPELTAGYYNTRYRDGYTPIARMLARHGAIFNFTCIEMHDHEQPQNAQCSPEKLVRQV  447

Query  1377  KVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPENWRK  1556
             K+AT+ A   LAGENAL RYD   YEQ++  SR      + AFTYLRMN  LFE ENWR+
Sbjct  448   KLATQKAHVPLAGENALPRYDEYAYEQIVRASRE-----MCAFTYLRMNTQLFEEENWRR  502

Query  1557  LVEFVKSMSEGGRSTR  1604
              V FV+ M EG    R
Sbjct  503   FVGFVQKMKEGKNGHR  518



>gb|AAK96508.1| AT4g17090/dl4575c [Arabidopsis thaliana]
 gb|AAL31225.1| AT4g17090/dl4575c [Arabidopsis thaliana]
Length=376

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/378 (71%), Positives = 318/378 (84%), Gaps = 5/378 (1%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQPL-  230
             M LTL SS+S I  K+ K  +N +   + + F++ K   + + +AK+S++E     +   
Sbjct  1     MELTLNSSSSLIKRKDAKSSRNQESSSNNMTFAKMKPPTY-QFQAKNSVKEMKFTHEKTF  59

Query  231   --EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
               EG   EK E+LH L+   S + +S VPVF+MLPLDT+TM G+LNKPR+MNASLMAL+ 
Sbjct  60    TPEGETLEKWEKLHVLSYPHSKNDAS-VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKG  118

Query  405   AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
             AGVEGVMVDAWWGLVEKDGP+ YNWEGYA L++MVQ+HGLKLQVVMSFHQCGGNVGDSCS
Sbjct  119   AGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCS  178

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLPPWVLEEISKNPDLVYTD+SGRRNPEYISLGCD +PVLRGRTP+QVY+D+MRSFRER
Sbjct  179   IPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRER  238

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F+ Y+G VI E+QVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYM++SL A AE+ 
Sbjct  239   FEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESI  298

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAA  1124
             GK+ WG SGPHDAG+Y   PEDT FFRRDGTW +EYG+FF+EWYSGKLLEHGD++L++A 
Sbjct  299   GKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAK  358

Query  1125  GVFQGTGAKLSGKIAGIH  1178
             G+FQG+GAKLSGK+AGIH
Sbjct  359   GIFQGSGAKLSGKVAGIH  376



>ref|NP_189034.1| beta-amylase 1 [Arabidopsis thaliana]
 sp|Q9LIR6.1|BAM1_ARATH RecName: Full=Beta-amylase 1, chloroplastic; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase; AltName: Full=Beta-amylase 
7; AltName: Full=Thioredoxin-regulated beta-amylase; Short=TR-BAMY; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56281.1|AF367293_1 AT3g23920/F14O13_11 [Arabidopsis thaliana]
 dbj|BAB03009.1| beta-amylase [Arabidopsis thaliana]
 gb|AAL67089.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AAL77747.1| AT3g23920/F14O13_11 [Arabidopsis thaliana]
 gb|AAM20167.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AEE76832.1| beta-amylase 1 [Arabidopsis thaliana]
Length=575

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/444 (63%), Positives = 337/444 (76%), Gaps = 8/444 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAGVEG+M+D WWGLVEK+ P  YNW G
Sbjct  106   VPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGG  165

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L+++ ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+PDL YTD+ GRRN
Sbjct  166   YNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRN  225

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLG D LPVL+GRTPVQ YAD+MR+FR+ FK  +G  IVE+QVGMGP GELRYPSY
Sbjct  226   HEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSY  285

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE  GTW+FPGIG FQCYDKY  +SL A+AE +GK EWG +GP DAG YN +PEDT FF+
Sbjct  286   PEQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKPEWGSTGPTDAGHYNNWPEDTQFFK  345

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W +EYG FFL WYS  LL+HG+RIL++A  +F+  G K+S KIAGIHWHY TRSH
Sbjct  346   KEGGGWNSEYGDFFLSWYSQMLLDHGERILSSAKSIFENMGVKISVKIAGIHWHYGTRSH  405

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+H  +FNFTC+EM+D EQP  A C+PE LV QV +
Sbjct  406   APELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLVNQVAL  465

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATS--RSDSGN-----GLSAFTYLRMNKNLFEP  1541
             AT  A   LAGENAL RYD   +EQ+L  S    D  N      + AFTYLRMN  LF+ 
Sbjct  466   ATLAAEVPLAGENALPRYDDYAHEQILKASALNLDQNNEGEPREMCAFTYLRMNPELFQA  525

Query  1542  ENWRKLVEFVKSMSEGGRSTRLPE  1613
             +NW K V FVK M EG  S R  E
Sbjct  526   DNWGKFVAFVKKMGEGRDSHRCRE  549



>gb|EAY88485.1| hypothetical protein OsI_09956 [Oryza sativa Indica Group]
 gb|EAZ25531.1| hypothetical protein OsJ_09355 [Oryza sativa Japonica Group]
Length=556

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/432 (63%), Positives = 342/432 (79%), Gaps = 3/432 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGN-LNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPV++M+PLDT+   GN LN+ +++ ASL AL+SAG EG+MVD WWG+ E +GP +YN+ 
Sbjct  92    VPVYVMMPLDTVRKDGNGLNRRKAVEASLKALKSAGAEGIMVDVWWGIAECEGPGRYNFT  151

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GY  L++M +++GLK+Q VMSFHQCGGNVGDS +IPLP WVLEE+ K+ DL YTDRSGRR
Sbjct  152   GYMELMEMAKKNGLKVQAVMSFHQCGGNVGDSVTIPLPKWVLEEMDKDQDLAYTDRSGRR  211

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EY+SLG D +PVL+GRTPVQ Y D+MR+FR+ F  +MGN IVE+QVGMGP GELRYPS
Sbjct  212   NYEYLSLGADAMPVLKGRTPVQCYGDFMRAFRDHFAAFMGNTIVEIQVGMGPAGELRYPS  271

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPESNGTWRFPGIGEFQCYD+YM +SL A+AEA GK EWG +GP D+G YN +PED+ FF
Sbjct  272   YPESNGTWRFPGIGEFQCYDRYMLSSLKAAAEAVGKPEWGNAGPGDSGGYNDWPEDSPFF  331

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGT-GAKLSGKIAGIHWHYNTRS  1199
             RR+G W T YG+FF+ WYS  LLEHG+RIL+AA+GV+ GT G K+S K+AGIHWHY TRS
Sbjct  332   RREGGWNTPYGEFFMSWYSQMLLEHGERILSAASGVYTGTPGVKISVKVAGIHWHYGTRS  391

Query  1200  HAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVK  1379
             HAAEL AGYYNTR  +GY PIA MLA+HG V NFTC+EM++ EQP  A C PE LV+QV 
Sbjct  392   HAAELTAGYYNTRHHDGYQPIARMLARHGAVLNFTCVEMRNHEQPQDAQCRPEELVQQVA  451

Query  1380  VATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-LSAFTYLRMNKNLFEPENWRK  1556
              A +++G  LAGENAL RYD   ++Q++ T+   +    + AFTYLRM  +LF+P+NWR+
Sbjct  452   AAARESGVGLAGENALPRYDETAHDQIVTTAAEKAEEERMVAFTYLRMGPDLFQPDNWRR  511

Query  1557  LVEFVKSMSEGG  1592
                FVK M+E G
Sbjct  512   FAAFVKRMTESG  523



>ref|NP_001048926.1| Os03g0141200 [Oryza sativa Japonica Group]
 gb|ABF93905.1| Beta-amylase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10840.1| Os03g0141200 [Oryza sativa Japonica Group]
 dbj|BAG91188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=557

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/432 (63%), Positives = 342/432 (79%), Gaps = 3/432 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGN-LNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPV++M+PLDT+   GN LN+ +++ ASL AL+SAG EG+MVD WWG+ E +GP +YN+ 
Sbjct  93    VPVYVMMPLDTVRKDGNGLNRRKAVEASLKALKSAGAEGIMVDVWWGIAECEGPGRYNFT  152

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GY  L++M +++GLK+Q VMSFHQCGGNVGDS +IPLP WVLEE+ K+ DL YTDRSGRR
Sbjct  153   GYMELMEMAKKNGLKVQAVMSFHQCGGNVGDSVTIPLPKWVLEEMDKDQDLAYTDRSGRR  212

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EY+SLG D +PVL+GRTPVQ Y D+MR+FR+ F  +MGN IVE+QVGMGP GELRYPS
Sbjct  213   NYEYLSLGADAMPVLKGRTPVQCYGDFMRAFRDHFAAFMGNTIVEIQVGMGPAGELRYPS  272

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPESNGTWRFPGIGEFQCYD+YM +SL A+AEA GK EWG +GP D+G YN +PED+ FF
Sbjct  273   YPESNGTWRFPGIGEFQCYDRYMLSSLKAAAEAVGKPEWGNAGPGDSGGYNDWPEDSPFF  332

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGT-GAKLSGKIAGIHWHYNTRS  1199
             RR+G W T YG+FF+ WYS  LLEHG+RIL+AA+GV+ GT G K+S K+AGIHWHY TRS
Sbjct  333   RREGGWNTPYGEFFMSWYSQMLLEHGERILSAASGVYTGTPGVKISVKVAGIHWHYGTRS  392

Query  1200  HAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVK  1379
             HAAEL AGYYNTR  +GY PIA MLA+HG V NFTC+EM++ EQP  A C PE LV+QV 
Sbjct  393   HAAELTAGYYNTRHHDGYQPIARMLARHGAVLNFTCVEMRNHEQPQDAQCRPEELVQQVA  452

Query  1380  VATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-LSAFTYLRMNKNLFEPENWRK  1556
              A +++G  LAGENAL RYD   ++Q++ T+   +    + AFTYLRM  +LF+P+NWR+
Sbjct  453   AAARESGVGLAGENALPRYDETAHDQIVTTAAEKAEEERMVAFTYLRMGPDLFQPDNWRR  512

Query  1557  LVEFVKSMSEGG  1592
                FVK M+E G
Sbjct  513   FAAFVKRMTESG  524



>ref|XP_010918964.1| PREDICTED: beta-amylase 1, chloroplastic [Elaeis guineensis]
Length=571

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/425 (66%), Positives = 340/425 (80%), Gaps = 2/425 (0%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++MLPLDT+  GG +N+ ++MNASL AL+SAGVEGVMVD WWG+VE++ P +Y+W G
Sbjct  110   VPVYVMLPLDTVRPGGGVNRRKAMNASLQALKSAGVEGVMVDVWWGIVERERPGEYDWGG  169

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             YA L++M +  GLK+Q VMSFHQCGGNVGDSC+IPLP WV+EE+ K+PDL YTD+ GRRN
Sbjct  170   YADLMEMARRIGLKVQAVMSFHQCGGNVGDSCTIPLPRWVVEEMEKDPDLAYTDQWGRRN  229

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLGCD LPVL+GRTP+Q YAD+MR+FR+RF+  +G+ IVE+QVGMGP GE+RYPSY
Sbjct  230   YEYVSLGCDTLPVLKGRTPIQCYADFMRAFRDRFQPLLGSTIVEIQVGMGPAGEIRYPSY  289

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE +GTW+FPGIG FQCYDKY  +SL A+AEA GK EWG  GP DAG YN +PEDT FF+
Sbjct  290   PELHGTWKFPGIGAFQCYDKYTLSSLKAAAEAAGKPEWGHGGPSDAGGYNSWPEDTPFFQ  349

Query  1026  RDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHA  1205
             R+G WK  YG+FFL WYS  LL+HG+R+L+AA  +F G G K+S K+AGIHWHY TRSHA
Sbjct  350   REGGWKGPYGEFFLTWYSQMLLDHGERVLSAATSIFHGAGVKISVKVAGIHWHYGTRSHA  409

Query  1206  AELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVA  1385
             AEL AGYYNTR R+GYLPIA ML +HG VFNFTC+EM+D EQ G A C PEGLVRQV  A
Sbjct  410   AELTAGYYNTRFRDGYLPIAQMLGRHGAVFNFTCVEMRDEEQSGEACCRPEGLVRQVAAA  469

Query  1386  TKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLVE  1565
              + AG  LAGENAL RYD   +EQ++ T+    G  + AFTYLRM   LF+P+NWR+ V 
Sbjct  470   ARAAGVGLAGENALPRYDETAHEQIVQTAV--QGEEMKAFTYLRMGPALFQPDNWRRFVA  527

Query  1566  FVKSM  1580
             FVK M
Sbjct  528   FVKRM  532



>ref|XP_009608726.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana tomentosiformis]
Length=565

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/458 (59%), Positives = 347/458 (76%), Gaps = 9/458 (2%)
 Frame = +3

Query  240   VNEKRERLHGLA-ANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVE  416
             + E R+ L   A   + H     VPV++M+PLD++     +N+ ++M ASL AL+SAGVE
Sbjct  75    LTEARDALAETAEVKKEHKLGKGVPVYVMMPLDSVKTDNTVNRKKAMKASLQALKSAGVE  134

Query  417   GVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLP  596
             G+M+D WWGLVE+D P +YNW GYA +++M ++ GLK+Q VMSFHQCGGNVGDSCSIPLP
Sbjct  135   GIMMDVWWGLVERDAPGEYNWGGYAEVLEMAKKRGLKVQAVMSFHQCGGNVGDSCSIPLP  194

Query  597   PWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEY  776
              WV++EI K+PDL Y+D+ GRRN EYISLGCD LPVL+GRTPV+ Y+D+MR+FR+RF+  
Sbjct  195   GWVVKEIDKDPDLAYSDQWGRRNHEYISLGCDTLPVLKGRTPVECYSDFMRAFRDRFENL  254

Query  777   MGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSE  956
             +G+ IVE+QVGMGP GELRYPSYP  +G W+FPGIG FQCYDKYM +SL  +AE  GK E
Sbjct  255   LGDTIVEIQVGMGPAGELRYPSYPVKDGIWKFPGIGAFQCYDKYMLSSLKVAAEEAGKPE  314

Query  957   WGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF  1133
             WG +GP DAG+YN +PEDT FF+++ G W   YG+FFL WYS  LL+HG+ IL +   +F
Sbjct  315   WGYTGPTDAGEYNNWPEDTTFFKKESGGWNCPYGEFFLTWYSQMLLDHGEGILQSTKAIF  374

Query  1134  QGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCME  1313
             +  G K+S K+AGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+H  +FNFTC+E
Sbjct  375   EKKGVKISVKVAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPIAQMLARHDAIFNFTCIE  434

Query  1314  MKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLAT------SR  1475
             M+D EQP  A C+PE LVRQV +AT++A   LAGENAL RY+   +EQ+L        S+
Sbjct  435   MRDHEQPQDAECAPEKLVRQVALATREAQVPLAGENALPRYNEFAHEQILQASSLNIDSQ  494

Query  1476  SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
             SD    + AFTYLRMN +LF P+NWR+ + FVK +++G
Sbjct  495   SDD-RQMCAFTYLRMNPDLFHPDNWRRFIAFVKKLNDG  531



>ref|XP_003558837.1| PREDICTED: beta-amylase 1, chloroplastic-like [Brachypodium distachyon]
Length=573

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/432 (64%), Positives = 336/432 (78%), Gaps = 3/432 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGN-LNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPVF+M+PLDT+   G+ LN+ ++M ASL AL+SAG EG+MVD WWG+ E + P +YN+ 
Sbjct  109   VPVFVMMPLDTVRKDGSALNRRKAMQASLAALKSAGAEGIMVDVWWGIAESEAPGQYNFA  168

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GY  L+++ ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+ DL YTDR GRR
Sbjct  169   GYIELMELAKKAGLKVQAVMSFHQCGGNVGDSVNIPLPKWVIEEMDKDQDLAYTDRCGRR  228

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EYISLG D LP L+GRTP+Q YAD+MR+FR+    YMGN IVE+QVGMGP GELRYPS
Sbjct  229   NYEYISLGADALPALKGRTPIQCYADFMRAFRDHMAPYMGNTIVEIQVGMGPAGELRYPS  288

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPESNGTW FPGIGEFQCYD+YM +SL A+AE+ GK EWG +GP D+G YNQ+PEDT FF
Sbjct  289   YPESNGTWSFPGIGEFQCYDRYMLSSLKAAAESVGKPEWGNAGPGDSGSYNQWPEDTNFF  348

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGT-GAKLSGKIAGIHWHYNTRS  1199
             RR+G W TEYGQFF+ WYS  LLEHG+RIL+A + V+ GT G K+S K+AGIHWHY TRS
Sbjct  349   RREGGWNTEYGQFFMSWYSQMLLEHGERILSATSSVYTGTPGVKVSVKVAGIHWHYGTRS  408

Query  1200  HAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVK  1379
             HA EL AGYYNTR  +GY PIA ML +HG V NFTC+EM++ EQP  A C PE LV+QV 
Sbjct  409   HAPELTAGYYNTRNHDGYQPIARMLGRHGAVLNFTCVEMRNHEQPQDAQCMPENLVQQVA  468

Query  1380  VATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-LSAFTYLRMNKNLFEPENWRK  1556
              A K+AG  LAGENAL RYD   ++QVLAT+   +    + AFTYLRM  +LF+P+NWR+
Sbjct  469   NAAKEAGIGLAGENALPRYDETAHDQVLATAAEKAEEERMVAFTYLRMGPDLFQPDNWRR  528

Query  1557  LVEFVKSMSEGG  1592
                FVK M+E G
Sbjct  529   FAAFVKRMTETG  540



>ref|XP_004168709.1| PREDICTED: beta-amylase 3, chloroplastic-like, partial [Cucumis 
sativus]
Length=341

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/336 (81%), Positives = 300/336 (89%), Gaps = 1/336 (0%)
 Frame = +3

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
             PEYISLGCD LPVLRGRTP+QVYADYMRSFR+RF++Y+G VI EVQVG GPCGELRYPSY
Sbjct  1     PEYISLGCDSLPVLRGRTPIQVYADYMRSFRDRFRDYLGEVITEVQVGAGPCGELRYPSY  60

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSG-PHDAGQYNQFPEDTGFF  1022
             PESNGTWRFPGIGEFQCYDKYMRASL A+AEA GK +WG SG PHD+GQYNQFPEDTGFF
Sbjct  61    PESNGTWRFPGIGEFQCYDKYMRASLEAAAEAIGKRDWGSSGGPHDSGQYNQFPEDTGFF  120

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             +++GTWKTEYG+FFL WYS KLL+HGD IL AA G+F+GTGAKLS K+AGIHWHY TRSH
Sbjct  121   KKEGTWKTEYGEFFLAWYSSKLLQHGDSILAAAKGIFRGTGAKLSAKVAGIHWHYGTRSH  180

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             AAEL AGYYNTR R+GY PIA MLAKHGVVFNFTCMEM+DG+QPG ANCSPEGLVRQVK+
Sbjct  181   AAELTAGYYNTRHRDGYSPIAKMLAKHGVVFNFTCMEMRDGQQPGHANCSPEGLVRQVKM  240

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLV  1562
             AT+DA  ELAGENALERYD   YEQ+LATSRSDSGNGL+AFTYLRMNKNLFEP NWR LV
Sbjct  241   ATRDAKVELAGENALERYDGAAYEQILATSRSDSGNGLAAFTYLRMNKNLFEPNNWRNLV  300

Query  1563  EFVKSMSEGGRSTRLPECDSSRTDLYVGLIKKRNAK  1670
             EFVKSMSEGGR+ RLPE D   +DL+VG IK++  K
Sbjct  301   EFVKSMSEGGRNRRLPESDCCGSDLHVGFIKEKKIK  336



>ref|XP_004985749.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X1 [Setaria 
italica]
Length=603

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/503 (58%), Positives = 353/503 (70%), Gaps = 44/503 (9%)
 Frame = +3

Query  216   LSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGN-LNKPRSMNASLM  392
             L+   +  V    E  H   A +  S +  VPVF+M+PLDT+   GN LN+ R++ ASL 
Sbjct  70    LAMACQALVEAAPEAEHADVAAELKSKAG-VPVFVMMPLDTVRKDGNSLNRRRAVEASLA  128

Query  393   ALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVG  572
             AL+SAGVEG+MVD WWG+ E +GP +YN+ GY  L++M +++GLK+Q VMSFHQCGGNVG
Sbjct  129   ALKSAGVEGIMVDVWWGIAEAEGPGQYNFNGYMELMEMARKNGLKVQAVMSFHQCGGNVG  188

Query  573   DSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRS  752
             DS +IPLP WVLEE+ K+ DL YTDRSGRRN EY+SLGCD LPVL+GRTP+Q YAD+MR+
Sbjct  189   DSVTIPLPKWVLEEMDKDQDLAYTDRSGRRNYEYVSLGCDALPVLKGRTPIQCYADFMRA  248

Query  753   FRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDK---------  905
             FR+ F  YMGN IVE+QVGMGP GELRYPSYPESNGTW FPGIGEFQCYD+         
Sbjct  249   FRDHFATYMGNTIVEIQVGMGPAGELRYPSYPESNGTWSFPGIGEFQCYDRVCSSAPFVF  308

Query  906   -------------------------------YMRASLAASAEAHGKSEWGRSGPHDAGQY  992
                                            YM +SL A+AEA GK EWG +GP D+G Y
Sbjct  309   SVVLIDKREQHPSSVISSVSVADVNVSFGVQYMLSSLKAAAEAVGKPEWGNAGPGDSGSY  368

Query  993   NQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGT-GAKLSGKIA  1169
               +PEDT FFRR+G W TEYGQFF+ WYS  LLEHG+RIL+AA GVF  + G K+S K+A
Sbjct  369   KDWPEDTPFFRREGGWNTEYGQFFMSWYSQMLLEHGERILSAATGVFTASPGVKISVKVA  428

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHWHY TRSHAAEL AGYYNTR  +GY PIA ML +HG V NFTC+EM+D EQP  A C
Sbjct  429   GIHWHYGTRSHAAELTAGYYNTRHHDGYQPIARMLGRHGAVLNFTCVEMRDHEQPQDAQC  488

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-LSAFTYLRMNK  1526
              PE LV+QV +A +DAG  LAGENAL RYD   ++QV+AT+   +    + AFTYLRM  
Sbjct  489   RPEALVQQVALAARDAGVGLAGENALPRYDETAHDQVVATAAEKAEEERMVAFTYLRMGP  548

Query  1527  NLFEPENWRKLVEFVKSMSEGGR  1595
             +LF+P+NWR+   FVK MS  G+
Sbjct  549   DLFQPDNWRRFAAFVKRMSGAGK  571



>ref|XP_010550849.1| PREDICTED: beta-amylase 1, chloroplastic [Tarenaya hassleriana]
Length=591

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/416 (66%), Positives = 331/416 (80%), Gaps = 8/416 (2%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+M+PLD++TMG  +N+ ++M ASL AL+SAGVEG+M+D WWGLVE++ P  YNW G
Sbjct  116   VPVFVMMPLDSVTMGNTVNRKKAMKASLQALKSAGVEGIMIDVWWGLVERESPGVYNWGG  175

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M Q+ GLK+Q VMSFHQCGGNVGDSC+IPLP WV+EEI K+ DL YTD+ GRRN
Sbjct  176   YNELLEMAQKLGLKVQAVMSFHQCGGNVGDSCTIPLPKWVVEEIEKDQDLAYTDQWGRRN  235

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLGCD +PVL+GRTPVQ YAD+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  236   YEYISLGCDTIPVLKGRTPVQCYADFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  295

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTW+FPGIG FQCYDKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FFR
Sbjct  296   PEQNGTWKFPGIGAFQCYDKYMISSLKAAAEAAGKPEWGSTGPTDAGHYNNWPEDTQFFR  355

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W TEYG+FFL WYS  LL+HG+RIL++A  VF+ T  K+S KIAGIHWHY +RSH
Sbjct  356   KEGGGWNTEYGEFFLSWYSQMLLDHGERILSSAKSVFENTSTKISVKIAGIHWHYGSRSH  415

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GY+PIA MLA+HG VFNFTC+EM+D EQP  A C+PE LV+QV +
Sbjct  416   APELTAGYYNTRFRDGYIPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVKQVAM  475

Query  1383  ATKDagaelagenaleRYDSRGYEQVL---ATSRSDSGNG----LSAFTYLRMNKN  1529
             AT++A   LAGENAL RYD   +EQ+L   A S     NG    + AFTYLRMN +
Sbjct  476   ATREAEVALAGENALPRYDEYAHEQILKASALSLDGDKNGGNKEMCAFTYLRMNPD  531



>emb|CDX93004.1| BnaA03g37260D [Brassica napus]
Length=555

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/436 (63%), Positives = 334/436 (77%), Gaps = 8/436 (2%)
 Frame = +3

Query  321   MLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALV  500
             M+PLD++TMG  +N+ ++M ASL ALRS GVEG+M+D WWGLVE++ P  YNW GY  ++
Sbjct  91    MMPLDSVTMGNAVNRRKAMRASLQALRSGGVEGIMIDVWWGLVEREAPGGYNWGGYDEVL  150

Query  501   KMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYIS  680
             +M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+E + K+PDL YTD+ GRRN EYIS
Sbjct  151   EMARKVGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEAVDKDPDLAYTDQWGRRNHEYIS  210

Query  681   LGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNG  860
             LG D LP+L+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSYPE +G
Sbjct  211   LGADTLPLLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSYPEQDG  270

Query  861   TWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRR-DGT  1037
             TW+FPGIG FQCYDKY  +SL A+AEA+GK EWG +GP DAG YN +PEDT FF++ DG 
Sbjct  271   TWKFPGIGAFQCYDKYSLSSLKAAAEAYGKPEWGSTGPTDAGHYNNWPEDTHFFKKEDGG  330

Query  1038  WKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELN  1217
             W TEYG+FFL WYS  LL HG+RIL++A  +FQ TG KLS K+AGIHWHY TRSHA EL 
Sbjct  331   WNTEYGEFFLTWYSQMLLNHGERILSSAKSIFQNTGVKLSAKVAGIHWHYGTRSHAPELT  390

Query  1218  AGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDa  1397
             AGYYNTR RNGYLPIA MLA++  VFNFTC+EM+D EQP  A C+PE LV QV +AT  +
Sbjct  391   AGYYNTRFRNGYLPIAQMLARYNAVFNFTCIEMRDHEQPQDALCAPEQLVNQVALATLAS  450

Query  1398  gaelagenaleRYDSRGYEQVLATS-----RSDSGNG--LSAFTYLRMNKNLFEPENWRK  1556
                LAGENAL RYD   +EQ+L  S     R++ G    + AFTYLRMN  LF  ENW +
Sbjct  451   EVPLAGENALPRYDDYAHEQILKASALIFDRNNEGESREMCAFTYLRMNPELFRAENWGR  510

Query  1557  LVEFVKSMSEGGRSTR  1604
              V FVK M EG  S R
Sbjct  511   FVGFVKRMGEGRDSHR  526



>ref|XP_008775132.1| PREDICTED: beta-amylase 1, chloroplastic [Phoenix dactylifera]
Length=572

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/423 (65%), Positives = 335/423 (79%), Gaps = 2/423 (0%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++MLPLDT+  GG +N+ ++MNASL AL+SAGVEGVMVD WWG+VE + P +Y+W G
Sbjct  111   VPVYVMLPLDTVRPGGGVNRRKAMNASLQALKSAGVEGVMVDVWWGIVEAERPGEYDWGG  170

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y+ L++M +  GLK+Q VMSFHQCGGNVGDSC+IPLP WVLEE+ K+PDL YTD+ GRRN
Sbjct  171   YSDLMEMARRIGLKVQAVMSFHQCGGNVGDSCTIPLPRWVLEEMEKDPDLAYTDQWGRRN  230

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLGCD LP+L+GRTP Q YAD+MR+FR+RF+  +G+ IVE+QVGMGP GELR+PSY
Sbjct  231   YEYVSLGCDALPLLKGRTPAQCYADFMRAFRDRFQPRLGSTIVEIQVGMGPAGELRFPSY  290

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE NGTW++PGIG FQCYDKYM +SL A+AE  GK EWG  GP DAG YN +PED  FF+
Sbjct  291   PELNGTWKYPGIGAFQCYDKYMLSSLKAAAEVAGKPEWGHGGPSDAGNYNSWPEDAPFFQ  350

Query  1026  RDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHA  1205
             R+G W   YG+FFL WYS  LL+HG+R+L+AA  VF G G K+S K+AGIHWHY TRSHA
Sbjct  351   REGGWNGPYGEFFLTWYSQMLLDHGERVLSAATSVFHGAGVKISVKVAGIHWHYGTRSHA  410

Query  1206  AELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVA  1385
              EL AGYYNTR R+GYLPIA ML +HG VFNFTC+EM+D EQ G A C PEGLVRQV  A
Sbjct  411   PELTAGYYNTRFRDGYLPIAQMLGRHGAVFNFTCVEMRDEEQSGEACCRPEGLVRQVAAA  470

Query  1386  TKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLVE  1565
              + AG  LAGENAL RYD   ++Q++ T+    G  + AFTYLRM  +LF+P+NWR+ V 
Sbjct  471   ARAAGVGLAGENALPRYDETAHDQIVQTAV--EGEKMKAFTYLRMGPDLFQPDNWRRFVA  528

Query  1566  FVK  1574
             FVK
Sbjct  529   FVK  531



>ref|XP_004982940.1| PREDICTED: beta-amylase 1, chloroplastic-like [Setaria italica]
Length=543

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/432 (63%), Positives = 332/432 (77%), Gaps = 3/432 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGN-LNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPVF+M+PLDT+   G  LN+ +++ ASL AL+SAGVEGVMVD WWG+ E DGP +YN+ 
Sbjct  82    VPVFVMMPLDTVKKCGTALNRRKAVQASLAALKSAGVEGVMVDVWWGIAESDGPGRYNFA  141

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GYA L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP W LEE+ K+ DL YTD+ GRR
Sbjct  142   GYAELMEMARKTGLKVQAVMSFHQCGGNVGDSVNIPLPRWALEEMEKDQDLCYTDQWGRR  201

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EY+SLGCD +PVL+GRTPV+ Y D+MR+FR+ F +Y+GN IVE+QVGMGP GELRYPS
Sbjct  202   NFEYVSLGCDAMPVLKGRTPVECYTDFMRAFRDHFADYLGNTIVEIQVGMGPAGELRYPS  261

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPESNGTWRFPGIG FQC D+YM +SL A+AEA GK EWG  GP DAG YN +PEDT FF
Sbjct  262   YPESNGTWRFPGIGAFQCNDRYMLSSLKAAAEAAGKPEWGHGGPTDAGSYNNWPEDTIFF  321

Query  1023  RRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRS  1199
             RR+ G W TEYG FFL WYS  L+EHGDRILT A+ VF  +  ++S K+AGIHWHY TRS
Sbjct  322   RRENGGWSTEYGDFFLSWYSQMLMEHGDRILTGASSVFSASPVEVSVKVAGIHWHYGTRS  381

Query  1200  HAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVK  1379
             HA EL AGYYNTR  +GYLP+A +LA+HG V NFTC+EM+D EQP  A C PE LVRQV 
Sbjct  382   HAPELTAGYYNTRHHDGYLPVARLLARHGAVLNFTCVEMRDHEQPQDAQCMPEALVRQVG  441

Query  1380  VATKDagaelagenaleRYDSRGYEQVLATSRSDSG-NGLSAFTYLRMNKNLFEPENWRK  1556
              A + AG  LAGENAL RYD   ++QV++T+   +  + + AFTYLRM  +LF P+NW +
Sbjct  442   AAARAAGVGLAGENALPRYDGAAHDQVVSTAAERAAEDRMVAFTYLRMGADLFHPDNWHR  501

Query  1557  LVEFVKSMSEGG  1592
                FV+ M   G
Sbjct  502   FAAFVRRMDGAG  513



>ref|XP_009135884.1| PREDICTED: beta-amylase 1, chloroplastic-like [Brassica rapa]
Length=564

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/436 (62%), Positives = 334/436 (77%), Gaps = 8/436 (2%)
 Frame = +3

Query  321   MLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALV  500
             M+PLD++TMG  +N+ ++M ASL ALRS GVEG+M+D WWGLVE++ P  YNW GY  ++
Sbjct  100   MMPLDSVTMGNAVNRRKAMRASLQALRSGGVEGIMIDVWWGLVEREAPGGYNWGGYDEVL  159

Query  501   KMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYIS  680
             +M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+  +PDL YTD+ GRRN EYIS
Sbjct  160   EMARKVGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDNDPDLGYTDQWGRRNHEYIS  219

Query  681   LGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNG  860
             LG D LP+L+GRTPVQ Y+D+MR+FR+ F+  +G+ IVE+QVGMGP GELRYPSYPE +G
Sbjct  220   LGADTLPLLKGRTPVQCYSDFMRAFRDNFRHLLGDTIVEIQVGMGPAGELRYPSYPEQDG  279

Query  861   TWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRR-DGT  1037
             TW+FPGIG FQCYDKY  +SL A+AEA+GK EWG +GP DAG YN +PEDT FF++ DG 
Sbjct  280   TWKFPGIGAFQCYDKYSLSSLKAAAEAYGKPEWGSTGPTDAGHYNNWPEDTHFFKKEDGG  339

Query  1038  WKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELN  1217
             W TEYG+FFL WYS  LL+HG+RIL++A  +F+ T  K+S K+AGIHWHY TRSHA EL 
Sbjct  340   WNTEYGEFFLTWYSQMLLDHGERILSSAKSIFESTSVKISAKVAGIHWHYGTRSHAPELT  399

Query  1218  AGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDa  1397
             AGYYNTR R+GYLPIA MLA+H  VFNFTC+EM+D EQP  A C+PE LV QV +AT  +
Sbjct  400   AGYYNTRFRDGYLPIAQMLARHKAVFNFTCIEMRDHEQPQDALCAPEQLVNQVALATLAS  459

Query  1398  gaelagenaleRYDSRGYEQVLATS-----RSDSGNG--LSAFTYLRMNKNLFEPENWRK  1556
                LAGENAL RYD   +EQ+L  S     R++ G    + AFTYLRMN  LF  ENW +
Sbjct  460   EVPLAGENALPRYDDYAHEQILKASALIFDRNNEGESREMCAFTYLRMNPELFRAENWGR  519

Query  1557  LVEFVKSMSEGGRSTR  1604
              V FVK M EG  S R
Sbjct  520   FVGFVKRMGEGRDSHR  535



>ref|XP_002468533.1| hypothetical protein SORBIDRAFT_01g047500 [Sorghum bicolor]
 gb|EER95531.1| hypothetical protein SORBIDRAFT_01g047500 [Sorghum bicolor]
Length=564

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/432 (65%), Positives = 343/432 (79%), Gaps = 3/432 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGN-LNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPVF+M+PLDT+   GN LN+ +++ ASL AL+SAGVEG+MVD WWG+ E DGP +YN+ 
Sbjct  100   VPVFVMMPLDTVRKDGNSLNRRKAVEASLAALKSAGVEGIMVDVWWGIAEADGPGQYNFN  159

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+ DL YTDRSGRR
Sbjct  160   GYMELMEMARKTGLKVQAVMSFHQCGGNVGDSVTIPLPRWVVEEMDKDQDLAYTDRSGRR  219

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EY+SLGCD LPVL+GRTP+Q YAD+MR+FR+ F  +MGN IVE+QVGMGP GELRYPS
Sbjct  220   NYEYVSLGCDTLPVLKGRTPIQCYADFMRAFRDHFATFMGNTIVEIQVGMGPAGELRYPS  279

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPES+GTW FPGIGEFQCYD+YM +SL A+AE+ GK EWG  GP DAG Y  +PEDTGFF
Sbjct  280   YPESDGTWSFPGIGEFQCYDRYMLSSLKAAAESVGKPEWGNGGPGDAGGYKNWPEDTGFF  339

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGT-GAKLSGKIAGIHWHYNTRS  1199
             RR+G W  EYGQFF+ WYS  LLEHG+RIL+AA GV+ G+ G K+S K+AGIHWHY TRS
Sbjct  340   RREGGWSNEYGQFFMSWYSQMLLEHGERILSAATGVYTGSPGVKISVKVAGIHWHYGTRS  399

Query  1200  HAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVK  1379
             HAAEL AGYYNTR  +GY PIA MLA+HG V NFTC+EM+D EQP  A C PE LV+QV 
Sbjct  400   HAAELTAGYYNTRHHDGYAPIARMLARHGAVLNFTCVEMRDHEQPQDAQCRPEALVQQVA  459

Query  1380  VATKDagaelagenaleRYDSRGYEQVLATSRSDSG-NGLSAFTYLRMNKNLFEPENWRK  1556
              A ++AG  LAGENAL RYD   ++QV+AT+   +  + + AFTYLRM  +LF+P+NWR+
Sbjct  460   AAAREAGVGLAGENALPRYDETAHDQVVATAADRAAEDRMVAFTYLRMGPDLFQPDNWRR  519

Query  1557  LVEFVKSMSEGG  1592
                FVK MS+ G
Sbjct  520   FAAFVKRMSQPG  531



>gb|ABK24605.1| unknown [Picea sitchensis]
Length=492

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/471 (59%), Positives = 346/471 (73%), Gaps = 12/471 (3%)
 Frame = +3

Query  198   MQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSM  377
             M ++AL ++ L  R  E+  R+    + + H     VPVF+ LPLD++T    +N+ ++M
Sbjct  1     MSDSALKNE-LGLRFAEQYGRILPSISTRDHGG---VPVFVKLPLDSVTSKHTVNRRKAM  56

Query  378   NASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQC  557
             +ASLMAL+SAGVEGVMV+ WWGLVE++ P +YNW  Y  L++MV++ GLK+Q VMSFH+C
Sbjct  57    DASLMALKSAGVEGVMVNVWWGLVEREAPGEYNWSAYRELLEMVRKRGLKVQAVMSFHKC  116

Query  558   GGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYA  737
             GGNVGDS SIPLP WV+EEI ++ DL YTD+  RRN EYISLGCD LPVL+GRTPVQ Y+
Sbjct  117   GGNVGDSVSIPLPKWVVEEIDRDNDLAYTDQWERRNYEYISLGCDNLPVLKGRTPVQCYS  176

Query  738   DYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRA  917
             D+MRSF+E F + MG  +VE+QVGMGP GELRYPSYPESNGTW+FPGIG FQCYDKYM A
Sbjct  177   DFMRSFKENFTDLMGETVVEIQVGMGPAGELRYPSYPESNGTWKFPGIGAFQCYDKYMLA  236

Query  918   SLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEH  1097
             +L A+AE  GK EWG  GP +AG YN + E+T FF  +G W + YG+FFL+WYS  LL H
Sbjct  237   NLKATAETAGKKEWGCGGPTNAGYYNNWSEETEFFCSEGGWNSPYGEFFLQWYSNMLLNH  296

Query  1098  GDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLA  1277
             G+RIL  A  +F  +GA+LSGK+AGIHWHY TRSHA EL AGYYNT +R+GYLPIA M  
Sbjct  297   GERILAEAESIFHKSGARLSGKVAGIHWHYLTRSHAPELTAGYYNTGDRDGYLPIAQMFG  356

Query  1278  KHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQ  1457
             +HGVVF FTC+EMKD EQP  A CSPE L++QV  AT+ A   LAGENAL R+D   Y Q
Sbjct  357   RHGVVFIFTCIEMKDVEQPADAKCSPEKLIKQVIKATRKARIHLAGENALPRFDEAAYTQ  416

Query  1458  VLATS--------RSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSE  1586
             VL  S          D    + AFTYLRM+++LF+ +NW   V FV+ MS+
Sbjct  417   VLNNSCLRLEQDNPDDKIEPMCAFTYLRMSQHLFQSKNWSTFVSFVRRMSQ  467



>ref|XP_002975660.1| hypothetical protein SELMODRAFT_232533 [Selaginella moellendorffii]
 gb|EFJ23289.1| hypothetical protein SELMODRAFT_232533 [Selaginella moellendorffii]
Length=472

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/445 (61%), Positives = 330/445 (74%), Gaps = 20/445 (4%)
 Frame = +3

Query  321   MLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALV  500
             MLPLD++ +   LN+ R++NA L+AL+SAGVEGVMVD WWG+VE++ P  Y W  Y  LV
Sbjct  1     MLPLDSVNVNNTLNRRRALNAGLIALKSAGVEGVMVDVWWGIVEREKPHHYKWSAYKELV  60

Query  501   KMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYIS  680
              ++Q++GLK+QVVMSFHQCGGNVGDSC IPLP WVLEE+  NP++VYTD+SG RN EY+S
Sbjct  61    SLIQKNGLKIQVVMSFHQCGGNVGDSCYIPLPLWVLEEVQNNPNIVYTDKSGNRNHEYLS  120

Query  681   LGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNG  860
             LGCD LPVLRGRTP+Q Y+D+MRSF+  FK+ +G  IVEVQVG+GP GELRYP+YPE NG
Sbjct  121   LGCDFLPVLRGRTPIQAYSDFMRSFKHVFKDVLGETIVEVQVGLGPAGELRYPAYPEYNG  180

Query  861   TWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTW  1040
              WRFPGIGEFQCYDKYM ASL A A A G   WG+ GPHDAG YNQ+P+DTGFF RDG+W
Sbjct  181   KWRFPGIGEFQCYDKYMLASLRACATACGTKHWGQGGPHDAGHYNQWPDDTGFFNRDGSW  240

Query  1041  KTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNA  1220
              + YGQFFLEWYSG L+ HG+R+L+AA  VF+G G KL+GK+AG+HWHY T+ H AEL A
Sbjct  241   NSPYGQFFLEWYSGMLISHGERVLSAAEAVFRGAGIKLAGKVAGVHWHYGTKPHPAELTA  300

Query  1221  GYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDag  1400
             GYYNTR R+GY  +A M  +HG V  FTC+EM+D EQP  A  SPE L+ QV  A K AG
Sbjct  301   GYYNTRLRDGYTGLARMFGRHGAVMIFTCLEMRDLEQPPHALSSPESLLHQVVSACKQAG  360

Query  1401  aelagenaleRYDSRGYEQVLATSR-----------SDSGNGLS--------AFTYLRMN  1523
               LAGENAL R+D   YEQV+  SR           S S  G S        +FT+LRM+
Sbjct  361   ISLAGENALPRFDEAAYEQVVKKSRMQESEEEDDWISASSGGCSSTACEPMCSFTFLRMS  420

Query  1524  KNLFEPENWRKLVEFVKSMSEGGRS  1598
             + LF  ENW   V FV+ M+ GGR+
Sbjct  421   EKLFYSENWHNFVPFVRRMA-GGRA  444



>ref|XP_002978844.1| hypothetical protein SELMODRAFT_233213 [Selaginella moellendorffii]
 gb|EFJ20291.1| hypothetical protein SELMODRAFT_233213 [Selaginella moellendorffii]
Length=472

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/445 (60%), Positives = 326/445 (73%), Gaps = 20/445 (4%)
 Frame = +3

Query  321   MLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALV  500
             MLPLD++ +   LN+ R++NA L+AL+SAGVEGVMVD WWG+VE++ P  Y W  Y  LV
Sbjct  1     MLPLDSVNVNNTLNRRRALNAGLIALKSAGVEGVMVDVWWGIVEREKPQHYKWSAYKELV  60

Query  501   KMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYIS  680
              +VQ++GLK+QVVMSFHQCGGNVGDSC IPLP WVLEE+  NP++VYTD+SG RN EY+S
Sbjct  61    SLVQKNGLKVQVVMSFHQCGGNVGDSCYIPLPLWVLEEVQNNPNIVYTDKSGNRNHEYLS  120

Query  681   LGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNG  860
             LGCD LPVLRGRTP+Q Y+D+MRSF+  F + +G  IVEVQVG+GP GELRYP+YPE NG
Sbjct  121   LGCDFLPVLRGRTPIQAYSDFMRSFKHAFTDVLGETIVEVQVGLGPAGELRYPAYPEYNG  180

Query  861   TWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTW  1040
              WRFPGIGEFQCYD+YM ASL A A A G   WG+ GPHDAG YNQ+P++TGFF RDG+W
Sbjct  181   KWRFPGIGEFQCYDEYMLASLRACATACGTKHWGQGGPHDAGHYNQWPDETGFFNRDGSW  240

Query  1041  KTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNA  1220
              + YGQFFLEWYSG L  HG+R+L+ A  VF+GTG KL+GK+AG+HWHY TR H AEL A
Sbjct  241   NSPYGQFFLEWYSGMLTSHGERVLSTAEAVFRGTGIKLAGKVAGVHWHYGTRPHPAELTA  300

Query  1221  GYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDag  1400
             GYYNTR R+GY  +A M  +HGVV  FTC+EM+D EQP  A  SPE L+ QV  A K AG
Sbjct  301   GYYNTRLRDGYTGLARMFGRHGVVMIFTCVEMRDLEQPPHALSSPESLLHQVVSACKQAG  360

Query  1401  aelagenaleRYDSRGYEQVLATSRSDSGNG-------------------LSAFTYLRMN  1523
               LAGENAL R+D   YEQVL  SR                         + +FT+LRM+
Sbjct  361   ISLAGENALPRFDEAAYEQVLKKSRMQESEDEDDWISPSSSGCSSTACEPMCSFTFLRMS  420

Query  1524  KNLFEPENWRKLVEFVKSMSEGGRS  1598
             + LF  ENW   V FV+ M+ GGR+
Sbjct  421   EKLFYSENWHNFVPFVRRMA-GGRA  444



>ref|NP_001147532.1| beta-amylase [Zea mays]
 gb|ACF86357.1| unknown [Zea mays]
 gb|ACG27842.1| beta-amylase [Zea mays]
 gb|AFW68644.1| beta-amylase [Zea mays]
Length=544

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/435 (62%), Positives = 331/435 (76%), Gaps = 3/435 (1%)
 Frame = +3

Query  297   SSRVPVFIMLPLDTIT-MGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKY  473
             SS VPVF+M+PLDT+   G  L++ +++ ASL AL+SAGVEGVMVD WWG+ E+DGP +Y
Sbjct  80    SSGVPVFVMMPLDTVKECGTALHRRKAVQASLSALKSAGVEGVMVDVWWGIAERDGPGRY  139

Query  474   NWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRS  653
             N+ GYA L++M ++ GLK+Q VMSFHQCGGNVGDS SIPLP W  EE+ ++ DL YTD+ 
Sbjct  140   NFAGYAELMEMARKAGLKVQAVMSFHQCGGNVGDSVSIPLPRWAAEEMERDQDLCYTDQW  199

Query  654   GRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELR  833
             GRRN EY+SLGCD +PVL+GRTPV+ Y D+MR+FR+ F +Y+GN IVE+QVGMGP GELR
Sbjct  200   GRRNYEYVSLGCDAMPVLKGRTPVECYTDFMRAFRDHFADYLGNTIVEIQVGMGPAGELR  259

Query  834   YPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDT  1013
             YPSYPESNGTW+FPGIG FQC D+YMR+ L A+AEA GK EWG  GP DAG YN +PEDT
Sbjct  260   YPSYPESNGTWKFPGIGAFQCNDRYMRSRLKAAAEAAGKPEWGHGGPTDAGGYNNWPEDT  319

Query  1014  GFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYN  1190
              FFR D G W TEYG FFL WYS  LLEHGDRIL+ A  VF     ++S K+AGIHWHY 
Sbjct  320   VFFRGDNGGWSTEYGDFFLSWYSQMLLEHGDRILSGATSVFGAAPVEVSVKVAGIHWHYG  379

Query  1191  TRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVR  1370
             +RSHA EL AGYYNTR  +GYL IA +LA+HG V NFTC+EM+D EQP  A C PE LVR
Sbjct  380   SRSHAPELTAGYYNTRRHDGYLTIARLLARHGAVLNFTCVEMRDHEQPQEARCMPEALVR  439

Query  1371  QVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG-NGLSAFTYLRMNKNLFEPEN  1547
             QV  A + AG  LAGENAL RYD   ++QV+ T+   +  + + AFTYLRM  +LF P+N
Sbjct  440   QVGAAARAAGVGLAGENALPRYDGTAHDQVVTTAAERAAEDRMVAFTYLRMGPDLFHPDN  499

Query  1548  WRKLVEFVKSMSEGG  1592
             WR+   FV+ M+  G
Sbjct  500   WRRFAAFVRRMNGAG  514



>ref|XP_007035341.1| Beta-amylase 1 isoform 2, partial [Theobroma cacao]
 gb|EOY06267.1| Beta-amylase 1 isoform 2, partial [Theobroma cacao]
Length=521

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/362 (69%), Positives = 301/362 (83%), Gaps = 1/362 (0%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++M+PLD++T G  LN+ ++MNASL AL+SAGVEG+MVD WWGLVE++ P  YNW G
Sbjct  145   VPVYVMMPLDSVTYGNTLNRKKAMNASLHALKSAGVEGIMVDVWWGLVEREAPGAYNWGG  204

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             YA L++M ++HGLK+Q VMSFHQCGGNVGDSC+IPLP WV+EEI K+PD+ YTD+ GRRN
Sbjct  205   YAELLEMAKKHGLKVQAVMSFHQCGGNVGDSCTIPLPKWVVEEIDKDPDIAYTDQWGRRN  264

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLGCD LPVL+GRT VQ YAD+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  265   YEYVSLGCDTLPVLKGRTSVQCYADFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  324

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PE +GTWRFPGIG FQCYDKYM +SL A+AEA GK EWG +GP DAG YN +PEDT FF+
Sbjct  325   PEQDGTWRFPGIGAFQCYDKYMLSSLKAAAEAVGKPEWGSTGPTDAGHYNYWPEDTPFFK  384

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             ++ G W + YG+FFL WYS  LL+HG+RIL++A  VF+G G K+S K+AGIHWHY TRSH
Sbjct  385   KEGGGWNSRYGEFFLSWYSQMLLDHGERILSSATSVFEGAGVKISVKVAGIHWHYGTRSH  444

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             A EL AGYYNTR R+GYLPIA MLA+HG VFNFTC+EM+D EQP  A C+PE LVRQV +
Sbjct  445   APELTAGYYNTRFRDGYLPIAQMLARHGAVFNFTCIEMRDHEQPQDALCAPEKLVRQVAL  504

Query  1383  AT  1388
             AT
Sbjct  505   AT  506



>ref|XP_002467119.1| hypothetical protein SORBIDRAFT_01g019850 [Sorghum bicolor]
 gb|EER94117.1| hypothetical protein SORBIDRAFT_01g019850 [Sorghum bicolor]
Length=547

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/446 (61%), Positives = 339/446 (76%), Gaps = 6/446 (1%)
 Frame = +3

Query  273   AANQSHSSSSR--VPVFIMLPLDTIT-MGGNLNKPRSMNASLMALRSAGVEGVMVDAWWG  443
             AA+++ S+  R  VPVF+M+PLDT+   G  LN+ +++ ASL AL+SAGVEG+MVD WWG
Sbjct  72    AADRAASTRRRSGVPVFVMMPLDTVKKCGSALNRRKAVQASLSALKSAGVEGIMVDVWWG  131

Query  444   LVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISK  623
             + E DGP +YN+ GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP W +EE+ K
Sbjct  132   IAESDGPGRYNFAGYMELMEMARKAGLKVQAVMSFHQCGGNVGDSVNIPLPRWAVEEMEK  191

Query  624   NPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQ  803
             + DL YTD+ GRRN EY+SLGCD +PVL+GRTPV+ Y D+MR+FR+ F +Y+GN IVE+Q
Sbjct  192   DQDLCYTDQWGRRNYEYVSLGCDAMPVLKGRTPVECYTDFMRAFRDHFADYLGNTIVEIQ  251

Query  804   VGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDA  983
             VGMGP GELRYPSYPESNGTW+FPGIG FQC D++MR+SL A+AEA GK EWG  GP DA
Sbjct  252   VGMGPAGELRYPSYPESNGTWKFPGIGAFQCNDRHMRSSLKAAAEAAGKPEWGHGGPTDA  311

Query  984   GQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTG-AKLS  1157
             G YN +PEDT FFR D G W T+YG FFL WYS  LLEHGDRIL+ A  VF  +   ++S
Sbjct  312   GGYNNWPEDTLFFRADNGGWSTQYGDFFLSWYSQMLLEHGDRILSGATSVFGASSPVEVS  371

Query  1158  GKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPG  1337
              K+AGIHWHY TRSHA EL AGYYNTR  +GY PIA +LA+HG V NFTC+EM+D EQP 
Sbjct  372   VKVAGIHWHYGTRSHAPELTAGYYNTRHHDGYRPIADLLARHGAVLNFTCVEMRDHEQPQ  431

Query  1338  SANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSG-NGLSAFTYL  1514
              A C PE LVRQV  A + AG  LAGENAL RYD   ++QV+AT+   +  + + AFTYL
Sbjct  432   EAQCMPEHLVRQVGAAARAAGVGLAGENALPRYDGTAHDQVVATAAQRAAEDRMVAFTYL  491

Query  1515  RMNKNLFEPENWRKLVEFVKSMSEGG  1592
             RM  +LF P+NW++   FV+ M+  G
Sbjct  492   RMGPDLFHPDNWQRFAAFVRRMNGAG  517



>ref|XP_010111574.1| Beta-amylase 1 [Morus notabilis]
 gb|EXC31281.1| Beta-amylase 1 [Morus notabilis]
Length=604

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/439 (62%), Positives = 327/439 (74%), Gaps = 9/439 (2%)
 Frame = +3

Query  300   SRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNW  479
             S VPV++M+PL+++ M   ++K ++M  SL AL+SAGVEG+M+D WWGLVE D P  YNW
Sbjct  133   SGVPVYVMMPLNSVMMNHTVHKRKAMEMSLRALKSAGVEGIMLDVWWGLVEGDAPGAYNW  192

Query  480   EGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGR  659
              GY  L++M +  GLK+Q VMSFHQCGGNVGD   IPLP WV+EEI K+ DL YTD+ GR
Sbjct  193   GGYKELMEMAKNLGLKVQAVMSFHQCGGNVGDDVFIPLPKWVVEEIDKDQDLAYTDQWGR  252

Query  660   RNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYP  839
             RN EY+SLG D +P L+GRTPVQ YAD+MR+FR+ FK  +GN IVE+QVGMGP GELRYP
Sbjct  253   RNYEYVSLGADTIPALKGRTPVQCYADFMRAFRDNFKHLLGNTIVEIQVGMGPAGELRYP  312

Query  840   SYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGF  1019
             SYP+ N  W++PGIG FQC+DKYM +SL A AEA GK EWG SGP DAG Y  +PED  F
Sbjct  313   SYPQQNDLWKYPGIGCFQCFDKYMISSLKAVAEAAGKPEWGSSGPTDAGDYKNWPEDAPF  372

Query  1020  FRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTR  1196
             F+++ G W + YG+FFL WYS  L+ HG+RILT+A  VF+ TG K+S KIAGIHWHY TR
Sbjct  373   FKKEGGGWNSPYGEFFLTWYSQMLIGHGERILTSAKSVFENTGVKISVKIAGIHWHYGTR  432

Query  1197  SHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGS---ANCSPEGLV  1367
             SHA EL AGYYNTR R+GYLPIA ML++HG VFNFTC+EM+D EQ G    A CSPE LV
Sbjct  433   SHAPELTAGYYNTRSRDGYLPIAQMLSRHGAVFNFTCIEMRDYEQQGDYPGALCSPENLV  492

Query  1368  RQVKVATKDagaelagenaleRYDSRGYEQVLATSR-----SDSGNGLSAFTYLRMNKNL  1532
             RQV +ATK A   LAGENALERYD   YEQ+L  S      +     + AFTYLRMNK L
Sbjct  493   RQVALATKKAQVPLAGENALERYDKDAYEQILQASSLNFEGASGEEEMCAFTYLRMNKEL  552

Query  1533  FEPENWRKLVEFVKSMSEG  1589
             F+ EN  + + FVK M EG
Sbjct  553   FKEENILRFMAFVKKMKEG  571



>gb|EAZ16360.1| hypothetical protein OsJ_31822 [Oryza sativa Japonica Group]
Length=535

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/433 (63%), Positives = 335/433 (77%), Gaps = 4/433 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTIT-MGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPVF+M+PLDT++  G  LN+ +++ ASL AL+SAGVEG+MVD WWG+VE +GP +YN++
Sbjct  73    VPVFVMMPLDTVSKCGSALNRRKAVAASLAALKSAGVEGIMVDVWWGIVESEGPGRYNFD  132

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+ DL YTD+ GRR
Sbjct  133   GYVELMEMARKTGLKVQAVMSFHQCGGNVGDSVNIPLPRWVVEEMEKDNDLAYTDQWGRR  192

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EYISLGCD +PV +GRTPV+ Y D+MR+FR+ F  ++G+ IVE+QVGMGP GELRYPS
Sbjct  193   NFEYISLGCDAMPVFKGRTPVECYTDFMRAFRDHFASFLGDTIVEIQVGMGPAGELRYPS  252

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPESNGTWRFPGIG FQC D+YMR+SL A+AEA GK EWG  GP DAG YN +PEDT FF
Sbjct  253   YPESNGTWRFPGIGAFQCNDRYMRSSLKAAAEARGKPEWGHGGPTDAGGYNNWPEDTVFF  312

Query  1023  RRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF-QGTGAKLSGKIAGIHWHYNTR  1196
             R D G W TEYG+FFL WYS  LLEHG+R+L+ A  VF  G GAK+S K+AGIHWHY TR
Sbjct  313   RGDCGGWSTEYGEFFLSWYSQMLLEHGERVLSGATSVFGDGAGAKISVKVAGIHWHYGTR  372

Query  1197  SHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQV  1376
             SHA EL AGYYNTR R+GYLPIA MLA+HG V NFTC+EM+D EQP  A C PE LVRQV
Sbjct  373   SHAPELTAGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQEAQCMPEALVRQV  432

Query  1377  KVATKDagaelagenaleRYDSRGYEQVLATSRSDSG-NGLSAFTYLRMNKNLFEPENWR  1553
               A + AG  L GENAL RYD   ++ V+ T+ + +  + + A TYLRM  +LF PE W 
Sbjct  433   AAAARAAGFGLPGENALPRYDGTAHDPVITTAANRAAEDRIVALTYLRMGPDLFHPEKWG  492

Query  1554  KLVEFVKSMSEGG  1592
             + V FV+ +SE G
Sbjct  493   RFVAFVRRISEFG  505



>ref|NP_001064798.1| Os10g0465700 [Oryza sativa Japonica Group]
 gb|AAK27799.1|AC022457_2 putative amylase [Oryza sativa Japonica Group]
 gb|AAP54185.1| Glycosyl hydrolase family 14 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26712.1| Os10g0465700 [Oryza sativa Japonica Group]
 dbj|BAG90332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=535

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/433 (64%), Positives = 339/433 (78%), Gaps = 4/433 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTIT-MGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPVF+M+PLDT++  G  LN+ +++ ASL AL+SAGVEG+MVD WWG+VE +GP +YN++
Sbjct  73    VPVFVMMPLDTVSKCGSALNRRKAVAASLAALKSAGVEGIMVDVWWGIVESEGPGRYNFD  132

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+ DL YTD+ GRR
Sbjct  133   GYVELMEMARKTGLKVQAVMSFHQCGGNVGDSVNIPLPRWVVEEMEKDNDLAYTDQWGRR  192

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EYISLGCD +PV +GRTPV+ Y D+MR+FR+ F  ++G+ IVE+QVGMGP GELRYPS
Sbjct  193   NFEYISLGCDAMPVFKGRTPVECYTDFMRAFRDHFASFLGDTIVEIQVGMGPAGELRYPS  252

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPESNGTWRFPGIG FQC D+YMR+SL A+AEA GK EWG  GP DAG YN +PEDT FF
Sbjct  253   YPESNGTWRFPGIGAFQCNDRYMRSSLKAAAEARGKPEWGHGGPTDAGGYNNWPEDTVFF  312

Query  1023  RRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF-QGTGAKLSGKIAGIHWHYNTR  1196
             R D G W TEYG+FFL WYS  LLEHG+R+L+ A  VF  G GAK+S K+AGIHWHY TR
Sbjct  313   RGDCGGWSTEYGEFFLSWYSQMLLEHGERVLSGATSVFGDGAGAKISVKVAGIHWHYGTR  372

Query  1197  SHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQV  1376
             SHA EL AGYYNTR R+GYLPIA MLA+HG V NFTC+EM+D EQP  A C PE LVRQV
Sbjct  373   SHAPELTAGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQEAQCMPEALVRQV  432

Query  1377  KVATKDagaelagenaleRYDSRGYEQVL-ATSRSDSGNGLSAFTYLRMNKNLFEPENWR  1553
               A + AG  LAGENAL RYD   ++QV+ A +   + + + AFTYLRM  +LF P+NWR
Sbjct  433   AAAARAAGVGLAGENALPRYDGTAHDQVVAAAADRAAEDRMVAFTYLRMGPDLFHPDNWR  492

Query  1554  KLVEFVKSMSEGG  1592
             + V FV+ MSE G
Sbjct  493   RFVAFVRRMSESG  505



>gb|AFI71858.1| amylase [Oryza sativa]
Length=535

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/440 (63%), Positives = 341/440 (78%), Gaps = 4/440 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTIT-MGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPVF+M+PLDT++  G  LN+ +++ ASL AL+SAGVEG+MVD WWG+VE +GP +YN++
Sbjct  73    VPVFVMMPLDTVSKCGSALNRRKAVAASLAALKSAGVEGIMVDVWWGIVESEGPGRYNFD  132

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+ DL YTD+ GRR
Sbjct  133   GYVELMEMARKTGLKVQAVMSFHQCGGNVGDSVNIPLPRWVVEEMEKDNDLAYTDQWGRR  192

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EYISLGCD +PV +GRTPV+ Y D+MR+FR+ F  ++G+ IVE+QVGMGP GELRYPS
Sbjct  193   NFEYISLGCDAMPVFKGRTPVECYTDFMRAFRDHFASFLGDTIVEIQVGMGPAGELRYPS  252

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPESNGTWRFPGIG FQC D+YMR+SL A+AEA GK EWG  GP DAG YN +PEDT FF
Sbjct  253   YPESNGTWRFPGIGAFQCNDRYMRSSLKAAAEARGKPEWGHGGPTDAGGYNNWPEDTVFF  312

Query  1023  RRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF-QGTGAKLSGKIAGIHWHYNTR  1196
             R D G W TEYG+FFL WYS  LLEHG+R+L+ A  VF  G GAK+S K+AGIHWHY TR
Sbjct  313   RGDCGGWSTEYGEFFLSWYSQMLLEHGERVLSGATSVFGAGAGAKISVKVAGIHWHYGTR  372

Query  1197  SHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQV  1376
             SHA EL AGYYNTR R+GYLPIA MLA+HG V NFTC+EM+D EQP  A C PE LVRQV
Sbjct  373   SHAPELTAGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQEAQCMPEALVRQV  432

Query  1377  KVATKDagaelagenaleRYDSRGYEQVL-ATSRSDSGNGLSAFTYLRMNKNLFEPENWR  1553
               A + AG  LAGENAL RYD   ++QV+ A +   + + + AFT+LRM  +LF P+NWR
Sbjct  433   AAAARAAGVGLAGENALPRYDGTAHDQVVAAAADRAAEDRMVAFTFLRMGPDLFHPDNWR  492

Query  1554  KLVEFVKSMSEGGRSTRLPE  1613
             + V FV+ MSE G    + E
Sbjct  493   RFVAFVRRMSESGSPREVAE  512



>gb|EAY78842.1| hypothetical protein OsI_33946 [Oryza sativa Indica Group]
Length=536

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/441 (63%), Positives = 339/441 (77%), Gaps = 5/441 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTIT-MGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWE  482
             VPVF+M+PLDT++  G  LN+ +++ ASL AL+SAGVEG+MVD WWG+VE +GP +YN++
Sbjct  73    VPVFVMMPLDTVSKCGSALNRRKAVAASLAALKSAGVEGIMVDVWWGIVESEGPGRYNFD  132

Query  483   GYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRR  662
             GY  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+ DL YTD+ GRR
Sbjct  133   GYVELMEMARKTGLKVQAVMSFHQCGGNVGDSVNIPLPRWVVEEMEKDNDLAYTDQWGRR  192

Query  663   NPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPS  842
             N EYISLGCD +PV +GRTPV+ Y D+MR+FR+ F  ++G+ IVE+QVGMGP GELRYPS
Sbjct  193   NFEYISLGCDAMPVFKGRTPVECYTDFMRAFRDHFASFLGDTIVEIQVGMGPAGELRYPS  252

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YPESNGTWRFPGIG FQC D+YMR+SL A+AEA GK EWG  GP DAG YN +PEDT FF
Sbjct  253   YPESNGTWRFPGIGAFQCNDRYMRSSLKAAAEARGKPEWGHGGPTDAGGYNNWPEDTVFF  312

Query  1023  RRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF-QGTGAKLSGKIAGIHWHYNTR  1196
             R D G W TEYG+FFL WYS  LLEHG+R+L+ A  VF  G GAK+S K+AGIHWHY TR
Sbjct  313   RGDCGGWSTEYGEFFLSWYSQMLLEHGERVLSGATSVFGAGAGAKISVKVAGIHWHYGTR  372

Query  1197  SHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQV  1376
             SHA EL AGYYNTR R+GYLPIA MLA+HG V NFTC+EM+D EQP  A C PE LVRQV
Sbjct  373   SHAPELTAGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQEAQCMPEALVRQV  432

Query  1377  KVATKDagaelagenaleRYDSRGYEQ--VLATSRSDSGNGLSAFTYLRMNKNLFEPENW  1550
               A + AG  LAGENAL RYD   ++Q    A  R+   + + AFTYLRM  +LF P+NW
Sbjct  433   AAAARAAGVGLAGENALPRYDGTAHDQVVAAAADRAAEEDRMVAFTYLRMGPDLFHPDNW  492

Query  1551  RKLVEFVKSMSEGGRSTRLPE  1613
             R+ V FV+ MSE G    + E
Sbjct  493   RRFVAFVRRMSESGSPREVAE  513



>gb|AAL37169.1|AF319168_1 putative chloroplast-targeted beta-amylase [Brassica napus]
Length=569

 Score =   539 bits (1389),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 267/449 (59%), Positives = 331/449 (74%), Gaps = 19/449 (4%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+M+PLD++T+G  +N+ ++M ASL AL+SAGVEG+M+D WWGLVE++ P  YNW G
Sbjct  101   VPVFVMIPLDSVTIGNTVNRRKAMRASLQALKSAGVEGIMIDVWWGLVEREAPGAYNWGG  160

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++ GLK+Q VMSFHQCGGNVGDS +IPLP WV+EE+ K+PDL YTD+ GRRN
Sbjct  161   YNELLEMAKKVGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRN  220

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              E+ISLG D LPVL+GRTPVQ Y+D+MR+FR+ FK  +G+ IVE+QVGMGP GELRYPSY
Sbjct  221   HEHISLGADTLPVLKGRTPVQCYSDFMRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSY  280

Query  846   PESNG-----TWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPED  1010
             PE +G      W  P + +         +SL A+AEA+GK EWG +GP DAG YN +PED
Sbjct  281   PEQDGHEVPRDWSLPVLRQDSL------SSLKAAAEAYGKPEWGGTGPTDAGHYNNWPED  334

Query  1011  TGFFRR-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHY  1187
             T FF++ DG W TEYG FFL WYS  LL+HG+RIL++A  +FQ TG K+S K+AGIHWHY
Sbjct  335   TQFFKKEDGGWNTEYGDFFLTWYSQMLLDHGERILSSAKSIFQDTGVKISVKVAGIHWHY  394

Query  1188  NTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLV  1367
              TRSHA EL AGYYNTR R+GYLPIA MLA+H  +FNFTC+EM+D EQP  A C+PE LV
Sbjct  395   GTRSHAPELTAGYYNTRFRDGYLPIAQMLARHNAIFNFTCIEMRDHEQPQDALCAPEKLV  454

Query  1368  RQVKVATKDagaelagenaleRYDSRGYEQVL---ATSRSDSGNG----LSAFTYLRMNK  1526
              QV +AT  A   LAGENAL RY+   +EQ+L   A S   +  G    + AFTYLRMN 
Sbjct  455   NQVALATLAAEVPLAGENALPRYEDYAHEQILKASALSFDQNSEGENREMCAFTYLRMNP  514

Query  1527  NLFEPENWRKLVEFVKSMSEGGRSTRLPE  1613
              LF+ +NW K V FVK M EG  S R  E
Sbjct  515   ELFKADNWGKFVGFVKKMGEGRDSDRCRE  543



>ref|XP_003571854.1| PREDICTED: beta-amylase 1, chloroplastic-like [Brachypodium distachyon]
Length=534

 Score =   535 bits (1377),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 280/497 (56%), Positives = 356/497 (72%), Gaps = 11/497 (2%)
 Frame = +3

Query  135   SIVCFSQFKRSCHHRLRA--KSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRV  308
             S V  S F  S   R+ A  + +  +   +   L+ R+           A ++ + SS V
Sbjct  8     SAVAASSFAPSTARRVAAPRRKAASQVPPIGLRLQRRLAACEPSRMSSTACRASARSSGV  67

Query  309   PVFIMLPLDTITM-GGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             PVF+MLPLDT+   G  L + ++M ASL AL+SAGVEGVMVD WWG VE +GP +YN+ G
Sbjct  68    PVFVMLPLDTVKQCGSGLKRRKAMAASLAALKSAGVEGVMVDVWWGTVESEGPGRYNFAG  127

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L++M ++ GLK+Q VMSFH+CGGNVGDS +IPLP WV EE+ K+ DL YTD+  RRN
Sbjct  128   YMELMEMARDTGLKVQAVMSFHKCGGNVGDSVTIPLPRWVTEEMDKDQDLAYTDQWERRN  187

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EY+SLGCD +PVL GR PVQ Y D+MR+FR+ F  ++GN IVE+QVG+GP GELR+PSY
Sbjct  188   YEYVSLGCDAVPVLNGRAPVQCYTDFMRAFRDHFTRFLGNTIVEIQVGLGPAGELRFPSY  247

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PESNGTWRFPGIG FQCY++YM +SL ++AEA GK EWG SGP DAG+YN +PEDT FFR
Sbjct  248   PESNGTWRFPGIGAFQCYNRYMLSSLKSAAEAAGKPEWGISGPTDAGEYNSWPEDTLFFR  307

Query  1026  RD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGA------KLSGKIAGIHWH  1184
             +D G W  EYG+FF+ WYS  LL+HGDR+L+ AA VF  + +      +LS K++GIHWH
Sbjct  308   QDGGGWGCEYGEFFMSWYSQMLLDHGDRVLSGAASVFSASASPDVDDIRLSAKVSGIHWH  367

Query  1185  YNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGL  1364
             Y TRSHA EL AGYYNT +R+GY P+A MLA+HG V NFTC+EM+D EQP  A C PE L
Sbjct  368   YGTRSHAPELTAGYYNTGDRDGYRPVARMLARHGAVLNFTCVEMRDREQPREARCMPEAL  427

Query  1365  VRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDS-GNGLSAFTYLRMNKNLFEP  1541
             VRQV  A +DAG  LAGENAL RYD   ++QV+AT+   +  + + AFTYLRM  +LF+P
Sbjct  428   VRQVAAAARDAGVGLAGENALPRYDGAAHDQVVATAAERAEEDRMVAFTYLRMGPDLFQP  487

Query  1542  ENWRKLVEFVKSMSEGG  1592
             +NWR+   FV  MS+ G
Sbjct  488   DNWRRFAAFVNRMSKSG  504



>gb|KHN24537.1| Beta-amylase 1, chloroplastic [Glycine soja]
Length=422

 Score =   529 bits (1363),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 255/395 (65%), Positives = 303/395 (77%), Gaps = 12/395 (3%)
 Frame = +3

Query  423   MVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPW  602
             M+D WWGLVE++ P +YNW GY  L++M ++HGLK+Q VMSFHQCGGNVGDSC+IPLP W
Sbjct  1     MMDVWWGLVEREKPGEYNWGGYVELIEMAKKHGLKVQAVMSFHQCGGNVGDSCTIPLPKW  60

Query  603   VLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMG  782
             V+EEI  +PDL YTD+ GRRN EYISLGCD  PVL+GRTPVQ YAD+MR+FR+ FK  +G
Sbjct  61    VVEEIDNDPDLAYTDQWGRRNYEYISLGCDTSPVLKGRTPVQCYADFMRAFRDTFKHLLG  120

Query  783   NVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWG  962
             + IVE+QVGMGP GELRYPSYPE NGTW FPGIG FQCYDKYM +SL A+AEA GK EWG
Sbjct  121   DTIVEIQVGMGPAGELRYPSYPEQNGTWNFPGIGGFQCYDKYMLSSLKAAAEAEGKPEWG  180

Query  963   RSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQG  1139
              +GP DAG YN +PEDT FFR++ G W   YG+FFL WYS  LL+HGDRIL++A  +F  
Sbjct  181   STGPTDAGHYNNWPEDTQFFRKEGGGWDGPYGEFFLTWYSQMLLDHGDRILSSATSIFDN  240

Query  1140  TGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMK  1319
             TG K+S K+AGIHWHY +RSHA EL AGYYNTR R+GY+PIA MLA+HG +FNFTCM   
Sbjct  241   TGVKISVKVAGIHWHYGSRSHAPELTAGYYNTRFRDGYIPIAQMLARHGAIFNFTCM---  297

Query  1320  DGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD-----S  1484
                 P  A C+PE LV+QV +AT+ A   LAGENAL RYD   +EQ++  S+ D      
Sbjct  298   ---LPQDALCAPEKLVKQVALATQKAQVPLAGENALPRYDEYAHEQIIRASQLDVDGDSG  354

Query  1485  GNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
             G  + AFTYLRMN +LFEP NWRK V FVK M EG
Sbjct  355   GREMCAFTYLRMNPHLFEPNNWRKFVGFVKKMKEG  389



>tpg|DAA46351.1| TPA: hypothetical protein ZEAMMB73_080734 [Zea mays]
Length=363

 Score =   524 bits (1350),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 253/346 (73%), Positives = 287/346 (83%), Gaps = 3/346 (1%)
 Frame = +3

Query  615   ISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV  794
             +S NPD+VYTDRSGRRNPEYISLGCD LPVL+GRTP+QVY DYMRSFRERF++Y+GNVI 
Sbjct  1     MSSNPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPIQVYTDYMRSFRERFRDYLGNVIA  60

Query  795   EVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGP  974
             E+QVGMGPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL A+A A G  EWGR GP
Sbjct  61    EIQVGMGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLEAAAVAAGHQEWGRGGP  120

Query  975   HDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKL  1154
             HDAG+Y Q P+DTGFFRR+GTW TEYG FFL WYSG LLEHGDR+L AA  VF GTGA L
Sbjct  121   HDAGEYKQMPDDTGFFRREGTWSTEYGHFFLAWYSGMLLEHGDRVLAAAEAVFGGTGATL  180

Query  1155  SGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQP  1334
             S K+AGIHWHY TRSHAAEL AGYYNTR+R+GY PIA MLAK G V NFTCMEMKD +QP
Sbjct  181   SAKVAGIHWHYRTRSHAAELTAGYYNTRDRDGYAPIARMLAKRGAVLNFTCMEMKDEQQP  240

Query  1335  GSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYL  1514
               A+CSPE LV+QVK A   AG ELAGENALERYD   + QV +T+R   G GL+AFTYL
Sbjct  241   KHASCSPELLVQQVKTAASAAGVELAGENALERYDEAAFSQVASTAR---GAGLAAFTYL  297

Query  1515  RMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYVGLI  1652
             RMNK LF+ +NWR+ V FV++M++GG    LP CD+  +DLYVG +
Sbjct  298   RMNKTLFDGDNWRQFVSFVRAMADGGARPALPRCDTGHSDLYVGFL  343



>dbj|BAJ95735.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score =   525 bits (1353),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 265/435 (61%), Positives = 323/435 (74%), Gaps = 7/435 (2%)
 Frame = +3

Query  300   SRVPVFIMLPLDTITM--GGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKY  473
             S VPVF+M+PLDT+    G  LN  R+M   L AL+S+GVEGVMVD WWG+VE +    Y
Sbjct  36    SGVPVFVMMPLDTVKTCCGSGLNHRRTMARDLAALKSSGVEGVMVDVWWGVVEGEESGLY  95

Query  474   NWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRS  653
             N+EGY  LV+M ++  LK+Q VMSFHQCGGNVGD+ +IPLP WV+EE+ K+ DL YTD+ 
Sbjct  96    NFEGYMKLVEMARDAKLKVQAVMSFHQCGGNVGDTVNIPLPRWVVEEMDKDQDLAYTDQC  155

Query  654   GRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELR  833
             GRR+ EY+SLGCD +PVL GRTP++ Y D+MR+FR+    ++G+ IVEVQVGMGP GELR
Sbjct  156   GRRSYEYVSLGCDDVPVLDGRTPIRCYTDFMRAFRDHLAGFLGDTIVEVQVGMGPAGELR  215

Query  834   YPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDT  1013
             YPSYPES GTW+FPGIG FQCYDKY+  SL  +A A G  +WG  GP DAG YN  P+DT
Sbjct  216   YPSYPESEGTWKFPGIGAFQCYDKYLLNSLRMAAVAAGNPDWGLGGPTDAGGYNSRPDDT  275

Query  1014  GFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF-QGTGAKLSGKIAGIHWHY  1187
              FFR+D G W +EYGQFF+ WYS  L+EHGDR+L+ AA VF    G +LS K+AGIHWH+
Sbjct  276   DFFRQDGGGWDSEYGQFFMSWYSRMLIEHGDRVLSGAASVFGHEPGVRLSVKVAGIHWHH  335

Query  1188  NTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLV  1367
              T SHA EL AGYYNTR R+GYLPIA ML +HG V NFTC+EM+D EQP  A C PEGLV
Sbjct  336   GTESHAPELTAGYYNTRRRDGYLPIASMLGRHGAVLNFTCVEMRDEEQPRDARCMPEGLV  395

Query  1368  RQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPEN  1547
             R+V  A + AG  LAGENAL RYD   Y+QVL T+R +    + AFTYLRM  +LF+P+N
Sbjct  396   RRVAAAARGAGVGLAGENALPRYDDAAYDQVLVTAREER---MVAFTYLRMGSDLFQPDN  452

Query  1548  WRKLVEFVKSMSEGG  1592
             WR+   FV  MSE G
Sbjct  453   WRRFAAFVTRMSEAG  467



>emb|CAX51379.1| beta-amylase [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   523 bits (1348),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 264/435 (61%), Positives = 323/435 (74%), Gaps = 7/435 (2%)
 Frame = +3

Query  300   SRVPVFIMLPLDTITM--GGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKY  473
             S VPVF+M+PLDT+    G  LN  R+M   L AL+S+GVEGVMVD WWG+VE +    Y
Sbjct  17    SGVPVFVMMPLDTVKTCCGSGLNHRRTMARDLAALKSSGVEGVMVDVWWGVVEGEESGLY  76

Query  474   NWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRS  653
             N+EGY  LV+M ++  LK+Q VMSFHQCGGNVGD+ +IPLP WV+EE+ K+ DL YTD+ 
Sbjct  77    NFEGYMKLVEMARDAKLKVQAVMSFHQCGGNVGDTVNIPLPRWVVEEMDKDQDLAYTDQC  136

Query  654   GRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELR  833
             GRR+ E++SLGCD +PVL GRTP++ Y D+MR+FR+    ++G+ IVEVQVGMGP GELR
Sbjct  137   GRRSYEFVSLGCDDVPVLDGRTPIRCYTDFMRAFRDHLAGFLGDTIVEVQVGMGPAGELR  196

Query  834   YPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDT  1013
             YPSYPES GTW+FPGIG FQCYDKY+  SL  +A A G  +WG  GP DAG YN  P+DT
Sbjct  197   YPSYPESRGTWKFPGIGAFQCYDKYLLNSLRMAAVAAGNPDWGLGGPTDAGGYNSRPDDT  256

Query  1014  GFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVF-QGTGAKLSGKIAGIHWHY  1187
              FFR+D G W +EYGQFF+ WYS  L+EHGDR+L+ AA VF    G +LS K+AGIHWH+
Sbjct  257   DFFRQDVGGWDSEYGQFFMSWYSRMLIEHGDRVLSGAASVFGHEPGVRLSVKVAGIHWHH  316

Query  1188  NTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLV  1367
              T SHA EL AGYYNTR R+GYLPIA ML +HG V NFTC+EM+D EQP  A C PEGLV
Sbjct  317   GTESHAPELTAGYYNTRRRDGYLPIASMLGRHGAVLNFTCVEMRDEEQPRDARCMPEGLV  376

Query  1368  RQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSAFTYLRMNKNLFEPEN  1547
             R+V  A + AG  LAGENAL RYD   Y+QVL T+R +    + AFTYLRM  +LF+P+N
Sbjct  377   RRVAAAARGAGVGLAGENALPRYDDAAYDQVLVTAREER---MVAFTYLRMGSDLFQPDN  433

Query  1548  WRKLVEFVKSMSEGG  1592
             WR+   FV  MSE G
Sbjct  434   WRRFAAFVTRMSEAG  448



>gb|ABR18773.1| beta-amylase [Boehmeria nivea]
Length=266

 Score =   503 bits (1296),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 230/266 (86%), Positives = 250/266 (94%), Gaps = 0/266 (0%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPVF+MLPLDT+ +GG LNKPR+MNASLMAL+SAGVEGVMVDAWWGLVEKDGPLKYNW+G
Sbjct  1     VPVFVMLPLDTVGLGGGLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKDGPLKYNWDG  60

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             YA LV+MVQ HGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLE IS+NPDLVYTDRSGRRN
Sbjct  61    YAELVQMVQRHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEVISQNPDLVYTDRSGRRN  120

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
             PEYISLGCD LP  + +TP+QVYAD+MRSFR+RF +Y+G+VIVE+QVGMGPCGELRYP+Y
Sbjct  121   PEYISLGCDSLPCPQRKTPIQVYADFMRSFRDRFADYLGDVIVEIQVGMGPCGELRYPAY  180

Query  846   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
             PESNGTWRFPGIGEFQCYDKYMRASLAASAEA GK +WG SGPHD+GQYNQFPEDTGFFR
Sbjct  181   PESNGTWRFPGIGEFQCYDKYMRASLAASAEAIGKKDWGNSGPHDSGQYNQFPEDTGFFR  240

Query  1026  RDGTWKTEYGQFFLEWYSGKLLEHGD  1103
             RDGTW TEYGQFFLEWYS KLL HGD
Sbjct  241   RDGTWNTEYGQFFLEWYSKKLLAHGD  266



>ref|XP_006662424.1| PREDICTED: beta-amylase 1, chloroplastic-like, partial [Oryza 
brachyantha]
Length=453

 Score =   495 bits (1275),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 241/389 (62%), Positives = 297/389 (76%), Gaps = 10/389 (3%)
 Frame = +3

Query  213   LLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTIT-MGGNLNKPRSMNASL  389
             LL +P   R+     +   L      ++++ VPVF+M+PLDT+   G  LN+ +++ ASL
Sbjct  45    LLPEPFSDRLIGIPSKSMALT-----NATNGVPVFVMMPLDTVKKCGSALNRRKAVAASL  99

Query  390   MALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNV  569
              AL+SAGVEGVMVD WWG+VE +GP +YN++GY  L++M ++ GLK+Q VMSFHQCGGNV
Sbjct  100   AALKSAGVEGVMVDVWWGIVESEGPGRYNFDGYMELMEMARKTGLKVQAVMSFHQCGGNV  159

Query  570   GDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMR  749
             GDS +IPLP WV+EE+ K+ DL YTD+ GRRN EYISLGCD +PV +GRTPV+ Y D+MR
Sbjct  160   GDSVNIPLPRWVVEEMEKDQDLAYTDQWGRRNFEYISLGCDAMPVFKGRTPVECYTDFMR  219

Query  750   SFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAA  929
             +FR+ F  ++G+ IVE+QVGMGP GELRYPSYPESNGTW+FPGIG FQC D+YMR+SL A
Sbjct  220   AFRDHFASFLGDTIVEIQVGMGPAGELRYPSYPESNGTWKFPGIGAFQCNDRYMRSSLKA  279

Query  930   SAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDR  1106
             +AEA GK EWG  GP DAG YN +PEDT FFRRD G W TEYG+FFL WYS  L+EHG+R
Sbjct  280   AAEAAGKPEWGHGGPTDAGGYNNWPEDTLFFRRDGGGWSTEYGEFFLSWYSQMLMEHGER  339

Query  1107  ILTAAAGVFQGT---GAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLA  1277
             +L+ A  VF      G K+S K+AGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA
Sbjct  340   VLSGATSVFGDDAPGGVKVSVKVAGIHWHYGTRSHAPELTAGYYNTRHRDGYLPIARMLA  399

Query  1278  KHGVVFNFTCMEMKDGEQPGSANCSPEGL  1364
             +HG V NFTC+EM+D EQP  A C PE L
Sbjct  400   RHGAVLNFTCVEMRDHEQPQEAECMPEAL  428



>gb|AFK46577.1| unknown [Lotus japonicus]
Length=320

 Score =   486 bits (1252),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 236/327 (72%), Positives = 263/327 (80%), Gaps = 13/327 (4%)
 Frame = +3

Query  54    MALTLRSSTSFINLKEIKGVKNPDDFPS-IVCFSQFKRSCHHRLRAKSSMQEAALLSQPL  230
             MAL L SS S +N KE K +   DD  S  + F + +      LRAKSSM   A ++   
Sbjct  1     MALILPSSFSLVNNKETKVLLAFDDVSSKALVFPKVQPPL--SLRAKSSMMAEAPIT---  55

Query  231   EGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAG  410
                     E++H   A    S S  VP F+MLPLDT+T+GG LNKPR MN SLMAL+SAG
Sbjct  56    -------LEKIHAPLAVHGLSDSKSVPSFVMLPLDTVTVGGTLNKPRVMNVSLMALKSAG  108

Query  411   VEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIP  590
             VEGVMVD WWGLVEKDGP KYNWEGYA L +MVQ+HGLKLQVVMSFHQCGGNVGDSCSIP
Sbjct  109   VEGVMVDVWWGLVEKDGPFKYNWEGYAELFQMVQKHGLKLQVVMSFHQCGGNVGDSCSIP  168

Query  591   LPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFK  770
             LPPWVLEEIS+NPDLVYTDRSGRRNPEYISLGCD +PVLRGRTP+QVY+DYMRSFR+RF 
Sbjct  169   LPPWVLEEISENPDLVYTDRSGRRNPEYISLGCDSMPVLRGRTPLQVYSDYMRSFRDRFI  228

Query  771   EYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGK  950
              Y+GNVI EVQVG+GPCGELRYPSYPES GTWRFPGIGEFQCYDKYMRASL ASAEA GK
Sbjct  229   YYLGNVISEVQVGLGPCGELRYPSYPESEGTWRFPGIGEFQCYDKYMRASLEASAEAIGK  288

Query  951   SEWGRSGPHDAGQYNQFPEDTGFFRRD  1031
              +WGRSGPHD+GQYNQFPEDTGFF+++
Sbjct  289   KDWGRSGPHDSGQYNQFPEDTGFFKKE  315



>gb|AGS94413.1| beta-amylase, partial [Actinidia chinensis]
Length=377

 Score =   478 bits (1231),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 228/347 (66%), Positives = 275/347 (79%), Gaps = 7/347 (2%)
 Frame = +3

Query  570   GDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMR  749
             GDSC+IPLP WV+EEI ++PDL YTD+ GRRN EY+SLGCD LPVL+GRTP+Q YAD+M 
Sbjct  1     GDSCTIPLPKWVVEEIERDPDLAYTDQWGRRNSEYLSLGCDTLPVLKGRTPIQCYADFMH  60

Query  750   SFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAA  929
             +FR+RF+  +G+ IVE+QVGMGP GELRYPSYPE NGTW+FPGIG FQCYDKYM + L A
Sbjct  61    AFRDRFENLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWKFPGIGAFQCYDKYMLSHLKA  120

Query  930   SAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDR  1106
             +AEA GKS+WG +GP DAG YN +PEDT FFR++ G W   YG+FFL WYS  LL+HGDR
Sbjct  121   AAEAAGKSKWGSTGPTDAGHYNNWPEDTNFFRKEGGGWDGAYGEFFLGWYSQMLLDHGDR  180

Query  1107  ILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHG  1286
             IL++A  +F+  G K+S KIAGIHWHY TRSHA EL AGYYNTR R+GYLPIA MLA+HG
Sbjct  181   ILSSAKAIFENKGVKISVKIAGIHWHYGTRSHAPELTAGYYNTRFRDGYLPIAQMLARHG  240

Query  1287  VVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLA  1466
              VFNFTC+EM+D EQP  A C+PE LV+QV +AT+ A   LAGENAL RYD R +EQ+L 
Sbjct  241   AVFNFTCIEMRDHEQPQDAQCAPEKLVKQVALATRAAQVPLAGENALPRYDERAHEQILQ  300

Query  1467  TS----RSDSGNG--LSAFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
              S      DSG+   + AFTYLRMN++LF+P+NWR+ V FVK M EG
Sbjct  301   ASSLNIEGDSGDNREMCAFTYLRMNQDLFQPDNWRRFVAFVKKMKEG  347



>gb|ACY25894.1| beta-amylase 1 [Euphorbia esula]
Length=311

 Score =   473 bits (1218),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 230/314 (73%), Positives = 259/314 (82%), Gaps = 6/314 (2%)
 Frame = +3

Query  54   MALTLRSSTSFINLKEIKGVKNPDDFPSIVCFSQFKRSCHHRLRAKSSMQEAALLSQ---  224
            MALTLRSSTSFINLK+ K +K PD   S + F+Q   SC   LR K+S Q A L S    
Sbjct  1    MALTLRSSTSFINLKDSKSLKAPDGISSTISFAQMMPSCS--LRVKNSTQGAQLSSGNIF  58

Query  225  PLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRS  404
             LEG  + K E++  ++  Q+ S+  +VPVF+MLPLDTIT+GG LN+PR++NASLMAL+S
Sbjct  59   TLEGNKSNKWEKVSEISIPQT-SNGPKVPVFVMLPLDTITLGGKLNRPRALNASLMALKS  117

Query  405  AGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCS  584
            AGVEGVMVD WWGLVEKDGPL YNWEGYA LV+ V++H LKLQ VMSFHQCGGNVGDSCS
Sbjct  118  AGVEGVMVDVWWGLVEKDGPLIYNWEGYADLVQTVKKHCLKLQAVMSFHQCGGNVGDSCS  177

Query  585  IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
            IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLG D L VLRGRTP+QVYADYMRSF  R
Sbjct  178  IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGSDSLQVLRGRTPIQVYADYMRSFSNR  237

Query  765  FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
            FK+Y+G+VIVE+QVGMGPCGELRYP+YPESNGTW FPGIGEFQCYDKYM ASL ASAEA 
Sbjct  238  FKDYLGDVIVEIQVGMGPCGELRYPAYPESNGTWSFPGIGEFQCYDKYMIASLKASAEAI  297

Query  945  GKSEWGRSGPHDAG  986
             K +WG  GPHDAG
Sbjct  298  SKKDWGLGGPHDAG  311



>ref|XP_006844925.1| hypothetical protein AMTR_s00058p00155330 [Amborella trichopoda]
 gb|ERN06600.1| hypothetical protein AMTR_s00058p00155330 [Amborella trichopoda]
Length=559

 Score =   477 bits (1227),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 244/496 (49%), Positives = 317/496 (64%), Gaps = 16/496 (3%)
 Frame = +3

Query  150   SQFKRSCHHRLRAKSS--------MQEAALLSQP--LEGRVN-EKRERLHGLAANQSHSS  296
             S F+   H   RA++            A L S+P   +G V+ E+   LH L   QS   
Sbjct  43    SNFRIRAHKTCRARAQRNLGQGGLTAMAKLFSKPSGADGSVSPEEPNELHYLGPAQSRGG  102

Query  297   SSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYN  476
                 PVF+ LPLD+++  G + + ++M  S  AL+ AGVEGV +D WWGLVE+D P  Y+
Sbjct  103   RG-FPVFVALPLDSVSSDGKMMRRKAMEVSFRALKLAGVEGVAMDVWWGLVERDRPGVYD  161

Query  477   WEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSG  656
             W GY  +V+M   HGLK++ VM+FH C G   D C I LP WV +E+ +  D  YTDR G
Sbjct  162   WRGYREVVEMALRHGLKVRAVMAFHSCVGTEADPCHITLPHWVRQEMERETDSAYTDRQG  221

Query  657   RRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRY  836
             RRN +YISLG D LPVLRGR+P+Q Y+D+MR+FR  F++++G +I  +QVGMGP GELRY
Sbjct  222   RRNYDYISLGSDLLPVLRGRSPIQAYSDFMRNFRGTFQQFLGVIITGIQVGMGPAGELRY  281

Query  837   PSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTG  1016
             PS+P  N +W   GIGEFQCYDK+M ASL A A   GK EWG+ GP DAG Y Q PE+TG
Sbjct  282   PSHPSENLSWSSQGIGEFQCYDKHMLASLDACAREIGKEEWGKGGPIDAGSYYQNPEETG  341

Query  1017  FFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTR  1196
             FF+ DGTW T YG FFLEWYSG LL HG+R+  AA  +F GTG KLS K+ GIHW Y+ +
Sbjct  342   FFKSDGTWNTPYGHFFLEWYSGMLLLHGERLCIAAESIFSGTGVKLSAKVGGIHWQYDLK  401

Query  1197  SHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKD-GEQPGSANCSPEGLVRQ  1373
             SH AEL AGY+NT  R+GY+PIAHM A+HGV     C +M D   +  + + SPEG ++Q
Sbjct  402   SHPAELTAGYFNTSFRDGYIPIAHMFARHGVSLCCPCFDMSDENAKFFNIHSSPEGFLKQ  461

Query  1374  VKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLS---AFTYLRMNKNLFEPE  1544
             +  A K     L GEN+L + D    +QVL +S+     GL    +F ++RMNKN F P+
Sbjct  462   IVFAAKICNIHLTGENSLTKLDESSSKQVLKSSKLYPDGGLDPACSFLFVRMNKNFFLPD  521

Query  1545  NWRKLVEFVKSMSEGG  1592
             NW +    V  MS+ G
Sbjct  522   NWNRFERLVWHMSDTG  537



>gb|KEH26843.1| beta-amylase [Medicago truncatula]
Length=384

 Score =   465 bits (1197),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 222/364 (61%), Positives = 272/364 (75%), Gaps = 6/364 (2%)
 Frame = +3

Query  582   SIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRE  761
             +IPLP W +EE+ K+PDL YTD+ GRRN EY+SLGCD LPVL+GR+PVQ YAD+MR+FR+
Sbjct  10    NIPLPKWAVEEMEKDPDLAYTDQWGRRNFEYLSLGCDTLPVLKGRSPVQCYADFMRAFRD  69

Query  762   RFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEA  941
              FK  +G+ IVE+QVGMGP GELRYPSYPE NGTW+FPGIG FQCYDKYM +SL A+A+A
Sbjct  70    NFKHLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWKFPGIGAFQCYDKYMLSSLQAAADA  129

Query  942   HGKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
               KSEWG +GP DAG+YN +PEDT FFR++ G W +EYG+FFL WYS  LL HG+RILT+
Sbjct  130   ANKSEWGSTGPTDAGEYNNWPEDTNFFRKEGGGWDSEYGEFFLTWYSQMLLNHGERILTS  189

Query  1119  AAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFN  1298
             A  +F  TG K+S K+AGIHWHY TRSHA EL AGYYNTR R+GYLPIA M A+H  +FN
Sbjct  190   AKSIFDNTGVKISVKVAGIHWHYGTRSHAPELTAGYYNTRNRDGYLPIAQMFARHDAIFN  249

Query  1299  FTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR-  1475
             FTC+EM+D EQP  A C PE LV QV +AT+ A   LAGENAL RYD   +EQ+L  S  
Sbjct  250   FTCIEMRDHEQPQDAQCLPEKLVNQVALATQKAQVHLAGENALPRYDEHAHEQILKASAL  309

Query  1476  ----SDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPECDSSRTDLYV  1643
                 S     + AFTYLRMN++LF+P+NWRK V FVK M EG  + +  E      + +V
Sbjct  310   NIEGSSDETEMCAFTYLRMNQDLFQPDNWRKFVAFVKKMKEGKSANKCWEQVEREAEHFV  369

Query  1644  GLIK  1655
              + +
Sbjct  370   HVTQ  373



>ref|XP_006662612.1| PREDICTED: beta-amylase 3, chloroplastic-like [Oryza brachyantha]
Length=305

 Score =   458 bits (1178),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 212/285 (74%), Positives = 248/285 (87%), Gaps = 2/285 (1%)
 Frame = +3

Query  258   RLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAW  437
             +LH  AA +     +  PV++MLPLDT+  GG L++ R++ ASLMAL+SAGVEGVMVD W
Sbjct  20    KLHKAAAGEDAPPGT--PVYVMLPLDTVGPGGQLSRARALAASLMALQSAGVEGVMVDVW  77

Query  438   WGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEI  617
             WG+VE+DGP +Y+W  Y  LV+MV+  GL+LQ+VMSFHQCGGNVGDSC IPLPPWV+EE+
Sbjct  78    WGVVERDGPGRYDWAAYGELVRMVERAGLRLQMVMSFHQCGGNVGDSCHIPLPPWVVEEM  137

Query  618   SKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVE  797
             S NPD+VYTDRSGRRNPEYISLGCD+LP+L GRTPVQVY+DYMRSF + F++Y+GNVIVE
Sbjct  138   SSNPDIVYTDRSGRRNPEYISLGCDELPLLNGRTPVQVYSDYMRSFHDTFRDYLGNVIVE  197

Query  798   VQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPH  977
             +QVG+GPCGELRYPSYPE+NGTWRFPGIGEFQCYDKYMRASL A+AEA G  EWGR GPH
Sbjct  198   IQVGLGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLQAAAEAAGHEEWGRGGPH  257

Query  978   DAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRIL  1112
             DAG+Y QFPE+TGFFRRDGTW TEYG FFLEWYSG LLEHGDR+L
Sbjct  258   DAGEYKQFPEETGFFRRDGTWSTEYGAFFLEWYSGMLLEHGDRVL  302



>tpg|DAA43307.1| TPA: beta-amylase [Zea mays]
Length=390

 Score =   460 bits (1184),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 271/340 (80%), Gaps = 2/340 (1%)
 Frame = +3

Query  579   CSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFR  758
             CSIPLP WVLEE+ K+ DL YTDRSGRRN EY+SLGCD +PVL+GRTP+Q YAD+MR+FR
Sbjct  18    CSIPLPGWVLEEMDKDQDLAYTDRSGRRNYEYVSLGCDAMPVLKGRTPIQCYADFMRAFR  77

Query  759   ERFKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAE  938
             + F  +MGN IVE+QVGMGP GELRYPSYPES+GTW FPGIGEFQCYD++M +SL A+AE
Sbjct  78    DHFATFMGNTIVEIQVGMGPAGELRYPSYPESDGTWSFPGIGEFQCYDRFMLSSLKAAAE  137

Query  939   AHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTA  1118
             A GK EWG +GP D+G Y  +PEDTGFFRR+G W TEYG+FF+ WYS  LLEHG+RIL+A
Sbjct  138   AVGKPEWGNAGPGDSGSYKDWPEDTGFFRREGGWSTEYGEFFMSWYSQMLLEHGERILSA  197

Query  1119  AAGVFQGT-GAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVF  1295
             A GVF G+ G K+S K+AGIHWHY TRSHAAEL AGYYNTR  +GY PIA MLA+HG V 
Sbjct  198   ATGVFTGSPGVKISVKVAGIHWHYGTRSHAAELTAGYYNTRSHDGYAPIARMLARHGAVL  257

Query  1296  NFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSR  1475
             NFTC+EM+D EQP  A C PE LV+QV  A ++AG  LAGENAL RYD   ++QV+AT+ 
Sbjct  258   NFTCVEMRDHEQPQDAQCRPEALVQQVAAAAREAGVGLAGENALPRYDDTAHDQVVATAA  317

Query  1476  SDSG-NGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGG  1592
               +  + + AFTYLRM  +LF+P+NWR+   FVK M+E G
Sbjct  318   DRAAEDRMVAFTYLRMGPDLFQPDNWRRFAAFVKRMTEPG  357



>ref|XP_010915994.1| PREDICTED: beta-amylase 1, chloroplastic-like [Elaeis guineensis]
Length=550

 Score =   465 bits (1196),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 223/432 (52%), Positives = 289/432 (67%), Gaps = 5/432 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
              PVF+ LP++ +   G + + ++M AS MAL +AGVEG+ V+ WWG+VE++ P  Y+W G
Sbjct  88    APVFVTLPMNVVGATGQMARRKTMGASFMALAAAGVEGIAVECWWGIVEREAPGVYDWGG  147

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  LV + +  GLK++ +M+FHQCG   GD   IPLP WVLEE+ K PDL Y+D+ GRR+
Sbjct  148   YMELVSLARRFGLKVRAIMAFHQCGTGPGDPSWIPLPQWVLEEMDKEPDLAYSDKFGRRS  207

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLGCD LPVL+GR+P+Q Y+D+MRSFR+ F+E++G ++ E+QVGMGP GELRYPS 
Sbjct  208   EEYISLGCDVLPVLKGRSPIQAYSDFMRSFRDTFREFLGVIVTEIQVGMGPAGELRYPSC  267

Query  846   PESN--GTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGF  1019
             P          P +GEFQCYDKYM ASL A A   G  EWG  GP  A    Q  EDT F
Sbjct  268   PTEKLMRPGASPELGEFQCYDKYMLASLNAWARNVGMREWGNGGPLGASNLLQHSEDTSF  327

Query  1020  FRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRS  1199
             FR DG+W T YGQFFLEWYSG LL HG+R+      +F GTG K+SGKIAGIHWHY+T S
Sbjct  328   FRSDGSWNTTYGQFFLEWYSGMLLLHGERLCAVTNAIFWGTGVKISGKIAGIHWHYDTSS  387

Query  1200  HAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVK  1379
             H +EL AGYYNT  R+GYLPIA M  ++ +    TC +M+D E+  +   SPEG +RQ+ 
Sbjct  388   HPSELTAGYYNTFIRDGYLPIARMFGRYRMTLCCTCFDMRDSEERSNPKSSPEGFLRQLV  447

Query  1380  VATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSA---FTYLRMNKNLFEPENW  1550
              A +     L GEN++ R D     QV+ +SR  S     A   F Y+RMN+NLF+  NW
Sbjct  448   YAARMCNLPLLGENSVTRLDDISLNQVIKSSRLYSSGAYEASLSFNYVRMNRNLFDSHNW  507

Query  1551  RKLVEFVKSMSE  1586
              +   FV+ MS+
Sbjct  508   NRFTRFVRKMSD  519



>ref|XP_004164889.1| PREDICTED: beta-amylase 1, chloroplastic-like, partial [Cucumis 
sativus]
Length=363

 Score =   456 bits (1173),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 220/341 (65%), Positives = 260/341 (76%), Gaps = 6/341 (2%)
 Frame = +3

Query  585   IPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRER  764
             IPLP WV+EE+ K+PDL YTD+ GRRN EY+SLGCD LPVL+GRTPVQ YAD+MR+F+  
Sbjct  1     IPLPKWVVEEMEKDPDLAYTDQWGRRNLEYLSLGCDNLPVLKGRTPVQCYADFMRAFKHN  60

Query  765   FKEYMGNVIVEVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAH  944
             F   +GN IVE+QVGMGP GELRYPSYPE NGTWRFPGIG FQC+DKYM +SL A+A   
Sbjct  61    FNHLLGNTIVEIQVGMGPAGELRYPSYPEQNGTWRFPGIGAFQCFDKYMLSSLKAAANVA  120

Query  945   GKSEWGRSGPHDAGQYNQFPEDTGFFRRD-GTWKTEYGQFFLEWYSGKLLEHGDRILTAA  1121
             GK EWG +GP DAG YN +PEDT FF+++ G W + YG+FFL WYS  LL+HGD IL+ A
Sbjct  121   GKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSTYGEFFLSWYSQILLDHGDAILSHA  180

Query  1122  AGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNF  1301
             + +F+ +  K+S KIAGIHWHY TRSHA EL AGYYNTR R+GY PIA MLA+HG +FNF
Sbjct  181   SSIFKPSSVKISVKIAGIHWHYGTRSHAPELTAGYYNTRYRDGYTPIARMLARHGAIFNF  240

Query  1302  TCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD  1481
             TC+EM D EQP +A CSPE LVRQVK+AT+ A   LAGENAL RYD   YEQ++  SR  
Sbjct  241   TCIEMHDHEQPQNAQCSPEKLVRQVKLATQKAHVPLAGENALPRYDEYAYEQIVRASRE-  299

Query  1482  SGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTR  1604
                 + AFTYLRMN  LFE ENWR+ V FV+ M EG    R
Sbjct  300   ----MCAFTYLRMNTQLFEEENWRRFVGFVQKMKEGKNGHR  336



>ref|XP_008783150.1| PREDICTED: beta-amylase 3, chloroplastic-like [Phoenix dactylifera]
Length=550

 Score =   463 bits (1191),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 222/432 (51%), Positives = 291/432 (67%), Gaps = 5/432 (1%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
              PVF+ LP+D +   G + + ++M AS MAL +AGVEG+ V+ WWG+VE++ P  Y+W G
Sbjct  88    APVFVALPVDAVGATGRMARRKTMGASFMALAAAGVEGIAVECWWGIVEREAPGVYDWGG  147

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  LV + + +GLK++ +M+FHQCG   GD   IPLP WVLEE+ K P+L Y+D+ GRR+
Sbjct  148   YLELVSLARRYGLKVRAIMAFHQCGTGPGDPSWIPLPQWVLEEMDKEPNLAYSDKFGRRS  207

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSY  845
              EYISLGCD LPVL+GR+P+Q Y+D+MRSFR+ F+E++G +I E+QVGMGP GELRYPS 
Sbjct  208   KEYISLGCDVLPVLKGRSPIQAYSDFMRSFRDTFREFLGVIITEIQVGMGPAGELRYPSC  267

Query  846   PESNGT--WRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGF  1019
             P          P +GEFQCYDKYM ASL A A   G   WG  G   A    Q  EDT F
Sbjct  268   PTEKLMRPGAAPELGEFQCYDKYMLASLNACARNVGMCGWGNGGALGASNLLQNLEDTAF  327

Query  1020  FRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRS  1199
             FR DG+W T +GQFFLEWYSG LL HG+R+ T   G+F GTGAK+SGK+AGIHWHY T S
Sbjct  328   FRSDGSWNTPFGQFFLEWYSGMLLLHGERLCTVTNGIFGGTGAKISGKVAGIHWHYGTSS  387

Query  1200  HAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVK  1379
             H +EL AGYYNT  R+GYLPIA M  ++ +    TC +M+D E+  +   SPEG +RQ+ 
Sbjct  388   HPSELTAGYYNTFIRDGYLPIARMFGRYRMTLCCTCFDMRDSEERSTPKSSPEGFLRQLV  447

Query  1380  VATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSA---FTYLRMNKNLFEPENW  1550
              A +     L GEN++ R D     QV+ ++R  S     A   F Y+RMN+NLF+  NW
Sbjct  448   YAARMCNLPLLGENSVTRLDDTSLNQVIKSARLYSSGAYEASLSFNYVRMNRNLFDSHNW  507

Query  1551  RKLVEFVKSMSE  1586
              +  +FV+ MS+
Sbjct  508   NRFTKFVRKMSD  519



>ref|XP_008337562.1| PREDICTED: beta-amylase 1, chloroplastic-like [Malus domestica]
Length=559

 Score =   460 bits (1183),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 235/453 (52%), Positives = 302/453 (67%), Gaps = 12/453 (3%)
 Frame = +3

Query  255   ERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDA  434
             E  HG +  +    S   PVF+ LP+D++   G + +P++M  SL AL +AGVEGV+++ 
Sbjct  76    ELFHGFSQQRRRRGS---PVFVTLPVDSVGSRGAVRRPKAMVQSLKALAAAGVEGVVMEV  132

Query  435   WWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEE  614
             WWGLVE+D P+ YNWEGY  +V + +  GLK++ V++FHQCG    DS  IPLP WVLEE
Sbjct  133   WWGLVERDQPMLYNWEGYLEIVSLARRCGLKVRAVLAFHQCGTGPEDSHWIPLPLWVLEE  192

Query  615   ISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV  794
             I ++PDLVY+DR GRRN EY+SLGCD LPVLRGR+PVQ YAD+MR+FR+ F+ + G VI 
Sbjct  193   IDRDPDLVYSDRFGRRNVEYLSLGCDMLPVLRGRSPVQAYADFMRNFRDTFRPFFGLVIT  252

Query  795   EVQVGMGPCGELRYPSYPESNGT--WRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRS  968
              +QVGMGP GELRYPS P    T  WR   +GEFQCYDKYM ASL A A   G  EWG  
Sbjct  253   GIQVGMGPAGELRYPSCPTQKLTWAWRSRELGEFQCYDKYMLASLNACAREIGIPEWGNG  312

Query  969   GPHDAGQYNQFPEDTGFFRR-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTG  1145
             GP  A    Q PE T FFR  DG+W T YG FFLEWYSG LL HG+RI   A  +F+GT 
Sbjct  313   GPIGAANLMQDPELTEFFRSDDGSWNTSYGTFFLEWYSGMLLLHGERICREAETIFRGTE  372

Query  1146  AKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDG  1325
             A  S K+AG+HWHY T+SH +EL AGY+NT  R+GYLPI  MLAK+G     +C E++D 
Sbjct  373   ASTSVKLAGMHWHYRTKSHPSELTAGYFNTSTRDGYLPIVRMLAKYGFTLCCSCFELQDV  432

Query  1326  EQ-PGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLS-  1499
             E+   +A  SPE L+RQ+  A +     L GE +  R DS+  +QV+  S+  S +GL  
Sbjct  433   EERKMNAVSSPESLLRQLLSAARVCDIPLEGETSAARLDSQSLQQVVRMSKYYS-SGLEK  491

Query  1500  ---AFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
                +F ++RM+KN+FE  NW     FV+ MS+ 
Sbjct  492   PSFSFNFVRMDKNMFEFHNWVHFTRFVRQMSDA  524



>ref|XP_007209090.1| hypothetical protein PRUPE_ppa003539mg [Prunus persica]
 gb|EMJ10289.1| hypothetical protein PRUPE_ppa003539mg [Prunus persica]
Length=567

 Score =   456 bits (1174),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 237/453 (52%), Positives = 301/453 (66%), Gaps = 12/453 (3%)
 Frame = +3

Query  255   ERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDA  434
             E  HGL+  +    S   PVF+ LPLDT+   G L +PR+M  SL AL +AGVEGV+++ 
Sbjct  84    ELFHGLSPQRCRKGS---PVFVTLPLDTVGPLGLLRRPRAMVQSLKALAAAGVEGVVMEV  140

Query  435   WWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEE  614
             WWGLVE+D P+ YNWEGY  +V + +  GLK++ V++FHQCG    D   IPLP WVL+E
Sbjct  141   WWGLVERDQPMLYNWEGYLEIVALARRCGLKVRAVLAFHQCGTGPEDPHWIPLPLWVLDE  200

Query  615   ISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV  794
             I K+PDL Y+DR GRRN EY+SLGCD LPVL GR+P+Q YAD+MR+FR+ F+ ++G VI 
Sbjct  201   IDKDPDLAYSDRFGRRNMEYVSLGCDMLPVLLGRSPLQAYADFMRNFRDTFRPFLGVVIT  260

Query  795   EVQVGMGPCGELRYPSYPES--NGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRS  968
              +QVGMGP GELRYPS P      TWR   +GEFQCYDKYM ASL A A A G  EWG  
Sbjct  261   RIQVGMGPAGELRYPSCPTQKLTWTWRSRELGEFQCYDKYMLASLNACARAIGMPEWGNG  320

Query  969   GPHDAGQYNQFPEDTGFFR-RDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTG  1145
             GP  AG   Q  E T FF+   G+W T YG FFLEWYSG LL HG+RI   A  +F+GT 
Sbjct  321   GPIGAGNLMQNLEQTDFFKSHHGSWTTPYGNFFLEWYSGMLLLHGERICREAETIFRGTE  380

Query  1146  AKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKD-  1322
             A  S KIAGIHWHY T+SH +E+ AGYYNTR R+GYLPIA MLAK+G     +C E++D 
Sbjct  381   ASTSVKIAGIHWHYRTQSHPSEITAGYYNTRLRDGYLPIARMLAKYGFTLCCSCFELQDL  440

Query  1323  GEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLS-  1499
              EQ  +   SPEGL+RQ+  A +     L GE +    D + ++QV+  S+  S  GL  
Sbjct  441   EEQRMNPVGSPEGLLRQLLSAARVCDIPLEGETSTTSLDHQSFQQVVRMSKFYS-YGLEK  499

Query  1500  ---AFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
                +F ++RM+K +FE  NW +   FV+ MS+ 
Sbjct  500   PSFSFNFVRMDKKMFEYHNWIRFNRFVRQMSDA  532



>ref|XP_008239169.1| PREDICTED: beta-amylase 3, chloroplastic-like [Prunus mume]
Length=567

 Score =   456 bits (1172),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 236/453 (52%), Positives = 301/453 (66%), Gaps = 12/453 (3%)
 Frame = +3

Query  255   ERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDA  434
             E  HGL+  +    S   PVF+ LPLDT+   G L +PR+M  SL AL +AGVEGV+++ 
Sbjct  84    ELFHGLSPQRCRKGS---PVFVTLPLDTVGPLGLLRRPRAMVQSLKALAAAGVEGVVMEV  140

Query  435   WWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEE  614
             WWGLVE+D P+ YNWEGY  +V + +  GLK++ V++FHQCG    D   IPLP WVL+E
Sbjct  141   WWGLVERDQPMLYNWEGYLEIVALARRCGLKVRAVLAFHQCGTGPEDPHWIPLPLWVLDE  200

Query  615   ISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV  794
             I K+PDL Y+DR GRRN EY+SLGCD LPVL GR+P+Q YAD+MR+FR+ F+ ++G VI 
Sbjct  201   IDKDPDLAYSDRFGRRNMEYVSLGCDMLPVLLGRSPLQAYADFMRNFRDTFRPFLGVVIT  260

Query  795   EVQVGMGPCGELRYPSYPESNGT--WRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRS  968
              +QVGMGP GELRYPS P    T  WR   +GEFQCYDKYM ASL A A A G  EWG  
Sbjct  261   RIQVGMGPAGELRYPSCPTQKLTWAWRSRELGEFQCYDKYMLASLNACARAIGMPEWGNG  320

Query  969   GPHDAGQYNQFPEDTGFFR-RDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTG  1145
             GP  AG   Q  E T FF+   G+W T YG FFLEWYSG LL HG+RI   A  +F+GT 
Sbjct  321   GPIGAGNLMQNLEQTDFFKSHHGSWTTPYGNFFLEWYSGMLLLHGERICREAETIFRGTE  380

Query  1146  AKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKD-  1322
             A  S K+AGIHWHY T+SH +E+ AGYYNTR R+GYLPIA MLAK+G     +C E++D 
Sbjct  381   ASTSVKVAGIHWHYRTQSHPSEITAGYYNTRLRDGYLPIARMLAKYGFTLCCSCFELQDL  440

Query  1323  GEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLS-  1499
              EQ  +   SPEGL+RQ+  A +     L GE +    D + ++QV+  S+  S  GL  
Sbjct  441   EEQRMNPVGSPEGLLRQLLSAARVCDIPLEGETSTTSLDHQSFQQVVRMSKFYS-YGLEK  499

Query  1500  ---AFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
                +F ++RM+K +FE  NW +   FV+ MS+ 
Sbjct  500   PSFSFNFVRMDKKMFEYHNWIRFNRFVRQMSDA  532



>ref|XP_009358648.1| PREDICTED: beta-amylase 1, chloroplastic-like [Pyrus x bretschneideri]
Length=559

 Score =   455 bits (1170),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 233/453 (51%), Positives = 302/453 (67%), Gaps = 12/453 (3%)
 Frame = +3

Query  255   ERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDA  434
             E  HG +  +    S   PVF+ LP+D++   G + +P++M  SL AL +AGVEGV+++ 
Sbjct  76    ELFHGFSQQRRRRGS---PVFVTLPVDSVGTRGAVRRPKAMVQSLKALAAAGVEGVVMEV  132

Query  435   WWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEE  614
             WWGLVE+D P+ YNWEGY  +V + +  GLK++ V++FHQCG    DS  I LP WVLEE
Sbjct  133   WWGLVERDQPMLYNWEGYLEIVSLARRCGLKVRAVLAFHQCGTGPEDSHWIHLPLWVLEE  192

Query  615   ISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV  794
             I ++PDLVY+DR GRRN EY+SLGCD LPVLRGR+PVQ YAD+MR+FR+ F+ ++G VI 
Sbjct  193   IDRDPDLVYSDRFGRRNVEYLSLGCDMLPVLRGRSPVQAYADFMRNFRDTFRPFLGLVIT  252

Query  795   EVQVGMGPCGELRYPSYPESNGT--WRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRS  968
              ++VGMGP GELRYPS P    T  WR   +GEFQCYDKYM ASL A A   G  EWG  
Sbjct  253   GIRVGMGPAGELRYPSCPIQKLTWAWRSRELGEFQCYDKYMLASLNACAREIGIPEWGNG  312

Query  969   GPHDAGQYNQFPEDTGFFRR-DGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTG  1145
             GP  A    Q PE T FFR  DG+W T YG FFLEWYSG LL HG+RI   A  +F+GT 
Sbjct  313   GPIGAANLMQDPELTEFFRSDDGSWNTSYGTFFLEWYSGMLLLHGERICREAETIFRGTE  372

Query  1146  AKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDG  1325
             A  S K+AG+HWHY T+SH +EL AGYYNT  R+GYLPI  MLAK+G     +C E++D 
Sbjct  373   ASTSVKLAGMHWHYRTKSHPSELTAGYYNTSTRDGYLPIVRMLAKYGFTLCCSCFELQDV  432

Query  1326  EQ-PGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLS-  1499
             E+   +A  SPE L+RQ+  A +     L GE +  R D++  +QV+  S+  S +GL  
Sbjct  433   EERKMNAVSSPESLLRQLLSAARVCDIPLEGETSAARLDNQSLQQVVRMSKYYS-SGLEK  491

Query  1500  ---AFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
                +F ++RM+KN+FE  NW     FV+ MS+ 
Sbjct  492   PSFSFNFVRMDKNMFEFHNWVHFTRFVRQMSDA  524



>gb|KHN22864.1| Beta-amylase [Glycine soja]
Length=489

 Score =   451 bits (1159),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 216/433 (50%), Positives = 292/433 (67%), Gaps = 11/433 (3%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++MLPL  +T+      P  +   L+ LR+AGV+GVMVD WWG++E  GP +Y+W  
Sbjct  6     VPVYVMLPLGVVTVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIELKGPKQYDWSA  65

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y +L ++VQE GL LQ +MSFHQCGGNVGD+ +IP+P WVL+    NPD+ YT+RSG RN
Sbjct  66    YRSLFQLVQECGLTLQAIMSFHQCGGNVGDAVNIPIPQWVLDIGESNPDIFYTNRSGFRN  125

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGN-VIVEVQVGMGPCGELRYPS  842
              EY+++G D  P+  GRT +++Y+DYM+SFRE   +++ + +I++++VG+GP GELRYPS
Sbjct  126   KEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLDSGLIIDIEVGLGPAGELRYPS  185

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+YN  PE TGFF
Sbjct  186   YPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGKYNDVPESTGFF  242

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             + +GT+ TE G+FFL WYS KLL HGD+IL  A   F     KL+ K++GIHW Y   +H
Sbjct  243   KSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLSCKVKLAIKVSGIHWWYKVENH  302

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             AAEL AGYYN   R+GY PIA +L++H  + NFTC+EM+D EQP  A   P+ LV+QV  
Sbjct  303   AAELTAGYYNLNNRDGYRPIARLLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLS  362

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--TYLRMNKNLFEP  1541
                    ++AGENAL RYD+  Y Q++  +R    N      LS F  TYLR++ +L + 
Sbjct  363   GGWREDIQVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVTYLRLSDDLLQK  422

Query  1542  ENWRKLVEFVKSM  1580
              N+    +FV  M
Sbjct  423   SNFNMFKKFVLKM  435



>pdb|1UKP|A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted 
At Surface Region
 pdb|1UKP|B Chain B, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted 
At Surface Region
 pdb|1UKP|C Chain C, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted 
At Surface Region
 pdb|1UKP|D Chain D, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted 
At Surface Region
Length=495

 Score =   450 bits (1158),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 295/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREYIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>pdb|1UKO|A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted 
At Surface Region
 pdb|1UKO|B Chain B, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted 
At Surface Region
 pdb|1UKO|C Chain C, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted 
At Surface Region
 pdb|1UKO|D Chain D, Crystal Structure Of Soybean Beta-Amylase Mutant Substituted 
At Surface Region
Length=495

 Score =   450 bits (1158),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 295/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREYIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>ref|XP_007051810.1| Beta-amylase 2 isoform 1 [Theobroma cacao]
 gb|EOX95967.1| Beta-amylase 2 isoform 1 [Theobroma cacao]
Length=554

 Score =   452 bits (1163),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 244/484 (50%), Positives = 308/484 (64%), Gaps = 13/484 (3%)
 Frame = +3

Query  150   SQFKRSCHHRLRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLP  329
             S    SC  +LRA    +       PL G   +K +    +   +  + +S VPV++MLP
Sbjct  49    SSISGSC--QLRAIVRDKGKRTEDHPLVGDSTDKVDENQVMEPERDFAGTSYVPVYVMLP  106

Query  330   LDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMV  509
             LD I M   L  P  +   L  LRS  V+GVMVD WWG+VE      YNW GY  L ++V
Sbjct  107   LDVIDMKCELVDPEGLLDQLRILRSVNVDGVMVDCWWGIVEAHTSQLYNWSGYKRLFQIV  166

Query  510   QEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGC  689
             ++ GLKLQVVMSFH+CGGNVGD+  IPLP W+ E    NPD+ +TDR G+RNPE ++ G 
Sbjct  167   RDLGLKLQVVMSFHECGGNVGDNVHIPLPQWIREIGESNPDIYFTDREGKRNPECLTWGI  226

Query  690   DQLPVLRGRTPVQVYADYMRSFRERFKE-YMGNVIVEVQVGMGPCGELRYPSYPESNGTW  866
             D+  VL+GRT V+VY DYMRSFR  F E ++  VI E++VG+GPCGELRYPSYP  +G W
Sbjct  227   DKERVLKGRTAVEVYFDYMRSFRVEFDEFFVDGVISEIEVGLGPCGELRYPSYPAKHG-W  285

Query  867   RFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKT  1046
             R+PGIGEFQCYDKY+  SL+ +AE  G S W R GP +AG YN  P +TGFFR  G + +
Sbjct  286   RYPGIGEFQCYDKYLMKSLSKAAEIRGHSFWAR-GPDNAGSYNSTPHETGFFRDGGDYDS  344

Query  1047  EYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGY  1226
              YG+FFL WYS  L++HGDR+L  A   F+GT   ++ K++GIHW Y T SHAAEL AG+
Sbjct  345   YYGRFFLNWYSQVLVDHGDRVLALANLAFEGTC--IAAKLSGIHWWYKTASHAAELTAGF  402

Query  1227  YNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGS---ANCSPEGLVRQVKVATKDa  1397
             YN   R+GY PIA ML KHGV  NFTC+E++  +Q      A   PEGLV QV  A  D 
Sbjct  403   YNPSNRDGYAPIASMLKKHGVALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDV  462

Query  1398  gaelagenaleRYDSRGYEQVL--ATSRSD-SGNGLSAFTYLRMNKNLFEPENWRKLVEF  1568
                +A ENAL  YD  GY ++L  A  R+D  G  LSAFTYLR+N  L E  N+ +   F
Sbjct  463   SILVASENALPCYDREGYNKILENAKPRNDPDGRHLSAFTYLRLNPVLMETHNFAEFERF  522

Query  1569  VKSM  1580
             V  M
Sbjct  523   VTRM  526



>ref|XP_003539882.1| PREDICTED: beta-amylase-like [Glycine max]
Length=496

 Score =   450 bits (1158),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 217/445 (49%), Positives = 296/445 (67%), Gaps = 11/445 (2%)
 Frame = +3

Query  270   LAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLV  449
             +A +  +   + VPV++MLPL  +T+      P  +   L+ LR+AGV+GVMVD WWG++
Sbjct  1     MATSDRNMLLNYVPVYVMLPLGVVTVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGII  60

Query  450   EKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNP  629
             E  GP +Y+W  Y +L ++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    NP
Sbjct  61    ELKGPKQYDWSAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDVVNIPIPQWVLDIGESNP  120

Query  630   DLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGN-VIVEVQV  806
             D+ YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++ + +I++++V
Sbjct  121   DIFYTNRSGFRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLDSGLIIDIEV  180

Query  807   GMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAG  986
             G+GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG
Sbjct  181   GLGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAG  237

Query  987   QYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKI  1166
             +YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F     KL+ K+
Sbjct  238   KYNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLSCKVKLAIKV  297

Query  1167  AGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSAN  1346
             +GIHW Y   +HAAEL AGYYN   R+GY PIA +L++H  + NFTC+EM+D EQP  A 
Sbjct  298   SGIHWWYKVENHAAELTAGYYNLNNRDGYRPIARLLSRHHAILNFTCLEMRDSEQPSDAK  357

Query  1347  CSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--  1505
               P+ LV+QV         ++AGENAL RYD+  Y Q++  +R    N      LS F  
Sbjct  358   SGPQELVQQVLSGGWREDIQVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGV  417

Query  1506  TYLRMNKNLFEPENWRKLVEFVKSM  1580
             TYLR++ +L +  N+    +FV  M
Sbjct  418   TYLRLSDDLLQKSNFNMFKKFVLKM  442



>pdb|1Q6C|A Chain A, Crystal Structure Of Soybean Beta-Amylase Complexed 
With Maltose
 pdb|1WDP|A Chain A, The Role Of An Inner Loop In The Catalytic Mechanism 
Of Soybean Beta-Amylase
 pdb|1BFN|A Chain A, Beta-AmylaseBETA-Cyclodextrin Complex
Length=495

 Score =   450 bits (1158),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 295/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>pdb|1V3I|A Chain A, The Roles Of Glu186 And Glu380 In The Catalytic Reaction 
Of Soybean Beta-Amylase
Length=495

 Score =   450 bits (1158),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 295/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AG+NAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREDIRVAGQNALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>dbj|BAA09462.1| beta-amylase [Glycine max]
 dbj|BAA20453.1| beta-amylase [Glycine max]
 gb|AAZ38832.1| beta-amylase [Glycine max]
Length=496

 Score =   450 bits (1158),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 218/445 (49%), Positives = 295/445 (66%), Gaps = 11/445 (2%)
 Frame = +3

Query  270   LAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLV  449
             +A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++
Sbjct  1     MATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGII  60

Query  450   EKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNP  629
             E  GP +Y+W  Y +L ++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N 
Sbjct  61    ELKGPKQYDWRAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNH  120

Query  630   DLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQV  806
             D+ YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++V
Sbjct  121   DIFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEV  180

Query  807   GMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAG  986
             G+GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG
Sbjct  181   GLGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAG  237

Query  987   QYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKI  1166
             +YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K+
Sbjct  238   KYNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKV  297

Query  1167  AGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSAN  1346
             +GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A 
Sbjct  298   SGIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAK  357

Query  1347  CSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--  1505
               P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  
Sbjct  358   SGPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGV  417

Query  1506  TYLRMNKNLFEPENWRKLVEFVKSM  1580
             TYLR++ +L +  N+    +FV  M
Sbjct  418   TYLRLSDDLLQKSNFNIFKKFVLKM  442



>gb|AAZ38831.1| beta-amylase [Glycine max]
 gb|KHN41189.1| Beta-amylase [Glycine soja]
Length=496

 Score =   450 bits (1157),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 218/445 (49%), Positives = 295/445 (66%), Gaps = 11/445 (2%)
 Frame = +3

Query  270   LAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLV  449
             +A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++
Sbjct  1     MATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGII  60

Query  450   EKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNP  629
             E  GP +Y+W  Y +L ++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N 
Sbjct  61    ELKGPKQYDWRAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNH  120

Query  630   DLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQV  806
             D+ YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++V
Sbjct  121   DIFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIKIYSDYMKSFRENMSDFLESGLIIDIEV  180

Query  807   GMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAG  986
             G+GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG
Sbjct  181   GLGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAG  237

Query  987   QYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKI  1166
             +YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K+
Sbjct  238   KYNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKV  297

Query  1167  AGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSAN  1346
             +GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A 
Sbjct  298   SGIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAK  357

Query  1347  CSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--  1505
               P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  
Sbjct  358   SGPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGV  417

Query  1506  TYLRMNKNLFEPENWRKLVEFVKSM  1580
             TYLR++ +L +  N+    +FV  M
Sbjct  418   TYLRLSDDLLQKSNFNIFKKFVLKM  442



>ref|XP_010688831.1| PREDICTED: beta-amylase-like [Beta vulgaris subsp. vulgaris]
Length=571

 Score =   452 bits (1163),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 218/433 (50%), Positives = 288/433 (67%), Gaps = 11/433 (3%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++MLPL  ++   +          L  L+ AGV+G+MVD WW  +E  GP +Y+W+ 
Sbjct  67    VPVYVMLPLGVVSPKNSFKDEEGTKMQLEKLKKAGVDGIMVDVWWATIEGKGPKQYDWKA  126

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y  L ++VQ++GLK+Q +MSFHQCGGNVGD  +IPLP WVL+    NPD+ YT+ +G RN
Sbjct  127   YRRLFQIVQQYGLKIQAIMSFHQCGGNVGDIVNIPLPQWVLDVGKSNPDIFYTNLAGTRN  186

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVGMGPCGELRYPS  842
              EY+SLG D  P+  GRTP+Q+Y+D+M+SFR+   +++    IV+++VG GP GELRYPS
Sbjct  187   AEYLSLGVDDKPLFDGRTPIQIYSDFMKSFRQNMSDFLEAGTIVDIEVGTGPAGELRYPS  246

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YP++ G W FPGIGEFQCYDKYM      +A+  G  EW    P DAG+YN  PE+TGFF
Sbjct  247   YPQNQG-WVFPGIGEFQCYDKYMEEDFKKAAKEAGHPEW--ELPTDAGKYNDTPEETGFF  303

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             RR+GT+KTE G FFL WYS KL+ HGD+IL  A   F+G   KL+ K++GIHW +N   H
Sbjct  304   RRNGTYKTEKGIFFLTWYSTKLILHGDQILEEANKAFRGCTLKLAIKVSGIHWWFNYHCH  363

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             AAEL AGYYN   R+GY PIA ML +H  + NFTC+EM+D EQP +A   P+ LVRQV  
Sbjct  364   AAELTAGYYNLYARDGYRPIARMLTRHNAILNFTCLEMRDSEQPAAAYSGPQALVRQVLS  423

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSRSDSGN-------GLSAFTYLRMNKNLFEP  1541
                    ++AGENAL RYDS  Y Q+L  +R +  N        +  FTYLR++ +L E 
Sbjct  424   DAWKENIKVAGENALPRYDSTAYNQILLNARPNGVNPNGAPALKMFGFTYLRVSDDLLEN  483

Query  1542  ENWRKLVEFVKSM  1580
              N++    FVK M
Sbjct  484   NNYKLFKTFVKRM  496



>ref|XP_007051811.1| Beta-amylase 2 isoform 2, partial [Theobroma cacao]
 gb|EOX95968.1| Beta-amylase 2 isoform 2, partial [Theobroma cacao]
Length=571

 Score =   452 bits (1162),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 244/484 (50%), Positives = 308/484 (64%), Gaps = 13/484 (3%)
 Frame = +3

Query  150   SQFKRSCHHRLRAKSSMQEAALLSQPLEGRVNEKRERLHGLAANQSHSSSSRVPVFIMLP  329
             S    SC  +LRA    +       PL G   +K +    +   +  + +S VPV++MLP
Sbjct  66    SSISGSC--QLRAIVRDKGKRTEDHPLVGDSTDKVDENQVMEPERDFAGTSYVPVYVMLP  123

Query  330   LDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYAALVKMV  509
             LD I M   L  P  +   L  LRS  V+GVMVD WWG+VE      YNW GY  L ++V
Sbjct  124   LDVIDMKCELVDPEGLLDQLRILRSVNVDGVMVDCWWGIVEAHTSQLYNWSGYKRLFQIV  183

Query  510   QEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPEYISLGC  689
             ++ GLKLQVVMSFH+CGGNVGD+  IPLP W+ E    NPD+ +TDR G+RNPE ++ G 
Sbjct  184   RDLGLKLQVVMSFHECGGNVGDNVHIPLPQWIREIGESNPDIYFTDREGKRNPECLTWGI  243

Query  690   DQLPVLRGRTPVQVYADYMRSFRERFKE-YMGNVIVEVQVGMGPCGELRYPSYPESNGTW  866
             D+  VL+GRT V+VY DYMRSFR  F E ++  VI E++VG+GPCGELRYPSYP  +G W
Sbjct  244   DKERVLKGRTAVEVYFDYMRSFRVEFDEFFVDGVISEIEVGLGPCGELRYPSYPAKHG-W  302

Query  867   RFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFRRDGTWKT  1046
             R+PGIGEFQCYDKY+  SL+ +AE  G S W R GP +AG YN  P +TGFFR  G + +
Sbjct  303   RYPGIGEFQCYDKYLMKSLSKAAEIRGHSFWAR-GPDNAGSYNSTPHETGFFRDGGDYDS  361

Query  1047  EYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHAAELNAGY  1226
              YG+FFL WYS  L++HGDR+L  A   F+GT   ++ K++GIHW Y T SHAAEL AG+
Sbjct  362   YYGRFFLNWYSQVLVDHGDRVLALANLAFEGTC--IAAKLSGIHWWYKTASHAAELTAGF  419

Query  1227  YNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGS---ANCSPEGLVRQVKVATKDa  1397
             YN   R+GY PIA ML KHGV  NFTC+E++  +Q      A   PEGLV QV  A  D 
Sbjct  420   YNPSNRDGYAPIASMLKKHGVALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDV  479

Query  1398  gaelagenaleRYDSRGYEQVL--ATSRSD-SGNGLSAFTYLRMNKNLFEPENWRKLVEF  1568
                +A ENAL  YD  GY ++L  A  R+D  G  LSAFTYLR+N  L E  N+ +   F
Sbjct  480   SILVASENALPCYDREGYNKILENAKPRNDPDGRHLSAFTYLRLNPVLMETHNFAEFERF  539

Query  1569  VKSM  1580
             V  M
Sbjct  540   VTRM  543



>pdb|1WDR|A Chain A, The Role Of An Inner Loop In The Catalytic Mechanism 
Of Soybean Beta-Amylase
Length=495

 Score =   449 bits (1155),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 295/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGXKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NF+C+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFSCLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>pdb|1V3H|A Chain A, The Roles Of Glu186 And Glu380 In The Catalytic Reaction 
Of Soybean Beta-Amylase
Length=495

 Score =   449 bits (1154),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 295/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP G+LRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGQLRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>pdb|1Q6E|A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant (E178y) 
With Increased Ph Optimum At Ph 5.4
 pdb|1Q6F|A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant (E178y) 
With Increased Ph Optimum At Ph 7.1
Length=495

 Score =   449 bits (1154),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 294/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I+++ VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIYVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>emb|CDP20214.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   449 bits (1154),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 221/436 (51%), Positives = 292/436 (67%), Gaps = 11/436 (3%)
 Frame = +3

Query  297   SSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYN  476
             S+ VP+F+MLPL  + +      P ++   L  L+  GV+G+MVD WWGL+E  GP +Y 
Sbjct  7     SNYVPIFVMLPLGVVNVNNVFEDPETLEKQLKKLKEIGVDGIMVDVWWGLIENKGPKQYE  66

Query  477   WEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSG  656
             W  Y +L ++V + GLK+Q +MSFHQCGGNVGD  +IPLP WVL    K PD+ YT+RSG
Sbjct  67    WAAYRSLFELVVKIGLKIQAIMSFHQCGGNVGDIVTIPLPKWVLAIGDKVPDIFYTNRSG  126

Query  657   RRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKE-YMGNVIVEVQVGMGPCGELR  833
              RNPEY+SLG D   + +GRTPVQ+Y+DYM+SF+    + +    I +V+VG+GP GELR
Sbjct  127   TRNPEYLSLGVDNENLFQGRTPVQIYSDYMKSFKNAMADIFEAGHITDVEVGLGPAGELR  186

Query  834   YPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDT  1013
             Y SYPE+ G W+FPGIGEFQCYDKY++A   A+A   G  EW    P +AG YN  P DT
Sbjct  187   YSSYPETQG-WKFPGIGEFQCYDKYLKADFKAAATKAGHPEWDL--PDNAGTYNDTPGDT  243

Query  1014  GFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNT  1193
              FF  +GT++TE G+ FL WYS KL+EHGD+IL  A  VF GT  +L+ K++GIHW +  
Sbjct  244   EFFATNGTYRTEKGKSFLTWYSNKLIEHGDQILEEANKVFNGTKTRLAAKVSGIHWWFKD  303

Query  1194  RSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQ  1373
             +SHAAEL AGYYN  +R+GY P+A ML +H    +FTC+EMKD EQP +A   P+ LV+Q
Sbjct  304   QSHAAELTAGYYNLDDRDGYRPLARMLTRHYGTLDFTCLEMKDSEQPETAKSGPQELVQQ  363

Query  1374  VKVATKDagaelagenaleRYDSRGYEQVLATSRSD--SGNG-----LSAFTYLRMNKNL  1532
             V  A      ++AGENAL RYD+  Y Q+L   R +  S  G     +SA TYLR++++L
Sbjct  364   VLSAGWREVIDVAGENALSRYDATAYNQMLLNVRPNGVSKEGERKPKMSALTYLRLSEDL  423

Query  1533  FEPENWRKLVEFVKSM  1580
             F  EN+     FVK M
Sbjct  424   FTTENFSLFASFVKKM  439



>ref|XP_001691372.1| beta-amylase [Chlamydomonas reinhardtii]
 gb|EDP05105.1| beta-amylase [Chlamydomonas reinhardtii]
Length=594

 Score =   452 bits (1163),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 230/468 (49%), Positives = 301/468 (64%), Gaps = 35/468 (7%)
 Frame = +3

Query  276   ANQSHSSSSRVPVFIMLPLDTITMGGN-------LNKPRSMNASLMALRSAGVEGVMVDA  434
             A +  SS S  PV++MLPLDT+ +          L K RS++ +L  L+ AGVEGVMVD 
Sbjct  125   AEEPSSSGSGCPVYVMLPLDTVWVVERDGKRISVLKKERSLDIALHTLKQAGVEGVMVDV  184

Query  435   WWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEE  614
             WWG+VE+ GP +Y++  Y  L   V   GLK+Q VMSFH  GGNVGD+C IPLP WVLE 
Sbjct  185   WWGIVERAGPRQYDFSAYKRLFYKVAAAGLKVQAVMSFHAAGGNVGDTCKIPLPKWVLEI  244

Query  615   ISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV  794
               +NPD+ YTD++G RN E +SLGCD++P+  GRTPV +Y D++ +F ++F+   G VI 
Sbjct  245   GERNPDIFYTDKAGHRNRECLSLGCDEVPLFWGRTPVLMYRDFINAFADKFQHLFGTVIT  304

Query  795   EVQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGP  974
             EV VG+GP GELRYPSYPE +G WRFPG+GEFQCYDK+M  SL  +AEA G +EWG SGP
Sbjct  305   EVTVGLGPAGELRYPSYPEGDGRWRFPGVGEFQCYDKFMLESLRRTAEAAGHAEWGLSGP  364

Query  975   HDAGQYNQFPEDTGFF-RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTG--  1145
             HDAG YN    +TGFF  ++G+W T YG FFL WYS  LLEH DR+L++AA V    G  
Sbjct  365   HDAGHYNSSSWETGFFVSQNGSWNTAYGHFFLSWYSNMLLEHADRVLSSAAEVLNKHGRP  424

Query  1146  ---------------------AKLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPI  1262
                                   K+  K+AG+HW + +R+HAAEL AGYYNTR+R+GYLP 
Sbjct  425   RVFNSMRDASNGHVIYEFTPACKMGIKLAGVHWWFKSRAHAAELTAGYYNTRDRDGYLPF  484

Query  1263  AHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDS  1442
               ML +H    +FTC+EM+D E P    CSP+ L++QV  A +  G  L+GENAL+RYD 
Sbjct  485   MAMLRRHDASLSFTCVEMRDCEHPPEGRCSPQALLQQVIEAAEKYGVPLSGENALQRYDD  544

Query  1443  RGYEQVL--ATSRSDSGNGLSAFTYLRMNKNLFEPENWRKLVEFVKSM  1580
               +E++   A  R+     L+  T+LRM   +F  +NW     F+  M
Sbjct  545   YAFERIAESAFGRNARAGRLTQVTFLRMGDLMF--DNWDAFSRFLNRM  590



>dbj|BAD93291.1| beta-amylase [Glycine max]
Length=496

 Score =   449 bits (1154),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 217/445 (49%), Positives = 294/445 (66%), Gaps = 11/445 (2%)
 Frame = +3

Query  270   LAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLV  449
             +A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++
Sbjct  1     MATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGII  60

Query  450   EKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNP  629
             E  GP +Y+W  Y +L ++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N 
Sbjct  61    ELKGPKQYDWRAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNH  120

Query  630   DLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQV  806
             D+ YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++V
Sbjct  121   DIFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEV  180

Query  807   GMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAG  986
             G+GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG
Sbjct  181   GLGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAG  237

Query  987   QYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKI  1166
             +YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K+
Sbjct  238   KYNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKV  297

Query  1167  AGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSAN  1346
             +GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP    
Sbjct  298   SGIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDVK  357

Query  1347  CSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--  1505
               P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  
Sbjct  358   SGPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGV  417

Query  1506  TYLRMNKNLFEPENWRKLVEFVKSM  1580
             TYLR++ +L +  N+    +FV  M
Sbjct  418   TYLRLSDDLLQKSNFNIFKKFVLKM  442



>pdb|1WDQ|A Chain A, The Role Of An Inner Loop In The Catalytic Mechanism 
Of Soybean Beta-Amylase
Length=495

 Score =   448 bits (1153),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 294/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NF C+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFVCLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>pdb|1WDS|A Chain A, The Role Of An Inner Loop In The Catalytic Mechanism 
Of Soybean Beta- Amylase
Length=495

 Score =   448 bits (1153),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 294/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NF C+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFACLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>pdb|1Q6G|A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant (N340t) 
With Increased Ph Optimum
Length=495

 Score =   448 bits (1152),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 294/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  +  FTC+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILTFTCLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>dbj|BAD93289.1| beta-amylase [Glycine max]
Length=496

 Score =   448 bits (1152),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 217/445 (49%), Positives = 294/445 (66%), Gaps = 11/445 (2%)
 Frame = +3

Query  270   LAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLV  449
             +A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++
Sbjct  1     MATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGII  60

Query  450   EKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNP  629
             E  GP +Y+W  Y +L ++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N 
Sbjct  61    ELKGPKQYDWRAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNH  120

Query  630   DLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQV  806
             D+ YT+RSG R  EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++V
Sbjct  121   DIFYTNRSGTRTKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEV  180

Query  807   GMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAG  986
             G+GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG
Sbjct  181   GLGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAG  237

Query  987   QYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKI  1166
             +YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K+
Sbjct  238   KYNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKV  297

Query  1167  AGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSAN  1346
             +GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A 
Sbjct  298   SGIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAK  357

Query  1347  CSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--  1505
               P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  
Sbjct  358   SGPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGV  417

Query  1506  TYLRMNKNLFEPENWRKLVEFVKSM  1580
             TYLR++ +L +  N+    +FV  M
Sbjct  418   TYLRLSDDLLQKSNFNIFKKFVLKM  442



>pdb|1Q6D|A Chain A, Crystal Structure Of Soybean Beta-Amylase Mutant (M51t) 
With Increased Ph Optimum
Length=495

 Score =   448 bits (1152),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 294/444 (66%), Gaps = 11/444 (2%)
 Frame = +3

Query  273   AANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVE  452
             A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GV VD WWG++E
Sbjct  1     ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVTVDVWWGIIE  60

Query  453   KDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPD  632
               GP +Y+W  Y +L+++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N D
Sbjct  61    LKGPKQYDWRAYRSLLQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD  120

Query  633   LVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVG  809
             + YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++VG
Sbjct  121   IFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG  180

Query  810   MGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQ  989
             +GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG+
Sbjct  181   LGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAGK  237

Query  990   YNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIA  1169
             YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K++
Sbjct  238   YNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVS  297

Query  1170  GIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANC  1349
             GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A  
Sbjct  298   GIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKS  357

Query  1350  SPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--T  1508
              P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  T
Sbjct  358   GPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGVT  417

Query  1509  YLRMNKNLFEPENWRKLVEFVKSM  1580
             YLR++ +L +  N+    +FV  M
Sbjct  418   YLRLSDDLLQKSNFNIFKKFVLKM  441



>ref|XP_009409087.1| PREDICTED: beta-amylase 3, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=561

 Score =   450 bits (1158),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 217/430 (50%), Positives = 285/430 (66%), Gaps = 5/430 (1%)
 Frame = +3

Query  312   VFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEGYA  491
             VF+ LPLD +   G + + ++M AS MAL +AGVEG+ V+ WWG+VE++ P  Y+W GY 
Sbjct  99    VFVTLPLDAVGTSGQMARKKAMRASFMALSAAGVEGIAVECWWGIVEREAPGVYDWGGYM  158

Query  492   ALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRNPE  671
              LV + Q  GLK++ +M+FHQ G   GD   IPLP WVLEE+ K P+L + DR GRRN E
Sbjct  159   DLVMLAQRCGLKVRAIMAFHQWGTGPGDPGWIPLPRWVLEEMDKEPNLAFADRFGRRNKE  218

Query  672   YISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIVEVQVGMGPCGELRYPSYPE  851
             YISLGCD  PVLRGR+P+Q Y+D+MRSFR+ F++++  VI E+QVGMGP GELRYPS P 
Sbjct  219   YISLGCDVFPVLRGRSPIQAYSDFMRSFRDTFRDFLRVVITEIQVGMGPAGELRYPSCPS  278

Query  852   SNGTWRFPG--IGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFFR  1025
                        +GEFQCYDKYM ASL+A A+  G  EWG  GP  A  + Q PE+T FF+
Sbjct  279   EKLIRARAAAELGEFQCYDKYMLASLSACAQKVGMDEWGYGGPIGASNFPQNPEETAFFK  338

Query  1026  RDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSHA  1205
              DG+W T YGQFFLEWYSG LL HG+R+   A  +F GTG ++S K+AGIHWHY+T SH 
Sbjct  339   SDGSWNTPYGQFFLEWYSGLLLLHGERLCMVADVIFLGTGVQISAKVAGIHWHYSTNSHP  398

Query  1206  AELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKVA  1385
             +EL AGYYNT  R+GYLPIA M +++ +     C +M+D E+  +   SPEG +R++   
Sbjct  399   SELTAGYYNTLIRDGYLPIARMFSRYRMTLCCMCFDMRDSEESSNPRSSPEGFLRKLIYT  458

Query  1386  TKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLSA---FTYLRMNKNLFEPENWRK  1556
              +     L GEN+  R D    +QV+  S+   G    A   F Y+RMN+NLF+  NW +
Sbjct  459   ARMCKLPLTGENSFARLDEASLDQVVKNSKLYYGGVYEASLSFNYVRMNRNLFDSHNWNR  518

Query  1557  LVEFVKSMSE  1586
                FVK MS+
Sbjct  519   FTRFVKRMSD  528



>dbj|BAD93290.1| beta-amylase [Glycine max]
Length=496

 Score =   447 bits (1151),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 218/445 (49%), Positives = 296/445 (67%), Gaps = 11/445 (2%)
 Frame = +3

Query  270   LAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLV  449
             +A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+GVMVD WWG++
Sbjct  1     MATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGII  60

Query  450   EKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNP  629
             E  GP +Y+W  Y +L ++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N 
Sbjct  61    ELKGPKQYDWRAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNH  120

Query  630   DLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQV  806
             D+ YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++V
Sbjct  121   DIFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEV  180

Query  807   GMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAG  986
             G+GP GELRYPSYP+S G W FPGIGEFQCYDKY++    A+    G  EW    P DAG
Sbjct  181   GLGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKPDFKAAVARAGHPEW--ELPDDAG  237

Query  987   QYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKI  1166
             +YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K+
Sbjct  238   KYNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKV  297

Query  1167  AGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSAN  1346
             +GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A 
Sbjct  298   SGIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAK  357

Query  1347  CSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSD--SGNG---LSAF--  1505
               P+ LV+QV          +AGENAL RYD+  Y Q++  +R    + NG   LS F  
Sbjct  358   SGPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVTNNGPPKLSMFGV  417

Query  1506  TYLRMNKNLFEPENWRKLVEFVKSM  1580
             TYLR++ +L +  N+    +FV  M
Sbjct  418   TYLRLSDDLLQKSNFNIFKKFVLKM  442



>emb|CAN65860.1| hypothetical protein VITISV_014849 [Vitis vinifera]
Length=542

 Score =   449 bits (1155),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 227/452 (50%), Positives = 296/452 (65%), Gaps = 12/452 (3%)
 Frame = +3

Query  255   ERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDA  434
             E  HG +A +S  S    PVF+ LP+D ++  G + + ++M  S  A+ +AGVEGV+++ 
Sbjct  73    ELQHGFSAQRSKGS----PVFVTLPVDVVSSSGEVRRWKTMVQSFRAIAAAGVEGVVMEV  128

Query  435   WWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEE  614
             WWGLVE++ P  YNW+GY  +V + +  GLK++VVM+FHQCG   GD   IPLP WVLEE
Sbjct  129   WWGLVEREEPRVYNWQGYMEIVALARRXGLKVRVVMAFHQCGTGPGDPSWIPLPQWVLEE  188

Query  615   ISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV  794
             + ++PDL ++DR G RN EYISLGCD LPVLRGR+P+Q Y D+MR+FR+ FK ++G  I 
Sbjct  189   MDRDPDLAFSDRFGTRNXEYISLGCDILPVLRGRSPIQTYXDFMRNFRDTFKPFLGLTIT  248

Query  795   EVQVGMGPCGELRYPSYPESNGT--WRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRS  968
              +QVGMGP GELRYPS P    T  WR   +GEFQCYDKYM ASL A A   G  EWG  
Sbjct  249   VIQVGMGPAGELRYPSCPSHKLTWAWRSYELGEFQCYDKYMLASLNACAREIGMHEWGNG  308

Query  969   GPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGA  1148
             GP   G     PE T FFR +G+W T YG+FFLEWYS  LL HG+RI   A  +F+G   
Sbjct  309   GPIGTGNLMHNPEHTEFFRSNGSWNTPYGKFFLEWYSRMLLLHGERICKEAETIFRGIEV  368

Query  1149  KLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDG-  1325
             + S K+AGIHWHY T+SH +EL AGYYNT  R+GYLPI  M  K+G     TC EM+D  
Sbjct  369   RTSAKVAGIHWHYGTQSHPSELTAGYYNTSIRDGYLPIVRMFCKYGFTLCSTCFEMQDAD  428

Query  1326  EQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLS--  1499
             E+  +   SPEG +RQ+ +  +  G  L GEN+  R D + ++QVL  S   S +GL   
Sbjct  429   EKQRNPVSSPEGFLRQLLLTARICGIPLEGENSGARLDDKSFQQVLKMSXFYS-DGLEKP  487

Query  1500  --AFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
               +F ++RM+KN FE +NW +   FV+ MS G
Sbjct  488   SFSFNFVRMDKNFFEYDNWVRFTRFVRQMSGG  519



>ref|XP_010659745.1| PREDICTED: beta-amylase 1, chloroplastic-like [Vitis vinifera]
Length=542

 Score =   449 bits (1155),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 227/452 (50%), Positives = 296/452 (65%), Gaps = 12/452 (3%)
 Frame = +3

Query  255   ERLHGLAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDA  434
             E  HG +A +S  S    PVF+ LP+D ++  G + + ++M  S  A+ +AGVEGV+++ 
Sbjct  73    ELQHGFSAQRSKGS----PVFVTLPVDVVSSSGEVRRWKTMVQSFRAIAAAGVEGVVMEV  128

Query  435   WWGLVEKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEE  614
             WWGLVE++ P  YNW+GY  +V + +  GLK++VVM+FHQCG   GD   IPLP WVLEE
Sbjct  129   WWGLVEREEPRVYNWQGYMEIVALARRCGLKVRVVMAFHQCGTGPGDPSWIPLPQWVLEE  188

Query  615   ISKNPDLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYMGNVIV  794
             + ++PDL ++DR G RN EYISLGCD LPVLRGR+P+Q Y D+MR+FR+ FK ++G  I 
Sbjct  189   MDRDPDLAFSDRFGTRNMEYISLGCDILPVLRGRSPIQTYVDFMRNFRDTFKPFLGLTIT  248

Query  795   EVQVGMGPCGELRYPSYPESNGT--WRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRS  968
              +QVGMGP GELRYPS P    T  WR   +GEFQCYDKYM ASL A A   G  EWG  
Sbjct  249   VIQVGMGPAGELRYPSCPSHKLTWAWRSYELGEFQCYDKYMLASLNACAREIGMHEWGNG  308

Query  969   GPHDAGQYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGA  1148
             GP   G     PE T FFR +G+W T YG+FFLEWYS  LL HG+RI   A  +F+G   
Sbjct  309   GPIGTGNLMHNPEHTEFFRSNGSWNTPYGKFFLEWYSRMLLLHGERICKEAETIFRGIEV  368

Query  1149  KLSGKIAGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDG-  1325
             + S K+AGIHWHY T+SH +EL AGYYNT  R+GYLPI  M  K+G     TC EM+D  
Sbjct  369   RTSAKVAGIHWHYGTQSHPSELTAGYYNTSIRDGYLPIVRMFCKYGFTLCSTCFEMQDAD  428

Query  1326  EQPGSANCSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNGLS--  1499
             E+  +   SPEG +RQ+ +  +  G  L GEN+  R D + ++QVL  S S   +GL   
Sbjct  429   EKQRNPVSSPEGFLRQLLLTARICGIPLEGENSGARLDDKSFQQVLKMS-SFYSDGLEKP  487

Query  1500  --AFTYLRMNKNLFEPENWRKLVEFVKSMSEG  1589
               +F ++RM+KN FE +NW +   FV+ MS G
Sbjct  488   SFSFNFVRMDKNFFEYDNWVRFTRFVRQMSGG  519



>sp|O22585.1|AMYB_MEDSA RecName: Full=Beta-amylase; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase [Medicago sativa]
 gb|AAD04188.1| beta-amylase [Medicago sativa]
Length=496

 Score =   447 bits (1150),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/456 (48%), Positives = 299/456 (66%), Gaps = 11/456 (2%)
 Frame = +3

Query  270   LAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLV  449
             +A +  +   + VPV++MLPL  I +      P  +   L+ LR+AGV+GVM+D WWG++
Sbjct  1     MATSNKNMLLNYVPVYVMLPLGVINVNNVFEDPDGLKEQLVQLRAAGVDGVMIDVWWGII  60

Query  450   EKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNP  629
             E+ GP +Y+W  Y +L ++VQ+ GLKLQ +MSFHQCGGNVGD  +IPLP WVL+    +P
Sbjct  61    EQKGPKEYDWSAYKSLFQLVQKCGLKLQAIMSFHQCGGNVGDVVNIPLPKWVLDIGESDP  120

Query  630   DLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQV  806
             D+ YT+RSG RN EY+S+G D  P+  GRT +++Y+DYM+SFRE   + +   VI++++V
Sbjct  121   DIFYTNRSGIRNQEYLSIGVDNKPIFHGRTAIEIYSDYMKSFRENMSDLLKSEVIIDIEV  180

Query  807   GMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAG  986
             G+GP GELRYPSYP++ G W+FPGIGEFQCYDKY+R S  A+A   G SEW    P DAG
Sbjct  181   GLGPAGELRYPSYPQNQG-WQFPGIGEFQCYDKYLRESFKAAAAKAGHSEW--ELPDDAG  237

Query  987   QYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKI  1166
              YN  PE T FF+ +GT+ TE G+FFL WYS +LL HGD+IL  A   F G   KL+ K+
Sbjct  238   TYNDVPESTEFFKTNGTYLTEKGKFFLTWYSNQLLNHGDQILDEANKAFLGCKVKLAIKV  297

Query  1167  AGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSAN  1346
             +GIHW Y   +HAAEL AGYYN  +R+GY PIA ++++H  + NFTC+EM+D EQ   A+
Sbjct  298   SGIHWWYKAPNHAAELTAGYYNLDDRDGYRPIAKIVSRHHAILNFTCLEMRDSEQSSDAH  357

Query  1347  CSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-------LSAF  1505
              SP+ LV+QV         E+AGENAL RYD+  Y Q++  +R    N        +   
Sbjct  358   SSPQKLVQQVLSGGWRENIEVAGENALSRYDATAYNQIILNARPQGVNKDGPPKLRMYGV  417

Query  1506  TYLRMNKNLFEPENWRKLVEFVKSMSEGGRSTRLPE  1613
             TYLR++ +L +  N+    +FV  M         PE
Sbjct  418   TYLRLSDDLMQQSNFDIFKKFVVKMHADQDYCSDPE  453



>dbj|BAD93288.1| beta-amylase [Glycine max]
Length=496

 Score =   447 bits (1150),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 217/445 (49%), Positives = 294/445 (66%), Gaps = 11/445 (2%)
 Frame = +3

Query  270   LAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLV  449
             +A + S+   + VPV++MLPL  + +      P  +   L+ LR+AGV+ VMVD WWG++
Sbjct  1     MATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDRVMVDVWWGII  60

Query  450   EKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNP  629
             E  GP +Y+W  Y +L ++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    N 
Sbjct  61    ELKGPKQYDWRAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNH  120

Query  630   DLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQV  806
             D+ YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++V
Sbjct  121   DIFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEV  180

Query  807   GMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAG  986
             G+GP GELRYPSYP+S G W FPGIGEFQCYDKY++A   A+    G  EW    P DAG
Sbjct  181   GLGPAGELRYPSYPQSQG-WEFPGIGEFQCYDKYLKADFKAAVARAGHPEW--ELPDDAG  237

Query  987   QYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKI  1166
             +YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F G   KL+ K+
Sbjct  238   KYNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKV  297

Query  1167  AGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSAN  1346
             +GIHW Y   +HAAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQP  A 
Sbjct  298   SGIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAK  357

Query  1347  CSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--  1505
               P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  
Sbjct  358   SGPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGV  417

Query  1506  TYLRMNKNLFEPENWRKLVEFVKSM  1580
             TYLR++ +L +  N+    +FV  M
Sbjct  418   TYLRLSDDLLQKSNFNIFKKFVLKM  442



>ref|XP_007132589.1| hypothetical protein PHAVU_011G107700g [Phaseolus vulgaris]
 gb|ESW04583.1| hypothetical protein PHAVU_011G107700g [Phaseolus vulgaris]
Length=497

 Score =   447 bits (1149),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 214/433 (49%), Positives = 287/433 (66%), Gaps = 11/433 (3%)
 Frame = +3

Query  306   VPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLVEKDGPLKYNWEG  485
             VPV++MLPL  +T+      P  +   L+ LR+  ++GVMVD WWG+VE  GP +Y+W  
Sbjct  14    VPVYVMLPLGVVTVDSVFGDPNGLKEQLLKLRATEIDGVMVDVWWGIVELKGPKQYDWSA  73

Query  486   YAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDRSGRRN  665
             Y +L K+VQE GLKLQ +MSFHQCGGNVGD  +IP+P WVL+    +PD+ YT+RSG RN
Sbjct  74    YRSLFKLVQECGLKLQAIMSFHQCGGNVGDVVNIPIPKWVLDIGESDPDIFYTNRSGTRN  133

Query  666   PEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQVGMGPCGELRYPS  842
              EY+S+G D  P+  GRT +++Y+DYM+SFRE   +++   +IV+++VG+GP GELRYPS
Sbjct  134   KEYLSVGVDDEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIVDIEVGLGPAGELRYPS  193

Query  843   YPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAGQYNQFPEDTGFF  1022
             YP++ G W FPGIGEFQCYDKY++A    +  + G  EW    P DAGQYN  PE +GFF
Sbjct  194   YPQNQG-WEFPGIGEFQCYDKYLKADYKEAVVSAGHPEW--ELPDDAGQYNDVPESSGFF  250

Query  1023  RRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKIAGIHWHYNTRSH  1202
             + +GT+ TE G+FFL WYS KLL HGD+IL  A   F G+  KL+ K++GIHW Y   +H
Sbjct  251   KSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLGSKVKLAIKVSGIHWWYKVENH  310

Query  1203  AAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSANCSPEGLVRQVKV  1382
             AAEL AGYYN  +R+GY PIA ML++H  + NFTC+EM+D EQ   A   P  LV+QV  
Sbjct  311   AAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQSSDAKSGPAELVQQVLS  370

Query  1383  ATKDagaelagenaleRYDSRGYEQVLATSRSDSGN-------GLSAFTYLRMNKNLFEP  1541
                     +AGENAL RYDS  Y Q++  +R    N        +   TYLR++ +L + 
Sbjct  371   GGWTEDILVAGENALPRYDSTAYNQIILNARPQGVNKNGPPKAKMFGVTYLRLSDDLLQQ  430

Query  1542  ENWRKLVEFVKSM  1580
              N+    +FV  M
Sbjct  431   SNYDTFKKFVLKM  443



>gb|AAY40266.1| beta-amylase [Glycine max]
Length=496

 Score =   446 bits (1148),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 215/445 (48%), Positives = 293/445 (66%), Gaps = 11/445 (2%)
 Frame = +3

Query  270   LAANQSHSSSSRVPVFIMLPLDTITMGGNLNKPRSMNASLMALRSAGVEGVMVDAWWGLV  449
             +A +  +   + VPV++MLPL  +T+      P  +   L+ LR+AGV+GVMVD WWG++
Sbjct  1     MATSDRNMLLNYVPVYVMLPLGVVTVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGII  60

Query  450   EKDGPLKYNWEGYAALVKMVQEHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNP  629
             E  GP +Y+W  Y +L ++VQE GL LQ +MSFHQCGGNVGD  +IP+P WVL+    NP
Sbjct  61    ELKGPKQYDWSAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDVVNIPIPQWVLDIGESNP  120

Query  630   DLVYTDRSGRRNPEYISLGCDQLPVLRGRTPVQVYADYMRSFRERFKEYM-GNVIVEVQV  806
             D+ YT+RSG RN EY+++G D  P+  GRT +++Y+DYM+SFRE   +++   +I++++V
Sbjct  121   DIFYTNRSGFRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEV  180

Query  807   GMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMRASLAASAEAHGKSEWGRSGPHDAG  986
             G+GP GELRYPSYP+S G W FPGIG+FQCYDKY++A   A+    G  EW    P DAG
Sbjct  181   GLGPAGELRYPSYPQSQG-WEFPGIGDFQCYDKYLKADFKAAVARAGHPEW--ELPDDAG  237

Query  987   QYNQFPEDTGFFRRDGTWKTEYGQFFLEWYSGKLLEHGDRILTAAAGVFQGTGAKLSGKI  1166
             +YN  PE TGFF+ +GT+ TE G+FFL WYS KLL HGD+IL  A   F     KL+ K+
Sbjct  238   KYNDVPESTGFFKSNGTYVTEKGKFFLTWYSNKLLNHGDQILDEANKAFLSCKVKLAIKV  297

Query  1167  AGIHWHYNTRSHAAELNAGYYNTRERNGYLPIAHMLAKHGVVFNFTCMEMKDGEQPGSAN  1346
             +GIHW Y   +HAAEL AGYYN   R+GY PIA +L++H  + NFTC+EM+D EQP  A 
Sbjct  298   SGIHWWYKVENHAAELTAGYYNLNNRDGYRPIARLLSRHHAILNFTCLEMRDSEQPSDAK  357

Query  1347  CSPEGLVRQVKVATKDagaelagenaleRYDSRGYEQVLATSRSDSGNG-----LSAF--  1505
               P+ LV+QV          +AGENAL RYD+  Y Q++  +R    N      LS F  
Sbjct  358   SGPQELVQQVLSGGWREDIRVAGENALPRYDATAYNQIILNARPQGVNNNGPPKLSMFGV  417

Query  1506  TYLRMNKNLFEPENWRKLVEFVKSM  1580
             TY R++ +L +  N+    +FV  M
Sbjct  418   TYFRLSDDLLQKSNFNIFKKFVLKM  442



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6752487684330