BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8241_g2_i1 len=911 path=[889:0-910]

Length=911
                                                                      Score     E

ref|XP_007133838.1|  hypothetical protein PHAVU_011G213200g             388   3e-130   
ref|XP_003542855.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    384   9e-129   
ref|XP_009768570.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    383   3e-128   
ref|XP_009628854.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    382   6e-128   
ref|XP_011090371.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    381   1e-127   
gb|KGN62492.1|  hypothetical protein Csa_2G356660                       380   2e-127   
ref|XP_004142869.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    380   3e-127   
ref|XP_003531442.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    380   3e-127   
ref|XP_004142870.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    380   3e-127   
gb|KHN39926.1|  ADP,ATP carrier protein 1, mitochondrial                380   4e-127   
ref|XP_009773874.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    380   4e-127   
gb|KHG00455.1|  ADP,ATP carrier 1, mitochondrial                        379   6e-127   
gb|KDP43465.1|  hypothetical protein JCGZ_16752                         379   7e-127   
emb|CAA05979.1|  adenine nucleotide translocator                        379   8e-127   Lupinus albus
ref|XP_006345460.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    379   9e-127   
ref|XP_002299948.1|  adenine nucleotide translocator family protein     379   1e-126   Populus trichocarpa [western balsam poplar]
gb|EPS71896.1|  hypothetical protein M569_02862                         376   1e-126   
ref|XP_006439128.1|  hypothetical protein CICLE_v10033595mg             379   1e-126   
ref|XP_009593341.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    379   1e-126   
ref|XP_004229620.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    378   1e-126   
ref|XP_004513729.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    378   2e-126   
gb|KDP22076.1|  hypothetical protein JCGZ_25907                         378   2e-126   
gb|ADN33720.1|  adenine nucleotide translocator                         378   2e-126   
ref|XP_009590576.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    378   2e-126   
gb|KDO83390.1|  hypothetical protein CISIN_1g016015mg                   378   2e-126   
ref|XP_009590575.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    379   2e-126   
gb|KDO83389.1|  hypothetical protein CISIN_1g016015mg                   378   2e-126   
gb|ADN33719.1|  adenine nucleotide translocator                         378   2e-126   
ref|XP_010067876.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    378   3e-126   
ref|XP_011080275.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    378   3e-126   
ref|XP_011025426.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    378   3e-126   
ref|XP_006379099.1|  ADP family protein                                 377   3e-126   
ref|XP_009381664.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    377   4e-126   
gb|KCW66116.1|  hypothetical protein EUGRSUZ_G03388                     380   5e-126   
gb|AFX72760.1|  ATP/ADP carrier protein                                 376   1e-125   
ref|XP_010547255.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    376   1e-125   
ref|NP_001276257.1|  ADP,ATP carrier protein 1, mitochondrial-like      376   2e-125   
ref|XP_010928866.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    376   2e-125   
emb|CDP20773.1|  unnamed protein product                                372   2e-125   
ref|XP_009391811.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    375   2e-125   
ref|XP_009415408.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    375   2e-125   
gb|EYU46270.1|  hypothetical protein MIMGU_mgv1a0080302mg               369   2e-125   
ref|XP_010534246.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    375   3e-125   
ref|XP_010246934.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    375   3e-125   
ref|XP_002279748.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    375   3e-125   Vitis vinifera
ref|XP_007052542.1|  ADP/ATP carrier 2                                  379   3e-125   
ref|XP_011011044.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    375   4e-125   
ref|XP_002531911.1|  ADP,ATP carrier protein, putative                  375   4e-125   Ricinus communis
ref|XP_009760860.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    377   4e-125   
gb|KEH33219.1|  ADP/ATP carrier protein                                 375   6e-125   
gb|KEH33218.1|  ADP/ATP carrier protein                                 374   7e-125   
ref|XP_010268073.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    374   7e-125   
ref|XP_009774739.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    374   8e-125   
ref|XP_007014994.1|  ADP/ATP carrier 2 isoform 1                        374   9e-125   
ref|XP_010257291.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    374   1e-124   
ref|XP_010557791.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    374   1e-124   
ref|XP_009391889.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    374   1e-124   
ref|XP_008231276.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    374   1e-124   
ref|XP_007218125.1|  hypothetical protein PRUPE_ppa007062mg             373   1e-124   
ref|XP_008782907.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    374   2e-124   
emb|CAN81107.1|  hypothetical protein VITISV_008170                     373   2e-124   Vitis vinifera
ref|XP_010913950.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    374   2e-124   
gb|EEC73899.1|  hypothetical protein OsI_08713                          373   2e-124   Oryza sativa Indica Group [Indian rice]
ref|NP_001047941.1|  Os02g0718900                                       373   2e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010913169.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    373   2e-124   
ref|XP_006446100.1|  hypothetical protein CICLE_v10017600mg             373   2e-124   
ref|XP_007148866.1|  hypothetical protein PHAVU_005G020700g             373   3e-124   
ref|XP_009624983.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    373   3e-124   
ref|XP_006470591.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    373   3e-124   
ref|XP_006647801.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    372   3e-124   
ref|XP_008795699.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    372   6e-124   
ref|XP_010313215.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    372   6e-124   
ref|XP_010928502.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    372   7e-124   
emb|CBI16399.3|  unnamed protein product                                368   7e-124   
ref|XP_008375169.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    372   7e-124   
ref|XP_010492107.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    372   8e-124   
ref|XP_002285503.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    372   8e-124   Vitis vinifera
ref|XP_010419930.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    371   8e-124   
ref|XP_010102327.1|  ADP,ATP carrier protein                            372   8e-124   
ref|XP_009355177.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    371   9e-124   
sp|O22342.1|ADT1_GOSHI  RecName: Full=ADP,ATP carrier protein 1, ...    371   1e-123   Gossypium hirsutum [American cotton]
ref|XP_008798767.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    371   1e-123   
ref|XP_006287927.1|  hypothetical protein CARUB_v10001162mg             371   1e-123   
ref|XP_008346928.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    371   1e-123   
ref|XP_009354735.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    370   2e-123   
gb|ABB55387.1|  ADP,ATP carrier protein precursor-like                  370   2e-123   Solanum tuberosum [potatoes]
ref|XP_010453428.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    370   3e-123   
ref|NP_001275285.1|  ADP,ATP carrier protein, mitochondrial             370   3e-123   
ref|XP_002299232.1|  hypothetical protein POPTR_0001s05690g             370   4e-123   Populus trichocarpa [western balsam poplar]
ref|XP_002303893.1|  hypothetical protein POPTR_0003s20360g             369   6e-123   Populus trichocarpa [western balsam poplar]
ref|XP_004306529.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    369   7e-123   
ref|XP_008375168.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    369   9e-123   
ref|XP_008813282.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    369   1e-122   
ref|NP_001234018.1|  ADP/ATP translocator                               368   1e-122   
ref|XP_009375063.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    368   2e-122   
ref|XP_008346927.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    368   2e-122   
ref|XP_002871570.1|  hypothetical protein ARALYDRAFT_488169             368   2e-122   
emb|CAA26600.1|  unnamed protein product                                365   2e-122   Zea mays [maize]
ref|XP_008227151.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    368   3e-122   
ref|XP_007211408.1|  hypothetical protein PRUPE_ppa006913mg             368   3e-122   
ref|XP_008372658.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    367   3e-122   
gb|AFW73142.1|  adenine nucleotide translocator, mRNA                   365   3e-122   
ref|XP_011037819.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    367   3e-122   
ref|XP_002513476.1|  ADP,ATP carrier protein, putative                  367   4e-122   Ricinus communis
ref|NP_001105434.1|  ADP,ATP carrier protein 2, mitochondrial pre...    367   4e-122   Zea mays [maize]
emb|CAA33742.1|  adenine nucleotide translocator                        367   6e-122   Zea mays [maize]
ref|XP_004953705.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    367   8e-122   
ref|NP_001105431.1|  ADP,ATP carrier protein 1, mitochondrial pre...    366   9e-122   Zea mays [maize]
gb|AFW63697.1|  adenine nucleotide translocator2                        369   1e-121   
ref|XP_010673613.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    366   1e-121   
ref|XP_010259400.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    366   2e-121   
ref|XP_008677790.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    370   2e-121   
sp|P25083.1|ADT1_SOLTU  RecName: Full=ADP,ATP carrier protein, mi...    365   3e-121   Solanum tuberosum [potatoes]
gb|EMT17760.1|  ADP,ATP carrier protein, mitochondrial                  365   3e-121   
gb|EMS54584.1|  ADP,ATP carrier protein, mitochondrial                  364   4e-121   
ref|NP_196853.1|  ADP/ATP carrier protein 2                             364   6e-121   Arabidopsis thaliana [mouse-ear cress]
gb|KCW66115.1|  hypothetical protein EUGRSUZ_G03387                     364   9e-121   
emb|CAA33743.1|  adenine nucleotide translocator                        363   2e-120   Zea mays [maize]
sp|Q41629.1|ADT1_WHEAT  RecName: Full=ADP,ATP carrier protein 1, ...    361   2e-120   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011042099.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    363   2e-120   
emb|CAA56325.1|  ATP/ADP carrier protein                                360   4e-120   Triticum turgidum [cone wheat]
emb|CAA48579.1|  adenosine nucleotide translocator                      362   6e-120   Arabidopsis thaliana [mouse-ear cress]
prf||1908224A  nucleotide translocator                                  362   7e-120
ref|XP_003539937.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    360   1e-119   
ref|XP_004303109.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    360   2e-119   
ref|XP_009354733.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    360   2e-119   
ref|XP_010555116.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    360   3e-119   
emb|CDP07763.1|  unnamed protein product                                356   4e-119   
ref|XP_010235895.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    359   4e-119   
ref|XP_010555114.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    360   5e-119   
dbj|BAE71194.1|  putative ADP ATP carrier protein                       357   1e-118   Trifolium pratense [peavine clover]
dbj|BAE71236.1|  putative ADP,ATP carrier-like protein                  357   1e-118   Trifolium pratense [peavine clover]
ref|XP_006372724.1|  ADP/ATP CARRIER 3 family protein                   357   3e-118   
ref|XP_010035773.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    356   7e-118   
ref|XP_004510962.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    355   1e-117   
dbj|BAD91181.1|  putative mitochondrial adenylate transporter           355   2e-117   Mesembryanthemum crystallinum
sp|Q41630.1|ADT2_WHEAT  RecName: Full=ADP,ATP carrier protein 2, ...    353   3e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007150379.1|  hypothetical protein PHAVU_005G148300g             355   3e-117   
ref|XP_004505560.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    354   3e-117   
ref|XP_006297905.1|  hypothetical protein CARUB_v10013947mg             354   5e-117   
ref|XP_002884685.1|  adenosine nucleotide translocator                  354   5e-117   
ref|XP_004985877.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    354   6e-117   
gb|EPS69506.1|  hypothetical protein M569_05258                         353   7e-117   
ref|XP_006407762.1|  hypothetical protein EUTSA_v10020919mg             353   8e-117   
gb|KHG01208.1|  ADP,ATP carrier 3, mitochondrial -like protein          353   8e-117   
gb|ABK24587.1|  unknown                                                 353   2e-116   Picea sitchensis
ref|NP_001055139.1|  Os05g0302700                                       353   2e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007132806.1|  hypothetical protein PHAVU_011G126000g             352   2e-116   
ref|XP_004306530.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    353   2e-116   
gb|KEH30700.1|  ADP/ATP carrier protein                                 352   2e-116   
ref|XP_003627715.1|  ADP,ATP carrier protein                            353   2e-116   
ref|XP_009121762.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    352   2e-116   
ref|XP_006654224.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    352   2e-116   
ref|XP_010464465.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    352   2e-116   
ref|XP_010462544.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    352   3e-116   
ref|XP_002468591.1|  hypothetical protein SORBIDRAFT_01g048660          352   4e-116   Sorghum bicolor [broomcorn]
ref|NP_194568.1|  ADP/ATP carrier 3 protein                             352   4e-116   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187470.1|  ADP,ATP carrier protein 1                             352   4e-116   Arabidopsis thaliana [mouse-ear cress]
emb|CAC27140.1|  ADP, ATP carrier protein precursor                     347   5e-116   Picea abies
ref|XP_002867450.1|  hypothetical protein ARALYDRAFT_491934             352   5e-116   
ref|XP_010447988.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    351   5e-116   
ref|XP_006282649.1|  hypothetical protein CARUB_v10005047mg             351   5e-116   
ref|XP_009131345.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    351   7e-116   
ref|NP_001150672.1|  LOC100284305                                       351   8e-116   Zea mays [maize]
ref|XP_003543539.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    351   9e-116   
ref|XP_008350772.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    349   1e-115   
ref|XP_010438469.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    350   2e-115   
gb|KHN30132.1|  ADP,ATP carrier protein, mitochondrial                  350   2e-115   
ref|NP_001275490.1|  ADP,ATP carrier protein, mitochondrial             350   2e-115   
ref|XP_010433228.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    350   2e-115   
sp|P27081.1|ADT2_SOLTU  RecName: Full=ADP,ATP carrier protein, mi...    350   2e-115   Solanum tuberosum [potatoes]
ref|XP_004985876.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    349   4e-115   
gb|AAM65696.1|  ADP,ATP carrier-like protein                            349   4e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291800.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    348   1e-114   
ref|XP_006412961.1|  hypothetical protein EUTSA_v10025467mg             347   2e-114   
gb|ACJ84706.1|  unknown                                                 347   2e-114   Medicago truncatula
emb|CAA46518.1|  adenylate translocator                                 347   2e-114   Arabidopsis thaliana [mouse-ear cress]
gb|KDP24106.1|  hypothetical protein JCGZ_25763                         347   3e-114   
gb|AFK44525.1|  unknown                                                 346   4e-114   
emb|CDX97439.1|  BnaC08g13040D                                          346   4e-114   
ref|XP_009109094.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    346   6e-114   
gb|KHN01114.1|  ADP,ATP carrier protein 3, mitochondrial                345   8e-114   
ref|XP_010689049.1|  PREDICTED: ADP,ATP carrier protein                 346   8e-114   
ref|XP_010260254.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    345   9e-114   
ref|NP_001241092.1|  uncharacterized protein LOC100802974               345   1e-113   
ref|XP_002517886.1|  ADP,ATP carrier protein, putative                  345   1e-113   Ricinus communis
ref|XP_006855242.1|  hypothetical protein AMTR_s00183p00019870          345   1e-113   
gb|EMT13243.1|  ADP,ATP carrier protein, mitochondrial                  343   1e-112   
ref|XP_008789809.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    342   2e-112   
dbj|BAJ99879.1|  predicted protein                                      342   2e-112   
ref|XP_006399842.1|  hypothetical protein EUTSA_v10013800mg             342   2e-112   
ref|XP_008810549.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    342   2e-112   
dbj|BAJ98173.1|  predicted protein                                      342   2e-112   
dbj|BAK03012.1|  predicted protein                                      339   4e-112   
ref|XP_009606916.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    341   6e-112   
ref|XP_002513475.1|  ADP,ATP carrier protein, putative                  340   6e-112   Ricinus communis
emb|CAN66307.1|  hypothetical protein VITISV_009087                     341   7e-112   Vitis vinifera
gb|EMS49632.1|  ADP,ATP carrier protein, mitochondrial                  340   8e-112   
ref|XP_010943967.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    341   8e-112   
ref|XP_010656992.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    341   8e-112   
ref|XP_002438320.1|  hypothetical protein SORBIDRAFT_10g012150          340   9e-112   Sorghum bicolor [broomcorn]
ref|XP_009781621.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    340   1e-111   
ref|XP_008455276.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    340   1e-111   
ref|XP_004136845.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    340   1e-111   
ref|XP_011047661.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    340   1e-111   
ref|XP_006447271.1|  hypothetical protein CICLE_v10015260mg             340   2e-111   
gb|KDO42766.1|  hypothetical protein CISIN_1g016996mg                   340   2e-111   
ref|XP_002310404.2|  hypothetical protein POPTR_0007s01010g             340   2e-111   Populus trichocarpa [western balsam poplar]
ref|XP_010272403.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    340   2e-111   
ref|XP_007043627.1|  ADP/ATP carrier 3 isoform 1                        339   2e-111   
ref|XP_008381597.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    339   3e-111   
gb|EYU42134.1|  hypothetical protein MIMGU_mgv1a019964mg                338   3e-111   
ref|XP_006447270.1|  hypothetical protein CICLE_v10015260mg             341   4e-111   
gb|ACL53828.1|  unknown                                                 337   4e-111   Zea mays [maize]
ref|XP_004338972.1|  adenine nucleotide translocator, putative          337   4e-111   
gb|KHN36650.1|  ADP,ATP carrier protein 3, mitochondrial                335   5e-111   
ref|XP_010272402.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    339   6e-111   
ref|XP_010091485.1|  ADP,ATP carrier protein 3                          338   6e-111   
ref|XP_011100347.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    338   6e-111   
ref|XP_006367480.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    338   6e-111   
ref|NP_001142273.1|  uncharacterized protein LOC100274442               338   6e-111   Zea mays [maize]
ref|XP_007198831.1|  hypothetical protein PRUPE_ppa007166mg             338   7e-111   
ref|XP_008229069.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    338   7e-111   
gb|ACU24302.1|  unknown                                                 337   1e-110   Glycine max [soybeans]
ref|XP_003543333.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    337   1e-110   
ref|XP_009397774.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    338   1e-110   
ref|XP_004243366.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    338   1e-110   
ref|XP_003540370.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    337   2e-110   
ref|XP_007149829.1|  hypothetical protein PHAVU_005G102000g             336   2e-110   
emb|CDX91117.1|  BnaC02g04800D                                          337   3e-110   
emb|CDX69638.1|  BnaA10g19870D                                          336   3e-110   
emb|CDY09801.1|  BnaC09g43600D                                          337   4e-110   
gb|AGZ15404.1|  ADP, ATP carrier 3 protein                              336   4e-110   
ref|XP_006366306.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    335   5e-110   
emb|CDX70507.1|  BnaC03g05910D                                          335   2e-109   
gb|AFW86475.1|  hypothetical protein ZEAMMB73_378887                    338   2e-109   
emb|CAG17934.1|  adenosine nucleotide translocator                      332   4e-109   Brassica oleracea var. viridis [collards]
emb|CDX78525.1|  BnaA03g04370D                                          333   7e-109   
ref|XP_004486958.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    332   8e-109   
ref|XP_009759661.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    333   1e-108   
gb|ACU24185.1|  unknown                                                 332   1e-108   Azolla caroliniana
gb|AGZ15396.1|  ADP, ATP carrier-like protein                           332   2e-108   
ref|XP_008342894.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    331   3e-108   
ref|XP_003597438.1|  ADP,ATP carrier protein                            330   4e-108   
emb|CDX85645.1|  BnaA02g01680D                                          338   5e-107   
gb|ABV25603.1|  putative mitochondrial ADP/ATP translocase              328   9e-107   
ref|XP_009336233.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    327   1e-106   
ref|XP_001695177.1|  adenine nucleotide translocator                    324   3e-106   Chlamydomonas reinhardtii
ref|XP_009759659.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    326   7e-106   
gb|KCW89548.1|  hypothetical protein EUGRSUZ_A01833                     323   2e-105   
ref|XP_002947108.1|  ADP/ATP carrier protein, probably mitochondrial    322   2e-105   
gb|ABA01103.1|  mitochondrial ADP/ATP translocator                      322   3e-105   Chlamydomonas incerta
ref|XP_008444607.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    316   6e-105   
gb|ESA16560.1|  hypothetical protein GLOINDRAFT_77245                   320   7e-105   
ref|XP_001782951.1|  predicted protein                                  320   1e-104   
ref|XP_008445560.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    318   2e-104   
ref|XP_001779965.1|  predicted protein                                  319   2e-104   
ref|XP_010526510.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    321   3e-104   
emb|CDP14815.1|  unnamed protein product                                320   4e-104   
emb|CDP14814.1|  unnamed protein product                                322   5e-104   
ref|XP_001764599.1|  predicted protein                                  318   6e-104   
dbj|BAH20415.1|  AT3G08580                                              313   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001784997.1|  predicted protein                                  317   1e-103   
emb|CDH55575.1|  atp adp translocator                                   317   1e-103   
emb|CDH59556.1|  carrier protein                                        316   3e-103   
emb|CDS09719.1|  Putative ADP,ATP carrier protein,mitochondrial         315   3e-103   
emb|CDH53267.1|  carrier protein                                        316   4e-103   
emb|CDS05938.1|  Putative ADP,ATP carrier protein 1,mitochondrial       315   4e-103   
ref|XP_003709362.1|  ADP,ATP carrier protein                            316   4e-103   
gb|AAX07662.1|  ADP/ATP carrier protein-like protein                    315   5e-103   Magnaporthe grisea
emb|CBN20772.1|  mitochondrial ADP/ATP translocator protein             315   9e-103   
gb|EKG17016.1|  Mitochondrial carrier protein                           314   3e-102   
gb|AAN11327.1|  ADP-ATP translocase                                     313   4e-102   Gaeumannomyces graminis var. tritici
gb|ENH79007.1|  carrier protein                                         313   7e-102   
gb|EPB91116.1|  ADP,ATP carrier protein, mitochondrial                  313   7e-102   
ref|XP_002965475.1|  hypothetical protein SELMODRAFT_230650             312   7e-102   
gb|EPE07551.1|  carrier protein                                         312   1e-101   
ref|XP_009227205.1|  ADP,ATP carrier protein                            312   1e-101   
emb|CCJ29026.1|  unnamed protein product                                311   1e-101   
gb|EIE78757.1|  ADP,ATP carrier protein                                 311   2e-101   
ref|XP_010088243.1|  ADP,ATP carrier protein                            308   2e-101   
ref|XP_002837794.1|  ADP/ATP carrier protein                            311   2e-101   
ref|XP_006692040.1|  putative ADP/ATP carrier protein                   311   3e-101   
ref|XP_001265129.1|  ADP/ATP carrier protein                            311   3e-101   
ref|XP_001909827.1|  hypothetical protein                               311   5e-101   
ref|XP_003658188.1|  ADP/ATP carrier protein                            311   5e-101   
emb|CEJ01906.1|  Putative ADP,ATP carrier protein, mitochondrial        310   8e-101   
dbj|GAD97782.1|  ADP/ATP carrier protein                                310   9e-101   
ref|XP_008079917.1|  Mitochondrial carrier                              310   1e-100   
ref|XP_750288.1|  mitochondrial ADP,ATP carrier protein (Ant)           310   1e-100   
gb|KIH89197.1|  solute carrier family 25 (mitochondrial adenine n...    308   1e-100   
gb|KEY80366.1|  ADP ATP carrier                                         310   1e-100   
gb|EHK97826.1|  putative ADP,ATP carrier protein                        310   1e-100   
gb|ERS96583.1|  ADP,ATP carrier protein                                 310   1e-100   
ref|XP_010052091.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    312   1e-100   
ref|XP_001228473.1|  ADP/ATP carrier protein                            309   2e-100   
emb|CEG81787.1|  Putative ADP,ATP carrier protein                       309   2e-100   
ref|XP_007860988.1|  mitochondrial carrier                              309   2e-100   
emb|CEG72703.1|  Putative ADP,ATP carrier protein, mitochondrial        308   2e-100   
ref|XP_003667288.1|  hypothetical protein MYCTH_2316753                 309   3e-100   
ref|XP_003351160.1|  ADP/ATP carrier protein                            308   3e-100   
emb|CEI97194.1|  Putative ADP,ATP carrier protein, mitochondrial        308   4e-100   
emb|CCG83952.1|  protein of unknown function                            308   5e-100   
ref|XP_002144144.1|  ADP/ATP carrier protein                            306   7e-100   
dbj|GAM39144.1|  adenine nucleotide carrier                             308   8e-100   
emb|CEG78726.1|  Putative ADP,ATP carrier protein                       307   9e-100   
ref|XP_001269624.1|  ADP/ATP carrier protein                            307   1e-99    
ref|XP_002144143.1|  ADP/ATP carrier protein                            307   1e-99    
gb|KFX50865.1|  ADP,ATP carrier protein                                 308   1e-99    
ref|XP_001398880.1|  ADP/ATP carrier protein                            307   1e-99    
ref|XP_002480550.1|  ADP/ATP carrier protein                            307   1e-99    
emb|CDH59498.1|  carrier protein mitochondrial-like                     306   2e-99    
ref|XP_007727161.1|  ADP,ATP carrier protein                            307   2e-99    
ref|XP_963201.1|  ADP/ATP carrier protein                               306   2e-99    
ref|XP_007918243.1|  putative carrier protein                           306   2e-99    
gb|KDR84934.1|  hypothetical protein GALMADRAFT_233406                  306   3e-99    
gb|KDQ12859.1|  hypothetical protein BOTBODRAFT_34011                   305   3e-99    
ref|XP_661668.1|  ADT_NEUCR ADP,ATP CARRIER PROTEIN (ADP/ATP TRAN...    306   3e-99    
ref|XP_007265679.1|  mitochondrial carrier                              306   4e-99    
ref|XP_001816872.1|  ADP/ATP carrier protein                            305   5e-99    
ref|XP_007598524.1|  ADP,ATP carrier protein                            306   7e-99    
gb|EQB52478.1|  hypothetical protein CGLO_07894                         303   7e-99    
ref|XP_007758253.1|  ADP,ATP carrier protein                            303   7e-99    
ref|XP_003840256.1|  similar to ADP,ATP carrier protein                 305   7e-99    
ref|XP_007585459.1|  putative carrier protein                           305   8e-99    
gb|EPS27841.1|  hypothetical protein PDE_02785                          305   8e-99    
ref|XP_009851690.1|  ADP, ATP carrier protein                           305   8e-99    
emb|CCX09646.1|  Similar to ADP,ATP carrier protein; acc. no. P02723    305   8e-99    
ref|XP_386197.1|  ADT_NEUCR ADP,ATP CARRIER PROTEIN (ADP/ATP TRAN...    305   1e-98    
gb|KEP54249.1|  putative ADP, ATP carrier (ADP/ATP translocase) p...    305   1e-98    
ref|XP_001873172.1|  ADP/ATP carrier protein                            304   1e-98    
ref|XP_011115865.1|  hypothetical protein H072_10403                    304   2e-98    
ref|XP_001212265.1|  ADP/ATP carrier protein                            304   2e-98    
ref|XP_009540389.1|  mitochondrial carrier protein                      304   2e-98    
ref|XP_001934086.1|  ADP/ATP carrier protein                            304   2e-98    
gb|EYE94375.1|  putative mitochondrial ADP,ATP carrier protein          303   2e-98    
ref|XP_008023978.1|  hypothetical protein SETTUDRAFT_107517             304   3e-98    
ref|XP_008729022.1|  ADP,ATP carrier protein                            302   3e-98    
gb|ELU41526.1|  eukaryotic ADP/ATP carrier                              303   3e-98    
ref|XP_007279251.1|  carrier protein                                    303   3e-98    
gb|EFX06704.1|  carnitine acyl carrier                                  303   3e-98    
emb|CCA69136.1|  probable ADP, ATP carrier protein (ADP/ATP trans...    303   4e-98    
gb|KGO47243.1|  Mitochondrial carrier protein                           303   4e-98    
gb|KDQ30847.1|  hypothetical protein PLEOSDRAFT_1062827                 303   4e-98    
gb|KFX85891.1|  hypothetical protein V490_09341                         303   5e-98    
emb|CCO26701.1|  ADP,ATP carrier protein AltName: Full=ADP/ATP tr...    303   5e-98    
ref|XP_006454299.1|  hypothetical protein AGABI2DRAFT_189567            303   5e-98    
gb|KDR76707.1|  hypothetical protein GALMADRAFT_156139                  303   6e-98    
ref|XP_003304315.1|  ADP/ATP carrier protein                            304   6e-98    
gb|EUC53792.1|  ADP, ATP carrier (ADP/ATP translocase) protein, p...    303   6e-98    
ref|XP_002562086.1|  mitochondrial ADP/ATP carrier BAC82547-Penic...    303   6e-98    
ref|XP_007778749.1|  ADP,ATP carrier protein                            303   7e-98    
gb|KFX88669.1|  hypothetical protein O988_08946                         303   7e-98    
ref|XP_007799002.1|  putative carrier protein                           302   7e-98    
ref|XP_009156194.1|  ADP,ATP carrier protein                            303   8e-98    
gb|EPQ67494.1|  ADP-ATP carrier of the mitochondrial inner membrane     302   8e-98    
ref|XP_007336426.1|  eukaryotic ADP/ATP carrier                         302   8e-98    
gb|EMD87278.1|  hypothetical protein COCHEDRAFT_1023464                 303   8e-98    
ref|XP_007704022.1|  hypothetical protein COCSADRAFT_29936              302   9e-98    
emb|CCL99023.1|  predicted protein                                      302   9e-98    
ref|XP_009496938.1|  ADP,ATP carrier protein                            302   9e-98    
ref|XP_001559435.1|  ADP/ATP carrier protein                            302   9e-98    
ref|XP_007835574.1|  ADP/ATP carrier protein                            302   1e-97    
ref|XP_001796004.1|  hypothetical protein SNOG_05601                    302   1e-97    
ref|XP_009254345.1|  hypothetical protein FPSE_02951                    307   1e-97    
ref|XP_001598713.1|  ADP/ATP carrier protein                            302   1e-97    
gb|ESZ96107.1|  ADP,ATP carrier protein                                 302   1e-97    
gb|EKV07561.1|  Mitochondrial ADP,ATP carrier protein (Ant), puta...    302   1e-97    
gb|KFH64900.1|  ADP,ATP carrier protein 2, mitochondrial                302   1e-97    
gb|KFY29059.1|  hypothetical protein V493_02581                         302   1e-97    
ref|XP_003051617.1|  ADP/ATP carrier protein                            302   1e-97    
gb|EWZ02370.1|  ADP,ATP carrier protein                                 302   1e-97    
ref|XP_007325689.1|  hypothetical protein AGABI1DRAFT_110533            302   1e-97    
ref|XP_007689325.1|  hypothetical protein COCMIDRAFT_98907              302   1e-97    
ref|XP_002850778.1|  ADP/ATP carrier protein                            302   1e-97    
emb|CCU76926.1|  ADP/ATP carrier protein                                303   2e-97    
gb|EPB81662.1|  ADP,ATP carrier protein 1, mitochondrial                301   2e-97    
emb|CDS10290.1|  Putative ADP,ATP carrier protein,mitochondrial         301   2e-97    
gb|EWC48323.1|  ADP,ATP carrier protein                                 301   2e-97    
gb|KFY05119.1|  hypothetical protein V491_09203                         301   2e-97    
ref|XP_007314385.1|  hypothetical protein SERLADRAFT_458613             302   2e-97    
gb|EME49358.1|  hypothetical protein DOTSEDRAFT_68212                   301   2e-97    
gb|ELR02880.1|  ADP,ATP carrier protein                                 301   2e-97    
emb|CDM33775.1|  ADP,ATP carrier protein                                301   3e-97    
gb|KHJ35242.1|  putative adp atp carrier protein                        301   3e-97    
ref|XP_007744399.1|  ADP,ATP carrier protein                            299   4e-97    
gb|KFY15533.1|  hypothetical protein V492_01931                         301   4e-97    
gb|EMT68221.1|  ADP,ATP carrier protein                                 300   5e-97    
gb|KGO71759.1|  Mitochondrial carrier protein                           300   5e-97    
gb|EWG42987.1|  ADP,ATP carrier protein                                 300   5e-97    
ref|XP_002988485.1|  hypothetical protein SELMODRAFT_235544             300   5e-97    
ref|XP_007842778.1|  hypothetical protein Moror_17205                   300   5e-97    
emb|CCT67036.1|  probable ADP, ATP carrier protein (ADP/ATP trans...    300   5e-97    
gb|EWG42988.1|  ADP,ATP carrier protein                                 298   6e-97    
ref|XP_011117860.1|  hypothetical protein AOL_s00006g249                300   7e-97    
gb|EMD42117.1|  hypothetical protein CERSUDRAFT_79726                   300   7e-97    
ref|XP_003016213.1|  hypothetical protein ARB_05611                     300   7e-97    
gb|EGD94876.1|  mitochondrial carrier protein                           300   8e-97    
ref|XP_010497666.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    295   8e-97    
gb|EMF17024.1|  mitochondrial carrier                                   300   8e-97    
gb|ABR25608.1|  mitochondrial ADP, ATP carrier protein precursor        294   9e-97    
ref|XP_008712056.1|  ADP,ATP carrier protein                            300   1e-96    
ref|XP_002789451.1|  ADP/ATP carrier protein                            300   1e-96    
ref|XP_010756915.1|  ADP,ATP carrier protein                            299   1e-96    
gb|EGU88025.1|  hypothetical protein FOXB_01508                         300   1e-96    
ref|XP_007000941.1|  hypothetical protein TREMEDRAFT_41701              299   1e-96    
gb|KEQ67555.1|  ADP,ATP carrier protein                                 299   2e-96    
ref|XP_008032171.1|  mitochondrial carrier                              299   2e-96    
emb|CCF36744.1|  ADP,ATP carrier protein                                299   2e-96    
gb|KEQ77702.1|  mitochondrial carrier                                   299   2e-96    
ref|XP_003177001.1|  ADP/ATP carrier protein                            299   2e-96    
ref|XP_007390541.1|  hypothetical protein PHACADRAFT_247486             298   3e-96    
gb|EPT03853.1|  hypothetical protein FOMPIDRAFT_1022048                 298   3e-96    
ref|XP_007294895.1|  40S ribosomal protein S3aE                         298   3e-96    
gb|ACN60125.1|  ATP:ADP antiporter                                      298   3e-96    
ref|XP_001244490.1|  ADP/ATP carrier protein                            298   3e-96    
gb|KEF55967.1|  ADP,ATP carrier protein                                 297   3e-96    
gb|EQK99145.1|  ADP,ATP carrier protein                                 298   4e-96    
gb|KEQ81602.1|  ADP,ATP carrier protein-like protein                    298   4e-96    
gb|KFY70670.1|  hypothetical protein V498_10276                         296   5e-96    
ref|XP_007737962.1|  ADP,ATP carrier protein                            296   5e-96    
ref|XP_003018775.1|  hypothetical protein TRV_07210                     302   5e-96    
gb|KFY47904.1|  hypothetical protein V496_10397                         298   6e-96    
ref|XP_002542493.1|  ADP,ATP carrier protein                            296   6e-96    
ref|XP_007378717.1|  eukaryotic ADP/ATP carrier                         297   1e-95    
gb|EIE87421.1|  ADP,ATP carrier protein                                 300   1e-95    
ref|XP_007762462.1|  mitochondrial carrier                              297   1e-95    
emb|CCH41233.1|  ADP,ATP carrier protein 3                              296   1e-95    
emb|CCO34654.1|  ADP,ATP carrier protein AltName: Full=ADP/ATP tr...    297   1e-95    
emb|CDR40724.1|  CYFA0S05e03730g1_1                                     296   2e-95    
gb|AEH50074.1|  putative ADP/ATP carrier of the mitochondrial inn...    296   2e-95    
ref|XP_007920298.1|  hypothetical protein MYCFIDRAFT_70408              296   2e-95    
gb|EEH05039.1|  ADP,ATP carrier protein                                 296   2e-95    
ref|XP_002978864.1|  hypothetical protein SELMODRAFT_109762             298   2e-95    
ref|XP_002625109.1|  ADP/ATP carrier protein                            296   3e-95    
gb|KDQ63527.1|  hypothetical protein JAAARDRAFT_29546                   295   3e-95    
ref|XP_002993422.1|  hypothetical protein SELMODRAFT_236748             295   3e-95    
ref|XP_002173271.1|  adenine nucleotide carrier Anc1                    296   3e-95    
dbj|BAC82547.1|  ADP/ATP carrier protein                                300   4e-95    
ref|XP_009654735.1|  ADP,ATP carrier protein                            295   4e-95    
ref|XP_004195002.1|  Piso0_005532                                       295   4e-95    
ref|XP_002982134.1|  hypothetical protein SELMODRAFT_115674             297   4e-95    
gb|KFZ02147.1|  hypothetical protein V501_09638                         295   5e-95    
emb|CDK26118.1|  unnamed protein product                                295   6e-95    
ref|XP_001538678.1|  ADP/ATP carrier protein                            295   8e-95    
gb|EGC41068.1|  ADP,ATP carrier protein                                 295   9e-95    
gb|KFY73104.1|  hypothetical protein V499_06748                         294   1e-94    
ref|XP_003004480.1|  ADP/ATP carrier protein                            294   1e-94    
gb|KFY82505.1|  hypothetical protein V500_10500                         294   2e-94    
ref|XP_003856256.1|  hypothetical protein MYCGRDRAFT_65997              294   2e-94    
gb|KEQ93767.1|  hypothetical protein AUEXF2481DRAFT_47440               294   2e-94    
ref|XP_001828677.2|  ADP/ATP carrier protein                            294   2e-94    
ref|NP_985041.1|  ADP/ATP carrier protein                               293   2e-94    
ref|XP_003037182.1|  ADP/ATP carrier protein                            293   2e-94    
ref|XP_002992147.1|  hypothetical protein SELMODRAFT_134740             290   2e-94    
ref|XP_006399841.1|  hypothetical protein EUTSA_v10013800mg             295   3e-94    
gb|KDN42973.1|  hypothetical protein RSAG8_06499                        308   4e-94    
ref|XP_007375229.1|  ADP,ATP carrier protein                            293   4e-94    
gb|KEZ46057.1|  hypothetical protein SAPIO_CDS0902                      293   5e-94    
ref|XP_007298175.1|  ATP:ADP antiporter                                 293   6e-94    
ref|XP_001481936.1|  ADP,ATP carrier protein                            292   6e-94    
ref|XP_004196090.1|  Piso0_005532                                       292   6e-94    
emb|CDO71638.1|  hypothetical protein BN946_scf184911.g108              292   7e-94    
ref|XP_002493614.1|  ADP/ATP carrier protein                            292   7e-94    
gb|AFR98326.1|  ADP,ATP carrier protein                                 292   8e-94    
ref|XP_007802937.1|  ADP, ATP carrier protein                           292   8e-94    
gb|AGO12524.1|  AaceriAER184Wp                                          291   1e-93    
ref|XP_003197280.1|  ADP,ATP carrier protein 2, mitochondrial pre...    291   1e-93    
ref|XP_007360270.1|  eukaryotic ADP/ATP carrier                         291   2e-93    
gb|KGB78973.1|  ADP/ATP translocase                                     291   2e-93    
ref|XP_568302.1|  ATP:ADP antiporter                                    291   2e-93    
gb|AEH41529.1|  ADP,ATP carrier protein                                 291   2e-93    
gb|ABB72849.1|  eukaryotic ADP/ATP carrier                              291   2e-93    
ref|XP_007671674.1|  hypothetical protein BAUCODRAFT_28844              291   3e-93    
gb|EJU01893.1|  eukaryotic ADP/ATP carrier                              291   3e-93    
ref|XP_007873150.1|  hypothetical protein PNEG_01231                    291   3e-93    
gb|AAO32575.1|  PET9                                                    290   5e-93    
gb|EPY49494.1|  adenine nucleotide carrier Anc1                         290   9e-93    
gb|KHC66225.1|  ADP,ATP carrier protein                                 289   1e-92    
ref|XP_001747021.1|  hypothetical protein                               290   1e-92    
ref|XP_002420364.1|  ADP/ATP carrier protein                            289   1e-92    
ref|XP_716829.1|  potential mitochondrial inner membrane ATP/ADP ...    288   2e-92    
ref|XP_006849411.1|  hypothetical protein AMTR_s00160p00071720          291   2e-92    
ref|XP_003870324.1|  Pet9 ADP/ATP carrier protein                       288   2e-92    
gb|EFQ31604.1|  hypothetical protein GLRG_06893                         288   3e-92    
ref|XP_446154.1|  ADP/ATP carrier protein                               288   3e-92    
ref|XP_459840.1|  ADP/ATP carrier protein                               288   3e-92    
ref|XP_001642420.1|  hypothetical protein Kpol_292p4                    288   3e-92    
ref|XP_007417231.1|  hypothetical protein MELLADRAFT_73392              288   4e-92    
emb|CCE26834.1|  probable ADP, ATP carrier protein (ADP/ATP trans...    287   7e-92    
ref|NP_595323.1|  mitochondrial adenine nucleotide carrier Anc1         287   8e-92    
ref|XP_002550970.1|  ADP,ATP carrier protein                            287   8e-92    
ref|XP_001524695.1|  ADP,ATP carrier protein                            287   8e-92    
ref|XP_002554108.1|  ADP/ATP carrier protein                            286   1e-91    
emb|CDR47536.1|  RHTO0S14e05006g1_1                                     287   1e-91    
ref|XP_001384264.1|  ADP/ATP carrier protein                            286   1e-91    
gb|EPX75146.1|  adenine nucleotide carrier Anc1                         287   1e-91    
ref|XP_009265996.1|  ADP,ATP carrier protein                            286   2e-91    
ref|XP_454505.1|  ADP/ATP carrier protein                               286   2e-91    
ref|XP_006965488.1|  adenine nucleotide translocator                    286   2e-91    



>ref|XP_007133838.1| hypothetical protein PHAVU_011G213200g [Phaseolus vulgaris]
 gb|ESW05832.1| hypothetical protein PHAVU_011G213200g [Phaseolus vulgaris]
Length=385

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 214/223 (96%), Positives = 220/223 (99%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTLASDGVAGLYRGFNISC+GIIVYRGLYFGMYDSLKPVLL
Sbjct  223  KAAKKGGERQFNGLIDVYKKTLASDGVAGLYRGFNISCIGIIVYRGLYFGMYDSLKPVLL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE
Sbjct  283  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  385



>ref|XP_003542855.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X1 [Glycine max]
 ref|XP_006594416.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X2 [Glycine max]
 gb|KHN37613.1| ADP,ATP carrier protein 2, mitochondrial [Glycine soja]
Length=369

 Score =   384 bits (985),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 215/223 (96%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  147  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDA  206

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  207  KAAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  266

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AFTQIL+NE
Sbjct  267  TGSLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFTQILKNE  326

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  327  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  369



>ref|XP_009768570.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Nicotiana 
sylvestris]
Length=387

 Score =   383 bits (983),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 215/223 (96%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  165  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  224

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  225  KAAKKGGERQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  284

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  285  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  344

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKKYGSGGA
Sbjct  345  GAKSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKKYGSGGA  387



>ref|XP_009628854.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=387

 Score =   382 bits (981),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 214/223 (96%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  165  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  224

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+K GG RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  225  KASKKGGERQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  284

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  285  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  344

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKKYGSGGA
Sbjct  345  GAKSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKKYGSGGA  387



>ref|XP_011090371.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Sesamum indicum]
 ref|XP_011090373.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Sesamum indicum]
Length=390

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 212/223 (95%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  168  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  227

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  228  KAAKKGGERQFNGLIDVYKKTLQSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  287

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  288  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  347

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQMIVFGKKYGSGGA
Sbjct  348  GAKSLFKGAGANILRAIAGAGVLAGYDKLQMIVFGKKYGSGGA  390



>gb|KGN62492.1| hypothetical protein Csa_2G356660 [Cucumis sativus]
Length=390

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 213/223 (96%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  168  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  227

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  228  KAAKKGGERQFNGLVDVYRKTLQSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  287

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QIL+NE
Sbjct  288  TGKMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKNE  347

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  348  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  390



>ref|XP_004142869.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Cucumis 
sativus]
Length=390

 Score =   380 bits (977),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 213/223 (96%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  168  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  227

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  228  KAAKKGGERQFNGLVDVYRKTLQSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  287

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QIL+NE
Sbjct  288  TGKMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKNE  347

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  348  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  390



>ref|XP_003531442.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Glycine 
max]
 gb|KHN29226.1| ADP,ATP carrier protein 1, mitochondrial [Glycine soja]
Length=388

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 212/223 (95%), Positives = 220/223 (99%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  166  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  225

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  226  KAAKKGGERQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVVL  285

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AFTQIL+NE
Sbjct  286  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFTQILKNE  345

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGGA
Sbjct  346  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKKYGSGGA  388



>ref|XP_004142870.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Cucumis 
sativus]
Length=390

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 213/223 (96%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  168  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  227

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  228  KAAKKGGERQFNGLVDVYRKTLQSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  287

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QIL+NE
Sbjct  288  TGKMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKNE  347

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  348  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  390



>gb|KHN39926.1| ADP,ATP carrier protein 1, mitochondrial [Glycine soja]
Length=389

 Score =   380 bits (976),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 212/223 (95%), Positives = 220/223 (99%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  167  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  226

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  227  KAAKKGGERQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVVL  286

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AFTQIL+NE
Sbjct  287  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFTQILKNE  346

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGGA
Sbjct  347  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKKYGSGGA  389



>ref|XP_009773874.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009773875.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=379

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+K+RDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRLFNFKKERDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVY+KTLASDGVAGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  217  KAAKGGGERQFNGLVDVYKKTLASDGVAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AFTQIL+NE
Sbjct  277  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFTQILKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQM+V GKKYGSGGA
Sbjct  337  GAKSLFKGAGANILRAIAGAGVLSGYDKLQMLVLGKKYGSGGA  379



>gb|KHG00455.1| ADP,ATP carrier 1, mitochondrial [Gossypium arboreum]
Length=386

 Score =   379 bits (974),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 211/223 (95%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  224  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGS+QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  284  TGSMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  344  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  386



>gb|KDP43465.1| hypothetical protein JCGZ_16752 [Jatropha curcas]
Length=383

 Score =   379 bits (973),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  161  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  220

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  221  KAAKKGGERQFNGLIDVYRKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  280

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  281  TGKMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  340

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  341  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  383



>emb|CAA05979.1| adenine nucleotide translocator [Lupinus albus]
Length=388

 Score =   379 bits (974),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 211/223 (95%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  166  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  225

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  226  KAAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  285

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  286  TGSLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  345

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  346  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  388



>ref|XP_006345460.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Solanum 
tuberosum]
Length=378

 Score =   379 bits (972),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNG+VDVY+KTLASDGVAGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  216  KAAKGGGDRQFNGMVDVYKKTLASDGVAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AFTQIL+NE
Sbjct  276  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFTQILKNE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYDKLQ+IV GKKYGSGGA
Sbjct  336  GPKSLFKGAGANILRAIAGAGVLSGYDKLQLIVLGKKYGSGGA  378



>ref|XP_002299948.1| adenine nucleotide translocator family protein [Populus trichocarpa]
 gb|EEE84753.1| adenine nucleotide translocator family protein [Populus trichocarpa]
Length=389

 Score =   379 bits (973),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 211/223 (95%), Positives = 220/223 (99%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  167  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  226

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  227  KAAKKGGGRQFNGLIDVYRKTMASDGLAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  286

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGS+QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  287  TGSMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  346

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  347  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  389



>gb|EPS71896.1| hypothetical protein M569_02862, partial [Genlisea aurea]
Length=316

 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 212/223 (95%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  94   QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  153

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  154  KAAKKGGERQFNGLVDVYRKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  213

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  214  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFAQILKNE  273

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  274  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  316



>ref|XP_006439128.1| hypothetical protein CICLE_v10033595mg [Citrus clementina]
 ref|XP_006482889.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Citrus 
sinensis]
 gb|ESR52368.1| hypothetical protein CICLE_v10033595mg [Citrus clementina]
Length=385

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 210/223 (94%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDA  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  223  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  283  TGKLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  385



>ref|XP_009593341.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Nicotiana 
tomentosiformis]
Length=386

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 212/223 (95%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  224  KAAKKGGGRQFNGLVDVYKKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGS+QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  284  TGSMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQILKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  344  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  386



>ref|XP_004229620.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Solanum 
lycopersicum]
 ref|XP_010324414.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Solanum 
lycopersicum]
Length=375

 Score =   378 bits (971),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  153  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  212

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNG+VDVY+KTLASDGVAGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  213  KAAKGGGDRQFNGMVDVYKKTLASDGVAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  272

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AFTQIL+NE
Sbjct  273  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFTQILKNE  332

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYDKLQ++V GKKYGSGGA
Sbjct  333  GPKSLFKGAGANILRAIAGAGVLSGYDKLQLLVLGKKYGSGGA  375



>ref|XP_004513729.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Cicer 
arietinum]
Length=389

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 212/223 (95%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  167  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  226

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  227  KAAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  286

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  287  TGKLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFKQILKNE  346

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  347  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  389



>gb|KDP22076.1| hypothetical protein JCGZ_25907 [Jatropha curcas]
Length=384

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/223 (95%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  162  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  222  KAAKSGGERQFNGLVDVYRKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  282  TGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSYDAFSQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQMIVFGKKYGSGGA
Sbjct  342  GAKSLFKGAGANILRAIAGAGVLAGYDKLQMIVFGKKYGSGGA  384



>gb|ADN33720.1| adenine nucleotide translocator [Cucumis melo subsp. melo]
Length=390

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/223 (95%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  168  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  227

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  228  KAAKKGGERQFNGLVDVYRKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  287

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  288  TGKMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  347

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  348  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  390



>ref|XP_009590576.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X2 [Nicotiana tomentosiformis]
Length=378

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+K+RDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  156  QALNFAFKDYFKRLFNFKKERDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVY+KTLASDGVAGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  216  KAAKGGGERQFNGLVDVYKKTLASDGVAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AFTQI++NE
Sbjct  276  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFTQIMKNE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQM+V GKKYGSGGA
Sbjct  336  GAKSLFKGAGANILRAIAGAGVLSGYDKLQMLVLGKKYGSGGA  378



>gb|KDO83390.1| hypothetical protein CISIN_1g016015mg [Citrus sinensis]
 gb|KDO83391.1| hypothetical protein CISIN_1g016015mg [Citrus sinensis]
 gb|KDO83392.1| hypothetical protein CISIN_1g016015mg [Citrus sinensis]
Length=385

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDA  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  223  KAAKKGGERQFNGLVDVYRKTMKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  283  TGKLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  385



>ref|XP_009590575.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X1 [Nicotiana tomentosiformis]
Length=409

 Score =   379 bits (973),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+K+RDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  187  QALNFAFKDYFKRLFNFKKERDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  246

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVY+KTLASDGVAGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  247  KAAKGGGERQFNGLVDVYKKTLASDGVAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  306

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AFTQI++NE
Sbjct  307  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFTQIMKNE  366

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQM+V GKKYGSGGA
Sbjct  367  GAKSLFKGAGANILRAIAGAGVLSGYDKLQMLVLGKKYGSGGA  409



>gb|KDO83389.1| hypothetical protein CISIN_1g016015mg [Citrus sinensis]
Length=397

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  175  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDA  234

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  235  KAAKKGGERQFNGLVDVYRKTMKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  294

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  295  TGKLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  354

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  355  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  397



>gb|ADN33719.1| adenine nucleotide translocator [Cucumis melo subsp. melo]
Length=390

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/223 (95%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  168  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  227

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  228  KAAKKGGERQFNGLVDVYRKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  287

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  288  TGKMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  347

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  348  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  390



>ref|XP_010067876.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Eucalyptus 
grandis]
 ref|XP_010067877.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Eucalyptus 
grandis]
Length=391

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 212/223 (95%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWF GNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  169  QALNFAFKDYFKRLFNFKKDKDGYWKWFGGNLASGGAAGASSLLFVYSLDYARTRLANDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  229  KAAKKGGGRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  289  TGTLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  349  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  391



>ref|XP_011080275.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Sesamum 
indicum]
Length=390

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 211/223 (95%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  168  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  227

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  228  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  287

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  288  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFAQILKNE  347

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGGA
Sbjct  348  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKKYGSGGA  390



>ref|XP_011025426.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Populus 
euphratica]
Length=389

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  167  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  226

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KT+ASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  227  KAAKKGGERQFNGLIDVYKKTMASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  286

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  287  TGDMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  346

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  347  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  389



>ref|XP_006379099.1| ADP family protein [Populus trichocarpa]
 gb|ERP56896.1| ADP family protein [Populus trichocarpa]
Length=385

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KT+ASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  223  KAAKKGGERQFNGLIDVYKKTMASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  283  TGDMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  385



>ref|XP_009381664.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009381665.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=391

 Score =   377 bits (969),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWF GNLASGGAAGA SLLFVYSLDYARTRLANDA
Sbjct  169  QALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGACSLLFVYSLDYARTRLANDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  229  KAAKKGGGRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  289  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  349  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  391



>gb|KCW66116.1| hypothetical protein EUGRSUZ_G03388, partial [Eucalyptus grandis]
Length=465

 Score =   380 bits (975),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 212/223 (95%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWF GNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  243  QALNFAFKDYFKRLFNFKKDKDGYWKWFGGNLASGGAAGASSLLFVYSLDYARTRLANDA  302

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  303  KAAKKGGGRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  362

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  363  TGTLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  422

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  423  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  465



>gb|AFX72760.1| ATP/ADP carrier protein, partial [Litchi chinensis]
Length=388

 Score =   376 bits (966),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 209/222 (94%), Positives = 218/222 (98%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  165  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  224

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  225  KAAKKGGERQFNGLVDVYRKTMKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  284

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  285  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  344

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGG
Sbjct  345  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGG  386



>ref|XP_010547255.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial [Tarenaya 
hassleriana]
Length=384

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  162  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  222  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVVL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QIL+NE
Sbjct  282  TGDLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  342  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  384



>ref|NP_001276257.1| ADP,ATP carrier protein 1, mitochondrial-like [Glycine max]
 gb|ACU18447.1| unknown [Glycine max]
Length=389

 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 210/223 (94%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  167  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  226

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  227  KAAKKGGERQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVVL  286

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMM SGEAVKYKSS+ AF QIL+NE
Sbjct  287  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMASGEAVKYKSSLDAFIQILKNE  346

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGGA
Sbjct  347  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKKYGSGGA  389



>ref|XP_010928866.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
Length=391

 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  169  QALNFAFKDYFKRMFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  229  KAAKKGGERQFNGLIDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  289  TGNLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  349  GPKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  391



>emb|CDP20773.1| unnamed protein product [Coffea canephora]
Length=295

 Score =   372 bits (955),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  73   QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  132

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL +DG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  133  KAAKKGGERQFNGLVDVYKKTLQTDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  192

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF QIL+NE
Sbjct  193  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFAQILKNE  252

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  253  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  295



>ref|XP_009391811.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391812.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391813.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=391

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  169  QALNFAFKDYFKRMFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  229  KAAKKGGERQFNGLIDVYRKTMQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  289  TGNLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  349  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  391



>ref|XP_009415408.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRMFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  224  KAAKTGGERQFNGLVDVYRKTLQSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  284  TGKLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+++FGKKYGSGGA
Sbjct  344  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLVLFGKKYGSGGA  386



>gb|EYU46270.1| hypothetical protein MIMGU_mgv1a0080302mg, partial [Erythranthe 
guttata]
Length=222

 Score =   369 bits (948),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 209/222 (94%), Positives = 217/222 (98%), Gaps = 0/222 (0%)
 Frame = -1

Query  908  ALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDAK  729
            ALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAK
Sbjct  1    ALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAK  60

Query  728  AAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLT  549
            AAK GG RQFNGLVDVYRKTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLT
Sbjct  61   AAKKGGERQFNGLVDVYRKTLKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLT  120

Query  548  GSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNEG  369
            GSLQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NEG
Sbjct  121  GSLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNEG  180

Query  368  AKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            AKSLFKGAGAN+LRAVAGAGVLAGYDKLQ+I+ GKKYGSGGA
Sbjct  181  AKSLFKGAGANVLRAVAGAGVLAGYDKLQVILLGKKYGSGGA  222



>ref|XP_010534246.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Tarenaya 
hassleriana]
 ref|XP_010534247.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Tarenaya 
hassleriana]
Length=379

 Score =   375 bits (963),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPVLL
Sbjct  217  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVLL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  277  TGDLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  337  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  379



>ref|XP_010246934.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=395

 Score =   375 bits (964),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 210/223 (94%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLF+F+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  173  QALNFAFKDYFKRLFSFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  232

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDGVAGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  233  KAAKKGGERQFNGLVDVYRKTLKSDGVAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  292

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  293  TGNLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  352

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  353  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  395



>ref|XP_002279748.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Vitis vinifera]
Length=385

 Score =   375 bits (963),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 211/223 (95%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  223  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF QIL+NE
Sbjct  283  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFAQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  385



>ref|XP_007052542.1| ADP/ATP carrier 2 [Theobroma cacao]
 gb|EOX96699.1| ADP/ATP carrier 2 [Theobroma cacao]
Length=507

 Score =   379 bits (974),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  285  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  344

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  345  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  404

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  405  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  464

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IV GKKYGSGGA
Sbjct  465  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVLGKKYGSGGA  507



>ref|XP_011011044.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Populus 
euphratica]
Length=389

 Score =   375 bits (963),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 210/223 (94%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  167  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  226

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  227  KAAKKGGGRQFNGLIDVYKKTLASDGLAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  286

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGS+QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  287  TGSMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQILKNE  346

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  347  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  389



>ref|XP_002531911.1| ADP,ATP carrier protein, putative [Ricinus communis]
 gb|EEF30484.1| ADP,ATP carrier protein, putative [Ricinus communis]
Length=385

 Score =   375 bits (962),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  163  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  223  KAAKKGGERQFNGLVDVYRKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKY+ S+ AF+QIL+NE
Sbjct  283  TGNLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYRGSLDAFSQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  385



>ref|XP_009760860.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Nicotiana 
sylvestris]
Length=436

 Score =   377 bits (967),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 210/223 (94%), Positives = 219/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  214  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  273

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  274  KAAKKGGGRQFNGLIDVYKKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  333

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG++QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  334  TGNMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQILKNE  393

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  394  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  436



>gb|KEH33219.1| ADP/ATP carrier protein [Medicago truncatula]
Length=393

 Score =   375 bits (962),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  171  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  230

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTLA+DGVAGLYRGFNISCVGIIVYRGLYFG+YDSLKPVLL
Sbjct  231  KAAKKGGERQFNGLVDVYKKTLATDGVAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVLL  290

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF QIL+NE
Sbjct  291  TGKLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFQQILKNE  350

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVL+GYDKLQ++VFGKKYGSGGA
Sbjct  351  GAKSLFKGAGANILRAVAGAGVLSGYDKLQVLVFGKKYGSGGA  393



>gb|KEH33218.1| ADP/ATP carrier protein [Medicago truncatula]
Length=389

 Score =   374 bits (961),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  167  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  226

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTLA+DGVAGLYRGFNISCVGIIVYRGLYFG+YDSLKPVLL
Sbjct  227  KAAKKGGERQFNGLVDVYKKTLATDGVAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVLL  286

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF QIL+NE
Sbjct  287  TGKLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFQQILKNE  346

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVL+GYDKLQ++VFGKKYGSGGA
Sbjct  347  GAKSLFKGAGANILRAVAGAGVLSGYDKLQVLVFGKKYGSGGA  389



>ref|XP_010268073.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=368

 Score =   374 bits (959),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 207/222 (93%), Positives = 214/222 (96%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  146  QALNFAFKDYFKRMFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  205

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL +DG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  206  KAAKKGGERQFNGLVDVYRKTLQTDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVIL  265

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QILQNE
Sbjct  266  VGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILQNE  325

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKKYGSGG
Sbjct  326  GMKSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKKYGSGG  367



>ref|XP_009774739.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Nicotiana 
sylvestris]
 ref|XP_009774745.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Nicotiana 
sylvestris]
Length=386

 Score =   374 bits (960),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+K GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  224  KASKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QI++NE
Sbjct  284  TGNLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  344  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  386



>ref|XP_007014994.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao]
 ref|XP_007014995.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao]
 gb|EOY32613.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao]
 gb|EOY32614.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao]
Length=391

 Score =   374 bits (960),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK+LFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  169  QALNFAFKDYFKKLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  229  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  289  VGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQMIV GKKYGSGGA
Sbjct  349  GAKSLFKGAGANILRAVAGAGVLAGYDKLQMIVLGKKYGSGGA  391



>ref|XP_010257291.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Nelumbo 
nucifera]
Length=393

 Score =   374 bits (960),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLF+F+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  171  QALNFAFKDYFKRLFSFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  230

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  231  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  290

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  291  TGKLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  350

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  351  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  393



>ref|XP_010557791.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Tarenaya 
hassleriana]
 ref|XP_010557792.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Tarenaya 
hassleriana]
Length=384

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPVLL
Sbjct  222  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSMKPVLL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  282  TGDLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFGQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  342  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  384



>ref|XP_009391889.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=391

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  169  QALNFAFKDYFKRMFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  229  KAAKKGGERQFNGLVDVYRKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+ E
Sbjct  289  TGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKKE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  349  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  391



>ref|XP_008231276.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Prunus 
mume]
Length=384

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  222  KAAKKGGERQFNGLVDVYRKTLKSDGLAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  282  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFKQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQ+IVFGKKYGSGGA
Sbjct  342  GAKSLFKGAGANILRAIAGAGVLSGYDKLQLIVFGKKYGSGGA  384



>ref|XP_007218125.1| hypothetical protein PRUPE_ppa007062mg [Prunus persica]
 gb|EMJ19324.1| hypothetical protein PRUPE_ppa007062mg [Prunus persica]
Length=384

 Score =   373 bits (958),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  222  KAAKKGGERQFNGLVDVYRKTLKSDGLAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  282  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFKQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQ++VFGKKYGSGGA
Sbjct  342  GAKSLFKGAGANILRAIAGAGVLSGYDKLQLVVFGKKYGSGGA  384



>ref|XP_008782907.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=391

 Score =   374 bits (959),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWF GNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  169  QALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLLFVYSLDYARTRLANDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  229  KAAKKGGERQFNGLIDVYRKTMKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QIL+NE
Sbjct  289  TGKMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKNE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  349  GPKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  391



>emb|CAN81107.1| hypothetical protein VITISV_008170 [Vitis vinifera]
Length=377

 Score =   373 bits (957),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 210/222 (95%), Positives = 215/222 (97%), Gaps = 0/222 (0%)
 Frame = -1

Query  908  ALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDAK  729
            ALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAK
Sbjct  156  ALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAK  215

Query  728  AAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLT  549
            AAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+LT
Sbjct  216  AAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVLT  275

Query  548  GSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNEG  369
            G LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF QIL+NEG
Sbjct  276  GGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFAQILKNEG  335

Query  368  AKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            AKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  336  AKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  377



>ref|XP_010913950.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
 ref|XP_010913951.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
Length=391

 Score =   374 bits (959),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  169  QALNFAFKDYFKRMFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  229  KAAKKGGERQFNGLIDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  289  TGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  349  GPKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  391



>gb|EEC73899.1| hypothetical protein OsI_08713 [Oryza sativa Indica Group]
Length=382

 Score =   373 bits (957),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWF GNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  160  QALNFAFKDYFKRLFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDA  219

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  220  KAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  279

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QIL+NE
Sbjct  280  TGSLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKNE  339

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  340  GAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  382



>ref|NP_001047941.1| Os02g0718900 [Oryza sativa Japonica Group]
 sp|P31691.1|ADT_ORYSJ RecName: Full=ADP,ATP carrier protein, mitochondrial; AltName: 
Full=ADP/ATP translocase; AltName: Full=Adenine nucleotide 
translocator; Short=ANT; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA02161.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 dbj|BAD12908.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 dbj|BAF09855.1| Os02g0718900 [Oryza sativa Japonica Group]
 gb|ABL74578.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 gb|EAZ24408.1| hypothetical protein OsJ_08162 [Oryza sativa Japonica Group]
 dbj|BAG93461.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86857.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 gb|AFI71837.1| ATP/ADP translocator protein [Oryza sativa]
 gb|AFI71838.1| ATP/ADP translocator protein [Oryza sativa]
Length=382

 Score =   373 bits (957),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWF GNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  160  QALNFAFKDYFKRLFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDA  219

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  220  KAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  279

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QIL+NE
Sbjct  280  TGSLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKNE  339

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  340  GAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  382



>ref|XP_010913169.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Elaeis guineensis]
Length=389

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWF GNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  167  QALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLLFVYSLDYARTRLANDA  226

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  227  KAAKKGGERQFNGLIDVYRKTMASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  286

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  287  TGKLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  346

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  347  GVKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  389



>ref|XP_006446100.1| hypothetical protein CICLE_v10017600mg [Citrus clementina]
 gb|ESR59340.1| hypothetical protein CICLE_v10017600mg [Citrus clementina]
Length=394

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  172  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  231

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKTL +DG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  232  KAAKHGGERQFNGLIDVYRKTLKTDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVIL  291

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF+QIL+NE
Sbjct  292  TGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFSQILKNE  351

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQMIV GKKYGSGGA
Sbjct  352  GAKSLFKGAGANILRAIAGAGVLAGYDKLQMIVLGKKYGSGGA  394



>ref|XP_007148866.1| hypothetical protein PHAVU_005G020700g [Phaseolus vulgaris]
 gb|ESW20860.1| hypothetical protein PHAVU_005G020700g [Phaseolus vulgaris]
Length=385

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 218/223 (98%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQF GLVDVYRKTLASDGVAGLYRGFN+SCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  223  KAAKKGGERQFKGLVDVYRKTLASDGVAGLYRGFNLSCVGIIVYRGLYFGLYDSVKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++NE
Sbjct  283  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQIVKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDK+Q++VFGKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLAGYDKMQVLVFGKKYGSGGA  385



>ref|XP_009624983.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Nicotiana 
tomentosiformis]
Length=386

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 208/223 (93%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+K GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  224  KASKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QI++NE
Sbjct  284  TGNLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  344  GPKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  386



>ref|XP_006470591.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Citrus 
sinensis]
 gb|KDO61295.1| hypothetical protein CISIN_1g016168mg [Citrus sinensis]
Length=394

 Score =   373 bits (958),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  172  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  231

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKTL +DG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  232  KAAKHGGERQFNGLIDVYRKTLKTDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVIL  291

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF+QIL+NE
Sbjct  292  TGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFSQILKNE  351

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQMIV GKKYGSGGA
Sbjct  352  GAKSLFKGAGANILRAIAGAGVLAGYDKLQMIVLGKKYGSGGA  394



>ref|XP_006647801.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006647802.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like isoform 
X2 [Oryza brachyantha]
Length=387

 Score =   372 bits (956),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWF GNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  165  QALNFAFKDYFKRLFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDA  224

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  225  KAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  284

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QIL+NE
Sbjct  285  TGSLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKNE  344

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  345  GAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  387



>ref|XP_008795699.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=391

 Score =   372 bits (955),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  169  QALNFAFKDYFKRMFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  229  KAAKKGGGRQFNGLIDVYRKTLASDGLAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+  F+QIL+NE
Sbjct  289  TGKLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDCFSQILKNE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IV GKK+GSGGA
Sbjct  349  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVLGKKFGSGGA  391



>ref|XP_010313215.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Solanum 
lycopersicum]
Length=386

 Score =   372 bits (954),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+K GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  224  KASKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  284  TGNLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQIVKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++V GKKYGSGGA
Sbjct  344  GPKSLFKGAGANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA  386



>ref|XP_010928502.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
Length=391

 Score =   372 bits (954),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRL NDA
Sbjct  169  QALNFAFKDYFKRMFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLTNDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  229  KAAKKGGERQFNGLIDVYRKTLASDGLAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYP DTVRRRMMMTSGEAVKYKSS+  F+QIL+NE
Sbjct  289  TGKLQDSFFASFALGWLITNGAGLASYPTDTVRRRMMMTSGEAVKYKSSLDCFSQILKNE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  349  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  391



>emb|CBI16399.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   368 bits (945),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 209/224 (93%), Positives = 217/224 (97%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  73   QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  132

Query  731  KAAK-GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+
Sbjct  133  KAAKKGGGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVI  192

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+N
Sbjct  193  LTGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFNQILKN  252

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVLAGYDKLQ++V GKKYGSGGA
Sbjct  253  EGAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA  296



>ref|XP_008375169.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Malus domestica]
 ref|XP_008364706.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Malus domestica]
Length=384

 Score =   372 bits (954),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 205/221 (93%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  222  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  282  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQ+IVFGKKYGSG
Sbjct  342  GAKSLFKGAGANILRAIAGAGVLSGYDKLQLIVFGKKYGSG  382



>ref|XP_010492107.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010492108.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010492109.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Camelina 
sativa]
Length=385

 Score =   372 bits (954),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            K+AK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISC GIIVYRGLYFG+YDS+KPVLL
Sbjct  223  KSAKKGGERQFNGLVDVYKKTLRSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVLL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+NE
Sbjct  283  TGDMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  385



>ref|XP_002285503.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Vitis vinifera]
Length=393

 Score =   372 bits (954),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 209/224 (93%), Positives = 217/224 (97%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  170  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  229

Query  731  KAAK-GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+
Sbjct  230  KAAKKGGGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVI  289

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+N
Sbjct  290  LTGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFNQILKN  349

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVLAGYDKLQ++V GKKYGSGGA
Sbjct  350  EGAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA  393



>ref|XP_010419930.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010419931.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Camelina 
sativa]
Length=385

 Score =   371 bits (953),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            K+AK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISC GIIVYRGLYFG+YDS+KPVLL
Sbjct  223  KSAKKGGERQFNGLVDVYKKTLMSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVLL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+NE
Sbjct  283  TGDMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  385



>ref|XP_010102327.1| ADP,ATP carrier protein [Morus notabilis]
 gb|EXB93288.1| ADP,ATP carrier protein [Morus notabilis]
Length=388

 Score =   372 bits (954),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  166  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  225

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKTL SDGVAGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  226  KAAKKGGGRQFNGLIDVYRKTLQSDGVAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVVL  285

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  286  TGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQILKNE  345

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGGA
Sbjct  346  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKKYGSGGA  388



>ref|XP_009355177.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009376878.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=383

 Score =   371 bits (953),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNFRKD+DGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  161  QALNFAFKDYFKRLFNFRKDKDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  220

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  221  KAAKKGGERQFNGLVDVYKKTLKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVIL  280

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASF LGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  281  TGKLQDSFFASFGLGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  340

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ IVFGKKYGSGGA
Sbjct  341  GAKSLFKGAGANILRAVAGAGVLAGYDKLQEIVFGKKYGSGGA  383



>sp|O22342.1|ADT1_GOSHI RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocator 1; Short=ANT 1; Flags: Precursor [Gossypium 
hirsutum]
 gb|AAB72047.1| adenine nucleotide translocator 1 [Gossypium hirsutum]
Length=386

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  224  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGS+QDSFFASF LGWLITNGA LASYPIDTVRRRMMMTSG+AVKYKSS+ AF+QIL+NE
Sbjct  284  TGSMQDSFFASFVLGWLITNGAALASYPIDTVRRRMMMTSGKAVKYKSSLDAFSQILKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAG+NILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  344  GGKSLFKGAGSNILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  386



>ref|XP_008798767.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008798768.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=391

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWF GNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  169  QALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLLFVYSLDYARTRLANDA  228

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  229  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  288

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  289  TGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  348

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGGA
Sbjct  349  GPKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKYGSGGA  391



>ref|XP_006287927.1| hypothetical protein CARUB_v10001162mg [Capsella rubella]
 gb|EOA20825.1| hypothetical protein CARUB_v10001162mg [Capsella rubella]
Length=384

 Score =   371 bits (952),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGG AGASSLLFVYSLDYARTRLAND+
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGGAGASSLLFVYSLDYARTRLANDS  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            K+AK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISC GIIVYRGLYFG+YDS+KPVLL
Sbjct  222  KSAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVLL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+NE
Sbjct  282  TGDMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGAN+LRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  342  GAKSLFKGAGANVLRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  384



>ref|XP_008346928.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Malus domestica]
Length=384

 Score =   371 bits (952),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 204/221 (92%), Positives = 213/221 (96%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  222  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  282  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQ+ VFGKKYGSG
Sbjct  342  GAKSLFKGAGANILRAIAGAGVLSGYDKLQLJVFGKKYGSG  382



>ref|XP_009354735.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Pyrus x 
bretschneideri]
Length=384

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 204/221 (92%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  222  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  282  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQ++VFGKKYGSG
Sbjct  342  GAKSLFKGAGANILRAIAGAGVLSGYDKLQLLVFGKKYGSG  382



>gb|ABB55387.1| ADP,ATP carrier protein precursor-like [Solanum tuberosum]
Length=386

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+K GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  224  KASKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  284  TGNLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQIVKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++V GKKYGSGGA
Sbjct  344  GPKSLFKGAGANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA  386



>ref|XP_010453428.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial [Camelina 
sativa]
Length=394

 Score =   370 bits (951),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  163  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            K+AK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISC GIIVYRGLYFG+YDS+KPVLL
Sbjct  223  KSAKKGGERQFNGLVDVYKKTLRSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVLL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+NE
Sbjct  283  TGDMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAIAGAGVLAGYDKLQLIVFGKKYGSGGA  385



>ref|NP_001275285.1| ADP,ATP carrier protein, mitochondrial [Solanum tuberosum]
 gb|ABB29945.1| ADP/ATP translocator-like [Solanum tuberosum]
 gb|ABB86279.1| ADP,ATP carrier protein precursor-like [Solanum tuberosum]
Length=386

 Score =   370 bits (950),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+K GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  224  KASKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  284  TGNLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQIVKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++V GKKYGSGGA
Sbjct  344  GPKSLFKGAGANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA  386



>ref|XP_002299232.1| hypothetical protein POPTR_0001s05690g [Populus trichocarpa]
 gb|EEE84037.1| hypothetical protein POPTR_0001s05690g [Populus trichocarpa]
Length=385

 Score =   370 bits (949),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRL ND+
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLTNDS  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  223  KAAKKGGERQFNGLVDVYKKTMQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGW+ITNGAGL SYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  283  TGKMQDSFFASFALGWVITNGAGLGSYPIDTVRRRMMMTSGEAVKYKSSFDAFSQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKK+GSGGA
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKKFGSGGA  385



>ref|XP_002303893.1| hypothetical protein POPTR_0003s20360g [Populus trichocarpa]
 gb|EEE78872.1| hypothetical protein POPTR_0003s20360g [Populus trichocarpa]
Length=385

 Score =   369 bits (948),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAG SSLLFVYSLDYARTRLANDA
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGGSSLLFVYSLDYARTRLANDA  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA K GG RQFNGLVDVYRKTL SDG+AG+YRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  223  KAGKKGGERQFNGLVDVYRKTLKSDGIAGIYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGA LASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  283  TGKLQDSFFASFALGWVITNGASLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGGA
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVLGKKYGSGGA  385



>ref|XP_004306529.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=385

 Score =   369 bits (947),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 203/221 (92%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  223  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AFTQIL+NE
Sbjct  283  TGGLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFTQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQ+IVFGKKYGSG
Sbjct  343  GAKSLFKGAGANILRAIAGAGVLSGYDKLQLIVFGKKYGSG  383



>ref|XP_008375168.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Malus 
domestica]
Length=384

 Score =   369 bits (946),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASG AAGA SLLFVYSLDYARTRL NDA
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGSAAGAYSLLFVYSLDYARTRLTNDA  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  222  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  282  TGGLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQ++VFGKKYGSG
Sbjct  342  GAKSLFKGAGANILRAIAGAGVLSGYDKLQLLVFGKKYGSG  382



>ref|XP_008813282.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=388

 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR FNF+KDRDGYWKWFAGNLASG AAGASSLLFVYSLDYARTRL NDA
Sbjct  166  QALNFAFKDYFKRTFNFKKDRDGYWKWFAGNLASGSAAGASSLLFVYSLDYARTRLTNDA  225

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKTLASDG+ GLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  226  KAAKKGGERQFNGLIDVYRKTLASDGIVGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  285

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYP DTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  286  TGKLQDSFFASFALGWLITNGAGLASYPTDTVRRRMMMTSGEAVKYKSSLDAFAQILKNE  345

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSL+KGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGGA
Sbjct  346  GAKSLYKGAGANILRAVAGAGVLAGYDKLQLIVLGKKYGSGGA  388



>ref|NP_001234018.1| ADP/ATP translocator [Solanum lycopersicum]
 gb|AAB49700.1| ADP/ATP translocator [Solanum lycopersicum]
Length=386

 Score =   368 bits (945),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGN ASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNPASGGAAGASSLFFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+K GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRG YFGMYDSLKPVLL
Sbjct  224  KASKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGFYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASFALGWLITNGAGLASYPIDT+RRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  284  TGNLQDSFFASFALGWLITNGAGLASYPIDTLRRRMMMTSGEAVKYKSSLDAFSQIVKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++V GKKYGSGGA
Sbjct  344  GPKSLFKGAGANILRAVAGAGVLAGYDKLQVLVLGKKYGSGGA  386



>ref|XP_009375063.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=384

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFNFRKD+DGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  162  QALNFAFKDYFKSLFNFRKDKDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  222  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVIL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASF LGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  282  TGKLQDSFFASFGLGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGGA
Sbjct  342  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKKYGSGGA  384



>ref|XP_008346927.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Malus 
domestica]
Length=384

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  222  KAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  282  TGGLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQ++VFGKKYGSG
Sbjct  342  GAKSLFKGAGANILRAIAGAGVLSGYDKLQLLVFGKKYGSG  382



>ref|XP_002871570.1| hypothetical protein ARALYDRAFT_488169 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47829.1| hypothetical protein ARALYDRAFT_488169 [Arabidopsis lyrata subsp. 
lyrata]
Length=384

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  162  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            K+AK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISC GIIVYRGLYFG+YDS+KPVLL
Sbjct  222  KSAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVLL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QIL+ E
Sbjct  282  TGDLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKKE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GA+SLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  342  GARSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  384



>emb|CAA26600.1| unnamed protein product [Zea mays]
Length=318

 Score =   365 bits (937),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  96   QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  155

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  156  KAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVL  215

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+ E
Sbjct  216  TGNLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKKE  275

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  276  GPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  318



>ref|XP_008227151.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Prunus 
mume]
 ref|XP_008227152.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Prunus 
mume]
Length=390

 Score =   368 bits (944),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  168  QALNFAFKDYFKSLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  227

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  228  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVIL  287

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASF LGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  288  TGKLQDSFFASFGLGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  347

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGGA
Sbjct  348  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKKYGSGGA  390



>ref|XP_007211408.1| hypothetical protein PRUPE_ppa006913mg [Prunus persica]
 gb|EMJ12607.1| hypothetical protein PRUPE_ppa006913mg [Prunus persica]
Length=390

 Score =   368 bits (944),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 204/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  168  QALNFAFKDYFKSLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  227

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  228  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVIL  287

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASF LGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  288  TGKLQDSFFASFGLGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  347

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGGA
Sbjct  348  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKKYGSGGA  390



>ref|XP_008372658.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Malus 
domestica]
Length=384

 Score =   367 bits (943),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFNFRKD+DGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND+
Sbjct  162  QALNFAFKDYFKSLFNFRKDKDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDS  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  222  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVIL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASF LGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  282  TGKLQDSFFASFGLGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GA+SLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGGA
Sbjct  342  GARSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKKYGSGGA  384



>gb|AFW73142.1| adenine nucleotide translocator, mRNA [Zea mays]
Length=338

 Score =   365 bits (938),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  116  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  175

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  176  KAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVL  235

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+ E
Sbjct  236  TGNLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKKE  295

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  296  GPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  338



>ref|XP_011037819.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Populus 
euphratica]
 ref|XP_011037820.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Populus 
euphratica]
Length=385

 Score =   367 bits (943),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLF F+KDRDGYWKWFAGNLASG AAGASSLLFVYSLDYARTRL ND+
Sbjct  163  QALNFAFKDYFKRLFIFKKDRDGYWKWFAGNLASGSAAGASSLLFVYSLDYARTRLTNDS  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  223  KAAKKGGERQFNGLVDVYKKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG +QDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  283  TGKMQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKK+GSGGA
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKKFGSGGA  385



>ref|XP_002513476.1| ADP,ATP carrier protein, putative [Ricinus communis]
 gb|EEF48879.1| ADP,ATP carrier protein, putative [Ricinus communis]
Length=392

 Score =   367 bits (943),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNFRKDRDGYWKWF GNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  170  QALNFAFKDYFKRLFNFRKDRDGYWKWFVGNLASGGAAGASSLLFVYSLDYARTRLANDA  229

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDGVAGLYRGFNISC GIIVYRGLYFGMYDSLKPV+L
Sbjct  230  KAAKKGGGRQFNGLVDVYRKTLQSDGVAGLYRGFNISCFGIIVYRGLYFGMYDSLKPVVL  289

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYK+S+ AF+ IL+NE
Sbjct  290  TGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKNSLEAFSVILKNE  349

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+I+ GKKYGSGGA
Sbjct  350  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVILLGKKYGSGGA  392



>ref|NP_001105434.1| ADP,ATP carrier protein 2, mitochondrial precursor [Zea mays]
 ref|XP_008677791.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial isoform X1 
[Zea mays]
 sp|P12857.2|ADT2_MAIZE RecName: Full=ADP,ATP carrier protein 2, mitochondrial; AltName: 
Full=ADP/ATP translocase 2; AltName: Full=Adenine nucleotide 
translocator 2; Short=ANT 2; Flags: Precursor [Zea mays]
 emb|CAA41812.1| adenine nucleotide translocator [Zea mays]
 gb|ACL53589.1| unknown [Zea mays]
 gb|ACR35796.1| unknown [Zea mays]
 gb|AFW63699.1| adenine nucleotide translocator2 isoform 1 [Zea mays]
 gb|AFW63700.1| adenine nucleotide translocator2 isoform 2 [Zea mays]
Length=387

 Score =   367 bits (942),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  165  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  224

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  225  KAAKGGGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVL  284

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+ E
Sbjct  285  TGSLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKKE  344

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  345  GPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  387



>emb|CAA33742.1| adenine nucleotide translocator [Zea mays]
Length=387

 Score =   367 bits (941),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  165  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  224

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  225  KAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVL  284

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+ E
Sbjct  285  TGNLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKKE  344

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  345  GPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  387



>ref|XP_004953705.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Setaria 
italica]
Length=388

 Score =   367 bits (941),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  166  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  225

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  226  KAAKGGGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVL  285

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  286  TGNLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  345

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  346  GPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  388



>ref|NP_001105431.1| ADP,ATP carrier protein 1, mitochondrial precursor [Zea mays]
 sp|P04709.3|ADT1_MAIZE RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocator 1; Short=ANT 1; Flags: Precursor [Zea mays]
 emb|CAA40781.1| adenine nucleotide translocator [Zea mays]
 gb|ACF88121.1| unknown [Zea mays]
 gb|ACG24998.1| ADP,ATP carrier protein [Zea mays]
Length=387

 Score =   366 bits (940),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  165  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  224

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  225  KAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVL  284

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+ E
Sbjct  285  TGNLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKKE  344

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  345  GPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  387



>gb|AFW63697.1| adenine nucleotide translocator2 [Zea mays]
Length=464

 Score =   369 bits (946),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  242  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  301

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  302  KAAKGGGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVL  361

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+ E
Sbjct  362  TGSLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKKE  421

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  422  GPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  464



>ref|XP_010673613.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=391

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 215/224 (96%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  168  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLCFVYSLDYARTRLANDA  227

Query  731  KAAK-GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GGG RQFNGLVDVYRKT+A+DG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+
Sbjct  228  KAAKKGGGDRQFNGLVDVYRKTMATDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVV  287

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG+L DSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYK S   F QIL+N
Sbjct  288  LTGNLADSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKGSFDCFAQILKN  347

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  348  EGAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGGA  391



>ref|XP_010259400.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=393

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 207/223 (93%), Positives = 214/223 (96%), Gaps = 1/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  170  QALNFAFKDYFKRMFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  229

Query  731  KAAK-GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GGG RQFNGLVDVY KTL SDG+AGLYRGFNISC+GIIVYRGLYFGMYDSLKPV+
Sbjct  230  KAAKKGGGERQFNGLVDVYTKTLKSDGIAGLYRGFNISCIGIIVYRGLYFGMYDSLKPVV  289

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            L G LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QI++N
Sbjct  290  LVGKLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFRQIVKN  349

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            EG KSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKKYGSGG
Sbjct  350  EGMKSLFKGAGANILRAVAGAGVLAGYDKLQMIVFGKKYGSGG  392



>ref|XP_008677790.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial isoform X2 
[Zea mays]
Length=519

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 215/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  297  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  356

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  357  KAAKGGGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVL  416

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+ E
Sbjct  417  TGSLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKKE  476

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  477  GPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  519



>sp|P25083.1|ADT1_SOLTU RecName: Full=ADP,ATP carrier protein, mitochondrial; AltName: 
Full=ADP/ATP translocase; AltName: Full=Adenine nucleotide 
translocator; Short=ANT; Flags: Precursor [Solanum tuberosum]
 emb|CAA44054.1| ADP /ATP translocator [Solanum tuberosum]
Length=386

 Score =   365 bits (937),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 202/223 (91%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAND 
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDR  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+K GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  224  KASKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  284  TGNLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQIVKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++V GKK+GSGGA
Sbjct  344  GPKSLFKGAGANILRAVAGAGVLAGYDKLQVLVLGKKFGSGGA  386



>gb|EMT17760.1| ADP,ATP carrier protein, mitochondrial [Aegilops tauschii]
Length=380

 Score =   365 bits (936),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWF GNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDA  217

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+KGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPVLL
Sbjct  218  KASKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVLL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL  E
Sbjct  278  TGTLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILAKE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  338  GAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  380



>gb|EMS54584.1| ADP,ATP carrier protein, mitochondrial [Triticum urartu]
Length=380

 Score =   364 bits (935),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWF GNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDA  217

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+KGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPVLL
Sbjct  218  KASKGGGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVLL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL  E
Sbjct  278  TGTLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILAKE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  338  GAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  380



>ref|NP_196853.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana]
 ref|NP_001031876.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana]
 sp|P40941.2|ADT2_ARATH RecName: Full=ADP,ATP carrier protein 2, mitochondrial; AltName: 
Full=ADP/ATP translocase 2; AltName: Full=Adenine nucleotide 
translocator 2; Short=ANT 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC05426.1| adenosine nucleotide translocator [Arabidopsis thaliana]
 gb|AAK92794.1| putative adenosine nucleotide translocator protein [Arabidopsis 
thaliana]
 gb|AAL85138.1| putative adenosine nucleotide translocator protein [Arabidopsis 
thaliana]
 dbj|BAH19937.1| AT5G13490 [Arabidopsis thaliana]
 gb|AED91901.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana]
 gb|AED91902.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana]
Length=385

 Score =   364 bits (934),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 204/224 (91%), Positives = 216/224 (96%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  162  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  221

Query  731  KAAK-GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            K+AK GGG RQFNGLVDVY+KTL SDG+AGLYRGFNISC GIIVYRGLYFG+YDS+KPVL
Sbjct  222  KSAKKGGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVL  281

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QI++ 
Sbjct  282  LTGDLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKK  341

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  342  EGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  385



>gb|KCW66115.1| hypothetical protein EUGRSUZ_G03387 [Eucalyptus grandis]
Length=388

 Score =   364 bits (934),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 203/219 (93%), Positives = 214/219 (98%), Gaps = 0/219 (0%)
 Frame = -1

Query  899  FAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDAKAAK  720
            F  +DYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAK
Sbjct  170  FPTQDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAK  229

Query  719  GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGSL  540
             GG RQFNGLVDVYRKTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTG+L
Sbjct  230  KGGERQFNGLVDVYRKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGTL  289

Query  539  QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNEGAKS  360
            QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NEGA+S
Sbjct  290  QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNEGARS  349

Query  359  LFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            LFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKK+GSGGA
Sbjct  350  LFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKFGSGGA  388



>emb|CAA33743.1| adenine nucleotide translocator [Zea mays]
Length=387

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  165  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  224

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDV RKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  225  KAAKGGGDRQFNGLVDVIRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVL  284

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGE VKYKSS+ AF QIL+ E
Sbjct  285  TGSLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEGVKYKSSLDAFQQILKKE  344

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  345  GPKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  387



>sp|Q41629.1|ADT1_WHEAT RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocator 1; Short=ANT 1; Flags: Precursor [Triticum 
aestivum]
 emb|CAA65119.1| adenine nucleotide translocator [Triticum turgidum]
Length=331

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWF GNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  109  QALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDA  168

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+KGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPVLL
Sbjct  169  KASKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVLL  228

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQ  FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+ E
Sbjct  229  TGTLQVCFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKKE  288

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  289  GAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  331



>ref|XP_011042099.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011042100.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Populus 
euphratica]
Length=386

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWK FAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKCFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA K GG RQFNGLVDVYRKTL SDGVAG+YRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  223  KAGKKGGERQFNGLVDVYRKTLKSDGVAGIYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFA+GW+ITNGA LASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QIL+NE
Sbjct  283  TGKLQDSFFASFAVGWVITNGASLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGG 
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVLGKKYGSGGP  385



>emb|CAA56325.1| ATP/ADP carrier protein [Triticum turgidum]
Length=331

 Score =   360 bits (924),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 198/223 (89%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWF GNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  109  QALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDA  168

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+KGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPVLL
Sbjct  169  KASKGGGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVLL  228

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQD+FFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL  E
Sbjct  229  TGTLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILAKE  288

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGA +LRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  289  GAKSLFKGAGAKLLRAIAGAGVLSGYDQLQILFFGKKYGSGGA  331



>emb|CAA48579.1| adenosine nucleotide translocator [Arabidopsis thaliana]
Length=385

 Score =   362 bits (928),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 215/224 (96%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  162  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  221

Query  731  KAAKGG-GSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            K+AK G G RQFNGLVDVY+KTL SDG+AGLYRGFNISC GIIVYRGLYFG+YDS+KPVL
Sbjct  222  KSAKKGRGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVL  281

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QI++ 
Sbjct  282  LTGDLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKK  341

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  342  EGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  385



>prf||1908224A nucleotide translocator
Length=403

 Score =   362 bits (929),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 215/224 (96%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  180  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  239

Query  731  KAAKGG-GSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            K+AK G G RQFNGLVDVY+KTL SDG+AGLYRGFNISC GIIVYRGLYFG+YDS+KPVL
Sbjct  240  KSAKKGRGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVL  299

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QI++ 
Sbjct  300  LTGDLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKK  359

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGGA
Sbjct  360  EGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVFGKKYGSGGA  403



>ref|XP_003539937.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Glycine 
max]
 gb|KHN28117.1| ADP,ATP carrier protein 3, mitochondrial [Glycine soja]
Length=371

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 203/222 (91%), Positives = 211/222 (95%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  149  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  208

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  209  KAAKKGGERQFNGLVDVYRKTIKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  268

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF  I+ NE
Sbjct  269  VGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFQTIVANE  328

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+I+FGKKYGSGG
Sbjct  329  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLILFGKKYGSGG  370



>ref|XP_004303109.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=379

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/222 (91%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG++DVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  217  KAAKKGGERQFNGMIDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             GSLQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++NE
Sbjct  277  VGSLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLVAFKQIVKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGG
Sbjct  337  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVLGKKYGSGG  378



>ref|XP_009354733.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=384

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 213/221 (96%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAA ASSL FVYSLDYARTRLANDA
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAAASSLFFVYSLDYARTRLANDA  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLV+VYRKTL SDG+AGL+RGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  222  KAAKKGGERQFNGLVEVYRKTLKSDGIAGLFRGFNISCVGIIVYRGLYFGLYDSLKPVVL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  282  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQILKNE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQ++VFGKKYGSG
Sbjct  342  GAKSLFKGAGANILRAIAGAGVLSGYDKLQLLVFGKKYGSG  382



>ref|XP_010555116.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial isoform X2 
[Tarenaya hassleriana]
Length=374

 Score =   360 bits (923),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 198/222 (89%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  152  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  211

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG++DVY+KTLASDG+AGLYRGFNISCVGI+VYRGLYFG+YDSLKPV+L
Sbjct  212  KAAKKGGQRQFNGMIDVYKKTLASDGIAGLYRGFNISCVGIVVYRGLYFGLYDSLKPVVL  271

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF++I++NE
Sbjct  272  IGDLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFSEIIKNE  331

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+FGKKYGSGG
Sbjct  332  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIIFGKKYGSGG  373



>emb|CDP07763.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   356 bits (914),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFN++KDRDGYWKWFAGNLASGGAAGASSL+FV+SLDYARTRLANDA
Sbjct  73   QALNFAFKDYFKSLFNYKKDRDGYWKWFAGNLASGGAAGASSLVFVFSLDYARTRLANDA  132

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT ASDG+AGLYRGFN+SCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  133  KAAKKGGERQFNGLIDVYRKTFASDGIAGLYRGFNLSCVGIIVYRGLYFGLYDSVKPVVL  192

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AFTQI++NE
Sbjct  193  TGKLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFTQIVKNE  252

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKG  ANILRAVAGAGVLAGYDKLQ++V GKKYGSGG
Sbjct  253  GVKSLFKGGAANILRAVAGAGVLAGYDKLQVLVLGKKYGSGG  294



>ref|XP_010235895.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Brachypodium 
distachyon]
Length=384

 Score =   359 bits (922),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+K++DGY KWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  162  QALNFAFKDYFKRMFNFKKEKDGYGKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+KGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPVLL
Sbjct  222  KASKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVLL  281

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQD+FFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF QIL+ E
Sbjct  282  TGSLQDNFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFQQILKKE  341

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRA+AGAGVL+GYD+LQ+I FGKKYGSGGA
Sbjct  342  GPKSLFKGAGANILRAIAGAGVLSGYDQLQIIFFGKKYGSGGA  384



>ref|XP_010555114.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial isoform X1 
[Tarenaya hassleriana]
Length=397

 Score =   360 bits (923),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 198/222 (89%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  175  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  234

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG++DVY+KTLASDG+AGLYRGFNISCVGI+VYRGLYFG+YDSLKPV+L
Sbjct  235  KAAKKGGQRQFNGMIDVYKKTLASDGIAGLYRGFNISCVGIVVYRGLYFGLYDSLKPVVL  294

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF++I++NE
Sbjct  295  IGDLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFSEIIKNE  354

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+FGKKYGSGG
Sbjct  355  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIIFGKKYGSGG  396



>dbj|BAE71194.1| putative ADP ATP carrier protein [Trifolium pratense]
Length=371

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  149  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  208

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG+VDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  209  KAAKKGGERQFNGMVDVYRKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  268

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF  I+  E
Sbjct  269  VGGMQDSFFASFLLGWAITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFQTIVAKE  328

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+++FGKKYGSGG
Sbjct  329  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLVLFGKKYGSGG  370



>dbj|BAE71236.1| putative ADP,ATP carrier-like protein [Trifolium pratense]
Length=371

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  149  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  208

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG+VDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  209  KAAKKGGERQFNGMVDVYRKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  268

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF  I+  E
Sbjct  269  VGGMQDSFFASFLLGWAITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFQTIVAKE  328

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+++FGKKYGSGG
Sbjct  329  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLVLFGKKYGSGG  370



>ref|XP_006372724.1| ADP/ATP CARRIER 3 family protein [Populus trichocarpa]
 gb|ERP50521.1| ADP/ATP CARRIER 3 family protein [Populus trichocarpa]
Length=379

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 201/222 (91%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+K+RDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRLFNFKKERDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  217  KAAKKGGGRQFNGLIDVYKKTLQSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++NE
Sbjct  277  VGDLQDSFFASFMLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFKQIIKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGG
Sbjct  337  GPKSLFKGAGANILRAVAGAGVLAGYDKLQVIVLGKKYGSGG  378



>ref|XP_010035773.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Eucalyptus 
grandis]
 gb|KCW47236.1| hypothetical protein EUGRSUZ_K01045 [Eucalyptus grandis]
Length=382

 Score =   356 bits (914),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 198/222 (89%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  160  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  219

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTLASDG+AGLYRGFNISC+GIIVYRGLYFGMYDSLKPV+L
Sbjct  220  KAAKKGGERQFNGLIDVYKKTLASDGIAGLYRGFNISCIGIIVYRGLYFGMYDSLKPVVL  279

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++NE
Sbjct  280  VGGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFNQIVKNE  339

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G++SLFKGAGANILRAVAGAGVLAGYDKLQ+++FGKKYGSGG
Sbjct  340  GSRSLFKGAGANILRAVAGAGVLAGYDKLQLVLFGKKYGSGG  381



>ref|XP_004510962.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X1 [Cicer arietinum]
 ref|XP_004510963.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X2 [Cicer arietinum]
 ref|XP_004510964.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X3 [Cicer arietinum]
 ref|XP_004510965.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X4 [Cicer arietinum]
Length=364

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 207/224 (92%), Positives = 216/224 (96%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  141  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  200

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK G   RQFNGL+DVY+KTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL
Sbjct  201  KAAKKGAGGRQFNGLIDVYKKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  260

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTGSLQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QIL+N
Sbjct  261  LTGSLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFSQILKN  320

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVLAGYDKLQ+I+ GKKYGSGGA
Sbjct  321  EGAKSLFKGAGANILRAVAGAGVLAGYDKLQVIMLGKKYGSGGA  364



>dbj|BAD91181.1| putative mitochondrial adenylate transporter [Mesembryanthemum 
crystallinum]
Length=388

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 210/223 (94%), Gaps = 1/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD + YWKWFAGNLASGGAAGASSL+FVYSLDYARTRLANDA
Sbjct  167  QALNFAFKDYFKRMFNFKKD-ESYWKWFAGNLASGGAAGASSLVFVYSLDYARTRLANDA  225

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KT ASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  226  KAAKKGGERQFNGLIDVYKKTFASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  285

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYK S   F QIL+NE
Sbjct  286  TGKLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKGSFDCFAQILKNE  345

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+I+ GKK+GSGGA
Sbjct  346  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVILLGKKFGSGGA  388



>sp|Q41630.1|ADT2_WHEAT RecName: Full=ADP,ATP carrier protein 2, mitochondrial; AltName: 
Full=ADP/ATP translocase 2; AltName: Full=Adenine nucleotide 
translocator 2; Short=ANT 2; Flags: Precursor [Triticum 
aestivum]
 emb|CAA65120.1| adenine nucleotide translocator [Triticum turgidum]
Length=331

 Score =   353 bits (905),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 196/223 (88%), Positives = 209/223 (94%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWF GNLASGGAAGASSL FVYSLDY RTRLANDA
Sbjct  109  QALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYGRTRLANDA  168

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+KGGG RQFNGLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKPVLL
Sbjct  169  KASKGGGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVLL  228

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQ   FASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI   E
Sbjct  229  TGTLQVCSFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFQQIPAKE  288

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYD+LQ++ FGKKYGSGGA
Sbjct  289  GAKSLFKGAGANILRAIAGAGVLSGYDQLQILFFGKKYGSGGA  331



>ref|XP_007150379.1| hypothetical protein PHAVU_005G148300g [Phaseolus vulgaris]
 gb|ESW22373.1| hypothetical protein PHAVU_005G148300g [Phaseolus vulgaris]
Length=392

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 191/223 (86%), Positives = 209/223 (94%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK+LFNF+KDRDGYWKWFAGN+ASGGAAGA S +FVYSLDYARTRLANDA
Sbjct  170  QALNFAFKDYFKKLFNFKKDRDGYWKWFAGNVASGGAAGAVSSVFVYSLDYARTRLANDA  229

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA K GG RQFNGL+DVYRKTL SDGVAGLYRGFN+SCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  230  KAGKKGGERQFNGLIDVYRKTLQSDGVAGLYRGFNVSCVGIIVYRGLYFGMYDSLKPVLL  289

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQDSF ASFALGWL+T GA LASYP+DTVRRRMMMTSGEAVKYKSS+ A +QI++NE
Sbjct  290  VGTLQDSFLASFALGWLVTIGASLASYPLDTVRRRMMMTSGEAVKYKSSLDALSQIVKNE  349

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G+KSLFKG GANILRAVAGAGVL+GYDKLQ+++ GKKYGSGGA
Sbjct  350  GSKSLFKGGGANILRAVAGAGVLSGYDKLQLLLIGKKYGSGGA  392



>ref|XP_004505560.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Cicer 
arietinum]
Length=371

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  149  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  208

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQF+GL+DVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  209  KAAKKGGGRQFDGLIDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  268

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF  I+  E
Sbjct  269  VGGMQDSFFASFLLGWAITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFQTIVAKE  328

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLA YDKLQ+I+FGKKYGSGG
Sbjct  329  GTKSLFKGAGANILRAVAGAGVLASYDKLQLILFGKKYGSGG  370



>ref|XP_006297905.1| hypothetical protein CARUB_v10013947mg [Capsella rubella]
 gb|EOA30803.1| hypothetical protein CARUB_v10013947mg [Capsella rubella]
Length=381

 Score =   354 bits (908),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 208/224 (93%), Positives = 217/224 (97%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  217

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GG  RQF+GLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPVL
Sbjct  218  KAAKKGGGGRQFDGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVL  277

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+N
Sbjct  278  LTGDLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFAQILKN  337

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVL+GYDKLQ+IVFGKKYGSGGA
Sbjct  338  EGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA  381



>ref|XP_002884685.1| adenosine nucleotide translocator [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60944.1| adenosine nucleotide translocator [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   354 bits (908),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 207/224 (92%), Positives = 218/224 (97%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  159  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  218

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GG  RQF+GLVDVYRKTL +DG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPVL
Sbjct  219  KAAKKGGGGRQFDGLVDVYRKTLKTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVL  278

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AFTQIL+N
Sbjct  279  LTGDLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFTQILKN  338

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVL+GYDKLQ+IVFGKKYGSGGA
Sbjct  339  EGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA  382



>ref|XP_004985877.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Setaria 
italica]
Length=381

 Score =   354 bits (908),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 199/223 (89%), Positives = 209/223 (94%), Gaps = 1/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNF+KD+DGYWKWFAGNLASGGAAGA SL FVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDHFKRMFNFKKDKDGYWKWFAGNLASGGAAGACSLFFVYSLDYARTRLANDA  217

Query  731  KAAK-GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            K AK GGG RQFNGLVDVYRKTLASDG+AGLYRGF+ISCVGIIVYRGLYFGMYDSLKPVL
Sbjct  218  KVAKKGGGERQFNGLVDVYRKTLASDGIAGLYRGFSISCVGIIVYRGLYFGMYDSLKPVL  277

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            L GSLQD+FFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI+  
Sbjct  278  LVGSLQDNFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFKQIVAK  337

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            EG KSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGG
Sbjct  338  EGTKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGG  380



>gb|EPS69506.1| hypothetical protein M569_05258, partial [Genlisea aurea]
Length=378

 Score =   353 bits (907),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWFAGNLASGG AGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRMFNFKKDKDGYWKWFAGNLASGGLAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG++DVYRKT+ SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  217  KAAKKGGERQFNGMIDVYRKTIQSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQD+F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++ E
Sbjct  277  VGTLQDNFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFNQIVKKE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGG
Sbjct  337  GTKSLFKGAGANILRAVAGAGVLAGYDKLQVVVFGKKYGSGG  378



>ref|XP_006407762.1| hypothetical protein EUTSA_v10020919mg [Eutrema salsugineum]
 gb|ESQ49215.1| hypothetical protein EUTSA_v10020919mg [Eutrema salsugineum]
Length=382

 Score =   353 bits (907),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 207/224 (92%), Positives = 218/224 (97%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  159  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  218

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GG  RQF+GLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPVL
Sbjct  219  KAAKKGGGGRQFDGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVL  278

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AFTQIL+N
Sbjct  279  LTGDLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFTQILKN  338

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVL+GYDKLQ++VFGKKYGSGGA
Sbjct  339  EGAKSLFKGAGANILRAVAGAGVLSGYDKLQLLVFGKKYGSGGA  382



>gb|KHG01208.1| ADP,ATP carrier 3, mitochondrial -like protein [Gossypium arboreum]
Length=379

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 198/222 (89%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND 
Sbjct  157  QALNFAFKDYFKRMFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDN  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  217  KAAKKGGQRQFNGLIDVYRKTIQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF+QI++NE
Sbjct  277  VGGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSMAAFSQIIKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++  GKKYGSGG
Sbjct  337  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLFLGKKYGSGG  378



>gb|ABK24587.1| unknown [Picea sitchensis]
 gb|ABK25127.1| unknown [Picea sitchensis]
 gb|ACN39892.1| unknown [Picea sitchensis]
 gb|ACN39958.1| unknown [Picea sitchensis]
Length=390

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 198/222 (89%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  168  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  227

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  228  KAAKKGGERQFNGLVDVYKKTLKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  287

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQD+F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++NE
Sbjct  288  TGDLQDNFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFNQIVKNE  347

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRA+AGAGVLAGYD+LQ+I+ GKKYGSGG
Sbjct  348  GTKSLFKGAGANILRAIAGAGVLAGYDQLQLILLGKKYGSGG  389



>ref|NP_001055139.1| Os05g0302700 [Oryza sativa Japonica Group]
 dbj|BAF17053.1| Os05g0302700 [Oryza sativa Japonica Group]
 gb|EAY97443.1| hypothetical protein OsI_19373 [Oryza sativa Indica Group]
 dbj|BAG88044.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63157.1| hypothetical protein OsJ_17966 [Oryza sativa Japonica Group]
Length=380

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNF+KD+DGYWKWFAGNLASGGAAGA SL FVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDHFKRMFNFKKDKDGYWKWFAGNLASGGAAGACSLFFVYSLDYARTRLANDA  217

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  218  KAAKKGGGRQFNGLVDVYRKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQD+F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI+  E
Sbjct  278  VGNLQDNFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFKQIVAKE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGG
Sbjct  338  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVVVFGKKYGSGG  379



>ref|XP_007132806.1| hypothetical protein PHAVU_011G126000g [Phaseolus vulgaris]
 gb|ESW04800.1| hypothetical protein PHAVU_011G126000g [Phaseolus vulgaris]
Length=371

 Score =   352 bits (904),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  149  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  208

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG++DVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  209  KAAKKGGERQFNGMIDVYRKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  268

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+HAF  I+  E
Sbjct  269  VGGMQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYNSSLHAFQTIVAKE  328

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+++FGKKYGSGG
Sbjct  329  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLVLFGKKYGSGG  370



>ref|XP_004306530.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=385

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 191/221 (86%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QA NFAFKDYFKRLFNF+KDRDGYWKWFAGNLASG AAGA+S  FVYSLDYARTRL +DA
Sbjct  163  QAFNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGSAAGAASSFFVYSLDYARTRLTSDA  222

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA K GG RQFNGLVDVYRKTL SDG+ GLYRGFN+SCVGIIVYRGLYFG+YDS+KPV+L
Sbjct  223  KAVKQGGERQFNGLVDVYRKTLKSDGIVGLYRGFNVSCVGIIVYRGLYFGLYDSIKPVVL  282

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGW+IT  AGLASYP DTVRRRMMMTSGEAVKYKSS+ AF QIL+NE
Sbjct  283  TGGLQDSFFASFALGWVITINAGLASYPFDTVRRRMMMTSGEAVKYKSSIDAFAQILKNE  342

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRAVAGAGVL+GYDKLQ++VFGKKYGSG
Sbjct  343  GAKSLFKGAGANILRAVAGAGVLSGYDKLQLVVFGKKYGSG  383



>gb|KEH30700.1| ADP/ATP carrier protein [Medicago truncatula]
Length=371

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 208/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  149  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  208

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG+VDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  209  KAAKKGGERQFNGMVDVYKKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  268

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGE+VKY SS+HAF  I+  E
Sbjct  269  VGGMQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGESVKYNSSLHAFQTIVAKE  328

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+++FGKKYGSGG
Sbjct  329  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLVLFGKKYGSGG  370



>ref|XP_003627715.1| ADP,ATP carrier protein [Medicago truncatula]
 gb|AET02191.1| ADP/ATP carrier protein [Medicago truncatula]
Length=399

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 205/224 (92%), Positives = 214/224 (96%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  176  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  235

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK G   RQFNGL+DVY+KTLA+DG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL
Sbjct  236  KAAKKGAGGRQFNGLIDVYKKTLATDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  295

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTGSLQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF QIL+N
Sbjct  296  LTGSLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFQQILKN  355

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVLAGYDKLQ+I+ GKKYGSGGA
Sbjct  356  EGAKSLFKGAGANILRAVAGAGVLAGYDKLQVIMLGKKYGSGGA  399



>ref|XP_009121762.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Brassica 
rapa]
Length=373

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 208/221 (94%), Gaps = 1/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  152  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDS  211

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKP LL
Sbjct  212  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKP-LL  270

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  271  PADLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  330

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            G KSLFKGAGANILRA+AGAGVL+GYDK+Q+++ GKKYGSG
Sbjct  331  GPKSLFKGAGANILRAIAGAGVLSGYDKIQLLLLGKKYGSG  371



>ref|XP_006654224.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Oryza 
brachyantha]
Length=379

 Score =   352 bits (904),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNF+KD+DGYWKWFAGNLASGGAAGA SL FVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDHFKRMFNFKKDKDGYWKWFAGNLASGGAAGACSLFFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAKGGG RQFNGLVDVYRKTL++DG+ GLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  217  KAAKGGGERQFNGLVDVYRKTLSTDGIRGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQD+F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI+  E
Sbjct  277  VGTLQDNFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFKQIVAKE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGG
Sbjct  337  GTKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGG  378



>ref|XP_010464465.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Camelina 
sativa]
Length=366

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 207/224 (92%), Positives = 216/224 (96%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  143  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  202

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GG  RQF+GLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPVL
Sbjct  203  KAAKKGGGGRQFDGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVL  262

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG L DSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+N
Sbjct  263  LTGDLSDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFAQILKN  322

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVL+GYDKLQ+IVFGKKYGSGGA
Sbjct  323  EGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA  366



>ref|XP_010462544.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Camelina 
sativa]
 ref|XP_010486395.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Camelina 
sativa]
Length=381

 Score =   352 bits (903),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 207/224 (92%), Positives = 216/224 (96%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  217

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GG  RQF+GLVDVYRKTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPVL
Sbjct  218  KAAKKGGGGRQFDGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVL  277

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG L DSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+N
Sbjct  278  LTGDLSDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFAQILKN  337

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVL+GYDKLQ+IVFGKKYGSGGA
Sbjct  338  EGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA  381



>ref|XP_002468591.1| hypothetical protein SORBIDRAFT_01g048660 [Sorghum bicolor]
 gb|EER95589.1| hypothetical protein SORBIDRAFT_01g048660 [Sorghum bicolor]
Length=380

 Score =   352 bits (902),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNF+KD+DGYWKWFAGNLASGGAAGA SL FVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDHFKRMFNFKKDKDGYWKWFAGNLASGGAAGACSLFFVYSLDYARTRLANDA  217

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTLASDG+ GLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  218  KAAKKGGERQFNGLVDVYRKTLASDGIRGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQD+F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI+  E
Sbjct  278  VGTLQDNFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFKQIVAKE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IVFGKKYGSGG
Sbjct  338  GTKSLFKGAGANILRAVAGAGVLAGYDKLQVIVFGKKYGSGG  379



>ref|NP_194568.1| ADP/ATP carrier 3 protein [Arabidopsis thaliana]
 sp|O49447.1|ADT3_ARATH RecName: Full=ADP,ATP carrier protein 3, mitochondrial; AltName: 
Full=ADP/ATP translocase 3; AltName: Full=Adenine nucleotide 
translocator 3; Short=ANT 3; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA16877.1| ADP, ATP carrier-like protein [Arabidopsis thaliana]
 emb|CAB79641.1| ADP, ATP carrier-like protein [Arabidopsis thaliana]
 dbj|BAC42650.1| putative ADP,ATP carrier [Arabidopsis thaliana]
 gb|AEE85477.1| ADP/ATP carrier 3 protein [Arabidopsis thaliana]
Length=379

 Score =   352 bits (902),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+K++DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRLFNFKKEKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG+VDVY+KT+ASDG+ GLYRGFNISCVGI+VYRGLYFG+YDSLKPV+L
Sbjct  217  KAAKKGGQRQFNGMVDVYKKTIASDGIVGLYRGFNISCVGIVVYRGLYFGLYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  277  VDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLQAFSQIVKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGG
Sbjct  337  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKYGSGG  378



>ref|NP_187470.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
 ref|NP_850541.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
 sp|P31167.2|ADT1_ARATH RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocator 1; Short=ANT 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51358.1|AC012562_19 adenylate translocator; 17953-16629 [Arabidopsis thaliana]
 gb|AAK59440.1| putative adenylate translocator protein [Arabidopsis thaliana]
 gb|AAK68754.1| adenylate translocator [Arabidopsis thaliana]
 gb|AAL06907.1| AT3g08580/F17O14_5 [Arabidopsis thaliana]
 gb|AAL69497.1| putative adenylate translocator protein [Arabidopsis thaliana]
 gb|AAN15700.1| adenylate translocator [Arabidopsis thaliana]
 gb|AAO00747.1| adenylate translocator [Arabidopsis thaliana]
 dbj|BAE98910.1| adenylate translocator [Arabidopsis thaliana]
 gb|AEE74648.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
 gb|AEE74649.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
Length=381

 Score =   352 bits (902),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 206/224 (92%), Positives = 217/224 (97%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  217

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GG  RQF+GLVDVYRKTL +DG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPVL
Sbjct  218  KAAKKGGGGRQFDGLVDVYRKTLKTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVL  277

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QIL+N
Sbjct  278  LTGDLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFKQILKN  337

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVL+GYDKLQ+IVFGKKYGSGGA
Sbjct  338  EGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA  381



>emb|CAC27140.1| ADP, ATP carrier protein precursor [Picea abies]
Length=262

 Score =   347 bits (890),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  40   QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  99

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  100  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  159

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQ++F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++NE
Sbjct  160  TGDLQNNFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFNQIVKNE  219

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRA+AGAGVLAGYD+LQ+I+ GKKYGSGG
Sbjct  220  GTKSLFKGAGANILRAIAGAGVLAGYDQLQLILLGKKYGSGG  261



>ref|XP_002867450.1| hypothetical protein ARALYDRAFT_491934 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43709.1| hypothetical protein ARALYDRAFT_491934 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   352 bits (902),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+K++DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDYFKRLFNFKKEKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  217

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG+VDVY+KT+ASDG+ GLYRGFNISCVGI+VYRGLYFG+YDSLKPV+L
Sbjct  218  KAAKKGGQRQFNGMVDVYKKTIASDGIVGLYRGFNISCVGIVVYRGLYFGLYDSLKPVVL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  278  VDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLQAFSQIVKNE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGG
Sbjct  338  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKYGSGG  379



>ref|XP_010447988.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Camelina 
sativa]
 ref|XP_010447990.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Camelina 
sativa]
Length=380

 Score =   351 bits (901),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  217

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG+ DVY+KT+ASDG+ GLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  218  KAAKKGGQRQFNGITDVYKKTIASDGIVGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  278  VDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLQAFSQIVKNE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGG
Sbjct  338  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKYGSGG  379



>ref|XP_006282649.1| hypothetical protein CARUB_v10005047mg [Capsella rubella]
 gb|EOA15547.1| hypothetical protein CARUB_v10005047mg [Capsella rubella]
Length=379

 Score =   351 bits (901),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG++DVY+KT+ASDG+ GLYRGFNISCVGI+VYRGLYFG+YDSLKPV+L
Sbjct  217  KAAKKGGQRQFNGMIDVYKKTIASDGIVGLYRGFNISCVGIVVYRGLYFGLYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  277  VDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLQAFSQIVKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGG
Sbjct  337  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKYGSGG  378



>ref|XP_009131345.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial [Brassica 
rapa]
Length=377

 Score =   351 bits (900),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 207/221 (94%), Gaps = 1/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  156  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDS  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKP LL
Sbjct  216  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKP-LL  274

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  275  PADLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  334

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            G KSLFKGAGANILRA+AGAGVL+GYDKLQ ++ GKKYGSG
Sbjct  335  GPKSLFKGAGANILRAIAGAGVLSGYDKLQFLLLGKKYGSG  375



>ref|NP_001150672.1| LOC100284305 [Zea mays]
 gb|ACF85000.1| unknown [Zea mays]
 gb|ACG39962.1| ADP,ATP carrier protein [Zea mays]
 tpg|DAA43102.1| TPA: ADP,ATP carrier protein isoform 1 [Zea mays]
 tpg|DAA43103.1| TPA: ADP,ATP carrier protein isoform 2 [Zea mays]
Length=380

 Score =   351 bits (900),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNF+KD+DGYWKWFAGNLASGGAAGA SL FVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDHFKRMFNFKKDKDGYWKWFAGNLASGGAAGACSLFFVYSLDYARTRLANDA  217

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTLASDG+ GLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  218  KAAKKGGERQFNGLVDVYRKTLASDGIRGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQD+F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI+  E
Sbjct  278  VGTLQDNFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFKQIVAKE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSGG
Sbjct  338  GTKSLFKGAGANILRAVAGAGVLAGYDKLQVVVFGKKYGSGG  379



>ref|XP_003543539.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like isoform 
X1 [Glycine max]
 ref|XP_006595041.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like isoform 
X2 [Glycine max]
 ref|XP_006595042.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like isoform 
X3 [Glycine max]
Length=395

 Score =   351 bits (901),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 192/223 (86%), Positives = 209/223 (94%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK+LFNF+KDRDGYWKWFAGN+ASG AAGA S +FVYSLDYARTRLANDA
Sbjct  173  QALNFAFKDYFKKLFNFKKDRDGYWKWFAGNMASGAAAGALSSVFVYSLDYARTRLANDA  232

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA K GG RQFNGLVDVYRKTL SDGVAGLYRGFN+SCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  233  KAGKTGGERQFNGLVDVYRKTLRSDGVAGLYRGFNVSCVGIIVYRGLYFGMYDSLKPVLL  292

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQDSF ASFALGW++T GA +ASYP+DTVRRRMMMTSGEAVKYKSS  AF+QI++NE
Sbjct  293  VGTLQDSFLASFALGWMVTIGASIASYPLDTVRRRMMMTSGEAVKYKSSFDAFSQIVKNE  352

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G+KSLFKGAGANILRAVAGAGVL+GYDKLQ++V GKKYGSGGA
Sbjct  353  GSKSLFKGAGANILRAVAGAGVLSGYDKLQVLVLGKKYGSGGA  395



>ref|XP_008350772.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Malus 
domestica]
Length=359

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 194/235 (83%), Positives = 209/235 (89%), Gaps = 0/235 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
             ALNFAFKDYFKRLFNF+KDRDGYWK FAGNLASGGA GAS L F Y LDYARTRLANDA
Sbjct  116  HALNFAFKDYFKRLFNFKKDRDGYWKCFAGNLASGGAVGASYLXFAYYLDYARTRLANDA  175

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTL SDG+AGLYRGFNISCVGIIVY  LYFG+YDSLKPV+L
Sbjct  176  KAAKKGGERQFNGLIDVYKKTLKSDGIAGLYRGFNISCVGIIVYHDLYFGLYDSLKPVVL  235

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKY+SS+ AF QIL+NE
Sbjct  236  TGGLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYRSSLDAFQQILKNE  295

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA*IQTFLIASTRE  207
            GA SLFKGAGANILRA+AGAGVL+GYDKLQ++VFGKKYGS    +  FL+    E
Sbjct  296  GANSLFKGAGANILRAIAGAGVLSGYDKLQLLVFGKKYGSSYLCLFLFLVFPVCE  350



>ref|XP_010438469.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Camelina 
sativa]
Length=380

 Score =   350 bits (898),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 194/222 (87%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD++GYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDYFKRLFNFKKDKEGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  217

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG++DVY+KT+ SDG+ GLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  218  KAAKKGGQRQFNGMIDVYKKTITSDGIVGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  278  VDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLQAFSQIVKNE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGG
Sbjct  338  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKYGSGG  379



>gb|KHN30132.1| ADP,ATP carrier protein, mitochondrial [Glycine soja]
Length=395

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 192/223 (86%), Positives = 209/223 (94%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK+LFNF+KDRDGYWKWFAGN+ASG AAGA S +FVYSLDYARTRLANDA
Sbjct  173  QALNFAFKDYFKKLFNFKKDRDGYWKWFAGNMASGAAAGALSSVFVYSLDYARTRLANDA  232

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA K GG RQFNGLVDVYRKTL SDGVAGLYRGFN+SCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  233  KAGKTGGERQFNGLVDVYRKTLRSDGVAGLYRGFNVSCVGIIVYRGLYFGMYDSLKPVLL  292

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQDSF ASFALGW++T GA +ASYP+DTVRRRMMMTSGEAVKYKSS  AF+QI++NE
Sbjct  293  VGTLQDSFLASFALGWMVTIGASIASYPLDTVRRRMMMTSGEAVKYKSSFDAFSQIVKNE  352

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G+KSLFKGAGANILRAVAGAGVL+GYDKLQ++V GKKYGSGGA
Sbjct  353  GSKSLFKGAGANILRAVAGAGVLSGYDKLQVLVLGKKYGSGGA  395



>ref|NP_001275490.1| ADP,ATP carrier protein, mitochondrial [Solanum tuberosum]
 ref|XP_006361217.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Solanum 
tuberosum]
 gb|AFX67036.1| ADP, ATP carrier protein [Solanum tuberosum]
Length=387

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 213/223 (96%), Gaps = 1/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGG AGASSLLFVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGGAGASSLLFVYSLDYARTRLANDA  223

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GG  RQF+GLVDVYRKTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL
Sbjct  224  KAAKKGGGGRQFDGLVDVYRKTLKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  283

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG ++DSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF QIL+N
Sbjct  284  LTGKMEDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFNQILKN  343

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            EG KSLFKGAGAN+LRAVAGAGVLAGYDKLQ+IVFGKKYGSGG
Sbjct  344  EGPKSLFKGAGANVLRAVAGAGVLAGYDKLQVIVFGKKYGSGG  386



>ref|XP_010433228.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Camelina 
sativa]
 ref|XP_010433229.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Camelina 
sativa]
Length=380

 Score =   350 bits (898),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 194/222 (87%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD++GYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDYFKRLFNFKKDKEGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  217

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG++DVY+KT+ SDG+ GLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  218  KAAKKGGQRQFNGMIDVYKKTITSDGIVGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  278  VDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLQAFSQIVKNE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGG
Sbjct  338  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKYGSGG  379



>sp|P27081.1|ADT2_SOLTU RecName: Full=ADP,ATP carrier protein, mitochondrial; AltName: 
Full=ADP/ATP translocase; AltName: Full=Adenine nucleotide 
translocator; Short=ANT; Flags: Precursor, partial [Solanum 
tuberosum]
 emb|CAA40782.1| adenine nucleotide translocator [Solanum tuberosum]
Length=386

 Score =   350 bits (898),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 213/223 (96%), Gaps = 1/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGG AGASSLLFVYSLDYARTRLANDA
Sbjct  163  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGGAGASSLLFVYSLDYARTRLANDA  222

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GG  RQF+GLVDVYRKTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL
Sbjct  223  KAAKKGGGGRQFDGLVDVYRKTLKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  282

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG ++DSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF QIL+N
Sbjct  283  LTGKMEDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFNQILKN  342

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            EG KSLFKGAGAN+LRAVAGAGVLAGYDKLQ+IVFGKKYGSGG
Sbjct  343  EGPKSLFKGAGANVLRAVAGAGVLAGYDKLQVIVFGKKYGSGG  385



>ref|XP_004985876.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Setaria 
italica]
Length=381

 Score =   349 bits (896),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 207/224 (92%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNF+KD+DGYWKWFAGNLASGGAAGA SL FVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDHFKRMFNFKKDKDGYWKWFAGNLASGGAAGACSLFFVYSLDYARTRLANDA  217

Query  731  KAAK-GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            K AK GGG RQFNGL+DVYRKTLASDG+AGLYRGF+ISCVGIIVYRGLYFGMYDSLKPVL
Sbjct  218  KVAKKGGGERQFNGLIDVYRKTLASDGIAGLYRGFSISCVGIIVYRGLYFGMYDSLKPVL  277

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            L GSLQD+F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI+  
Sbjct  278  LVGSLQDNFLASFFLGWCITMGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFKQIVAK  337

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EG KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+FGK YGSGGA
Sbjct  338  EGPKSLFKGAGANILRAVAGAGVLAGYDKLQVIMFGKTYGSGGA  381



>gb|AAM65696.1| ADP,ATP carrier-like protein [Arabidopsis thaliana]
Length=379

 Score =   349 bits (895),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 194/222 (87%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+K++DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRLFNFKKEKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG+VDVY+KT+ASDG+ GLYRGFNISCVGI+VYRGLYFG+YDSLKPV+L
Sbjct  217  KAAKKGGQRQFNGMVDVYKKTIASDGIVGLYRGFNISCVGIVVYRGLYFGLYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSF ASF LGW IT GAGLASYPIDTVRR MMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  277  VDGLQDSFLASFLLGWGITIGAGLASYPIDTVRRXMMMTSGEAVKYKSSLQAFSQIVKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GKKYGSGG
Sbjct  337  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKYGSGG  378



>ref|XP_004291800.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=394

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 214/224 (96%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK+LFNF+KDRDGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  171  QALNFAFKDYFKKLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  230

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GG  RQFNGLVDVY+KTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL
Sbjct  231  KAAKKGGGGRQFNGLVDVYKKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  290

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG +QDSFFASFALGW+ITNGAGLASYPIDT+RRRMMMTSGEAVKYK SM  F Q+L+N
Sbjct  291  LTGKMQDSFFASFALGWVITNGAGLASYPIDTIRRRMMMTSGEAVKYKGSMDCFNQVLKN  350

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRA+AGAGVLAGYDKLQ++V GKKYGSGGA
Sbjct  351  EGAKSLFKGAGANILRAIAGAGVLAGYDKLQVLVLGKKYGSGGA  394



>ref|XP_006412961.1| hypothetical protein EUTSA_v10025467mg [Eutrema salsugineum]
 gb|ESQ54414.1| hypothetical protein EUTSA_v10025467mg [Eutrema salsugineum]
Length=379

 Score =   347 bits (891),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 194/221 (88%), Positives = 208/221 (94%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG+VDVY+KT+ASDG+ GLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  217  KAAKKGGQRQFNGIVDVYKKTIASDGIVGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQD+FFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++ E
Sbjct  277  VDGLQDNFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLQAFSQIVKKE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV GK YGSG
Sbjct  337  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKTYGSG  377



>gb|ACJ84706.1| unknown [Medicago truncatula]
 gb|AFK47019.1| unknown [Medicago truncatula]
Length=371

 Score =   347 bits (891),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 194/222 (87%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKW AGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  149  QALNFAFKDYFKRLFNFKKDRDGYWKWSAGNLASGGAAGASSLLFVYSLDYARTRLANDA  208

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQF+G+VDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  209  KAAKKGGERQFDGMVDVYKKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  268

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGE+VKY SS+HAF  I+  E
Sbjct  269  VGGMQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGESVKYNSSLHAFQTIVAKE  328

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+++FGKKYGSGG
Sbjct  329  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLVLFGKKYGSGG  370



>emb|CAA46518.1| adenylate translocator [Arabidopsis thaliana]
 prf||1909354A adenylate translocator
Length=379

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 204/224 (91%), Positives = 215/224 (96%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK GG  RQF+GLVDVYRKTL +DG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPVL
Sbjct  216  KAAKKGGGGRQFDGLVDVYRKTLKTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVL  275

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG LQDSFFASFALGW+ITNGAGLASYPIDTVRRRMMMTS EAVKYKSS+ AF QIL+N
Sbjct  276  LTGDLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSNEAVKYKSSLDAFKQILKN  335

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVL+GYDKL +IVFGKKYGSGGA
Sbjct  336  EGAKSLFKGAGANILRAVAGAGVLSGYDKLTLIVFGKKYGSGGA  379



>gb|KDP24106.1| hypothetical protein JCGZ_25763 [Jatropha curcas]
Length=379

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  216  KAAKKGGERQFNGLVDVYRKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  276  VGNLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQIIKNE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IVF
Sbjct  336  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIVF  369



>gb|AFK44525.1| unknown [Medicago truncatula]
Length=365

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 212/224 (95%), Gaps = 1/224 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSL FVYSLDYARTRLAN A
Sbjct  142  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANGA  201

Query  731  KAAKGGGS-RQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            KAAK G   RQFNGL+DVY+KTLA+DG+AG YRGFNISCVGIIVYRGLYFGMYDSLKPVL
Sbjct  202  KAAKKGAGGRQFNGLIDVYKKTLATDGIAGPYRGFNISCVGIIVYRGLYFGMYDSLKPVL  261

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTGSLQDSFFASF LGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF QIL+N
Sbjct  262  LTGSLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFQQILKN  321

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EGAKSLFKGAGANILRAVAGAGVLAGYDKLQ+I+ GKKYGSGGA
Sbjct  322  EGAKSLFKGAGANILRAVAGAGVLAGYDKLQVIMLGKKYGSGGA  365



>emb|CDX97439.1| BnaC08g13040D [Brassica napus]
Length=377

 Score =   346 bits (888),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 193/221 (87%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  155  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  214

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG+VDVY+KT+ASDGV GLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  215  KAAKKGGQRQFNGIVDVYKKTIASDGVVGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  274

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               L+D+F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI++ E
Sbjct  275  VDGLEDNFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYTSSLQAFNQIVKKE  334

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSG
Sbjct  335  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLLVFGKKYGSG  375



>ref|XP_009109094.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Brassica 
rapa]
 ref|XP_009109095.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Brassica 
rapa]
 emb|CDY14242.1| BnaA08g13730D [Brassica napus]
Length=377

 Score =   346 bits (887),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 193/221 (87%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  155  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  214

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNG+VDVY+KT+ASDGV GLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  215  KAAKKGGQRQFNGIVDVYKKTVASDGVVGLYRGFNISCVGIIVYRGLYFGLYDSLKPVVL  274

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               L+D+F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI++ E
Sbjct  275  VDGLEDNFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYTSSLQAFNQIVKKE  334

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGKKYGSG
Sbjct  335  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLLVFGKKYGSG  375



>gb|KHN01114.1| ADP,ATP carrier protein 3, mitochondrial [Glycine soja]
Length=372

 Score =   345 bits (886),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  149  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  208

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  209  KAAKKGGERQFNGLVDVYRKTIKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  268

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF  I+ NE
Sbjct  269  VGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFQTIVANE  328

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+++F
Sbjct  329  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLVLF  362



>ref|XP_010689049.1| PREDICTED: ADP,ATP carrier protein [Beta vulgaris subsp. vulgaris]
 ref|XP_010689050.1| PREDICTED: ADP,ATP carrier protein [Beta vulgaris subsp. vulgaris]
Length=383

 Score =   346 bits (887),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 191/222 (86%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWF GNLASGG AGA+SL FVYSLDYARTRLAND+
Sbjct  161  QALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGLAGATSLFFVYSLDYARTRLANDS  220

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGF+ISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  221  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFSISCVGIIVYRGLYFGMYDSLKPVVL  280

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++ E
Sbjct  281  IGGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFNQIVKKE  340

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G+KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+ GKKYGSGG
Sbjct  341  GSKSLFKGAGANILRAVAGAGVLAGYDKLQLILLGKKYGSGG  382



>ref|XP_010260254.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nelumbo 
nucifera]
 ref|XP_010260255.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=379

 Score =   345 bits (886),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 206/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDYFKRMFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  216  KAAKKGGERQFNGLIDVYRKTIKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY+SS+ AF+QIL+NE
Sbjct  276  TGSLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYRSSLDAFSQILKNE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+++F
Sbjct  336  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLLLF  369



>ref|NP_001241092.1| uncharacterized protein LOC100802974 [Glycine max]
 gb|ACU18379.1| unknown [Glycine max]
Length=372

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  149  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  208

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  209  KAAKKGGERQFNGLVDVYRKTIKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  268

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF  I+ NE
Sbjct  269  VGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFQTIVANE  328

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+++F
Sbjct  329  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLVLF  362



>ref|XP_002517886.1| ADP,ATP carrier protein, putative [Ricinus communis]
 gb|EEF44404.1| ADP,ATP carrier protein, putative [Ricinus communis]
Length=379

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  216  KAAKKGGERQFNGLVDVYRKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  276  VGDLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQIMKNE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IVF
Sbjct  336  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLIVF  369



>ref|XP_006855242.1| hypothetical protein AMTR_s00183p00019870 [Amborella trichopoda]
 gb|ERN16709.1| hypothetical protein AMTR_s00183p00019870 [Amborella trichopoda]
Length=394

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  171  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  230

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  231  KAAKKGGERQFNGLVDVYKKTLKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  290

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG+LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+  F QIL+NE
Sbjct  291  TGNLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDCFNQILKNE  350

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++V 
Sbjct  351  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVVVL  384



>gb|EMT13243.1| ADP,ATP carrier protein, mitochondrial [Aegilops tauschii]
Length=378

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 189/222 (85%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNFRKD+DGYWKWF GN+ASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDHFKRMFNFRKDKDGYWKWFFGNIASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQF+G+VDVYRKTLASDGV GLYRGFN+SCVGIIVYRGLYFGMYDSLKP +L
Sbjct  216  KAAKVGGQRQFDGIVDVYRKTLASDGVRGLYRGFNVSCVGIIVYRGLYFGMYDSLKPAVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             GSL+D+  ASF LGW +T GAGLASYPIDTVRRRMMMTSGE+VKYK+SM AF +I+  E
Sbjct  276  VGSLEDNLLASFLLGWGVTMGAGLASYPIDTVRRRMMMTSGESVKYKNSMDAFRKIIAEE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLA YDKLQ++VFGKKYGSGG
Sbjct  336  GAKSLFKGAGANILRAVAGAGVLAVYDKLQVVVFGKKYGSGG  377



>ref|XP_008789809.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008789810.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008789811.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=384

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK +FNF+KDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  161  QALNFAFKDYFKCMFNFKKDRDGYWKWFAGNLLSGGAAGASSLLFVYSLDYARTRLANDA  220

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKTL SDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  221  KAAKKGGERQFNGLLDVYRKTLKSDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  280

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQD+FFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY+SS+ AF+QIL+NE
Sbjct  281  VGTLQDNFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYRSSLDAFSQILKNE  340

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VF
Sbjct  341  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVF  374



>dbj|BAJ99879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 189/222 (85%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNFRKD+DGYWKWF GN+ASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDHFKRMFNFRKDKDGYWKWFFGNIASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQF+G+VDVYRKTLASDGV GLYRGFN+SCVGIIVYRGLYFGMYDSLKP +L
Sbjct  216  KAAKVGGQRQFDGIVDVYRKTLASDGVRGLYRGFNVSCVGIIVYRGLYFGMYDSLKPAVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             GSL+D+  ASF LGW +T GAGLASYPIDTVRRRMMMTSGE+VKYK+SM AF +I+  E
Sbjct  276  VGSLEDNLLASFLLGWGVTMGAGLASYPIDTVRRRMMMTSGESVKYKNSMDAFKKIVAEE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLA YDKLQ++VFGKKYGSGG
Sbjct  336  GAKSLFKGAGANILRAVAGAGVLAVYDKLQVVVFGKKYGSGG  377



>ref|XP_006399842.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
 ref|XP_006399843.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
 dbj|BAJ34180.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41295.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
 gb|ESQ41296.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
Length=383

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 213/223 (96%), Gaps = 1/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  162  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  221

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKP LL
Sbjct  222  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKP-LL  280

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  281  PGDMQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  340

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLFKGAGANILRA+AGAGVL+GYDKLQ+++ GKKYGSGGA
Sbjct  341  GAKSLFKGAGANILRAIAGAGVLSGYDKLQLLLLGKKYGSGGA  383



>ref|XP_008810549.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008810550.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008810551.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008810552.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=387

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 206/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRMFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  224  KAAKKGGERQFNGLIDVYRKTVKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+L+D+FFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY+SS+ AF+QI++NE
Sbjct  284  VGALEDNFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYRSSLDAFSQIMKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VF
Sbjct  344  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVF  377



>dbj|BAJ98173.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 189/222 (85%), Positives = 206/222 (93%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNFRKD+DGYWKWF GN+ASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDHFKRMFNFRKDKDGYWKWFFGNIASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQF+G+VDVYRKTLASDGV GLYRGFN+SCVGIIVYRGLYFGMYDSLKP +L
Sbjct  216  KAAKVGGQRQFDGIVDVYRKTLASDGVRGLYRGFNVSCVGIIVYRGLYFGMYDSLKPAVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             GSL+D+  ASF LGW +T GAGLASYPIDTVRRRMMMTSGE+VKYK+SM AF +I+  E
Sbjct  276  VGSLEDNLLASFLLGWGVTMGAGLASYPIDTVRRRMMMTSGESVKYKNSMDAFKKIVAEE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GAKSLFKGAGANILRAVAGAGVLA YDKLQ++VFGKKYGSGG
Sbjct  336  GAKSLFKGAGANILRAVAGAGVLAVYDKLQVVVFGKKYGSGG  377



>dbj|BAK03012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   339 bits (870),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 206/223 (92%), Gaps = 1/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD FKR+F F + +DGYWKWFAGNLASGGAAGA SLLFVYSLDYARTRLANDA
Sbjct  90   QALNFAFKDQFKRMFGFSQTKDGYWKWFAGNLASGGAAGALSLLFVYSLDYARTRLANDA  149

Query  731  KAAK-GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            K+AK G G RQFNGLVDVYRKT+ASDG+AGLYRGFNISCVGIIVYRGLYFG+YDS+KPV+
Sbjct  150  KSAKKGAGERQFNGLVDVYRKTIASDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVV  209

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG+++DSF ASF LGW IT GAGLASYP+DTVRRRMMMTSGEAVKYKSSMHAF +I++ 
Sbjct  210  LTGNMKDSFLASFLLGWTITIGAGLASYPLDTVRRRMMMTSGEAVKYKSSMHAFQEIVKK  269

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            EG  SLFKGAGANILRA+AGAGVLAGYD+LQM+VFGK YGSGG
Sbjct  270  EGTASLFKGAGANILRAIAGAGVLAGYDQLQMLVFGKTYGSGG  312



>ref|XP_009606916.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=384

 Score =   341 bits (875),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND 
Sbjct  161  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDN  220

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+ GLYRGF ISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  221  KAAKKGGERQFNGLVDVYRKTLKSDGIGGLYRGFTISCVGIIVYRGLYFGMYDSLKPVVL  280

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYK SM AFTQI++NE
Sbjct  281  VGDLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKGSMDAFTQIVKNE  340

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+F
Sbjct  341  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIMF  374



>ref|XP_002513475.1| ADP,ATP carrier protein, putative [Ricinus communis]
 gb|EEF48878.1| ADP,ATP carrier protein, putative [Ricinus communis]
Length=363

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 191/223 (86%), Positives = 206/223 (92%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QA NFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLL  Y LDYARTRLAND 
Sbjct  141  QAFNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLLTYPLDYARTRLANDG  200

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA K GG RQFNGL+DVYRKT+ SDGVAGLYRGFNISCVGII+YRGLYFGMYDSLKPV+L
Sbjct  201  KAVKKGGERQFNGLIDVYRKTVQSDGVAGLYRGFNISCVGIIIYRGLYFGMYDSLKPVVL  260

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQD+F ASFALGW++TNGA LASYPIDTVRRRMMMTSGEAVKYK+SM A +QIL+NE
Sbjct  261  TGKLQDNFMASFALGWVVTNGASLASYPIDTVRRRMMMTSGEAVKYKNSMDALSQILKNE  320

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            GAKSLF+G GANILRAVAGAGVL+GYDKLQ++V GK YGSGGA
Sbjct  321  GAKSLFRGGGANILRAVAGAGVLSGYDKLQVLVLGKAYGSGGA  363



>emb|CAN66307.1| hypothetical protein VITISV_009087 [Vitis vinifera]
Length=383

 Score =   341 bits (874),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  160  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  219

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  220  KAAKKGGERQFNGLIDVYKKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  279

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  280  VGEMQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQILKNE  339

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++V 
Sbjct  340  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLLVL  373



>gb|EMS49632.1| ADP,ATP carrier protein, mitochondrial [Triticum urartu]
Length=378

 Score =   340 bits (873),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 188/222 (85%), Positives = 205/222 (92%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNFRKD+DGYWKWF GN+ASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDHFKRMFNFRKDKDGYWKWFFGNIASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQF+G+VDVYRKTLASDGV GLYRGFN+SCVGIIVYRGLYFGMYDSLKP +L
Sbjct  216  KAAKVGGQRQFDGIVDVYRKTLASDGVRGLYRGFNVSCVGIIVYRGLYFGMYDSLKPAVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             GSL+D+  ASF LGW +T GAGLASYPIDTVRRRMMMTSGE+VKYK+SM AF +I+  E
Sbjct  276  VGSLEDNLLASFLLGWGVTMGAGLASYPIDTVRRRMMMTSGESVKYKNSMDAFRKIIAEE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            GA SLFKGAGANILRAVAGAGVLA YDKLQ++VFGKKYGSGG
Sbjct  336  GATSLFKGAGANILRAVAGAGVLAVYDKLQVVVFGKKYGSGG  377



>ref|XP_010943967.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
 ref|XP_010943968.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
Length=387

 Score =   341 bits (874),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 205/214 (96%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWFAGNLASGGAAGASSL+FVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRMFNFKKDKDGYWKWFAGNLASGGAAGASSLVFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ +DGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  224  KAAKKGGERQFNGLIDVYRKTIKTDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQD+F ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY+SS+ AF+QIL+NE
Sbjct  284  VGALQDNFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYRSSLDAFSQILKNE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VF
Sbjct  344  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVF  377



>ref|XP_010656992.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Vitis vinifera]
Length=383

 Score =   341 bits (874),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  160  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  219

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  220  KAAKKGGERQFNGLIDVYKKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  279

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  280  VGEMQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQILKNE  339

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++V 
Sbjct  340  GAKSLFKGAGANILRAVAGAGVLAGYDKLQLLVL  373



>ref|XP_002438320.1| hypothetical protein SORBIDRAFT_10g012150 [Sorghum bicolor]
 gb|EER89687.1| hypothetical protein SORBIDRAFT_10g012150 [Sorghum bicolor]
Length=363

 Score =   340 bits (872),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 186/226 (82%), Positives = 202/226 (89%), Gaps = 3/226 (1%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFNF +DRDGYW+WFAGN+ SG AAGA+SLLFVYSLDYARTRL ND 
Sbjct  138  QALNFAFKDYFKSLFNFNRDRDGYWRWFAGNIVSGSAAGATSLLFVYSLDYARTRLTNDY  197

Query  731  KAAKG---GGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKP  561
            KAA     GG RQF GLVDVYRKTL SDGVAGLYRGFN+S VGI+VYRGLYFGMYDS KP
Sbjct  198  KAAAAMGKGGERQFTGLVDVYRKTLRSDGVAGLYRGFNVSVVGIVVYRGLYFGMYDSFKP  257

Query  560  VLLTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQIL  381
            VLLTG LQD+FFAS ALGW+ITNGA LASYP+DTVRRRMMMTSGEAVKYKSSM AF QI+
Sbjct  258  VLLTGKLQDNFFASLALGWMITNGANLASYPLDTVRRRMMMTSGEAVKYKSSMDAFAQIV  317

Query  380  QNEGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            +NEG +SLFKGAGAN+LRA+AGAG LAGYD+LQ+I FGKKYGSGGA
Sbjct  318  RNEGPRSLFKGAGANVLRAIAGAGALAGYDQLQLIFFGKKYGSGGA  363



>ref|XP_009781621.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=384

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND 
Sbjct  161  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDN  220

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+ GLYRGF ISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  221  KAAKKGGERQFNGLVDVYRKTLKSDGIGGLYRGFTISCVGIIVYRGLYFGMYDSLKPVVL  280

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYK SM AFTQI++NE
Sbjct  281  VGDLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKGSMDAFTQIVKNE  340

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+F
Sbjct  341  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIMF  374



>ref|XP_008455276.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Cucumis 
melo]
Length=378

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  155  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  214

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDS+KPV+L
Sbjct  215  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSMKPVVL  274

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI++NE
Sbjct  275  VGDLQDSFLASFLLGWCITIGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFKQIVKNE  334

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++V 
Sbjct  335  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLLVL  368



>ref|XP_004136845.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004170130.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Cucumis 
sativus]
 gb|KGN43648.1| hypothetical protein Csa_7G050790 [Cucumis sativus]
Length=378

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  155  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  214

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDS+KPV+L
Sbjct  215  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSMKPVVL  274

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI++NE
Sbjct  275  VGDLQDSFLASFLLGWCITIGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFKQIVKNE  334

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++V 
Sbjct  335  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLLVL  368



>ref|XP_011047661.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Populus 
euphratica]
 ref|XP_011047662.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Populus 
euphratica]
 ref|XP_011047663.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Populus 
euphratica]
Length=380

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFNF+K++DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKSLFNFKKEKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  217  KAAKKGGERQFNGLIDVYKKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++NE
Sbjct  277  VGNLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFKQIIKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IVF
Sbjct  337  GGKSLFKGAGANILRAVAGAGVLAGYDKLQVIVF  370



>ref|XP_006447271.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
 ref|XP_006447272.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
 ref|XP_006469891.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Citrus 
sinensis]
 gb|ESR60511.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
 gb|ESR60512.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
Length=379

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTL SDG+AGLYRGF+ISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  216  KAAKKGGERQFNGLIDVYKKTLKSDGIAGLYRGFSISCVGIIVYRGLYFGMYDSLKPVVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            T  +QDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF +I++NE
Sbjct  276  TDGMQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFQEIIKNE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+++F
Sbjct  336  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLVLF  369



>gb|KDO42766.1| hypothetical protein CISIN_1g016996mg [Citrus sinensis]
 gb|KDO42767.1| hypothetical protein CISIN_1g016996mg [Citrus sinensis]
 gb|KDO42768.1| hypothetical protein CISIN_1g016996mg [Citrus sinensis]
Length=379

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTL SDG+AGLYRGF+ISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  216  KAAKKGGERQFNGLIDVYKKTLKSDGIAGLYRGFSISCVGIIVYRGLYFGMYDSLKPVVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            T  +QDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF +I++NE
Sbjct  276  TDGMQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFQEIIKNE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+++F
Sbjct  336  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLVLF  369



>ref|XP_002310404.2| hypothetical protein POPTR_0007s01010g [Populus trichocarpa]
 gb|EEE90854.2| hypothetical protein POPTR_0007s01010g [Populus trichocarpa]
Length=380

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFNF+K++DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  157  QALNFAFKDYFKSLFNFKKEKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDS  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  217  KAAKTGGERQFNGLVDVYKKTLQSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++NE
Sbjct  277  VGNLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFKQIVKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IVF
Sbjct  337  GGKSLFKGAGANILRAVAGAGVLAGYDKLQVIVF  370



>ref|XP_010272403.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010272404.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like isoform 
X2 [Nelumbo nucifera]
Length=381

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  158  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  217

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+ GLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  218  KAAKKGGERQFNGLIDVYRKTIKSDGLVGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            T  LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  278  TDQLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQILKNE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VF
Sbjct  338  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVF  371



>ref|XP_007043627.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
 ref|XP_007043628.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
 ref|XP_007043629.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
 gb|EOX99458.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
 gb|EOX99459.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
 gb|EOX99460.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
Length=380

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRMFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  217  KAAKKGGERQFNGLVDVYKKTIKSDGLAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++NE
Sbjct  277  VGGLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFSQIIKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IV 
Sbjct  337  GTKSLFKGAGANILRAVAGAGVLAGYDKLQVIVL  370



>ref|XP_008381597.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Malus 
domestica]
Length=380

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  157  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGF+ISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  217  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFSISCVGIIVYRGLYFGMYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI++NE
Sbjct  277  TGGLQDSFVASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFKQIIKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIV  273
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+++
Sbjct  337  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVVL  369



>gb|EYU42134.1| hypothetical protein MIMGU_mgv1a019964mg [Erythranthe guttata]
Length=366

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QA NFAFKDYFKRLFNF+KDRDGYWKWFAGNLASG AAGASS LFVYS+DYARTRLAND+
Sbjct  149  QAFNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGSAAGASSQLFVYSIDYARTRLANDS  208

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+AGLYRGFNIS VGIIVYRGLYFGMYDSLKPV+L
Sbjct  209  KAAKKGGERQFNGLIDVYRKTIKSDGIAGLYRGFNISVVGIIVYRGLYFGMYDSLKPVVL  268

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+L+DSF ASF LGW IT GAGL SYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++ E
Sbjct  269  IGTLEDSFLASFMLGWGITIGAGLVSYPIDTVRRRMMMTSGEAVKYKSSIDAFSQIIKKE  328

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKY  258
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+FGKKY
Sbjct  329  GTKSLFKGAGANILRAVAGAGVLAGYDKLQVIMFGKKY  366



>ref|XP_006447270.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
 gb|ESR60510.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
Length=442

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  219  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  278

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTL SDG+AGLYRGF+ISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  279  KAAKKGGERQFNGLIDVYKKTLKSDGIAGLYRGFSISCVGIIVYRGLYFGMYDSLKPVVL  338

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            T  +QDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+HAF +I++NE
Sbjct  339  TDGMQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLHAFQEIIKNE  398

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+++F
Sbjct  399  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLVLF  432



>gb|ACL53828.1| unknown [Zea mays]
Length=339

 Score =   337 bits (865),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFNF KDRDGYW+WFAGN+ASG AAGA+SLLFVYSLDYARTRL +D 
Sbjct  117  QALNFAFKDYFKGLFNFNKDRDGYWRWFAGNIASGSAAGATSLLFVYSLDYARTRLTSDY  176

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            +AA  GG RQF GLVDVYRKTL SDGV GLYRGFN+S  GI+VYRGLYFGMYDSLKPVLL
Sbjct  177  RAAAKGGERQFTGLVDVYRKTLRSDGVVGLYRGFNVSVAGIVVYRGLYFGMYDSLKPVLL  236

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            T  LQD+FFAS ALGW+ITNGA LASYP+DT+RRRMMMTSGEAVKYKSSM AF QI++NE
Sbjct  237  TEKLQDNFFASLALGWMITNGASLASYPLDTIRRRMMMTSGEAVKYKSSMDAFAQIVRNE  296

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGAN+LRA+AGAG LAGYD+LQ+I FGKKYGSGGA
Sbjct  297  GPKSLFKGAGANVLRAIAGAGALAGYDQLQLIFFGKKYGSGGA  339



>ref|XP_004338972.1| adenine nucleotide translocator, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR16959.1| adenine nucleotide translocator, putative [Acanthamoeba castellanii 
str. Neff]
Length=313

 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 190/222 (86%), Positives = 205/222 (92%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD FKR+F + KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND 
Sbjct  91   QALNFAFKDQFKRMFGYNKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDN  150

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            K+AK GG RQFNGL DVY+KTL SDG+ GLYRGFNISCVGIIVYRGLYFG+YDSLKPVLL
Sbjct  151  KSAKKGGERQFNGLFDVYKKTLKSDGIVGLYRGFNISCVGIIVYRGLYFGLYDSLKPVLL  210

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSL DSFFASF LGW IT GAGLASYP+DTVRRRMMMTSGEAVKY+SS HAF++I++ E
Sbjct  211  TGSLSDSFFASFLLGWGITIGAGLASYPLDTVRRRMMMTSGEAVKYRSSAHAFSEIVKKE  270

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++VFGK YG+GG
Sbjct  271  GVKSLFKGAGANILRAVAGAGVLAGYDKLQVLVFGKTYGAGG  312



>gb|KHN36650.1| ADP,ATP carrier protein 3, mitochondrial [Glycine soja]
Length=268

 Score =   335 bits (858),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  45   QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  104

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  105  KAAKKGGERQFNGLVDVYRKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  164

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF  I+  E
Sbjct  165  VGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLEAFKIIIAKE  224

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+F
Sbjct  225  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLILF  258



>ref|XP_010272402.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like isoform 
X1 [Nelumbo nucifera]
Length=398

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  175  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  234

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+ GLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  235  KAAKKGGERQFNGLIDVYRKTIKSDGLVGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  294

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            T  LQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS  AF+QIL+NE
Sbjct  295  TDQLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQILKNE  354

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ++VF
Sbjct  355  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVLVF  388



>ref|XP_010091485.1| ADP,ATP carrier protein 3 [Morus notabilis]
 gb|EXB44636.1| ADP,ATP carrier protein 3 [Morus notabilis]
Length=373

 Score =   338 bits (867),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  150  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  209

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            K+AK GG RQFNGL+DVY+KTL SDG+AGLYRGF+ISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  210  KSAKKGGERQFNGLIDVYKKTLKSDGIAGLYRGFSISCVGIIVYRGLYFGLYDSLKPVVL  269

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF QI++NE
Sbjct  270  VGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDAFNQIIKNE  329

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IV 
Sbjct  330  GPKSLFKGAGANILRAVAGAGVLAGYDKLQVIVL  363



>ref|XP_011100347.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Sesamum 
indicum]
 ref|XP_011100349.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Sesamum 
indicum]
Length=383

 Score =   338 bits (868),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  160  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  219

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+ GLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  220  KAAKKGGERQFNGLIDVYRKTIQSDGLVGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  279

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TGSLQDSF ASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF+QI++ E
Sbjct  280  TGSLQDSFLASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSIDAFSQIVKKE  339

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++V 
Sbjct  340  GTKSLFKGAGANILRAVAGAGVLAGYDKLQVLVL  373



>ref|XP_006367480.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Solanum 
tuberosum]
Length=384

 Score =   338 bits (868),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND 
Sbjct  161  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDN  220

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KA+K GG RQFNGLVDVYRKTL SDG+ GLYRGF ISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  221  KASKKGGERQFNGLVDVYRKTLKSDGIGGLYRGFTISCVGIIVYRGLYFGMYDSLKPVLL  280

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYK SM AF+QI++NE
Sbjct  281  VGDMQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKGSMDAFSQIVKNE  340

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+F
Sbjct  341  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIMF  374



>ref|NP_001142273.1| uncharacterized protein LOC100274442 [Zea mays]
 ref|XP_008658318.1| PREDICTED: uncharacterized protein LOC100274442 isoform X1 [Zea 
mays]
 ref|XP_008658319.1| PREDICTED: uncharacterized protein LOC100274442 isoform X1 [Zea 
mays]
 ref|XP_008658320.1| PREDICTED: uncharacterized protein LOC100274442 isoform X1 [Zea 
mays]
 gb|ACF88062.1| unknown [Zea mays]
Length=366

 Score =   338 bits (866),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFNF KDRDGYW+WFAGN+ASG AAGA+SLLFVYSLDYARTRL +D 
Sbjct  144  QALNFAFKDYFKGLFNFNKDRDGYWRWFAGNIASGSAAGATSLLFVYSLDYARTRLTSDY  203

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            +AA  GG RQF GLVDVYRKTL SDGV GLYRGFN+S  GI+VYRGLYFGMYDSLKPVLL
Sbjct  204  RAAAKGGERQFTGLVDVYRKTLRSDGVVGLYRGFNVSVAGIVVYRGLYFGMYDSLKPVLL  263

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            T  LQD+FFAS ALGW+ITNGA LASYP+DT+RRRMMMTSGEAVKYKSSM AF QI++NE
Sbjct  264  TEKLQDNFFASLALGWMITNGASLASYPLDTIRRRMMMTSGEAVKYKSSMDAFAQIVRNE  323

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGAN+LRA+AGAG LAGYD+LQ+I FGKKYGSGGA
Sbjct  324  GPKSLFKGAGANVLRAIAGAGALAGYDQLQLIFFGKKYGSGGA  366



>ref|XP_007198831.1| hypothetical protein PRUPE_ppa007166mg [Prunus persica]
 gb|EMJ00030.1| hypothetical protein PRUPE_ppa007166mg [Prunus persica]
Length=379

 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  216  KAAKKGGERQFNGLIDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI++ E
Sbjct  276  TGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFKQIIKKE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G+KSLFKGAGANILRAVAGAGVLAGYDKLQ+++ 
Sbjct  336  GSKSLFKGAGANILRAVAGAGVLAGYDKLQVVLL  369



>ref|XP_008229069.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Prunus mume]
Length=379

 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  156  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  216  KAAKKGGERQFNGLIDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  275

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKY SS+ AF QI++ E
Sbjct  276  TGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYNSSLDAFKQIIKKE  335

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G+KSLFKGAGANILRAVAGAGVLAGYDKLQ+++ 
Sbjct  336  GSKSLFKGAGANILRAVAGAGVLAGYDKLQVVLL  369



>gb|ACU24302.1| unknown [Glycine max]
Length=367

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  144  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  203

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  204  KAAKKGGERQFNGLVDVYRKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  263

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF  I+  E
Sbjct  264  VGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLEAFKIIVAKE  323

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+F
Sbjct  324  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLILF  357



>ref|XP_003543333.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Glycine 
max]
Length=367

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  144  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  203

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  204  KAAKKGGERQFNGLVDVYRKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  263

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF  I+  E
Sbjct  264  VGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLEAFKIIVAKE  323

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+F
Sbjct  324  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLILF  357



>ref|XP_009397774.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397775.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=384

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKR+FNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  161  QALNFAFKDYFKRMFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  220

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDGVAGLYRGFNISCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  221  KAAKKGGERQFNGLVDVYRKTIQSDGVAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVML  280

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             GSLQD+FFASF LGW IT GA LASYP+DTVRRRMMMTSGEAVKY++SM AF+QI++NE
Sbjct  281  VGSLQDNFFASFLLGWGITIGASLASYPLDTVRRRMMMTSGEAVKYRNSMDAFSQIVKNE  340

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+IV 
Sbjct  341  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVIVL  374



>ref|XP_004243366.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Solanum 
lycopersicum]
Length=383

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLAND 
Sbjct  160  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDN  219

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKTL SDG+ GLYRGF ISCVGIIVYRGLYFGMYDSLKPVLL
Sbjct  220  KAAKKGGERQFNGLVDVYRKTLKSDGMGGLYRGFTISCVGIIVYRGLYFGMYDSLKPVLL  279

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYK SM AF+QI++NE
Sbjct  280  VGDMQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKGSMDAFSQIVKNE  339

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I+F
Sbjct  340  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIMF  373



>ref|XP_003540370.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Glycine 
max]
 gb|KHN27900.1| ADP,ATP carrier protein 3, mitochondrial [Glycine soja]
Length=367

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  144  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  203

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  204  KAAKKGGERQFNGLIDVYRKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  263

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF  I+  E
Sbjct  264  VGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLEAFKIIVAKE  323

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+++F
Sbjct  324  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLVLF  357



>ref|XP_007149829.1| hypothetical protein PHAVU_005G102000g [Phaseolus vulgaris]
 ref|XP_007149830.1| hypothetical protein PHAVU_005G102000g [Phaseolus vulgaris]
 gb|ESW21823.1| hypothetical protein PHAVU_005G102000g [Phaseolus vulgaris]
 gb|ESW21824.1| hypothetical protein PHAVU_005G102000g [Phaseolus vulgaris]
Length=367

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  144  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  203

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  204  KAAKKGGERQFNGLVDVYRKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  263

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF  I+  E
Sbjct  264  VGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLEAFKIIIAKE  323

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IV 
Sbjct  324  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIVL  357



>emb|CDX91117.1| BnaC02g04800D [Brassica napus]
Length=381

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 208/221 (94%), Gaps = 1/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  160  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDS  219

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKP LL
Sbjct  220  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKP-LL  278

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  279  PADLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  338

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            G KSLFKGAGANILRA+AGAGVL+GYDKLQ+++ GKKYGSG
Sbjct  339  GPKSLFKGAGANILRAIAGAGVLSGYDKLQLLLLGKKYGSG  379



>emb|CDX69638.1| BnaA10g19870D [Brassica napus]
Length=372

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 208/221 (94%), Gaps = 1/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  151  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDS  210

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKP LL
Sbjct  211  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKP-LL  269

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  270  PADLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  329

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            G KSLFKGAGANILRA+AGAGVL+GYDKLQ+++ GKKYGSG
Sbjct  330  GPKSLFKGAGANILRAIAGAGVLSGYDKLQLLLLGKKYGSG  370



>emb|CDY09801.1| BnaC09g43600D [Brassica napus]
Length=380

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 208/221 (94%), Gaps = 1/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  159  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDS  218

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKP LL
Sbjct  219  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKP-LL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  278  PADLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            G KSLFKGAGANILRA+AGAGVL+GYDKLQ+++ GKKYGSG
Sbjct  338  GPKSLFKGAGANILRAIAGAGVLSGYDKLQLLLLGKKYGSG  378



>gb|AGZ15404.1| ADP, ATP carrier 3 protein [Phaseolus vulgaris]
Length=367

 Score =   336 bits (861),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 191/214 (89%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  144  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  203

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  204  KAAKKGGERQFNGLVDVYRKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  263

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF  I+  E
Sbjct  264  VGGLQDSFFASFFLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLEAFKIIIAKE  323

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IV 
Sbjct  324  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIVL  357



>ref|XP_006366306.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Solanum 
tuberosum]
Length=349

 Score =   335 bits (859),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 185/222 (83%), Positives = 202/222 (91%), Gaps = 0/222 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAF+D+FKR+FNF K+RDGYWKWF GNLASGGAAGAS+LLFVYSLDYARTRL NDA
Sbjct  123  QALNFAFRDHFKRMFNFNKERDGYWKWFGGNLASGGAAGASTLLFVYSLDYARTRLTNDA  182

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFN L+DVYRKT+ SDG+ GLYRGF ISCVGI+VYRGLYFG+YDSLKPV+L
Sbjct  183  KAAKKGGERQFNSLLDVYRKTIKSDGIPGLYRGFTISCVGIVVYRGLYFGVYDSLKPVVL  242

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQDSFFASF LGW IT GAGL SYPIDTVRRRMMMTSGEAVKYK S+ AF+QI++ E
Sbjct  243  VGNLQDSFFASFLLGWGITIGAGLTSYPIDTVRRRMMMTSGEAVKYKGSLDAFSQIMKKE  302

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+I FG KYGSGG
Sbjct  303  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIFFGTKYGSGG  344



>emb|CDX70507.1| BnaC03g05910D [Brassica napus]
Length=377

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 208/221 (94%), Gaps = 1/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  156  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDS  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKP LL
Sbjct  216  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKP-LL  274

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  275  PADLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  334

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            G KSLFKGAGANILRA+AGAGVL+GYDKLQ+++ GKKYGSG
Sbjct  335  GPKSLFKGAGANILRAIAGAGVLSGYDKLQLLLLGKKYGSG  375



>gb|AFW86475.1| hypothetical protein ZEAMMB73_378887 [Zea mays]
Length=502

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/223 (83%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK LFNF KDRDGYW+WFAGN+ASG AAGA+SLLFVYSLDYARTRL +D 
Sbjct  280  QALNFAFKDYFKGLFNFNKDRDGYWRWFAGNIASGSAAGATSLLFVYSLDYARTRLTSDY  339

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            +AA  GG RQF GLVDVYRKTL SDGV GLYRGFN+S  GI+VYRGLYFGMYDSLKPVLL
Sbjct  340  RAAAKGGERQFTGLVDVYRKTLRSDGVVGLYRGFNVSVAGIVVYRGLYFGMYDSLKPVLL  399

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            T  LQD+FFAS ALGW+ITNGA LASYP+DT+RRRMMMTSGEAVKYKSSM AF QI++NE
Sbjct  400  TEKLQDNFFASLALGWMITNGASLASYPLDTIRRRMMMTSGEAVKYKSSMDAFAQIVRNE  459

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGAN+LRA+AGAG LAGYD+LQ+I FGKKYGSGGA
Sbjct  460  GPKSLFKGAGANVLRAIAGAGALAGYDQLQLIFFGKKYGSGGA  502



>emb|CAG17934.1| adenosine nucleotide translocator [Brassica oleracea var. viridis]
Length=322

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 195/220 (89%), Positives = 206/220 (94%), Gaps = 1/220 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNF FKDYFKRLFNF+KDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  101  QALNFVFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDS  160

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKP LL
Sbjct  161  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKP-LL  219

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  220  PADLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  279

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGS  252
            G KSLFKGAGANILRA+AGAGVL+GYDKLQ+++ GKKYGS
Sbjct  280  GPKSLFKGAGANILRAIAGAGVLSGYDKLQLLLLGKKYGS  319



>emb|CDX78525.1| BnaA03g04370D [Brassica napus]
Length=377

 Score =   333 bits (854),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 208/221 (94%), Gaps = 1/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  156  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDS  215

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKP LL
Sbjct  216  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKP-LL  274

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  275  PADLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  334

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            G KSLFKGAGANILRA+AGAGVL+GYDKLQ+++ GKK+GSG
Sbjct  335  GPKSLFKGAGANILRAIAGAGVLSGYDKLQLLLLGKKFGSG  375



>ref|XP_004486958.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Cicer 
arietinum]
Length=362

 Score =   332 bits (852),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 201/223 (90%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QA NFAFKDYFK+LFNF++D+DGYWKW AGN+ASG AAGASS +FVYSLDYARTRLA+DA
Sbjct  140  QAFNFAFKDYFKKLFNFKQDKDGYWKWLAGNVASGAAAGASSSVFVYSLDYARTRLASDA  199

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            K  K GG RQFNGL+DVY+KTL SDG+AGLYRGFN+S VGI+VYRGLYFGMYDS KP+LL
Sbjct  200  KTTKKGGERQFNGLIDVYKKTLKSDGIAGLYRGFNVSIVGIMVYRGLYFGMYDSFKPILL  259

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQDSF ASFALGWL+T GA +ASYP+DTVRRRMMMTSGEAVKYKSS  AF+QI++ E
Sbjct  260  VGNLQDSFVASFALGWLVTVGASVASYPLDTVRRRMMMTSGEAVKYKSSFDAFSQIVKTE  319

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLA YDKLQ+++ G KYGSGGA
Sbjct  320  GPKSLFKGAGANILRAVAGAGVLASYDKLQVLLLGNKYGSGGA  362



>ref|XP_009759661.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=387

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+K+RDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKERDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+ GLYRGF ISCVGIIVYRGLYFG+YDSLKP++L
Sbjct  224  KAAKKGGERQFNGLLDVYRKTIKSDGIVGLYRGFTISCVGIIVYRGLYFGIYDSLKPLVL  283

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYK S+ AF+QI + E
Sbjct  284  VGNLQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKGSLDAFSQITKRE  343

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ++VF
Sbjct  344  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLVVF  377



>gb|ACU24185.1| unknown [Glycine max]
Length=367

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  144  QALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  203

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  204  KAAKKGGERQFNGLIDVYRKTIKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  263

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRR MMMTSGEAVKYKSS+ AF  I+  E
Sbjct  264  VGGLQDSFFASFLLGWGITIGAGLASYPIDTVRRGMMMTSGEAVKYKSSLEAFKIIVAKE  323

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKG GANILRAVAGAGVLAGYDKLQ+++F
Sbjct  324  GTKSLFKGTGANILRAVAGAGVLAGYDKLQLVLF  357



>gb|AGZ15396.1| ADP, ATP carrier-like protein [Phaseolus vulgaris]
Length=367

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KD+DGYW+WFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  144  QALNFAFKDYFKRLFNFKKDKDGYWEWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  203

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVYRKT+  DG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPV+L
Sbjct  204  KAAKKGGERQFNGLVDVYRKTIKFDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVL  263

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G LQDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYKSS+ AF  I+  E
Sbjct  264  VGGLQDSFFASFFLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKSSLEAFKIIIAKE  323

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            G KSLFKGAGANILRAVAGAGVLAGYDKLQ+IV 
Sbjct  324  GTKSLFKGAGANILRAVAGAGVLAGYDKLQLIVL  357



>ref|XP_008342894.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Malus domestica]
 ref|XP_008362445.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Malus 
domestica]
 ref|XP_008368648.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Malus 
domestica]
Length=380

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 187/214 (87%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QA NFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSLLFVYSLD+ARTRLANDA
Sbjct  157  QAFNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLLFVYSLDFARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNIS VGIIVYRGLYFGMYDSLKPV+L
Sbjct  217  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISLVGIIVYRGLYFGMYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG LQDSFFASF LGW IT GAGL+SYP+DTVRRRMMMTSGEAVKY SS  AF QI++NE
Sbjct  277  TGGLQDSFFASFVLGWGITIGAGLSSYPLDTVRRRMMMTSGEAVKYSSSFDAFKQIIKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+++ 
Sbjct  337  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVVLL  370



>ref|XP_003597438.1| ADP,ATP carrier protein [Medicago truncatula]
 gb|AES67689.1| ADP/ATP carrier protein [Medicago truncatula]
Length=362

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 203/223 (91%), Gaps = 0/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QA NFAFKDYFK+LFNF+++RDGYWK FAGN+ASG AAGASS +FVYSLDYARTRLA+DA
Sbjct  140  QAFNFAFKDYFKKLFNFKQERDGYWKVFAGNIASGAAAGASSSIFVYSLDYARTRLASDA  199

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            K+ K GG RQFNGL+DVY+KTL SDG+AGLYRGFN+S VGIIVYRGLYFG+YDSLKPVLL
Sbjct  200  KSTKKGGERQFNGLIDVYKKTLQSDGIAGLYRGFNVSVVGIIVYRGLYFGLYDSLKPVLL  259

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G+ QDSF ASFALGW +T GA +ASYP+DTVRRRMMMTSGEAVKYKSS+ AF+QI++ E
Sbjct  260  VGTFQDSFLASFALGWAVTVGASVASYPLDTVRRRMMMTSGEAVKYKSSLDAFSQIVKTE  319

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            G KSLFKGAGANILRAVAGAGVLA YDKLQ+++ GKK+GSGGA
Sbjct  320  GPKSLFKGAGANILRAVAGAGVLASYDKLQVLMLGKKFGSGGA  362



>emb|CDX85645.1| BnaA02g01680D [Brassica napus]
Length=696

 Score =   338 bits (867),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 208/221 (94%), Gaps = 1/221 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+KDRDGYWKWFAGNL SGGAAGASSLLFVYSLDYARTRLAND+
Sbjct  159  QALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLGSGGAAGASSLLFVYSLDYARTRLANDS  218

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNISCVGIIVYRGLYFG+YDSLKP LL
Sbjct  219  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKP-LL  277

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
               LQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSM AF QIL+ E
Sbjct  278  PADLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDAFQQILKKE  337

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSG  249
            G KSLFKGAGANILRA+AGAGVL+GYDKLQ+++ GKKYGSG
Sbjct  338  GPKSLFKGAGANILRAIAGAGVLSGYDKLQLLLLGKKYGSG  378



>gb|ABV25603.1| putative mitochondrial ADP/ATP translocase [Marchantia polymorpha]
Length=388

 Score =   328 bits (841),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFK+LF ++KD+DGYW WFAGNLASGGAAGASSL FVYSLDYARTRLANDA
Sbjct  165  QALNFAFKDYFKKLFGYKKDKDGYWVWFAGNLASGGAAGASSLFFVYSLDYARTRLANDA  224

Query  731  KAAK-GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            K++K GGG RQFNGL+DVYRKTLASDG+AGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL
Sbjct  225  KSSKKGGGDRQFNGLLDVYRKTLASDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  284

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            LTG+L+ +FFASF LGW IT GAGLASYPIDTVRRRMMMTSGEA KY SS  AF +I+  
Sbjct  285  LTGNLEGNFFASFMLGWGITIGAGLASYPIDTVRRRMMMTSGEATKYSSSAAAFREIIAK  344

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGG  246
            EG KSLFKGAGANILRAVAGAGVL+GYD+LQM+  GKKY  GG
Sbjct  345  EGTKSLFKGAGANILRAVAGAGVLSGYDQLQMLFLGKKYSGGG  387



>ref|XP_009336233.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Pyrus x 
bretschneideri]
 ref|XP_009336234.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Pyrus x 
bretschneideri]
Length=380

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QA NFAFKDYFKRLFNF+KD+DGYWKWFAGNLASGGAAGASSL+FVYSLD+ARTRLANDA
Sbjct  157  QAFNFAFKDYFKRLFNFKKDKDGYWKWFAGNLASGGAAGASSLIFVYSLDFARTRLANDA  216

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGLVDVY+KTL SDG+AGLYRGFNIS VGIIVYRGLYFGMYDSLKPV+L
Sbjct  217  KAAKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISLVGIIVYRGLYFGMYDSLKPVVL  276

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
            TG L+DSFFASF LGW IT GAGLASYP+DTVRRRMMMTSGEAVKY SS  AF QI++NE
Sbjct  277  TGGLRDSFFASFFLGWGITIGAGLASYPLDTVRRRMMMTSGEAVKYNSSWDAFKQIIKNE  336

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGAGVLAGYDKLQ+++ 
Sbjct  337  GAKSLFKGAGANILRAVAGAGVLAGYDKLQVVLL  370



>ref|XP_001695177.1| adenine nucleotide translocator [Chlamydomonas reinhardtii]
 sp|P27080.1|ADT_CHLRE RecName: Full=ADP,ATP carrier protein; AltName: Full=ADP/ATP 
translocase; AltName: Full=Adenine nucleotide translocator; 
Short=ANT [Chlamydomonas reinhardtii]
 emb|CAA46311.1| mitochondrial ADP/ATP translocator protein [Chlamydomonas reinhardtii]
 gb|EDP01885.1| adenine nucleotide translocator [Chlamydomonas reinhardtii]
 prf||1912294A ADP/ATP translocator
Length=308

 Score =   324 bits (830),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 182/224 (81%), Positives = 201/224 (90%), Gaps = 2/224 (1%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD FKR+F F KD++ YWKWFAGN+ASGGAAGA SL FVYSLDYARTRLANDA
Sbjct  86   QALNFAFKDKFKRMFGFNKDKE-YWKWFAGNMASGGAAGAVSLSFVYSLDYARTRLANDA  144

Query  731  KAAK-GGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVL  555
            K+AK GGG RQFNGLVDVYRKT+ASDG+AGLYRGFNISCVGI+VYRGLYFGMYDSLKPV+
Sbjct  145  KSAKKGGGDRQFNGLVDVYRKTIASDGIAGLYRGFNISCVGIVVYRGLYFGMYDSLKPVV  204

Query  554  LTGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQN  375
            L G L ++F A+F LGW IT GAGLASYPIDT+RRRMMMTSG AVKY SS H F +I++N
Sbjct  205  LVGPLANNFLAAFLLGWGITIGAGLASYPIDTIRRRMMMTSGSAVKYNSSFHCFQEIVKN  264

Query  374  EGAKSLFKGAGANILRavagagvlaGYDKLQMIVFGKKYGSGGA  243
            EG KSLFKGAGANILRAVAGAGVLAGYD+LQ+I+ GKKYGSG A
Sbjct  265  EGMKSLFKGAGANILRAVAGAGVLAGYDQLQVILLGKKYGSGEA  308



>ref|XP_009759659.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009759660.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X1 [Nicotiana sylvestris]
Length=392

 Score =   326 bits (835),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 200/219 (91%), Gaps = 5/219 (2%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKDYFKRLFNF+K+RDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA
Sbjct  164  QALNFAFKDYFKRLFNFKKERDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDA  223

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            KAAK GG RQFNGL+DVYRKT+ SDG+ GLYRGF ISCVGIIVYRGLYFG+YDSLKP++L
Sbjct  224  KAAKKGGERQFNGLLDVYRKTIKSDGIVGLYRGFTISCVGIIVYRGLYFGIYDSLKPLVL  283

Query  551  TGSL-----QDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQ  387
             G+L     QDSFFASF LGW IT GAGLASYPIDTVRRRMMMTSGEAVKYK S+ AF+Q
Sbjct  284  VGNLQFWCSQDSFFASFLLGWGITIGAGLASYPIDTVRRRMMMTSGEAVKYKGSLDAFSQ  343

Query  386  ILQNEGAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            I + EG KSLFKGAGANILRAVAGAGVLAGYDKLQ++VF
Sbjct  344  ITKREGTKSLFKGAGANILRAVAGAGVLAGYDKLQLVVF  382



>gb|KCW89548.1| hypothetical protein EUGRSUZ_A01833 [Eucalyptus grandis]
Length=343

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 194/214 (91%), Gaps = 6/214 (3%)
 Frame = -1

Query  911  QALNFAFKDYFKRLFNFRKDRDGYWKWFAGNlasggaagasslLFVYSLDYARTRLANDA  732
            QALNFAFKD+FKR+FNF+K+RDGYWKWFAGNLASGGAAGA+SLLFVYSLDYARTRLANDA
Sbjct  126  QALNFAFKDHFKRMFNFKKERDGYWKWFAGNLASGGAAGATSLLFVYSLDYARTRLANDA  185

Query  731  KAAKGGGSRQFNGLVDVYRKTLASDGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLL  552
            K AK GG RQFNGL+DVY+KTL SDG+AGLYRGF +SCVGIIVYRGLYFG+YDSLKPV+L
Sbjct  186  KVAKLGGERQFNGLIDVYKKTLKSDGIAGLYRGFTVSCVGIIVYRGLYFGLYDSLKPVVL  245

Query  551  TGSLQDSFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMHAFTQILQNE  372
             G +QDSF ASF LGW +T GAGLASYPIDTVRRRMMMTSGEAVKY++S+ AF QI++ E
Sbjct  246  VGKMQDSFIASFLLGWAVTIGAGLASYPIDTVRRRMMMTSGEAVKYRNSIDAFQQIIEKE  305

Query  371  GAKSLFKGAGANILRavagagvlaGYDKLQMIVF  270
            GAKSLFKGAGANILRAVAGA      DKLQ+++F
Sbjct  306  GAKSLFKGAGANILRAVAGA------DKLQLLLF  333



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1887598073020