BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8241_g1_i1 len=577 path=[2331:0-576]

Length=577
                                                                      Score     E

ref|XP_010246934.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    226   7e-69   
ref|XP_010102327.1|  ADP,ATP carrier protein                            224   4e-68   
ref|XP_010257291.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    221   8e-67   
ref|XP_008795699.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    220   2e-66   
ref|XP_002279748.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    218   1e-65   Vitis vinifera
ref|XP_009355177.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    216   4e-65   
gb|EYU46271.1|  hypothetical protein MIMGU_mgv1a0080301mg               209   5e-65   
ref|XP_004291800.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    216   6e-65   
ref|XP_006446100.1|  hypothetical protein CICLE_v10017600mg             215   1e-64   
ref|XP_006470591.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    213   7e-64   
gb|AFX72760.1|  ATP/ADP carrier protein                                 213   9e-64   
ref|XP_009381664.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    213   2e-63   
ref|XP_007211408.1|  hypothetical protein PRUPE_ppa006913mg             212   3e-63   
gb|KDP22076.1|  hypothetical protein JCGZ_25907                         211   3e-63   
ref|XP_008227151.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    211   3e-63   
ref|XP_002285503.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    211   5e-63   Vitis vinifera
ref|XP_011090371.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    211   6e-63   
ref|XP_009391811.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    211   6e-63   
ref|XP_002303893.1|  hypothetical protein POPTR_0003s20360g             209   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006399841.1|  hypothetical protein EUTSA_v10013800mg             208   3e-62   
gb|KHG00455.1|  ADP,ATP carrier 1, mitochondrial                        209   3e-62   
ref|XP_009415408.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    209   4e-62   
ref|XP_009590575.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    209   4e-62   
ref|XP_006399842.1|  hypothetical protein EUTSA_v10013800mg             208   4e-62   
ref|XP_011042099.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    208   6e-62   
ref|XP_010067876.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    208   6e-62   
ref|XP_010928866.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    208   7e-62   
ref|XP_002513476.1|  ADP,ATP carrier protein, putative                  208   8e-62   Ricinus communis
ref|XP_006287927.1|  hypothetical protein CARUB_v10001162mg             208   8e-62   
sp|P27081.1|ADT2_SOLTU  RecName: Full=ADP,ATP carrier protein, mi...    207   9e-62   Solanum tuberosum [potatoes]
ref|XP_010313215.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    207   9e-62   
ref|XP_009760860.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    209   1e-61   
ref|XP_010913169.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    207   1e-61   
gb|KCW66116.1|  hypothetical protein EUGRSUZ_G03388                     209   1e-61   
sp|O22342.1|ADT1_GOSHI  RecName: Full=ADP,ATP carrier protein 1, ...    207   1e-61   Gossypium hirsutum [American cotton]
ref|XP_010462544.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    207   2e-61   
ref|XP_009590576.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    207   2e-61   
ref|NP_196853.1|  ADP/ATP carrier protein 2                             207   2e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CAA48579.1|  adenosine nucleotide translocator                      206   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009773874.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    206   2e-61   
ref|XP_010928502.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    207   3e-61   
ref|XP_007052542.1|  ADP/ATP carrier 2                                  209   3e-61   
ref|XP_006399840.1|  hypothetical protein EUTSA_v10013800mg             204   3e-61   
prf||1908224A  nucleotide translocator                                  206   4e-61
ref|NP_001275490.1|  ADP,ATP carrier protein, mitochondrial             206   4e-61   
ref|XP_009768570.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    206   4e-61   
ref|XP_006345460.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    206   4e-61   
ref|XP_002871570.1|  hypothetical protein ARALYDRAFT_488169             206   5e-61   
ref|XP_010453428.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    206   5e-61   
ref|XP_006407762.1|  hypothetical protein EUTSA_v10020919mg             206   5e-61   
ref|XP_008372658.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    206   6e-61   
ref|XP_002299232.1|  hypothetical protein POPTR_0001s05690g             206   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010492107.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    206   6e-61   
ref|XP_010913950.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    205   8e-61   
ref|XP_009628854.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    205   9e-61   
ref|XP_009774739.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    205   1e-60   
gb|ACU17667.1|  unknown                                                 199   1e-60   Glycine max [soybeans]
gb|KDO83393.1|  hypothetical protein CISIN_1g016015mg                   202   1e-60   
ref|XP_011080275.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    204   2e-60   
ref|XP_008782907.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    204   2e-60   
ref|XP_009375063.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    204   2e-60   
ref|XP_006297905.1|  hypothetical protein CARUB_v10013947mg             204   2e-60   
ref|XP_009624983.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    204   3e-60   
ref|NP_187470.1|  ADP,ATP carrier protein 1                             203   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391889.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    203   4e-60   
ref|XP_003543539.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    203   5e-60   
ref|XP_006439128.1|  hypothetical protein CICLE_v10033595mg             203   6e-60   
ref|XP_010557791.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    203   6e-60   
gb|KDO83390.1|  hypothetical protein CISIN_1g016015mg                   203   6e-60   
ref|XP_010419930.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    203   6e-60   
ref|XP_009593341.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    203   7e-60   
ref|XP_008798767.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    203   7e-60   
ref|NP_001275285.1|  ADP,ATP carrier protein, mitochondrial             202   7e-60   
ref|XP_002884685.1|  adenosine nucleotide translocator                  202   9e-60   
gb|KDO83389.1|  hypothetical protein CISIN_1g016015mg                   202   1e-59   
ref|XP_003531442.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    202   1e-59   
emb|CDY09801.1|  BnaC09g43600D                                          202   1e-59   
gb|KHN30132.1|  ADP,ATP carrier protein, mitochondrial                  202   1e-59   
ref|XP_002531911.1|  ADP,ATP carrier protein, putative                  202   2e-59   Ricinus communis
ref|XP_004229620.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    201   2e-59   
sp|P25083.1|ADT1_SOLTU  RecName: Full=ADP,ATP carrier protein, mi...    202   2e-59   Solanum tuberosum [potatoes]
ref|XP_011037819.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    202   2e-59   
emb|CAA05979.1|  adenine nucleotide translocator                        202   2e-59   Lupinus albus
ref|XP_008813282.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    201   2e-59   
ref|NP_001234018.1|  ADP/ATP translocator                               201   2e-59   
ref|XP_010489717.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    199   3e-59   
ref|XP_010464465.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    200   4e-59   
gb|ABB55387.1|  ADP,ATP carrier protein precursor-like                  201   4e-59   Solanum tuberosum [potatoes]
dbj|BAH56914.1|  AT3G08580                                              193   6e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CAA46518.1|  adenylate translocator                                 200   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004513729.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    200   8e-59   
ref|XP_010547255.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    200   9e-59   
gb|KHG01208.1|  ADP,ATP carrier 3, mitochondrial -like protein          199   1e-58   
gb|KHN39926.1|  ADP,ATP carrier protein 1, mitochondrial                199   2e-58   
ref|XP_010260254.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    198   3e-58   
emb|CDX78525.1|  BnaA03g04370D                                          197   6e-58   
ref|XP_007014994.1|  ADP/ATP carrier 2 isoform 1                        198   6e-58   
emb|CDX69638.1|  BnaA10g19870D                                          197   6e-58   
ref|NP_001276257.1|  ADP,ATP carrier protein 1, mitochondrial-like      197   7e-58   
emb|CDX70507.1|  BnaC03g05910D                                          197   8e-58   
ref|XP_007148866.1|  hypothetical protein PHAVU_005G020700g             197   9e-58   
emb|CDX91117.1|  BnaC02g04800D                                          196   2e-57   
emb|CAN81107.1|  hypothetical protein VITISV_008170                     196   2e-57   Vitis vinifera
ref|XP_009131345.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    196   3e-57   
gb|KEH33219.1|  ADP/ATP carrier protein                                 196   4e-57   
gb|KEH33218.1|  ADP/ATP carrier protein                                 196   4e-57   
ref|XP_004306529.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    195   8e-57   
ref|XP_002517886.1|  ADP,ATP carrier protein, putative                  194   1e-56   Ricinus communis
ref|XP_007043627.1|  ADP/ATP carrier 3 isoform 1                        193   4e-56   
ref|XP_009336233.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    192   8e-56   
ref|XP_009121762.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    192   9e-56   
dbj|BAD91181.1|  putative mitochondrial adenylate transporter           192   9e-56   Mesembryanthemum crystallinum
ref|XP_008342894.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    192   1e-55   
ref|XP_008346928.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    192   1e-55   
ref|XP_004306530.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    192   1e-55   
ref|XP_009354735.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    192   1e-55   
ref|XP_008375169.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    192   1e-55   
ref|XP_008346927.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    191   1e-55   
ref|XP_011011044.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    191   2e-55   
ref|XP_007218125.1|  hypothetical protein PRUPE_ppa007062mg             191   2e-55   
ref|XP_003542855.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    191   2e-55   
ref|XP_010534246.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    191   3e-55   
emb|CDX85645.1|  BnaA02g01680D                                          196   3e-55   
ref|XP_008375168.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    191   4e-55   
ref|XP_009354733.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    190   5e-55   
emb|CAG17934.1|  adenosine nucleotide translocator                      188   5e-55   Brassica oleracea var. viridis [collards]
ref|XP_010272403.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    190   6e-55   
ref|XP_010268073.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    189   7e-55   
ref|XP_008455276.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    189   9e-55   
ref|XP_010272402.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    189   1e-54   
ref|XP_004303109.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    189   1e-54   
ref|XP_010091485.1|  ADP,ATP carrier protein 3                          188   2e-54   
ref|XP_002299948.1|  adenine nucleotide translocator family protein     189   2e-54   Populus trichocarpa [western balsam poplar]
ref|NP_001241092.1|  uncharacterized protein LOC100802974               188   2e-54   
ref|XP_004173083.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    185   3e-54   
ref|XP_004136845.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    188   3e-54   
dbj|BAE71236.1|  putative ADP,ATP carrier-like protein                  187   3e-54   Trifolium pratense [peavine clover]
gb|KDP24106.1|  hypothetical protein JCGZ_25763                         188   3e-54   
gb|EPS71896.1|  hypothetical protein M569_02862                         186   4e-54   
ref|XP_008381597.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    187   4e-54   
gb|KDP43465.1|  hypothetical protein JCGZ_16752                         187   5e-54   
ref|XP_011047661.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    187   5e-54   
ref|XP_006412961.1|  hypothetical protein EUTSA_v10025467mg             187   6e-54   
gb|ADN33719.1|  adenine nucleotide translocator                         187   6e-54   
ref|XP_002310404.2|  hypothetical protein POPTR_0007s01010g             187   6e-54   Populus trichocarpa [western balsam poplar]
gb|ABK24587.1|  unknown                                                 187   6e-54   Picea sitchensis
gb|ADN33720.1|  adenine nucleotide translocator                         187   7e-54   
ref|XP_006372724.1|  ADP/ATP CARRIER 3 family protein                   187   8e-54   
ref|XP_010673613.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    186   1e-53   
ref|XP_007133838.1|  hypothetical protein PHAVU_011G213200g             186   2e-53   
ref|XP_002513475.1|  ADP,ATP carrier protein, putative                  186   2e-53   Ricinus communis
ref|XP_006282649.1|  hypothetical protein CARUB_v10005047mg             186   2e-53   
ref|XP_011025426.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    186   2e-53   
ref|XP_002867450.1|  hypothetical protein ARALYDRAFT_491934             186   3e-53   
ref|NP_001150672.1|  LOC100284305                                       185   3e-53   Zea mays [maize]
ref|XP_002468591.1|  hypothetical protein SORBIDRAFT_01g048660          185   3e-53   Sorghum bicolor [broomcorn]
ref|XP_007198831.1|  hypothetical protein PRUPE_ppa007166mg             185   4e-53   
ref|XP_004142870.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    185   4e-53   
ref|XP_010259400.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    185   4e-53   
gb|KHN01114.1|  ADP,ATP carrier protein 3, mitochondrial                185   4e-53   
emb|CDX97439.1|  BnaC08g13040D                                          184   6e-53   
ref|XP_004985877.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    184   6e-53   
ref|XP_004505560.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    184   7e-53   
ref|XP_006855242.1|  hypothetical protein AMTR_s00183p00019870          185   8e-53   
dbj|BAE71194.1|  putative ADP ATP carrier protein                       184   8e-53   Trifolium pratense [peavine clover]
ref|XP_010235895.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    184   8e-53   
ref|XP_004156402.1|  PREDICTED: LOW QUALITY PROTEIN: ADP,ATP carr...    181   8e-53   
gb|ACU21147.1|  unknown                                                 179   1e-52   Glycine max [soybeans]
ref|XP_003543333.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    183   1e-52   
ref|XP_008229069.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    184   1e-52   
ref|XP_011100347.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    184   1e-52   
ref|XP_004510962.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    183   1e-52   
ref|XP_010526510.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    183   2e-52   
ref|XP_010555114.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    184   2e-52   
ref|XP_010035773.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    183   2e-52   
ref|NP_194568.1|  ADP/ATP carrier 3 protein                             183   2e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CAA33743.1|  adenine nucleotide translocator                        183   3e-52   Zea mays [maize]
ref|NP_001105434.1|  ADP,ATP carrier protein 2, mitochondrial pre...    183   3e-52   Zea mays [maize]
ref|XP_007149829.1|  hypothetical protein PHAVU_005G102000g             182   4e-52   
ref|XP_004953705.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    182   4e-52   
gb|AGZ15404.1|  ADP, ATP carrier 3 protein                              182   4e-52   
gb|AGZ15396.1|  ADP, ATP carrier-like protein                           182   4e-52   
ref|XP_010555116.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    182   5e-52   
ref|NP_001047941.1|  Os02g0718900                                       182   5e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006379099.1|  ADP family protein                                 182   5e-52   
gb|KGN62492.1|  hypothetical protein Csa_2G356660                       182   5e-52   
ref|NP_001055139.1|  Os05g0302700                                       182   6e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004142869.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    182   6e-52   
ref|XP_006654224.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    182   7e-52   
gb|EEC73899.1|  hypothetical protein OsI_08713                          182   7e-52   Oryza sativa Indica Group [Indian rice]
gb|ACU24302.1|  unknown                                                 181   8e-52   Glycine max [soybeans]
ref|XP_006447271.1|  hypothetical protein CICLE_v10015260mg             181   1e-51   
ref|NP_001105431.1|  ADP,ATP carrier protein 1, mitochondrial pre...    181   2e-51   Zea mays [maize]
gb|AFW63697.1|  adenine nucleotide translocator2                        182   2e-51   
ref|XP_009109094.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    181   2e-51   
gb|KDO42766.1|  hypothetical protein CISIN_1g016996mg                   180   3e-51   
ref|XP_003539937.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    180   3e-51   
ref|XP_004985876.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    180   3e-51   
ref|XP_003540370.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    180   3e-51   
gb|ACU24185.1|  unknown                                                 180   3e-51   Azolla caroliniana
ref|XP_010438469.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    180   3e-51   
gb|AFW63698.1|  adenine nucleotide translocator2                        181   3e-51   
gb|ABV25603.1|  putative mitochondrial ADP/ATP translocase              180   3e-51   
ref|XP_006447270.1|  hypothetical protein CICLE_v10015260mg             181   5e-51   
ref|XP_010447988.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    179   5e-51   
gb|AAM65696.1|  ADP,ATP carrier-like protein                            179   6e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAA33742.1|  adenine nucleotide translocator                        179   7e-51   Zea mays [maize]
gb|KEH30700.1|  ADP/ATP carrier protein                                 179   7e-51   
ref|XP_010433228.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    179   1e-50   
ref|XP_009397774.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    178   2e-50   
ref|XP_008677790.1|  PREDICTED: ADP,ATP carrier protein 2, mitoch...    181   2e-50   
gb|ACJ84706.1|  unknown                                                 177   4e-50   Medicago truncatula
ref|XP_006849411.1|  hypothetical protein AMTR_s00160p00071720          177   4e-50   
ref|XP_008231276.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    177   4e-50   
ref|XP_006647801.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    177   5e-50   
ref|XP_007150379.1|  hypothetical protein PHAVU_005G148300g             177   6e-50   
gb|EMT17760.1|  ADP,ATP carrier protein, mitochondrial                  177   7e-50   
gb|EMS54584.1|  ADP,ATP carrier protein, mitochondrial                  176   7e-50   
gb|AFK44525.1|  unknown                                                 176   1e-49   
emb|CAA56325.1|  ATP/ADP carrier protein                                174   1e-49   Triticum turgidum [cone wheat]
dbj|BAJ99879.1|  predicted protein                                      176   1e-49   
gb|EMS49632.1|  ADP,ATP carrier protein, mitochondrial                  176   2e-49   
ref|XP_010943967.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    176   2e-49   
sp|Q41630.1|ADT2_WHEAT  RecName: Full=ADP,ATP carrier protein 2, ...    174   2e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003627715.1|  ADP,ATP carrier protein                            176   2e-49   
ref|XP_007132806.1|  hypothetical protein PHAVU_011G126000g             175   2e-49   
gb|AFW73141.1|  hypothetical protein ZEAMMB73_486171                    168   3e-49   
gb|EPS69506.1|  hypothetical protein M569_05258                         175   4e-49   
ref|XP_010689049.1|  PREDICTED: ADP,ATP carrier protein                 175   4e-49   
sp|Q41629.1|ADT1_WHEAT  RecName: Full=ADP,ATP carrier protein 1, ...    173   4e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008810549.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    174   5e-49   
gb|AFW73142.1|  adenine nucleotide translocator, mRNA                   173   5e-49   
dbj|BAJ98173.1|  predicted protein                                      174   8e-49   
ref|XP_006366306.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    173   1e-48   
gb|EMT13243.1|  ADP,ATP carrier protein, mitochondrial                  172   2e-48   
ref|XP_009606916.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    172   3e-48   
emb|CAA26600.1|  unnamed protein product                                170   5e-48   Zea mays [maize]
ref|XP_009781621.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    172   5e-48   
ref|XP_001779965.1|  predicted protein                                  169   8e-48   
ref|XP_001764599.1|  predicted protein                                  169   1e-47   
ref|XP_008789809.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    170   2e-47   
ref|XP_001784997.1|  predicted protein                                  168   2e-47   
ref|XP_006367480.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    169   4e-47   
ref|XP_004243366.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    169   4e-47   
emb|CAN66307.1|  hypothetical protein VITISV_009087                     169   5e-47   Vitis vinifera
emb|CDP14814.1|  unnamed protein product                                169   9e-47   
ref|XP_010656992.1|  PREDICTED: ADP,ATP carrier protein 3, mitoch...    168   9e-47   
ref|XP_009759661.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    168   2e-46   
ref|XP_009759659.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    168   2e-46   
ref|XP_002982134.1|  hypothetical protein SELMODRAFT_115674             165   2e-45   
gb|EYU42134.1|  hypothetical protein MIMGU_mgv1a019964mg                165   2e-45   
emb|CDH59498.1|  carrier protein mitochondrial-like                     162   5e-45   
emb|CDP14815.1|  unnamed protein product                                163   5e-45   
emb|CEG81787.1|  Putative ADP,ATP carrier protein                       161   1e-44   
ref|XP_002789451.1|  ADP/ATP carrier protein                            161   1e-44   Paracoccidioides lutzii Pb01
emb|CEG78726.1|  Putative ADP,ATP carrier protein                       160   2e-44   
ref|XP_010756915.1|  ADP,ATP carrier protein                            160   2e-44   
emb|CEI97194.1|  Putative ADP,ATP carrier protein, mitochondrial        160   2e-44   
ref|XP_006960748.1|  mitochondrial carrier                              160   3e-44   
emb|CEJ01906.1|  Putative ADP,ATP carrier protein, mitochondrial        159   4e-44   
gb|EPB91116.1|  ADP,ATP carrier protein, mitochondrial                  159   4e-44   
emb|CEG72703.1|  Putative ADP,ATP carrier protein, mitochondrial        159   6e-44   
ref|XP_002978864.1|  hypothetical protein SELMODRAFT_109762             160   8e-44   
ref|XP_009265996.1|  ADP,ATP carrier protein                            159   8e-44   
gb|EEH05039.1|  ADP,ATP carrier protein                                 159   1e-43   Histoplasma capsulatum G186AR
ref|XP_001538678.1|  ADP/ATP carrier protein                            159   1e-43   Histoplasma capsulatum NAm1
ref|XP_002438320.1|  hypothetical protein SORBIDRAFT_10g012150          159   1e-43   Sorghum bicolor [broomcorn]
ref|XP_002625109.1|  ADP/ATP carrier protein                            158   2e-43   Blastomyces gilchristii SLH14081
emb|CDO71638.1|  hypothetical protein BN946_scf184911.g108              158   2e-43   
gb|EGC41068.1|  ADP,ATP carrier protein                                 158   2e-43   
ref|XP_010052091.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    160   2e-43   
gb|EIE78757.1|  ADP,ATP carrier protein                                 157   2e-43   
emb|CCA69136.1|  probable ADP, ATP carrier protein (ADP/ATP trans...    158   2e-43   
ref|XP_007920298.1|  hypothetical protein MYCFIDRAFT_70408              158   3e-43   
ref|XP_009540389.1|  mitochondrial carrier protein                      157   3e-43   
gb|ACN60125.1|  ATP:ADP antiporter                                      157   3e-43   Serendipita indica
ref|XP_004486958.1|  PREDICTED: ADP,ATP carrier protein, mitochon...    159   3e-43   
ref|XP_007360270.1|  eukaryotic ADP/ATP carrier                         157   3e-43   
emb|CCL99023.1|  predicted protein                                      157   3e-43   
emb|CDS10290.1|  Putative ADP,ATP carrier protein,mitochondrial         157   4e-43   
gb|KEQ67555.1|  ADP,ATP carrier protein                                 157   4e-43   
gb|ABB72848.1|  eukaryotic ADP/ATP carrier                              157   4e-43   
emb|CDH59556.1|  carrier protein                                        157   5e-43   
emb|CDH53267.1|  carrier protein                                        157   5e-43   
gb|KEQ77702.1|  mitochondrial carrier                                   157   5e-43   
emb|CDS05938.1|  Putative ADP,ATP carrier protein 1,mitochondrial       157   6e-43   
gb|KEQ93767.1|  hypothetical protein AUEXF2481DRAFT_47440               157   6e-43   
emb|CDP07763.1|  unnamed protein product                                156   6e-43   
gb|KEQ81602.1|  ADP,ATP carrier protein-like protein                    157   6e-43   
ref|XP_757066.1|  hypothetical protein UM00919.1                        157   7e-43   
emb|CCO26701.1|  ADP,ATP carrier protein AltName: Full=ADP/ATP tr...    156   7e-43   
ref|XP_007880726.1|  hypothetical protein PFL1_05006                    156   8e-43   
emb|CDH55575.1|  atp adp translocator                                   156   8e-43   
gb|EST10154.1|  mitochondrial ADP/ATP carrier protein                   156   8e-43   
ref|XP_008032171.1|  mitochondrial carrier                              156   8e-43   
dbj|GAC99025.1|  hypothetical protein PHSY_006622                       156   1e-42   
dbj|GAK62800.1|  mitochondrial carrier                                  156   1e-42   
dbj|GAC72869.1|  mitochondrial ADP/ATP carrier proteins                 156   1e-42   
ref|XP_007860988.1|  mitochondrial carrier                              156   1e-42   
gb|KEP54249.1|  putative ADP, ATP carrier (ADP/ATP translocase) p...    156   1e-42   
ref|XP_568408.1|  hypothetical protein CNM01090                         156   1e-42   
emb|CCF54849.1|  probable ADP, ATP carrier protein (ADP/ATP trans...    156   1e-42   
gb|EUC53792.1|  ADP, ATP carrier (ADP/ATP translocase) protein, p...    156   1e-42   
ref|XP_007336426.1|  eukaryotic ADP/ATP carrier                         155   1e-42   
ref|XP_007390541.1|  hypothetical protein PHACADRAFT_247486             155   2e-42   
ref|XP_007873150.1|  hypothetical protein PNEG_01231                    155   2e-42   
emb|CBQ70311.1|  probable ADP, ATP carrier protein (ADP/ATP trans...    155   2e-42   
emb|CBI16399.3|  unnamed protein product                                155   2e-42   
gb|EPB81662.1|  ADP,ATP carrier protein 1, mitochondrial                155   2e-42   
ref|XP_007378717.1|  eukaryotic ADP/ATP carrier                         155   2e-42   
ref|XP_007727161.1|  ADP,ATP carrier protein                            155   2e-42   
ref|XP_007842778.1|  hypothetical protein Moror_17205                   155   2e-42   
emb|CDI51828.1|  probable ADP, ATP carrier protein (ADP/ATP trans...    155   2e-42   
ref|XP_008023978.1|  hypothetical protein SETTUDRAFT_107517             155   3e-42   
ref|XP_001934086.1|  ADP/ATP carrier protein                            155   3e-42   
ref|XP_003197279.1|  ADP,ATP carrier protein 2, mitochondrial pre...    155   4e-42   
gb|EPT03853.1|  hypothetical protein FOMPIDRAFT_1022048                 154   4e-42   
gb|EMD87278.1|  hypothetical protein COCHEDRAFT_1023464                 154   4e-42   
ref|XP_007689325.1|  hypothetical protein COCMIDRAFT_98907              154   5e-42   
gb|KGB78974.1|  mitochondrial ADP translocase                           154   6e-42   
ref|XP_003840256.1|  similar to ADP,ATP carrier protein                 154   6e-42   
gb|EGD94876.1|  mitochondrial carrier protein                           154   6e-42   
ref|XP_502564.1|  ADP/ATP carrier protein                               154   7e-42   
ref|XP_001244490.1|  ADP/ATP carrier protein                            154   8e-42   
ref|XP_003016213.1|  hypothetical protein ARB_05611                     154   8e-42   
ref|XP_007704022.1|  hypothetical protein COCSADRAFT_29936              154   9e-42   
ref|XP_002850778.1|  ADP/ATP carrier protein                            154   9e-42   
ref|XP_003597438.1|  ADP,ATP carrier protein                            155   1e-41   
ref|XP_008712056.1|  ADP,ATP carrier protein                            154   1e-41   
ref|XP_009156194.1|  ADP,ATP carrier protein                            154   1e-41   
dbj|BAK03012.1|  predicted protein                                      153   1e-41   
ref|XP_001212265.1|  ADP/ATP carrier protein                            153   1e-41   
ref|XP_001398880.1|  ADP/ATP carrier protein                            153   1e-41   
emb|CCX09646.1|  Similar to ADP,ATP carrier protein; acc. no. P02723    153   1e-41   
ref|XP_001816872.1|  ADP/ATP carrier protein                            153   1e-41   
gb|ABB72849.1|  eukaryotic ADP/ATP carrier                              153   1e-41   
ref|XP_011115865.1|  hypothetical protein H072_10403                    153   1e-41   
gb|AFR98326.1|  ADP,ATP carrier protein                                 153   1e-41   
ref|XP_007762462.1|  mitochondrial carrier                              153   1e-41   
gb|ESA16560.1|  hypothetical protein GLOINDRAFT_77245                   153   2e-41   
gb|EMD42117.1|  hypothetical protein CERSUDRAFT_79726                   153   2e-41   
gb|KDQ30847.1|  hypothetical protein PLEOSDRAFT_1062827                 153   2e-41   
gb|EWC48323.1|  ADP,ATP carrier protein                                 153   2e-41   
ref|XP_007325689.1|  hypothetical protein AGABI1DRAFT_110533            153   2e-41   
ref|XP_003856256.1|  hypothetical protein MYCGRDRAFT_65997              153   2e-41   
ref|XP_002173271.1|  adenine nucleotide carrier Anc1                    153   2e-41   
gb|EMG46293.1|  ADP,ATP carrier protein                                 153   2e-41   
ref|XP_006454299.1|  hypothetical protein AGABI2DRAFT_189567            153   2e-41   
gb|KGB78973.1|  ADP/ATP translocase                                     152   2e-41   
ref|XP_003197280.1|  ADP,ATP carrier protein 2, mitochondrial pre...    152   2e-41   
ref|XP_568302.1|  ATP:ADP antiporter                                    152   2e-41   
ref|XP_007298175.1|  ATP:ADP antiporter                                 152   2e-41   
ref|XP_003177001.1|  ADP/ATP carrier protein                            152   2e-41   
ref|XP_002550970.1|  ADP,ATP carrier protein                            152   3e-41   
ref|XP_008350772.1|  PREDICTED: ADP,ATP carrier protein 1, mitoch...    154   3e-41   
ref|XP_003304315.1|  ADP/ATP carrier protein                            153   3e-41   
ref|XP_007585459.1|  putative carrier protein                           152   3e-41   
ref|XP_002837794.1|  ADP/ATP carrier protein                            152   3e-41   
dbj|GAD97782.1|  ADP/ATP carrier protein                                152   4e-41   
emb|CCU98630.1|  unnamed protein product                                152   4e-41   
ref|XP_006962612.1|  predicted protein                                  152   4e-41   
gb|KGK40326.1|  hypothetical protein JL09_g343                          152   4e-41   
ref|XP_007671674.1|  hypothetical protein BAUCODRAFT_28844              152   4e-41   
gb|KCW89548.1|  hypothetical protein EUGRSUZ_A01833                     152   5e-41   
ref|XP_002480550.1|  ADP/ATP carrier protein                            152   5e-41   
gb|ETS04834.1|  mitochondrial carrier                                   152   5e-41   
ref|XP_499953.1|  ADP/ATP carrier protein                               151   5e-41   
emb|CDP20773.1|  unnamed protein product                                151   5e-41   
gb|EKG17016.1|  Mitochondrial carrier protein                           152   6e-41   
ref|XP_001269624.1|  ADP/ATP carrier protein                            152   6e-41   
gb|ERS96583.1|  ADP,ATP carrier protein                                 152   6e-41   
gb|EMF17024.1|  mitochondrial carrier                                   151   6e-41   
ref|XP_002144143.1|  ADP/ATP carrier protein                            151   7e-41   
gb|EIE87421.1|  ADP,ATP carrier protein                                 153   8e-41   
ref|XP_003018775.1|  hypothetical protein TRV_07210                     154   9e-41   
ref|XP_007314385.1|  hypothetical protein SERLADRAFT_458613             151   9e-41   
gb|KEY80366.1|  ADP ATP carrier                                         151   9e-41   
gb|EPE07551.1|  carrier protein                                         151   1e-40   
ref|XP_001265129.1|  ADP/ATP carrier protein                            151   1e-40   
emb|CCO34654.1|  ADP,ATP carrier protein AltName: Full=ADP/ATP tr...    150   1e-40   
ref|XP_716829.1|  potential mitochondrial inner membrane ATP/ADP ...    150   1e-40   
ref|XP_002420364.1|  ADP/ATP carrier protein                            150   1e-40   
gb|KHC66225.1|  ADP,ATP carrier protein                                 150   2e-40   
gb|ACL53828.1|  unknown                                                 151   2e-40   
gb|EFX06704.1|  carnitine acyl carrier                                  150   2e-40   
ref|XP_001524695.1|  ADP,ATP carrier protein                            150   2e-40   
ref|XP_011117860.1|  hypothetical protein AOL_s00006g249                150   2e-40   
gb|KFH64900.1|  ADP,ATP carrier protein 2, mitochondrial                150   2e-40   
ref|XP_001828677.2|  ADP/ATP carrier protein                            150   2e-40   
dbj|GAM39144.1|  adenine nucleotide carrier                             150   2e-40   
ref|NP_001142273.1|  uncharacterized protein LOC100274442               151   2e-40   
ref|XP_002947108.1|  ADP/ATP carrier protein, probably mitochondrial    150   2e-40   
gb|KID76755.1|  ADP,ATP carrier protein                                 150   2e-40   
ref|XP_002562086.1|  mitochondrial ADP/ATP carrier BAC82547-Penic...    150   2e-40   
ref|XP_007265679.1|  mitochondrial carrier                              150   2e-40   
emb|CAB88028.1|  mitochondrial ADP/ATP carrier isoform 2                150   3e-40   
ref|XP_661668.1|  ADT_NEUCR ADP,ATP CARRIER PROTEIN (ADP/ATP TRAN...    150   3e-40   
gb|KHO01863.1|  ADP,ATP carrier protein                                 150   3e-40   
ref|XP_007809984.1|  ADP,ATP carrier protein                            150   3e-40   
ref|XP_007818733.1|  ADP,ATP carrier protein                            150   3e-40   
gb|KEZ46057.1|  hypothetical protein SAPIO_CDS0902                      149   3e-40   
ref|XP_001873172.1|  ADP/ATP carrier protein                            149   3e-40   
ref|XP_001228473.1|  ADP/ATP carrier protein                            149   4e-40   
ref|XP_003037182.1|  ADP/ATP carrier protein                            149   4e-40   
gb|KGO71759.1|  Mitochondrial carrier protein                           149   4e-40   
emb|CDR40724.1|  CYFA0S05e03730g1_1                                     149   5e-40   
ref|XP_007918243.1|  putative carrier protein                           149   5e-40   
ref|XP_003667288.1|  hypothetical protein MYCTH_2316753                 149   5e-40   
gb|EPX75146.1|  adenine nucleotide carrier Anc1                         149   5e-40   
ref|XP_006692040.1|  putative ADP/ATP carrier protein                   149   5e-40   
gb|KDN68011.1|  hypothetical protein CSUB01_07102                       149   5e-40   
gb|KDN42973.1|  hypothetical protein RSAG8_06499                        155   5e-40   
gb|EFQ31604.1|  hypothetical protein GLRG_06893                         149   5e-40   
gb|ESA43738.1|  ADP/ATP carrier protein, variant                        146   5e-40   
gb|EPS27841.1|  hypothetical protein PDE_02785                          149   6e-40   
emb|CDM33775.1|  ADP,ATP carrier protein                                149   6e-40   
gb|KDR84934.1|  hypothetical protein GALMADRAFT_233406                  149   6e-40   
gb|KFY47904.1|  hypothetical protein V496_10397                         149   6e-40   
dbj|BAA13765.1|  unnamed protein product                                149   7e-40   
ref|XP_505633.1|  ADP/ATP carrier protein                               149   7e-40   
gb|KFY05119.1|  hypothetical protein V491_09203                         149   7e-40   
gb|KFY82505.1|  hypothetical protein V500_10500                         149   7e-40   
gb|EME49358.1|  hypothetical protein DOTSEDRAFT_68212                   149   7e-40   
gb|KFZ02147.1|  hypothetical protein V501_09638                         149   7e-40   
ref|XP_001796004.1|  hypothetical protein SNOG_05601                    149   7e-40   
ref|XP_009227205.1|  ADP,ATP carrier protein                            149   8e-40   
gb|AAN11327.1|  ADP-ATP translocase                                     149   8e-40   
gb|KFY73104.1|  hypothetical protein V499_06748                         149   8e-40   
ref|XP_008601894.1|  ADP, ATP carrier protein                           149   8e-40   
emb|CCE26834.1|  probable ADP, ATP carrier protein (ADP/ATP trans...    148   9e-40   
ref|NP_595323.1|  mitochondrial adenine nucleotide carrier Anc1         149   9e-40   
gb|KFY29059.1|  hypothetical protein V493_02581                         148   9e-40   
emb|CBN20772.1|  mitochondrial ADP/ATP translocator protein             148   9e-40   
gb|KFX88669.1|  hypothetical protein O988_08946                         148   9e-40   
gb|KFX85891.1|  hypothetical protein V490_09341                         148   9e-40   
gb|ELR02880.1|  ADP,ATP carrier protein                                 148   1e-39   
gb|EER45111.1|  conserved hypothetical protein                          146   1e-39   
gb|KDR68554.1|  hypothetical protein GALMADRAFT_256815                  148   1e-39   
gb|KFY15533.1|  hypothetical protein V492_01931                         148   1e-39   
emb|CCH41070.1|  ADP,ATP carrier protein 2                              148   1e-39   
ref|XP_006965488.1|  adenine nucleotide translocator                    148   1e-39   
emb|CAB88027.1|  mitochondrial ADP/ATP carrier isoform 1                148   1e-39   
ref|XP_001909827.1|  hypothetical protein                               148   1e-39   
ref|XP_446154.1|  ADP/ATP carrier protein                               148   1e-39   
emb|CEJ79961.1|  Putative ADP, ATP carrier protein                      148   1e-39   
gb|EWG42987.1|  ADP,ATP carrier protein                                 148   1e-39   
ref|XP_002993422.1|  hypothetical protein SELMODRAFT_236748             147   2e-39   
emb|CCH41233.1|  ADP,ATP carrier protein 3                              147   2e-39   
ref|XP_007375229.1|  ADP,ATP carrier protein                            147   2e-39   
ref|XP_001384264.1|  ADP/ATP carrier protein                            147   2e-39   
ref|XP_386197.1|  ADT_NEUCR ADP,ATP CARRIER PROTEIN (ADP/ATP TRAN...    147   2e-39   
emb|CDK26118.1|  unnamed protein product                                147   2e-39   
emb|CDS09719.1|  Putative ADP,ATP carrier protein,mitochondrial         147   2e-39   
gb|AFW86475.1|  hypothetical protein ZEAMMB73_378887                    150   2e-39   
ref|XP_007847547.1|  hypothetical protein Moror_1113                    147   2e-39   
ref|XP_003668164.1|  hypothetical protein NDAI_0A07670                  147   2e-39   
ref|XP_001386347.1|  ADP/ATP carrier protein                            147   2e-39   
ref|XP_003051617.1|  ADP/ATP carrier protein                            147   2e-39   
ref|XP_007835574.1|  ADP/ATP carrier protein                            147   2e-39   
ref|XP_963201.1|  ADP/ATP carrier protein                               147   3e-39   
gb|KDN42611.1|  mitochondrial carrier                                   147   3e-39   
ref|XP_002493614.1|  ADP/ATP carrier protein                            147   3e-39   
gb|AAO32575.1|  PET9                                                    147   3e-39   
ref|XP_009851690.1|  ADP, ATP carrier protein                           147   3e-39   
ref|XP_003351160.1|  ADP/ATP carrier protein                            147   3e-39   
gb|KFH43392.1|  ADP,ATP carrier protein-like protein                    147   3e-39   
ref|XP_001782951.1|  predicted protein                                  147   3e-39   
gb|EGU88025.1|  hypothetical protein FOXB_01508                         147   3e-39   
gb|EHK17881.1|  hypothetical protein TRIVIDRAFT_44655                   147   3e-39   
gb|EWZ02370.1|  ADP,ATP carrier protein                                 147   3e-39   
gb|EMT68221.1|  ADP,ATP carrier protein                                 147   3e-39   
ref|XP_003658188.1|  ADP/ATP carrier protein                            147   3e-39   
ref|XP_459840.1|  ADP/ATP carrier protein                               147   3e-39   
ref|XP_003674027.1|  hypothetical protein NCAS_0A10880                  147   3e-39   
ref|XP_007279251.1|  carrier protein                                    147   3e-39   
emb|CCF36744.1|  ADP,ATP carrier protein                                147   3e-39   
gb|ABA01103.1|  mitochondrial ADP/ATP translocator                      147   4e-39   
ref|XP_002988485.1|  hypothetical protein SELMODRAFT_235544             146   4e-39   
emb|CCT67036.1|  probable ADP, ATP carrier protein (ADP/ATP trans...    147   4e-39   
ref|XP_004338972.1|  adenine nucleotide translocator, putative          147   4e-39   
gb|EKV07561.1|  Mitochondrial ADP,ATP carrier protein (Ant), puta...    147   4e-39   
ref|XP_001695177.1|  adenine nucleotide translocator                    146   4e-39   
emb|CCJ29026.1|  unnamed protein product                                146   5e-39   
ref|XP_007294895.1|  40S ribosomal protein S3aE                         147   5e-39   
gb|KGO47243.1|  Mitochondrial carrier protein                           146   5e-39   
ref|XP_007778749.1|  ADP,ATP carrier protein                            147   5e-39   
ref|XP_454505.1|  ADP/ATP carrier protein                               146   5e-39   
emb|CDO92576.1|  unnamed protein product                                146   5e-39   
emb|CCF32866.1|  ADP,ATP carrier protein                                146   7e-39   
gb|EHK40748.1|  hypothetical protein TRIATDRAFT_301541                  146   8e-39   
gb|EHK15489.1|  hypothetical protein TRIVIDRAFT_80049                   146   9e-39   
dbj|BAC82547.1|  ADP/ATP carrier protein                                148   9e-39   
emb|CDH17331.1|  probable ADP,ATP carrier protein 3                     145   9e-39   
emb|CDF91561.1|  ZYBA0S12-01750g1_1                                     145   1e-38   
ref|XP_003682223.1|  ADP/ATP carrier protein                            145   1e-38   
ref|XP_007799002.1|  putative carrier protein                           145   1e-38   
gb|ENH79007.1|  carrier protein                                         145   1e-38   
gb|KHJ35242.1|  putative adp atp carrier protein                        145   1e-38   
ref|XP_003667940.1|  hypothetical protein NDAI_0A05420                  145   1e-38   
gb|KDQ63527.1|  hypothetical protein JAAARDRAFT_29546                   145   1e-38   



>ref|XP_010246934.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=395

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 133/177 (75%), Gaps = 11/177 (6%)
 Frame = -2

Query  501  MTIDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTN-----S  337
            M  DQPH  TV +KVAG+  L S+    D+Q+    FY+P +  + F +GNY+N     S
Sbjct  1    MMADQPHHPTVLQKVAGQFQLGSSLS-QDVQARNGSFYRPSMYQRRFAYGNYSNGGLQYS  59

Query  336  MLQPRNLSTARSY-----AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERV  172
            + QP + S++        AASP+FVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERV
Sbjct  60   LTQPCSSSSSCDLSMVAPAASPIFVQAPKEKGFTNFAIDFLMGGVSAAVSKTAAAPIERV  119

Query  171  KLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KLLIQNQDEMIKAGRLSEPYKGI DCF RT+ DEGI SLWRGNTANVIRYFPTQALN
Sbjct  120  KLLIQNQDEMIKAGRLSEPYKGITDCFKRTISDEGIASLWRGNTANVIRYFPTQALN  176



>ref|XP_010102327.1| ADP,ATP carrier protein [Morus notabilis]
 gb|EXB93288.1| ADP,ATP carrier protein [Morus notabilis]
Length=388

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRST-THVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTAR--  304
            TV +K AG+LHL S+ +H  D QS    F  P ++ + F +GNY+N+ LQ  + ST    
Sbjct  9    TVMQKFAGQLHLGSSLSH--DAQSRYTGFQGPAIHQRQFAYGNYSNAGLQYPSRSTIDLS  66

Query  303  --SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAG  130
              S A+SPV VQAPSEKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAG
Sbjct  67   MISSASSPVCVQAPSEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAG  126

Query  129  RLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            RLSEPYKGI DCFSRT+KDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  127  RLSEPYKGIGDCFSRTIKDEGVVALWRGNTANVIRYFPTQALN  169



>ref|XP_010257291.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Nelumbo 
nucifera]
Length=393

 Score =   221 bits (563),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 133/175 (76%), Gaps = 9/175 (5%)
 Frame = -2

Query  501  MTIDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ--  328
            M  D+ +  TV +KVAG+LHL S++   D+ +  + FY P L  + F +GNY+N+ LQ  
Sbjct  1    MMADRSNHPTVIQKVAGQLHL-SSSLSQDVSTRSNAFYGPSLYQRRFAYGNYSNAGLQYP  59

Query  327  ---PRNLSTARSY---AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKL  166
               P + S   S    +A P+FVQAP EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKL
Sbjct  60   FVQPCSGSCDLSMVPPSALPIFVQAPKEKGFSGFAIDFLMGGVSAAVSKTAAAPIERVKL  119

Query  165  LIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LIQNQDEMIKAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  120  LIQNQDEMIKAGRLSEPYKGITDCFKRTIKDEGFASLWRGNTANVIRYFPTQALN  174



>ref|XP_008795699.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=391

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 131/172 (76%), Gaps = 10/172 (6%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCF-YQPFLNSKTFKHGNYTNSMLQ-PRN  319
            DQ +  TV +KVAG+ HLRS+    D+Q+ RDC  Y P L  +++  GNY N  LQ P  
Sbjct  3    DQVNHPTVIQKVAGQFHLRSS-FSQDMQA-RDCTSYMPSLYKRSYTTGNYVNGGLQNPLM  60

Query  318  LSTARSYA------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
              ++ SY        SPVF  APSEKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  61   QVSSASYDHPVLTPVSPVFAHAPSEKGFTGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQ  120

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIK GRLSEPYKGI DCF RT++DEG+VSLWRGNTANVIRYFPTQALN
Sbjct  121  NQDEMIKTGRLSEPYKGIGDCFGRTIRDEGLVSLWRGNTANVIRYFPTQALN  172



>ref|XP_002279748.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Vitis vinifera]
Length=385

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 126/170 (74%), Gaps = 10/170 (6%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            IDQP   T+ +KVAG LH     H  ++Q+F   F QP L  +   +GNYTN+ LQ P  
Sbjct  2    IDQPQYPTIMQKVAGHLH-----HSQNIQAFHGRFQQPTLQQRHSAYGNYTNAALQYPMC  56

Query  318  LSTAR----SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
             +T          SPVFV AP EKG  GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  57   GATFDPLMVGSNVSPVFVPAPKEKGLAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ  116

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEMIK GRLSEPYKGI +CFSRT+KDEG +SLWRGNTANVIRYFPTQALN
Sbjct  117  DEMIKTGRLSEPYKGIGECFSRTIKDEGFMSLWRGNTANVIRYFPTQALN  166



>ref|XP_009355177.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009376878.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=383

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 131/170 (77%), Gaps = 14/170 (8%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRNL  316
            D+    T++EK +G+LHL S++H   +Q       +P +N + F +G+Y+N  LQ P N 
Sbjct  3    DRRQHPTITEKFSGQLHL-SSSHYGAIQ-------RPSVNQRRFSYGSYSNEALQYPMNQ  54

Query  315  STAR-----SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
            +        +  A PVFVQAP EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  55   ACRANDPLVASGALPVFVQAPKEKGFSGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ  114

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEMIKAGRLSEPYKGI DCFSRT+KDEG+VSLWRGNTANVIRYFPTQALN
Sbjct  115  DEMIKAGRLSEPYKGIGDCFSRTMKDEGMVSLWRGNTANVIRYFPTQALN  164



>gb|EYU46271.1| hypothetical protein MIMGU_mgv1a0080301mg, partial [Erythranthe 
guttata]
Length=165

 Score =   209 bits (532),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 125/160 (78%), Gaps = 7/160 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-----PRNLST  310
            T+ +KVA +LHL S+    D+Q+    F +P    + F +GNYTN+ LQ      +NLS 
Sbjct  8    TIRQKVANQLHLGSSLS-QDVQARYGGFQRPATYQRQFAYGNYTNAGLQYPATCSQNLSL  66

Query  309  ARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAG  130
              +  ASPVFVQAP EKGFVGFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAG
Sbjct  67   ITA-NASPVFVQAPQEKGFVGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAG  125

Query  129  RLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQ  10
            RLSEPYKGI +CF RTV++EG  SLWRGNTANVIRYFPTQ
Sbjct  126  RLSEPYKGIGECFKRTVQEEGFGSLWRGNTANVIRYFPTQ  165



>ref|XP_004291800.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=394

 Score =   216 bits (550),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 132/172 (77%), Gaps = 8/172 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRST-THVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            D+    TV +K AG+LHL ST +     QS    F +P +N + F +GNY N+ LQ P N
Sbjct  3    DRHQSRTVRQKFAGQLHLGSTLSQDIHSQSHYGSFQRPNVNQRRFAYGNYYNAALQYPMN  62

Query  318  L---STARSY---AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
                ST RS    + SP+ +Q+P EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  63   HTWGSTDRSLISSSTSPLLIQSPQEKGFTGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQ  122

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEM+KAGRLSEPYKGI +CFSRT+K+EG+VSLWRGNTANVIRYFPTQALN
Sbjct  123  NQDEMLKAGRLSEPYKGIGECFSRTMKEEGMVSLWRGNTANVIRYFPTQALN  174



>ref|XP_006446100.1| hypothetical protein CICLE_v10017600mg [Citrus clementina]
 gb|ESR59340.1| hypothetical protein CICLE_v10017600mg [Citrus clementina]
Length=394

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 127/167 (76%), Gaps = 9/167 (5%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPF-LNSKTFKHGNYTNSMLQPRNLSTARSY  298
            +V++KV G+L+L+ST     +Q+    F  P  L  + F +GNY+N+  Q     T R+ 
Sbjct  9    SVTQKVTGQLYLKSTLSQDIVQNRYAGFQNPAALPQRHFAYGNYSNAAFQYPLAQTCRAS  68

Query  297  A--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM  142
            +        ASPVFVQAPSEKGF GFA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM
Sbjct  69   SDLSLIASTASPVFVQAPSEKGFAGFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEM  128

Query  141  IKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IKAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  129  IKAGRLSEPYKGIGDCFGRTIKDEGFASLWRGNTANVIRYFPTQALN  175



>ref|XP_006470591.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Citrus 
sinensis]
 gb|KDO61295.1| hypothetical protein CISIN_1g016168mg [Citrus sinensis]
Length=394

 Score =   213 bits (543),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 125/167 (75%), Gaps = 9/167 (5%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPF-LNSKTFKHGNYTNSMLQPRNLSTARSY  298
            +V  KV G+L+L+ST     +Q+    F  P  L  + F +GNY+N+  Q     T R+ 
Sbjct  9    SVMHKVTGQLYLKSTLSQDIVQNRYAGFQNPAALPQRHFAYGNYSNAAFQYPLAQTCRAS  68

Query  297  A--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM  142
            +        ASPVFVQAPSEKGF GFA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM
Sbjct  69   SDLSLIASTASPVFVQAPSEKGFAGFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEM  128

Query  141  IKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IKAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  129  IKAGRLSEPYKGIGDCFGRTIKDEGFASLWRGNTANVIRYFPTQALN  175



>gb|AFX72760.1| ATP/ADP carrier protein, partial [Litchi chinensis]
Length=388

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 128/172 (74%), Gaps = 12/172 (7%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQP----  325
            DQ    +V +KVA +L   S TH  D++S    F +P L  +   +GNY+N+   P    
Sbjct  1    DQVQHPSVMQKVASQLLHSSLTH--DVRSCDGAFNRPALYQRR-TYGNYSNAAFHPVVRA  57

Query  324  ----RNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
                 ++S   S  ASPVFVQAPSEKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  58   CGATSDMSMVAS-TASPVFVQAPSEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQ  116

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIK GRLSEPYKGI DCF RT+KDEGIVSLWRGNTANVIRYFPTQALN
Sbjct  117  NQDEMIKTGRLSEPYKGIGDCFKRTMKDEGIVSLWRGNTANVIRYFPTQALN  168



>ref|XP_009381664.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009381665.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=391

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 126/171 (74%), Gaps = 8/171 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRNL  316
            DQ +  TV +KVAG+LHLRS+    D Q+     Y P L  + F   N TN   Q P   
Sbjct  3    DQVNHPTVMQKVAGQLHLRSS-FSRDPQALNCSLYSPSLYQRCFTTVNCTNGGFQNPSMA  61

Query  315  STARSY------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
              + +Y      + SP F  AP+EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  62   VYSGTYELPIVTSVSPGFAHAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQN  121

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIKAGRLSEPYKGI DCFSRT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  122  QDEMIKAGRLSEPYKGISDCFSRTIKDEGVLSLWRGNTANVIRYFPTQALN  172



>ref|XP_007211408.1| hypothetical protein PRUPE_ppa006913mg [Prunus persica]
 gb|EMJ12607.1| hypothetical protein PRUPE_ppa006913mg [Prunus persica]
Length=390

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D+    T  +K +G+LHL S+    D  S    F +P LN + F +GNY+N+ L+     
Sbjct  3    DRHQDPTAMQKFSGQLHLGSSLS-QDSHSHYGGFQRPALNQRRFAYGNYSNAALEYPMNH  61

Query  312  TARS------YAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
            T R+          PV VQAP EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  62   TCRANDPLVASGVLPVCVQAPKEKGFSGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ  121

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEMIKAGRLSEPYKGI DCFSRT+KDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  122  DEMIKAGRLSEPYKGIGDCFSRTMKDEGMVALWRGNTANVIRYFPTQALN  171



>gb|KDP22076.1| hypothetical protein JCGZ_25907 [Jatropha curcas]
Length=384

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 125/165 (76%), Gaps = 3/165 (2%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRST-THVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            D+    ++++KVAG++HL S  +H  D+Q     F +P +  + F +GNY N   Q    
Sbjct  3    DRQQYPSITQKVAGQVHLSSILSH--DVQCRSMAFQRPTIYHRQFAYGNYCNVGFQATPY  60

Query  315  STARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  136
             +      SPVFV +PSEKG  GFA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK
Sbjct  61   LSLVGSTTSPVFVNSPSEKGIAGFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  120

Query  135  AGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            AGRLSEPYKGI DCFSRT+KDEG +SLWRGNTANVIRYFPTQALN
Sbjct  121  AGRLSEPYKGIGDCFSRTMKDEGFMSLWRGNTANVIRYFPTQALN  165



>ref|XP_008227151.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Prunus 
mume]
 ref|XP_008227152.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Prunus 
mume]
Length=390

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRNL  316
            D+    T  +K +G+LHL S+    D  S    F +P LN + F +GNY+N+ L+ P N 
Sbjct  3    DRQQDPTARQKFSGQLHLGSSLS-QDSHSHYGGFQRPALNQRRFAYGNYSNAALEYPMNH  61

Query  315  STAR-----SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
            +        +    PV VQAP EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  62   ACRANDPLVASGVLPVCVQAPKEKGFSGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ  121

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEMIKAGRLSEPYKGI DCFSRT+KDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  122  DEMIKAGRLSEPYKGIGDCFSRTMKDEGMVALWRGNTANVIRYFPTQALN  171



>ref|XP_002285503.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Vitis vinifera]
Length=393

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 123/167 (74%), Gaps = 11/167 (7%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ---------PR  322
             +  KVAG+LHL S+    D+ +    F  P L  +    GNY+N +LQ          +
Sbjct  9    NIMRKVAGQLHLSSSIS-QDVHTHYGSFQSPALYQRRSAFGNYSNVVLQYPMTQSCQATQ  67

Query  321  NLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM  142
            +LS   S  ASPVFVQAP EKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM
Sbjct  68   DLSLIAS-TASPVFVQAPQEKGFASFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEM  126

Query  141  IKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IKAGRLSEPYKGI DCFSRT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  127  IKAGRLSEPYKGIGDCFSRTIKDEGFASLWRGNTANVIRYFPTQALN  173



>ref|XP_011090371.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Sesamum indicum]
 ref|XP_011090373.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Sesamum indicum]
Length=390

 Score =   211 bits (537),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 128/171 (75%), Gaps = 9/171 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-----  328
            DQ    T+++KVA +LHL S++   D+Q+    F QP +  +    GNYTN+ LQ     
Sbjct  3    DQHRYPTIAQKVANQLHL-SSSFSQDVQARYGGFQQPSVYQRRVASGNYTNAGLQYPMTC  61

Query  327  --PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
               ++LS   S  ASPVFVQAP EKG   FAIDFMMGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  62   QATQDLSLI-SANASPVFVQAPQEKGLASFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  120

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIKAGRLSEPYKGI +CF RT+++EG  SLWRGNTANVIRYFPTQALN
Sbjct  121  QDEMIKAGRLSEPYKGIGECFKRTIQEEGFGSLWRGNTANVIRYFPTQALN  171



>ref|XP_009391811.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391812.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391813.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=391

 Score =   211 bits (537),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 122/171 (71%), Gaps = 8/171 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTN-----SMLQ  328
            DQ    TV +K AG+ HLR T+   DL +    FY P L   +F  GNY N     S +Q
Sbjct  3    DQVKHPTVVQKFAGQFHLR-TSFSQDLHARNRSFYGPSLYGNSFTTGNYINGGFQKSTMQ  61

Query  327  PRNLSTARSYAAS--PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
              N S      +S  PVF  AP+EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  62   ACNASCGIPTMSSVLPVFANAPAEKGFTSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQN  121

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIK GRLSEPYKGI DCF RT++DEG+ SLWRGNTANVIRYFPTQALN
Sbjct  122  QDEMIKTGRLSEPYKGISDCFGRTIRDEGVASLWRGNTANVIRYFPTQALN  172



>ref|XP_002303893.1| hypothetical protein POPTR_0003s20360g [Populus trichocarpa]
 gb|EEE78872.1| hypothetical protein POPTR_0003s20360g [Populus trichocarpa]
Length=385

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 128/172 (74%), Gaps = 16/172 (9%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNS-----MLQ  328
            D+    +V +K+A ++HL S        SF   F +P L+ + F +GNY+N+     M +
Sbjct  3    DRRQQPSVMQKMASQVHLSS--------SFPQGFQRPALHRRQFAYGNYSNAGFQYAMTR  54

Query  327  PRNLSTARSYAAS---PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            P   S   S  AS   PVFVQAPSEKG  GFA+DF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  55   PCQSSPDMSLVASSTAPVFVQAPSEKGLAGFAVDFLMGGVSAAVSKTAAAPIERVKLLIQ  114

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIKAGRLSEPYKGI +CFSRT+KDEG +SLWRGNTANVIRYFPTQALN
Sbjct  115  NQDEMIKAGRLSEPYKGIGECFSRTIKDEGTMSLWRGNTANVIRYFPTQALN  166



>ref|XP_006399841.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
 gb|ESQ41294.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
Length=352

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            +DQ    T+ +K +G+  LRS+    DL  +   F +P    +   +GNY+N+  Q P  
Sbjct  2    VDQTQHPTILQKASGQF-LRSSVS-QDLVGYSSAFQRPATYQRHATYGNYSNAAFQYPLA  59

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             ++  +  ASPVFVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  60   AASRIATPASPVFVQAPGEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  119

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RTVKDEG  SLWRGNTANVIRYFPTQALN
Sbjct  120  KAGRLSEPYKGIGDCFGRTVKDEGFGSLWRGNTANVIRYFPTQALN  165



>gb|KHG00455.1| ADP,ATP carrier 1, mitochondrial [Gossypium arboreum]
Length=386

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 127/170 (75%), Gaps = 8/170 (5%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----  328
            +DQ    +V +KVAG+L LRS+ H  D Q +   F  P L  +   +GNY+N+ LQ    
Sbjct  1    MDQVQHPSVMQKVAGQL-LRSS-HSQDFQGYNGSFRSPALYQRRAAYGNYSNAALQYPVR  58

Query  327  -PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
               +LS   S  AS + VQAP+EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  59   ACGDLSMVPS-TASAICVQAPAEKGFTSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ  117

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEMIK+GRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  118  DEMIKSGRLSEPYKGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALN  167



>ref|XP_009415408.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            DQ    TVS+KVAG+ HLRS     DL +    FY P L  +    GN+ N   Q   + 
Sbjct  3    DQVTHPTVSQKVAGQFHLRSY-FSQDLHARNRSFYGPSLYERRITTGNFINQDFQKPYMH  61

Query  312  TA--RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
                   + SPVF  AP+EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  62   CGIPTVTSVSPVFANAPAEKGFASFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  121

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            K GRLSEPYKGI DCF+RT++DEG+ SLWRGNTANVIRYFPTQALN
Sbjct  122  KTGRLSEPYKGITDCFARTIRDEGVGSLWRGNTANVIRYFPTQALN  167



>ref|XP_009590575.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X1 [Nicotiana tomentosiformis]
Length=409

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 133/183 (73%), Gaps = 18/183 (10%)
 Frame = -2

Query  534  LIVSILRQRSEMTIDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCF-YQPFLNSKTFK  358
            LI S   + + M IDQP   +V+ KV+G   +RST +       RD   YQ     + +K
Sbjct  21   LIHSSKSEETAMMIDQPQYPSVAHKVSGNFLVRSTQN-------RDLLAYQ-----RPYK  68

Query  357  HGNYTNSMLQ----PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAA  190
            +GN T  +L       ++S   SY+ SPVFVQAPSEKG   FA+DF+MGGVSAAVSKTAA
Sbjct  69   YGNQTKPLLHQCEGKYDMSMVSSYS-SPVFVQAPSEKGISSFAVDFLMGGVSAAVSKTAA  127

Query  189  APIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQ  10
            APIERVKLLIQNQDEMIKAGRLS+PY GI +CFSRT+KDEGI+SLWRGNTANVIRYFPTQ
Sbjct  128  APIERVKLLIQNQDEMIKAGRLSKPYSGITECFSRTMKDEGIMSLWRGNTANVIRYFPTQ  187

Query  9    ALN  1
            ALN
Sbjct  188  ALN  190



>ref|XP_006399842.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
 ref|XP_006399843.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
 dbj|BAJ34180.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41295.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
 gb|ESQ41296.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
Length=383

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            +DQ    T+ +K +G+  LRS+    DL  +   F +P    +   +GNY+N+  Q P  
Sbjct  2    VDQTQHPTILQKASGQF-LRSSVS-QDLVGYSSAFQRPATYQRHATYGNYSNAAFQYPLA  59

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             ++  +  ASPVFVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  60   AASRIATPASPVFVQAPGEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  119

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RTVKDEG  SLWRGNTANVIRYFPTQALN
Sbjct  120  KAGRLSEPYKGIGDCFGRTVKDEGFGSLWRGNTANVIRYFPTQALN  165



>ref|XP_011042099.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011042100.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Populus 
euphratica]
Length=386

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 128/172 (74%), Gaps = 16/172 (9%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNS-----MLQ  328
            D+    +V +K+AG++HL S        SF   F +P L+ + F +GNY+N+     M +
Sbjct  3    DRGQQPSVMQKMAGQVHLSS--------SFPQGFRRPALHRRQFANGNYSNAGFQYAMTR  54

Query  327  PRNLSTARSYAASP---VFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            P   S   S  AS    VFVQAPSEKG  GFA+DF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  55   PCQSSLDISLVASSTATVFVQAPSEKGLAGFAVDFLMGGVSAAVSKTAAAPIERVKLLIQ  114

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIKAGRLSEPYKGI +CFSRT+KDEG +SLWRGNTANVIRYFPTQALN
Sbjct  115  NQDEMIKAGRLSEPYKGIGECFSRTIKDEGTMSLWRGNTANVIRYFPTQALN  166



>ref|XP_010067876.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Eucalyptus 
grandis]
 ref|XP_010067877.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Eucalyptus 
grandis]
Length=391

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 126/173 (73%), Gaps = 10/173 (6%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    TV +KVAG+L LR++    D++     F +P L  +   +GNYTN+ L    +
Sbjct  2    VDQGQHPTVMQKVAGQLLLRASLS-QDMRGCDGAFQRPALYQRR-AYGNYTNAALNYPTM  59

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R+ A        ASPVF+ AP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  60   PACRASADMSIVASTASPVFIHAPKEKGFASFAIDFLMGGVSAAVSKTAAAPIERVKLLI  119

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK+GRLSEPYKGI DCF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  120  QNQDEMIKSGRLSEPYKGIGDCFGRTIKEEGFGSLWRGNTANVIRYFPTQALN  172



>ref|XP_010928866.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
Length=391

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 123/171 (72%), Gaps = 8/171 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRNL  316
            DQ +  TV +KVAG+ HLRS+    D+Q     F +P    + F    Y NS LQ P   
Sbjct  3    DQINHPTVVQKVAGQFHLRSS-FAQDMQVRSYNFSRPSPYERRFTAAGYVNSGLQTPLMH  61

Query  315  STARSY------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
                +Y      + SPVF  APSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  62   GCKATYDLSMVSSMSPVFAHAPSEKGFTSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQN  121

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIK GRLSEPY+GIMDCF RT+KDEG+ SLWRGNTANVIRYFPTQALN
Sbjct  122  QDEMIKTGRLSEPYQGIMDCFRRTIKDEGVTSLWRGNTANVIRYFPTQALN  172



>ref|XP_002513476.1| ADP,ATP carrier protein, putative [Ricinus communis]
 gb|EEF48879.1| ADP,ATP carrier protein, putative [Ricinus communis]
Length=392

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 128/173 (74%), Gaps = 11/173 (6%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRST-THVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            D+    ++ +KVA ++HL S+ +H  D+Q        P L+ + F HGNY N+  Q P  
Sbjct  3    DRHQYPSLMQKVASQIHLSSSLSH--DVQYRYGGSQSPALHQRQFTHGNYCNAAFQYPMT  60

Query  318  LSTARS-------YAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
             +   S         ASPVFVQAPSEKGF  FA DF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  61   RACEASPDLPLIASTASPVFVQAPSEKGFASFATDFLMGGVSAAVSKTAAAPIERVKLLI  120

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIKAGRLSEPYKGI DCFSRT++DEG++SLWRGNTANVIRYFPTQALN
Sbjct  121  QNQDEMIKAGRLSEPYKGIGDCFSRTIEDEGMMSLWRGNTANVIRYFPTQALN  173



>ref|XP_006287927.1| hypothetical protein CARUB_v10001162mg [Capsella rubella]
 gb|EOA20825.1| hypothetical protein CARUB_v10001162mg [Capsella rubella]
Length=384

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            ++Q    T+ +K +G+  LRS+    D+Q +   F  P    +   +GNY+N+  Q   +
Sbjct  2    VEQTQHPTILQKASGQF-LRSSVS-QDVQGYASAFQSPATFQRRASYGNYSNAAFQSPLV  59

Query  315  STAR-SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
            + +R +   SPVFVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  60   AASRIATTTSPVFVQAPGEKGFTNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  119

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  120  KAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  165



>sp|P27081.1|ADT2_SOLTU RecName: Full=ADP,ATP carrier protein, mitochondrial; AltName: 
Full=ADP/ATP translocase; AltName: Full=Adenine nucleotide 
translocator; Short=ANT; Flags: Precursor, partial [Solanum 
tuberosum]
 emb|CAA40782.1| adenine nucleotide translocator [Solanum tuberosum]
Length=386

 Score =   207 bits (528),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 126/162 (78%), Gaps = 6/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQP----RNLSTA  307
            TV +KVA ++HL S++   D+ +      +P L+ + F +GNY+N+ LQ     ++LS  
Sbjct  7    TVYQKVASQMHL-SSSLSQDVHARYGGIQRPALSQRRFPYGNYSNAGLQTCQATQDLSLI  65

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             +  ASPVFVQAP EKG   FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR
Sbjct  66   AA-NASPVFVQAPQEKGLAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  124

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI DCFSRT+KDEG  +LWRGNTANVIRYFPTQALN
Sbjct  125  LSEPYKGIGDCFSRTIKDEGFAALWRGNTANVIRYFPTQALN  166



>ref|XP_010313215.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Solanum 
lycopersicum]
Length=386

 Score =   207 bits (528),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 125/162 (77%), Gaps = 7/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----PRNLSTA  307
            TV +K A +LHLRS+    D+ + R    QP +  + F +GNY+N+ LQ     ++LS  
Sbjct  9    TVFQKAANQLHLRSSLS-QDVHA-RYGGVQPAIYQRHFAYGNYSNAALQRGQATQDLSLI  66

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             S  ASPVFVQAP EKGF  FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAGR
Sbjct  67   TS-NASPVFVQAPQEKGFAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGR  125

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI DCF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  126  LSEPYKGIGDCFGRTIKEEGFGSLWRGNTANVIRYFPTQALN  167



>ref|XP_009760860.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Nicotiana 
sylvestris]
Length=436

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 135/189 (71%), Gaps = 17/189 (9%)
 Frame = -2

Query  555  EFKAALYLIVSILRQRSEMTIDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFL  376
            E+ A +YL ++          D  H  TV +KVA ++HL S++   D+ +      +P L
Sbjct  42   EWNAGVYLAMA----------DNQHP-TVFQKVANQMHL-SSSLSQDVHARYGGIQRPAL  89

Query  375  NSKTFKHGNYTNSMLQ----PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAA  208
            + + F +GNY+N+ LQ     ++LS   S  ASPVFVQAP EKG   FA DF+MGGVSAA
Sbjct  90   HQRRFAYGNYSNAGLQNCQATQDLSLI-SANASPVFVQAPQEKGLAAFATDFLMGGVSAA  148

Query  207  VSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVI  28
            VSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVI
Sbjct  149  VSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVI  208

Query  27   RYFPTQALN  1
            RYFPTQALN
Sbjct  209  RYFPTQALN  217



>ref|XP_010913169.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Elaeis guineensis]
Length=389

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 134/175 (77%), Gaps = 19/175 (11%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDC-FYQPFLNSKTF---KHGNYTNSMLQ  328
            I++P   TV +KV G+ HLRS+   PD+Q+ R+C FY P L  + +   K+G+  N +LQ
Sbjct  5    INRP---TVIQKVVGQFHLRSS-FSPDMQA-RNCGFYMPSLYERQYTAGKNGSLQNPLLQ  59

Query  327  PRNLSTARSYA------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKL  166
               +S+A SY        SPV   APSEKGF GFA+DF+MGGVSAAVSKTAAAPIERVKL
Sbjct  60   ---VSSA-SYDLPMLTPVSPVSAHAPSEKGFAGFAVDFLMGGVSAAVSKTAAAPIERVKL  115

Query  165  LIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LIQNQDEMIK+GRLSEPYKGI DCF RT++DEG+ SLWRGNTANVIRYFPTQALN
Sbjct  116  LIQNQDEMIKSGRLSEPYKGIGDCFGRTIRDEGLASLWRGNTANVIRYFPTQALN  170



>gb|KCW66116.1| hypothetical protein EUGRSUZ_G03388, partial [Eucalyptus grandis]
Length=465

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 133/183 (73%), Gaps = 11/183 (6%)
 Frame = -2

Query  525  SILRQRSEMTIDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNY  346
            S+L+ + +M +DQ    TV +KVAG+L LR++    D++     F +P L  +   +GNY
Sbjct  67   SLLQGQVKM-VDQGQHPTVMQKVAGQLLLRASLS-QDMRGCDGAFQRPALYQRR-AYGNY  123

Query  345  TNSMLQPRNLSTARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAA  190
            TN+ L    +   R+ A        ASPVF+ AP EKGF  FAIDF+MGGVSAAVSKTAA
Sbjct  124  TNAALNYPTMPACRASADMSIVASTASPVFIHAPKEKGFASFAIDFLMGGVSAAVSKTAA  183

Query  189  APIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQ  10
            APIERVKLLIQNQDEMIK+GRLSEPYKGI DCF RT+K+EG  SLWRGNTANVIRYFPTQ
Sbjct  184  APIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFGRTIKEEGFGSLWRGNTANVIRYFPTQ  243

Query  9    ALN  1
            ALN
Sbjct  244  ALN  246



>sp|O22342.1|ADT1_GOSHI RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocator 1; Short=ANT 1; Flags: Precursor [Gossypium 
hirsutum]
 gb|AAB72047.1| adenine nucleotide translocator 1 [Gossypium hirsutum]
Length=386

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 125/170 (74%), Gaps = 8/170 (5%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQP---  325
            +DQ    +V +KVAG+L    ++H  D Q +   F  P L  +   +GNY+N+ LQ    
Sbjct  1    MDQVQHPSVMQKVAGQLF--RSSHSQDFQGYNGSFRSPALYQRRAAYGNYSNAALQHPVR  58

Query  324  --RNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
               +LS   S  AS + VQAP+EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  59   AFGDLSMVPS-TASAICVQAPAEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ  117

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEMIK+GRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  118  DEMIKSGRLSEPYKGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALN  167



>ref|XP_010462544.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Camelina 
sativa]
 ref|XP_010486395.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Camelina 
sativa]
Length=381

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 121/165 (73%), Gaps = 5/165 (3%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    T+++K AG+    S ++   +   R   YQ     +   +GNY+N+  Q    
Sbjct  2    VDQVQHPTIAQKAAGQFICSSVSNDAHVGYQRPSMYQ-----RHATYGNYSNAAFQFPPT  56

Query  315  STARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  136
            S   + AASPVFVQAP EKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK
Sbjct  57   SRMLATAASPVFVQAPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  116

Query  135  AGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            AGRLSEPYKGI DCF RTVKDEG  SLWRGNTANVIRYFPTQALN
Sbjct  117  AGRLSEPYKGIGDCFGRTVKDEGFGSLWRGNTANVIRYFPTQALN  161



>ref|XP_009590576.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X2 [Nicotiana tomentosiformis]
Length=378

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 129/171 (75%), Gaps = 16/171 (9%)
 Frame = -2

Query  501  MTIDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ--  328
            M IDQP   +V+ KV+G   +RST +  DL +++          + +K+GN T  +L   
Sbjct  1    MMIDQPQYPSVAHKVSGNFLVRSTQN-RDLLAYQ----------RPYKYGNQTKPLLHQC  49

Query  327  --PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
                ++S   SY+ SPVFVQAPSEKG   FA+DF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  50   EGKYDMSMVSSYS-SPVFVQAPSEKGISSFAVDFLMGGVSAAVSKTAAAPIERVKLLIQN  108

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIKAGRLS+PY GI +CFSRT+KDEGI+SLWRGNTANVIRYFPTQALN
Sbjct  109  QDEMIKAGRLSKPYSGITECFSRTMKDEGIMSLWRGNTANVIRYFPTQALN  159



>ref|NP_196853.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana]
 ref|NP_001031876.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana]
 sp|P40941.2|ADT2_ARATH RecName: Full=ADP,ATP carrier protein 2, mitochondrial; AltName: 
Full=ADP/ATP translocase 2; AltName: Full=Adenine nucleotide 
translocator 2; Short=ANT 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC05426.1| adenosine nucleotide translocator [Arabidopsis thaliana]
 gb|AAK92794.1| putative adenosine nucleotide translocator protein [Arabidopsis 
thaliana]
 gb|AAL85138.1| putative adenosine nucleotide translocator protein [Arabidopsis 
thaliana]
 dbj|BAH19937.1| AT5G13490 [Arabidopsis thaliana]
 gb|AED91901.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana]
 gb|AED91902.1| ADP/ATP carrier protein 2 [Arabidopsis thaliana]
Length=385

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            ++Q    T+ +KV+G+L   S +   D++ +     +P    K   +GNY+N+  Q P  
Sbjct  2    VEQTQHPTILQKVSGQLLSSSVSQ--DIRGYASASKRPATYQKHAAYGNYSNAAFQYPLV  59

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             ++  +   SPVFVQAP EKGF  FAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  60   AASQIATTTSPVFVQAPGEKGFTNFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEML  119

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRL+EPYKGI DCF RT++DEGI SLWRGNTANVIRYFPTQALN
Sbjct  120  KAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYFPTQALN  165



>emb|CAA48579.1| adenosine nucleotide translocator [Arabidopsis thaliana]
Length=385

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            ++Q    T+ +KV+G+L   S +   D++ +     +P    K   +GNY+N+  Q P  
Sbjct  2    VEQTQHPTILQKVSGQLLSSSVSQ--DIRGYASASKRPATYQKHAAYGNYSNAAFQYPLV  59

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             ++  +   SPVFVQAP EKGF  FAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  60   AASQIATTTSPVFVQAPGEKGFTNFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEML  119

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRL+EPYKGI DCF RT++DEGI SLWRGNTANVIRYFPTQALN
Sbjct  120  KAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYFPTQALN  165



>ref|XP_009773874.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009773875.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=379

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 131/172 (76%), Gaps = 17/172 (10%)
 Frame = -2

Query  501  MTIDQPHCL-TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-  328
            MTIDQP    +V+ KV+G   +RST +  DL +++          + +K+GN T  +L  
Sbjct  1    MTIDQPQYYPSVAHKVSGNFLVRSTQN-RDLLAYQ----------RQYKYGNQTRPLLHQ  49

Query  327  ---PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
                 ++S   SY+ SPVFVQAPSEKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  50   CEGKYDMSMVSSYS-SPVFVQAPSEKGFSSFAVDFLMGGVSAAVSKTAAAPIERVKLLIQ  108

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIKAGRLS+PY GI +CFSRT+K+EGI+SLWRGNTANVIRYFPTQALN
Sbjct  109  NQDEMIKAGRLSKPYSGITECFSRTMKEEGIMSLWRGNTANVIRYFPTQALN  160



>ref|XP_010928502.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
Length=391

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 122/171 (71%), Gaps = 8/171 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRNL  316
            DQ +  TV +KVAG+ H RS+    D+Q+     Y P L  +++   NY N  LQ P   
Sbjct  3    DQVNHPTVIQKVAGQFHFRSS-FSQDMQARNHTSYMPCLYKRSYTTRNYVNGGLQNPVMQ  61

Query  315  STARSYA------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
             +  SY        SPVF  APSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  62   VSGASYDHPVLTPVSPVFAHAPSEKGFASFAIDFLMGGVSAAVSKTAAAPIERVKLLIQN  121

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIK GRLSEPYKGI DCF+RT+KDEG+ SLWRGN  NVIRYFPTQALN
Sbjct  122  QDEMIKTGRLSEPYKGIGDCFARTIKDEGLASLWRGNAVNVIRYFPTQALN  172



>ref|XP_007052542.1| ADP/ATP carrier 2 [Theobroma cacao]
 gb|EOX96699.1| ADP/ATP carrier 2 [Theobroma cacao]
Length=507

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 131/177 (74%), Gaps = 12/177 (7%)
 Frame = -2

Query  504  EMTIDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-  328
            E+ +DQ    TV +KVAG+L LRS+    D Q +     +P L+ +   +GNY+N+ LQ 
Sbjct  115  EVRMDQVQHPTVMQKVAGQL-LRSSLS-QDFQGYDGSLRRPALHQRCVAYGNYSNAALQY  172

Query  327  --------PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERV  172
                      +LS   S  A+ V VQAP+EKGF GFAIDF+MGGVSAAVSKTAAAPIERV
Sbjct  173  PIVRACGATSDLSMVPS-TATAVCVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERV  231

Query  171  KLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KLLIQNQDEMIK GRL+EPYKGI DCF RT++DEG+VSLWRGNTANVIRYFPTQALN
Sbjct  232  KLLIQNQDEMIKTGRLAEPYKGIGDCFKRTIQDEGVVSLWRGNTANVIRYFPTQALN  288



>ref|XP_006399840.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
 gb|ESQ41293.1| hypothetical protein EUTSA_v10013800mg [Eutrema salsugineum]
Length=323

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 122/164 (74%), Gaps = 3/164 (2%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            +DQ    T+ +K +G+  LRS+    DL  +   F +P    +   +GNY+N+  Q P  
Sbjct  2    VDQTQHPTILQKASGQF-LRSSVS-QDLVGYSSAFQRPATYQRHATYGNYSNAAFQYPLA  59

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             ++  +  ASPVFVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  60   AASRIATPASPVFVQAPGEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  119

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQA  7
            KAGRLSEPYKGI DCF RTVKDEG  SLWRGNTANVIRYFPTQA
Sbjct  120  KAGRLSEPYKGIGDCFGRTVKDEGFGSLWRGNTANVIRYFPTQA  163



>prf||1908224A nucleotide translocator
Length=403

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            ++Q    T+ +KV+G+L   S +   D++ +     +P    K   +GNY+N+  Q P  
Sbjct  20   VEQTQHPTILQKVSGQLLSSSVSQ--DIRGYASASKRPATYQKHAAYGNYSNAAFQYPLV  77

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             ++  +   SPVFVQAP EKGF  FAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  78   AASQIATTTSPVFVQAPGEKGFTNFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEML  137

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRL+EPYKGI DCF RT++DEGI SLWRGNTANVIRYFPTQALN
Sbjct  138  KAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNTANVIRYFPTQALN  183



>ref|NP_001275490.1| ADP,ATP carrier protein, mitochondrial [Solanum tuberosum]
 ref|XP_006361217.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Solanum 
tuberosum]
 gb|AFX67036.1| ADP, ATP carrier protein [Solanum tuberosum]
Length=387

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 126/162 (78%), Gaps = 6/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQP----RNLSTA  307
            TV +KVA ++HL S++   D+ +      +P L+ + F +GNY+N+ LQ     ++LS  
Sbjct  8    TVYQKVASQMHL-SSSLSQDVHARYGGIQRPALSQRRFPYGNYSNAGLQTCQATQDLSLI  66

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             +  ASPVFVQAP EKG   FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR
Sbjct  67   AA-NASPVFVQAPQEKGLAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  125

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI +CFSRT+KDEG  +LWRGNTANVIRYFPTQALN
Sbjct  126  LSEPYKGIGECFSRTIKDEGFAALWRGNTANVIRYFPTQALN  167



>ref|XP_009768570.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Nicotiana 
sylvestris]
Length=387

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 126/162 (78%), Gaps = 6/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----PRNLSTA  307
            TV +KVA +LHL S++   ++ +      +P L  + + +GNY+N+ LQ    P+ LS  
Sbjct  9    TVFQKVANQLHL-SSSLSQNVHARYGGIQRPALYQRHYAYGNYSNAGLQTCQAPQGLSLI  67

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             +  ASPVFVQAP+EKG   FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK GR
Sbjct  68   AA-NASPVFVQAPTEKGVAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKTGR  126

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI DCF RT++DEG+VSLWRGNTANVIRYFPTQALN
Sbjct  127  LSEPYKGIGDCFRRTMQDEGVVSLWRGNTANVIRYFPTQALN  168



>ref|XP_006345460.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Solanum 
tuberosum]
Length=378

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 128/171 (75%), Gaps = 16/171 (9%)
 Frame = -2

Query  501  MTIDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ--  328
            MTIDQP   +V+ KV G   +RST +  DL +++          + +K+GN T   L   
Sbjct  1    MTIDQPQYPSVTHKVGGNFLVRSTQN-RDLMAYQ----------RQYKYGNQTKPWLHRC  49

Query  327  --PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
                ++    SY+ SPVFVQAPSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  50   EGKYDMPVVSSYS-SPVFVQAPSEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQN  108

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIKAGRLS+PY GI +CFSRT+K+EG+++LWRGNTANVIRYFPTQALN
Sbjct  109  QDEMIKAGRLSKPYGGIAECFSRTMKEEGVMALWRGNTANVIRYFPTQALN  159



>ref|XP_002871570.1| hypothetical protein ARALYDRAFT_488169 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47829.1| hypothetical protein ARALYDRAFT_488169 [Arabidopsis lyrata subsp. 
lyrata]
Length=384

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            ++Q    T+ +K +G++ LRS     D++ +   F +P    +   +GNY+N+  Q P  
Sbjct  2    VEQTQHPTILQKASGQI-LRSGVS-QDIRGYASAFQRPATYQRHAAYGNYSNAAFQYPLA  59

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             ++  +   SPVFVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  60   AASRIATTTSPVFVQAPGEKGFTNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  119

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  120  KAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  165



>ref|XP_010453428.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial [Camelina 
sativa]
Length=394

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 121/166 (73%), Gaps = 2/166 (1%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            ++Q    T+ +K +    LRS+    D+Q +   F  P    +   +GNY+N+  Q P  
Sbjct  2    VEQTQHPTILQKASSGQFLRSSVS-QDVQGYASAFQSPATYQRRASYGNYSNAAFQYPLA  60

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             ++  +   SPVFVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  61   AASRIATTTSPVFVQAPGEKGFTNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  120

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLS+PYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  121  KAGRLSQPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  166



>ref|XP_006407762.1| hypothetical protein EUTSA_v10020919mg [Eutrema salsugineum]
 gb|ESQ49215.1| hypothetical protein EUTSA_v10020919mg [Eutrema salsugineum]
Length=382

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 127/166 (77%), Gaps = 6/166 (4%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            +DQ    T+++K AG+  LRS+    D+Q     + +P +  +   +GNY+N+  Q P N
Sbjct  2    VDQVQHPTIAQKSAGQF-LRSSVS-KDIQV---GYQRPSVYQRHATYGNYSNAAFQFPLN  56

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             ++  +  +SPVFVQAP EKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  57   PTSLMAANSSPVFVQAPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  116

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RTV+DEG  SLWRGNTANVIRYFPTQALN
Sbjct  117  KAGRLSEPYKGIGDCFGRTVRDEGFGSLWRGNTANVIRYFPTQALN  162



>ref|XP_008372658.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Malus 
domestica]
Length=384

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 132/174 (76%), Gaps = 21/174 (12%)
 Frame = -2

Query  492  DQPHCLTVSEKVAG-KLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            D+    T++EK +G +LHL S++H   +Q       +P +N + F +G+Y+N+ LQ P N
Sbjct  3    DRRQHPTITEKFSGHELHL-SSSHYGVIQ-------RPSINQRRFSYGSYSNAALQYPMN  54

Query  318  --------LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLL  163
                    L  +RS    PV V+AP EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLL
Sbjct  55   QACRANDPLVASRSL---PVCVEAPKEKGFSGFAIDFLMGGVSAAVSKTAAAPIERVKLL  111

Query  162  IQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IQNQDEMIKAGRLSEPYKGI DCFSRT+KDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  112  IQNQDEMIKAGRLSEPYKGIGDCFSRTMKDEGMVALWRGNTANVIRYFPTQALN  165



>ref|XP_002299232.1| hypothetical protein POPTR_0001s05690g [Populus trichocarpa]
 gb|EEE84037.1| hypothetical protein POPTR_0001s05690g [Populus trichocarpa]
Length=385

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 121/166 (73%), Gaps = 16/166 (10%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTARSY-  298
            +V +K+A + H  S        SF   F +P L+ + F +GNY+N+  Q       +S  
Sbjct  9    SVMQKMASQAHHSS--------SFSQGFQRPALHQRQFAYGNYSNAGFQYAMTRACQSTP  60

Query  297  -------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
                   + SPVFVQAPSEKG  GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  61   DMSLIASSTSPVFVQAPSEKGLAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  120

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            K GRLSEPYKGI DCFSRT+KDEG+VSLWRGNT NVIRYFPTQALN
Sbjct  121  KTGRLSEPYKGIGDCFSRTMKDEGMVSLWRGNTVNVIRYFPTQALN  166



>ref|XP_010492107.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010492108.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010492109.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Camelina 
sativa]
Length=385

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +++    T+ +K +    LRST    D+Q +   F  P    +   +GNY+N++ Q   +
Sbjct  2    VEKTQHTTILQKASSDQFLRSTVS-HDVQGYASAFQSPATYQRRASYGNYSNAVFQNPLV  60

Query  315  STAR-SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
            + +R +   SPVFVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  61   AASRIATTTSPVFVQAPGEKGFTNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  120

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLS+PYKGI +CF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  121  KAGRLSQPYKGIGECFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  166



>ref|XP_010913950.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
 ref|XP_010913951.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
Length=391

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 124/171 (73%), Gaps = 8/171 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            DQ +  TV +KV G+ HL S++   D+Q     F +P L  + F   ++ N+ LQ   + 
Sbjct  3    DQINHPTVIQKVTGQFHL-SSSFAQDMQVRSYNFSRPSLYGRHFTSASFVNNGLQTPFMP  61

Query  312  TARSY-------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
              ++        + SPVF  APSEKG   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  62   ACKATCDLSMVPSVSPVFAHAPSEKGLTSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQN  121

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIKAGRLSEPYKGIMDCF RT+KDEG+VSLWRGN ANVIRYFPTQALN
Sbjct  122  QDEMIKAGRLSEPYKGIMDCFRRTIKDEGVVSLWRGNAANVIRYFPTQALN  172



>ref|XP_009628854.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=387

 Score =   205 bits (522),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 126/162 (78%), Gaps = 6/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----PRNLSTA  307
            TV +KVA +LHL S++   ++ +      +P +  + + +GNY+N+ LQ    P+ LS  
Sbjct  9    TVFQKVANQLHL-SSSLSQNVHARYGGIQRPAIYQRHYAYGNYSNAGLQTCQAPQGLSLI  67

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             +  ASPVFVQAP+EKG   FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK GR
Sbjct  68   AA-NASPVFVQAPTEKGVAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKTGR  126

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI DCF RT++DEG+VSLWRGNTANVIRYFPTQALN
Sbjct  127  LSEPYKGIGDCFRRTMQDEGVVSLWRGNTANVIRYFPTQALN  168



>ref|XP_009774739.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Nicotiana 
sylvestris]
 ref|XP_009774745.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Nicotiana 
sylvestris]
Length=386

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 125/162 (77%), Gaps = 7/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQP----RNLSTA  307
            TV +K A +LHL S++   D+ + R    QP +  + F +GNY+N+ LQ     ++LS  
Sbjct  9    TVFQKAANQLHL-SSSLSQDVHA-RHGGVQPAVYQRRFAYGNYSNAGLQTCQATQDLSLI  66

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             S  ASPVFVQAP EKG   FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAGR
Sbjct  67   TS-NASPVFVQAPQEKGLAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGR  125

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI DCF RT+K+EGI SLWRGNTANVIRYFPTQALN
Sbjct  126  LSEPYKGIGDCFGRTIKEEGIGSLWRGNTANVIRYFPTQALN  167



>gb|ACU17667.1| unknown [Glycine max]
Length=214

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 127/173 (73%), Gaps = 13/173 (8%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----  328
            +DQ    T+ +KVAG+LHLRS   V  ++S+   +  P +  +    GNY+N+ LQ    
Sbjct  2    LDQVQHPTIMDKVAGQLHLRSG--VSGIRSYEGAYCHPTMYQRP-SFGNYSNAALQYPVM  58

Query  327  PRNLST----ARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
            P   +T    A +  ASPVFV AP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  59   PSCKATMDLSAAATTASPVFVAAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  116

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLSEPYKGI DCF RT+ DEG+VSLWRGNTANVIRYFPTQALN
Sbjct  117  QNQDEMIKTGRLSEPYKGIGDCFKRTMADEGVVSLWRGNTANVIRYFPTQALN  169



>gb|KDO83393.1| hypothetical protein CISIN_1g016015mg [Citrus sinensis]
Length=292

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 127/172 (74%), Gaps = 14/172 (8%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKL-HLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRN  319
            IDQ    +V +KVAG+L H   + ++ D +       +P +  +   +GNY+N+  Q   
Sbjct  2    IDQVQHPSVMQKVAGQLLHSSLSQNIQDYE-------RPTMYQRRGAYGNYSNAAFQYPI  54

Query  318  LSTARS------YAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            +S A +        AS + VQAP+EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  55   VSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQ  114

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIK+GRLSEPYKGI DCF RT+KDEGIV+LWRGNTANVIRYFPTQALN
Sbjct  115  NQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALN  166



>ref|XP_011080275.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Sesamum 
indicum]
Length=390

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 129/172 (75%), Gaps = 11/172 (6%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRST-THVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----  328
            +Q    ++S+KVA +LHL S+ +H   +++    F QP +  + F +GNYT+  LQ    
Sbjct  3    EQHQYPSISQKVANQLHLSSSLSH--GVEARYGGFQQPSVFQRRFAYGNYTSPGLQYPMT  60

Query  327  ---PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
                ++LS   S  ASPVFVQAP EKG   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  61   CRASQDLSLI-SANASPVFVQAPQEKGLASFAIDFLMGGVSAAVSKTAAAPIERVKLLIQ  119

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIKAGRLSEPYKGI DCF RT+++EG  SLWRGNTANVIRYFPTQALN
Sbjct  120  NQDEMIKAGRLSEPYKGIGDCFKRTIQEEGFGSLWRGNTANVIRYFPTQALN  171



>ref|XP_008782907.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=391

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 124/171 (73%), Gaps = 8/171 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRNL  316
            DQ +  TV +KVAG+ HLRS+    D+Q       +P    + F   +Y +S LQ P   
Sbjct  3    DQINHPTVVQKVAGQFHLRSS-FAQDMQVRSYNLSRPSPYERHFTAASYVSSGLQTPLMP  61

Query  315  STARSY------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
            +   +Y      + SPVF  APSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  62   ACKATYDLSMVSSVSPVFAHAPSEKGFASFAIDFLMGGVSAAVSKTAAAPIERVKLLIQN  121

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIK GRLSEPYKGIMDCF RT+KDEG+ SLWRGNTANVIRYFPTQALN
Sbjct  122  QDEMIKTGRLSEPYKGIMDCFRRTIKDEGVSSLWRGNTANVIRYFPTQALN  172



>ref|XP_009375063.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=384

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 130/168 (77%), Gaps = 21/168 (13%)
 Frame = -2

Query  474  TVSEKVAG-KLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN------  319
            T++EK +G +LHL S++H   +Q       +P +N + F +G+Y+N+ LQ P N      
Sbjct  9    TITEKFSGHELHL-SSSHYGVIQ-------RPSINQRRFSYGSYSNAALQYPMNQACRAN  60

Query  318  --LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDE  145
              L  +R   A PV ++AP EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDE
Sbjct  61   DPLVGSR---ALPVCIEAPKEKGFSGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDE  117

Query  144  MIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            MIKAGRLSEPYKGI DCFSRT+KDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  118  MIKAGRLSEPYKGIGDCFSRTMKDEGMVALWRGNTANVIRYFPTQALN  165



>ref|XP_006297905.1| hypothetical protein CARUB_v10013947mg [Capsella rubella]
 gb|EOA30803.1| hypothetical protein CARUB_v10013947mg [Capsella rubella]
Length=381

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 120/165 (73%), Gaps = 5/165 (3%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    T+++K AG+    S ++   +   R   YQ     +   +GNY+N+  Q    
Sbjct  2    VDQVQHPTIAQKAAGQFMRSSVSNDVHVGYPRPSMYQ-----RHATYGNYSNAAFQFPPT  56

Query  315  STARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  136
            S   +  ASPVFVQAP EKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK
Sbjct  57   SRMLATTASPVFVQAPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  116

Query  135  AGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            AGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  117  AGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  161



>ref|XP_009624983.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Nicotiana 
tomentosiformis]
Length=386

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 125/162 (77%), Gaps = 7/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQP----RNLSTA  307
            TV +K A +LHL S++   D+ + R    QP +  + F +GNY+N+ LQ     ++LS+ 
Sbjct  9    TVFQKAANQLHL-SSSLSQDVHA-RHGGVQPAVYQRRFAYGNYSNAGLQTCQATQDLSSI  66

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             S  ASPVFVQAP EKG   FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAGR
Sbjct  67   TS-NASPVFVQAPQEKGLAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGR  125

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI DCF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  126  LSEPYKGIGDCFGRTIKEEGFGSLWRGNTANVIRYFPTQALN  167



>ref|NP_187470.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
 ref|NP_850541.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
 sp|P31167.2|ADT1_ARATH RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocator 1; Short=ANT 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51358.1|AC012562_19 adenylate translocator; 17953-16629 [Arabidopsis thaliana]
 gb|AAK59440.1| putative adenylate translocator protein [Arabidopsis thaliana]
 gb|AAK68754.1| adenylate translocator [Arabidopsis thaliana]
 gb|AAL06907.1| AT3g08580/F17O14_5 [Arabidopsis thaliana]
 gb|AAL69497.1| putative adenylate translocator protein [Arabidopsis thaliana]
 gb|AAN15700.1| adenylate translocator [Arabidopsis thaliana]
 gb|AAO00747.1| adenylate translocator [Arabidopsis thaliana]
 dbj|BAE98910.1| adenylate translocator [Arabidopsis thaliana]
 gb|AEE74648.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
 gb|AEE74649.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
Length=381

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 123/165 (75%), Gaps = 5/165 (3%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    T+++K AG+  +RS+    D+Q     + +P +  +   +GNY+N+  Q    
Sbjct  2    VDQVQHPTIAQKAAGQF-MRSSVS-KDVQV---GYQRPSMYQRHATYGNYSNAAFQFPPT  56

Query  315  STARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  136
            S   +  ASPVFVQ P EKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK
Sbjct  57   SRMLATTASPVFVQTPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  116

Query  135  AGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            AGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  117  AGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  161



>ref|XP_009391889.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=391

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 123/171 (72%), Gaps = 8/171 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            DQ +  TV +K AG+ HL ST    D+Q+    F    +  + FK  NYTN  LQ   + 
Sbjct  3    DQVNHPTVVQKFAGQFHLGST-FSQDMQAIGYNFNTTSVYKRHFKTANYTNGALQSPVVP  61

Query  312  TAR-SY------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
              R SY      +ASP+F  AP+EKG   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  62   ACRASYDLSMLSSASPIFANAPAEKGLASFAIDFLMGGVSAAVSKTAAAPIERVKLLIQN  121

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIK GRLSEPYKGI DCF RT+++EG+ SLWRGNTANVIRYFPTQALN
Sbjct  122  QDEMIKTGRLSEPYKGISDCFKRTMQEEGVASLWRGNTANVIRYFPTQALN  172



>ref|XP_003543539.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like isoform 
X1 [Glycine max]
 ref|XP_006595041.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like isoform 
X2 [Glycine max]
 ref|XP_006595042.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like isoform 
X3 [Glycine max]
Length=395

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 130/176 (74%), Gaps = 9/176 (5%)
 Frame = -2

Query  501  MTIDQPHCLTVSEKVAGKLHLRSTTHV-PDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-  328
            M +D+    T+ +K+AG+LHLRS +++ P + +  +   +P L  + F   N++N+ L  
Sbjct  1    MMVDKQRYPTIEQKLAGQLHLRSNSNLSPHVGTCYERLKRPALFQQRFSLKNHSNAGLLC  60

Query  327  ---PRNLSTARSY----AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVK  169
               P   +T+  +    AASPV V +PSEK F  FA DF+MGGVSAAVSKTAAAPIER+K
Sbjct  61   PLVPAWKATSHLHSVASAASPVLVPSPSEKNFASFATDFLMGGVSAAVSKTAAAPIERIK  120

Query  168  LLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LLIQNQDEMIKAGRLSEPYKGI DCF RT KDEG+VSLWRGNTANVIRYFPTQALN
Sbjct  121  LLIQNQDEMIKAGRLSEPYKGIGDCFGRTTKDEGLVSLWRGNTANVIRYFPTQALN  176



>ref|XP_006439128.1| hypothetical protein CICLE_v10033595mg [Citrus clementina]
 ref|XP_006482889.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Citrus 
sinensis]
 gb|ESR52368.1| hypothetical protein CICLE_v10033595mg [Citrus clementina]
Length=385

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 127/172 (74%), Gaps = 14/172 (8%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKL-HLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRN  319
            IDQ    +V +KVAG+L H   + ++ D +       +P +  +   +GNY+N+  Q   
Sbjct  2    IDQVQHPSVMQKVAGQLLHSSLSQNIQDYE-------RPTMYQRRGAYGNYSNAAFQYPI  54

Query  318  LSTARS------YAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            +S A +        AS + VQAP+EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  55   VSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQ  114

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIK+GRLSEPYKGI DCF RT+KDEGIV+LWRGNTANVIRYFPTQALN
Sbjct  115  NQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALN  166



>ref|XP_010557791.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Tarenaya 
hassleriana]
 ref|XP_010557792.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Tarenaya 
hassleriana]
Length=384

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 126/166 (76%), Gaps = 3/166 (2%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    TV +K A +  LRS+    D+ ++   F +P ++ +   +GNY+N+  Q   +
Sbjct  2    VDQVQHPTVMQKAACQF-LRSSVS-QDINAYDGAFQRPSMHQRRAAYGNYSNAAFQYPLV  59

Query  315  STAR-SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             T+R +  ASPVFV APSEKG   FAIDF+MGGVSAAVSK AAAPIERVKLLIQNQDEMI
Sbjct  60   PTSRVASTASPVFVAAPSEKGLSIFAIDFLMGGVSAAVSKPAAAPIERVKLLIQNQDEMI  119

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT ++EGIVSLWRGNTANVIRYFPTQALN
Sbjct  120  KAGRLSEPYKGIGDCFKRTTQEEGIVSLWRGNTANVIRYFPTQALN  165



>gb|KDO83390.1| hypothetical protein CISIN_1g016015mg [Citrus sinensis]
 gb|KDO83391.1| hypothetical protein CISIN_1g016015mg [Citrus sinensis]
 gb|KDO83392.1| hypothetical protein CISIN_1g016015mg [Citrus sinensis]
Length=385

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 127/172 (74%), Gaps = 14/172 (8%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKL-HLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRN  319
            IDQ    +V +KVAG+L H   + ++ D +       +P +  +   +GNY+N+  Q   
Sbjct  2    IDQVQHPSVMQKVAGQLLHSSLSQNIQDYE-------RPTMYQRRGAYGNYSNAAFQYPI  54

Query  318  LSTARS------YAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            +S A +        AS + VQAP+EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  55   VSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQ  114

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIK+GRLSEPYKGI DCF RT+KDEGIV+LWRGNTANVIRYFPTQALN
Sbjct  115  NQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALN  166



>ref|XP_010419930.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010419931.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Camelina 
sativa]
Length=385

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            ++Q    T+ +K +    LRS+    D++ +   F  P        +GNY+N+  Q P  
Sbjct  2    VEQTQHPTILQKASSGQFLRSSVS-QDVKGYASAFQSPATYQSRASYGNYSNAAFQYPLA  60

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             ++  +   SPVFVQAP EKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  61   AASRIATTTSPVFVQAPGEKGFTNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  120

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLS+PYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  121  KAGRLSQPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  166



>ref|XP_009593341.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Nicotiana 
tomentosiformis]
Length=386

 Score =   203 bits (516),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 124/162 (77%), Gaps = 6/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQP----RNLSTA  307
            TV +KVA ++HL S++   D+ +      +P L  + F +GNY+N+ LQ     ++LS  
Sbjct  8    TVFQKVANQMHL-SSSLSQDVHARYGGIQRPALYQRRFAYGNYSNAGLQTCQATQDLSLI  66

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             +  ASPVFVQAP EKG   FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR
Sbjct  67   AA-NASPVFVQAPQEKGLAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  125

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI +CF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  126  LSEPYKGIGECFGRTIKEEGFGSLWRGNTANVIRYFPTQALN  167



>ref|XP_008798767.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008798768.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=391

 Score =   203 bits (516),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 122/171 (71%), Gaps = 8/171 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            DQ +  TV +KVA + HL S +   D+Q     F  P L  + F   ++ N+ LQ   + 
Sbjct  3    DQVNHPTVIQKVASQFHL-SPSFAQDMQVRSYNFSTPSLYERHFASASFVNNALQTPFMP  61

Query  312  TARSY-------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
              ++        + SPVF  APSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  62   ACKATCDLSMVSSVSPVFAHAPSEKGFASFAIDFLMGGVSAAVSKTAAAPIERVKLLIQN  121

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIKAGRLSEPYKGI DCF RT+KDEGI+SLWRGN ANVIRYFPTQALN
Sbjct  122  QDEMIKAGRLSEPYKGIADCFRRTIKDEGIISLWRGNAANVIRYFPTQALN  172



>ref|NP_001275285.1| ADP,ATP carrier protein, mitochondrial [Solanum tuberosum]
 gb|ABB29945.1| ADP/ATP translocator-like [Solanum tuberosum]
 gb|ABB86279.1| ADP,ATP carrier protein precursor-like [Solanum tuberosum]
Length=386

 Score =   202 bits (515),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 124/162 (77%), Gaps = 7/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----PRNLSTA  307
            TV +K A +LHLRS+    D+ + R    QP +  + F +GNY+N+ LQ     ++LS  
Sbjct  9    TVFQKAANQLHLRSSLS-QDVHA-RYGGVQPAIYRRHFAYGNYSNAGLQRGQATQDLSLI  66

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             S  ASPVFVQAP EKG   FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAGR
Sbjct  67   TS-NASPVFVQAPQEKGLAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGR  125

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI +CF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  126  LSEPYKGIGECFGRTIKEEGFGSLWRGNTANVIRYFPTQALN  167



>ref|XP_002884685.1| adenosine nucleotide translocator [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60944.1| adenosine nucleotide translocator [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   202 bits (514),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 119/166 (72%), Gaps = 6/166 (4%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            +DQ    T+++K AG+    S +    +   R   YQ     +   +GNY+N+  Q P  
Sbjct  2    VDQVQHPTIAQKAAGQFMRSSVSKDVHVGYQRPSMYQ-----RHATYGNYSNAAFQFPPT  56

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             S   +  ASPVFVQ P EKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  57   SSRMLATTASPVFVQTPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  116

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  117  KAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  162



>gb|KDO83389.1| hypothetical protein CISIN_1g016015mg [Citrus sinensis]
Length=397

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 127/172 (74%), Gaps = 14/172 (8%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKL-HLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRN  319
            IDQ    +V +KVAG+L H   + ++ D +       +P +  +   +GNY+N+  Q   
Sbjct  14   IDQVQHPSVMQKVAGQLLHSSLSQNIQDYE-------RPTMYQRRGAYGNYSNAAFQYPI  66

Query  318  LSTARS------YAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            +S A +        AS + VQAP+EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  67   VSAATTDLSMVPSTASAICVQAPAEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQ  126

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIK+GRLSEPYKGI DCF RT+KDEGIV+LWRGNTANVIRYFPTQALN
Sbjct  127  NQDEMIKSGRLSEPYKGIGDCFKRTMKDEGIVALWRGNTANVIRYFPTQALN  178



>ref|XP_003531442.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Glycine 
max]
 gb|KHN29226.1| ADP,ATP carrier protein 1, mitochondrial [Glycine soja]
Length=388

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 127/174 (73%), Gaps = 15/174 (9%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----  328
            +DQ    T+ +KVAG+LHLRS   V  ++S+   +  P +  +    GNY+N+ LQ    
Sbjct  2    LDQVQHPTIMDKVAGQLHLRSG--VSGIRSYEGAYCHPTMYQRP-SFGNYSNAALQYPVM  58

Query  327  -----PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLL  163
                   +LS A +  ASPVFV AP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLL
Sbjct  59   PSCKATMDLSAAAT-TASPVFVAAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLL  115

Query  162  IQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IQNQDEMIK GRLSEPYKGI DCF RT+ DEG+VSLWRGNTANVIRYFPTQALN
Sbjct  116  IQNQDEMIKTGRLSEPYKGIGDCFKRTMADEGVVSLWRGNTANVIRYFPTQALN  169



>emb|CDY09801.1| BnaC09g43600D [Brassica napus]
Length=380

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 123/168 (73%), Gaps = 10/168 (6%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            ++Q    T+ +K +G+L +R+     D+  +   F       +   +GNY+N+  Q    
Sbjct  2    VEQTQNPTILQKASGQL-MRTGVVSHDIHGYTSSF------QRRATYGNYSNAAFQYPLA  54

Query  315  STARSYAA---SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDE  145
            +T+R  A    SPVFVQAPSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDE
Sbjct  55   ATSRIVATTTTSPVFVQAPSEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDE  114

Query  144  MIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            M+KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  115  MLKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  162



>gb|KHN30132.1| ADP,ATP carrier protein, mitochondrial [Glycine soja]
Length=395

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 9/176 (5%)
 Frame = -2

Query  501  MTIDQPHCLTVSEKVAGKLHLRSTTHV-PDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-  328
            M +D+    T+ +K+AG+LHLRS +++ P + +  +   +P L  + F   N++N+ L  
Sbjct  1    MMVDKQRYPTIEQKLAGQLHLRSNSNLSPHVGTCYERLKRPALFQQRFSLKNHSNAGLLC  60

Query  327  ---PRNLSTARSY----AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVK  169
               P   +T+  +    AASPV V +PSEK F  FA DF+MGGVSAAVSKTAAAPIER+K
Sbjct  61   PLVPAWKATSHLHSVGSAASPVLVPSPSEKNFASFATDFLMGGVSAAVSKTAAAPIERIK  120

Query  168  LLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LLIQNQDEMIKAGRLSEPYKGI DCF RT KDEG VSLWRGNTANVIRYFPTQALN
Sbjct  121  LLIQNQDEMIKAGRLSEPYKGIGDCFGRTTKDEGFVSLWRGNTANVIRYFPTQALN  176



>ref|XP_002531911.1| ADP,ATP carrier protein, putative [Ricinus communis]
 gb|EEF30484.1| ADP,ATP carrier protein, putative [Ricinus communis]
Length=385

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 124/168 (74%), Gaps = 8/168 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----P  325
            DQ    +V +KVAG+ +L S+    D Q F     +P L  +   +GNYTN+  Q     
Sbjct  3    DQVQYPSVMQKVAGQ-YLHSSLS-QDFQGFDGSLQRPALYQRR-AYGNYTNAAFQYPMGC  59

Query  324  RNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDE  145
             +LS   +  AS V VQAPSEKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDE
Sbjct  60   ADLSVVPT-TASSVCVQAPSEKGFAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDE  118

Query  144  MIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            MIK+GRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  119  MIKSGRLSEPYKGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALN  166



>ref|XP_004229620.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Solanum 
lycopersicum]
 ref|XP_010324414.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Solanum 
lycopersicum]
Length=375

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 125/169 (74%), Gaps = 15/169 (9%)
 Frame = -2

Query  501  MTIDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCF-YQPFLNSKTFKHGNYTNSMLQP  325
            MT+DQP   +V+ K AG    RST +       RD   YQ     + +K+G+ T   L  
Sbjct  1    MTMDQPQYPSVTHKAAGNFLGRSTQN-------RDFMAYQ-----RQYKYGSQTKPWLHR  48

Query  324  -RNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  148
               +    SY+ SPVFVQAPSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQD
Sbjct  49   CEGMPVVSSYS-SPVFVQAPSEKGFTSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQD  107

Query  147  EMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            EMIKAGRLS+PY GI +CFSRT+K+EG++SLWRGNTANVIRYFPTQALN
Sbjct  108  EMIKAGRLSKPYGGIAECFSRTMKEEGVMSLWRGNTANVIRYFPTQALN  156



>sp|P25083.1|ADT1_SOLTU RecName: Full=ADP,ATP carrier protein, mitochondrial; AltName: 
Full=ADP/ATP translocase; AltName: Full=Adenine nucleotide 
translocator; Short=ANT; Flags: Precursor [Solanum tuberosum]
 emb|CAA44054.1| ADP /ATP translocator [Solanum tuberosum]
Length=386

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 124/162 (77%), Gaps = 7/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----PRNLSTA  307
            TV +K A +L LRS+    D+ + R    QP +  + F +GNY+N+ LQ     ++LS  
Sbjct  9    TVFQKAANQLDLRSSLS-QDVHA-RYGGVQPAIYQRHFAYGNYSNAGLQRGQATQDLSLI  66

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             S  ASPVFVQAP EKGF  FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAGR
Sbjct  67   TS-NASPVFVQAPQEKGFAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGR  125

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI +CF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  126  LSEPYKGIGECFGRTIKEEGFGSLWRGNTANVIRYFPTQALN  167



>ref|XP_011037819.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Populus 
euphratica]
 ref|XP_011037820.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Populus 
euphratica]
Length=385

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 120/166 (72%), Gaps = 16/166 (10%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTARSY-  298
            +V +K+A ++H  S        SF   F +P L+ + F +GNY+N+  Q       +S  
Sbjct  9    SVMQKMASQVHHSS--------SFSQGFQRPALHQRQFAYGNYSNAGFQYAMTRACQSTP  60

Query  297  -------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
                   + S VFVQAPSEKG  GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  61   DMSLIASSTSSVFVQAPSEKGLAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  120

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            K GRLSEPYKGI DCFSRT+KDEG+VSLWRGN  NVIRYFPTQALN
Sbjct  121  KTGRLSEPYKGIGDCFSRTMKDEGMVSLWRGNAVNVIRYFPTQALN  166



>emb|CAA05979.1| adenine nucleotide translocator [Lupinus albus]
Length=388

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 126/172 (73%), Gaps = 11/172 (6%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    T+ EKV+ +LHLRS     D+QS+   F +P +  +    GNY+N+ LQ   +
Sbjct  2    VDQVQRPTIMEKVSSQLHLRSGVS-SDIQSYDAAFRRPAVYQRR-SFGNYSNAALQYPVM  59

Query  315  STARSYA-------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
             + R+         ASPVF  AP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  60   PSCRATTDLSSVATASPVFAAAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLIQ  117

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIK+GRLSEPYKGI DCF RT+ DEG+V+LWRGNTANVIRYFPTQALN
Sbjct  118  NQDEMIKSGRLSEPYKGIGDCFKRTMADEGVVALWRGNTANVIRYFPTQALN  169



>ref|XP_008813282.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=388

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 127/172 (74%), Gaps = 13/172 (8%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTF--KHGNYTNSMLQPRN  319
            DQ +  TV +KVAG+ HLRS+    D+Q+    F+ P L  + +  K+G   N ++Q   
Sbjct  3    DQVNHPTVIQKVAGQFHLRSS-FSQDIQAHNCSFHMPSLYERQYTGKNGGLHNPLMQ---  58

Query  318  LSTARSYA------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            +S+A SY        SPVF  APSEKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  59   VSSA-SYDLPMLTPVSPVFAHAPSEKGFASFAVDFLMGGVSAAVSKTAAAPIERVKLLIQ  117

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIK+GRLSEPYKGI DCF RT++DEG+ SLWRGN  NVIRYFPTQALN
Sbjct  118  NQDEMIKSGRLSEPYKGIGDCFGRTIRDEGLASLWRGNMVNVIRYFPTQALN  169



>ref|NP_001234018.1| ADP/ATP translocator [Solanum lycopersicum]
 gb|AAB49700.1| ADP/ATP translocator [Solanum lycopersicum]
Length=386

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 123/162 (76%), Gaps = 7/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----PRNLSTA  307
            TV +K A +L LRS+    D+ + R    QP +  + F +GNY+N+ L      ++LS  
Sbjct  9    TVFQKAANQLDLRSSLS-QDVHA-RYGGVQPAIYQRHFAYGNYSNAGLHRGQATQDLSLI  66

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             S  ASPVFVQAP EKGF  FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAGR
Sbjct  67   TS-NASPVFVQAPQEKGFAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGR  125

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI DCF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  126  LSEPYKGIGDCFGRTIKEEGFGSLWRGNTANVIRYFPTQALN  167



>ref|XP_010489717.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Camelina 
sativa]
Length=314

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  402  RDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMG  223
            +  + +P +  +   +GNY+N+  Q    S   + AASPVFVQAP EKGF  FA+DF+MG
Sbjct  13   KSAYQRPSMYQRHATYGNYSNAAFQFPPTSRMLATAASPVFVQAPGEKGFTNFALDFLMG  72

Query  222  GVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGN  43
            GVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RTVKDEG  SLWRGN
Sbjct  73   GVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTVKDEGFGSLWRGN  132

Query  42   TANVIRYFPTQALN  1
            TANVIRYFPTQALN
Sbjct  133  TANVIRYFPTQALN  146



>ref|XP_010464465.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Camelina 
sativa]
Length=366

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  402  RDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMG  223
            +  + +P +  +   +GNY+N+  Q    S   + AASPVFVQAP EKGF  FA+DF+MG
Sbjct  13   KSAYQRPSMYQRHATYGNYSNAAFQFPPTSRMLATAASPVFVQAPGEKGFTNFALDFLMG  72

Query  222  GVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGN  43
            GVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RTVKDEG  SLWRGN
Sbjct  73   GVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTVKDEGFGSLWRGN  132

Query  42   TANVIRYFPTQALN  1
            TANVIRYFPTQALN
Sbjct  133  TANVIRYFPTQALN  146



>gb|ABB55387.1| ADP,ATP carrier protein precursor-like [Solanum tuberosum]
Length=386

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 123/162 (76%), Gaps = 7/162 (4%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----PRNLSTA  307
            TV +K A +LHLRS+    D+ + R    QP +  + F  GNY+N+ LQ     ++LS  
Sbjct  9    TVFQKAANQLHLRSSLS-QDVHA-RYGGVQPAIYQRHFACGNYSNAGLQRGQATQDLSLI  66

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             S  ASPVFVQAP EKG   FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAGR
Sbjct  67   TS-NASPVFVQAPQEKGLAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGR  125

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI +CF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  126  LSEPYKGIGECFGRTIKEEGFGSLWRGNTANVIRYFPTQALN  167



>dbj|BAH56914.1| AT3G08580 [Arabidopsis thaliana]
Length=159

 Score =   193 bits (491),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 116/160 (73%), Gaps = 5/160 (3%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    T+++K AG+    S +   D+Q     + +P +  +   +GNY+N+  Q    
Sbjct  2    VDQVQHPTIAQKAAGQFMRSSVSK--DVQV---GYQRPSMYQRHATYGNYSNAAFQFPPT  56

Query  315  STARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  136
            S   +  ASPVFVQ P EKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK
Sbjct  57   SRMLATTASPVFVQTPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  116

Query  135  AGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFP  16
            AGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFP
Sbjct  117  AGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFP  156



>emb|CAA46518.1| adenylate translocator [Arabidopsis thaliana]
 prf||1909354A adenylate translocator
Length=379

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 120/158 (76%), Gaps = 5/158 (3%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTARSYA  295
            T+++K AG+  +RS+    D+Q     + +P +  +   +GNY+N+  Q    S   +  
Sbjct  7    TIAQKAAGQF-MRSSVS-KDVQV---GYQRPSMYQRHATYGNYSNAAFQFPPTSRMLATT  61

Query  294  ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEP  115
            ASPVFVQ P EKGF  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEP
Sbjct  62   ASPVFVQTPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEP  121

Query  114  YKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            YKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  122  YKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  159



>ref|XP_004513729.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Cicer 
arietinum]
Length=389

 Score =   200 bits (509),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 123/173 (71%), Gaps = 12/173 (7%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    T+ EKV G+LH RS+       S+   F  P +  K + +GNY+N+ LQ    
Sbjct  2    VDQVQHPTIMEKVTGQLHRRSSPS-SGFTSYDGTFRHPAMYQK-YSYGNYSNAALQSPMA  59

Query  315  STARSY--------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
            ST R+          ASP+FV AP+EK    F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  60   STCRATVDLSAVATTASPLFVAAPAEKSH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  117

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLSEPYKGI DCF RT+ DEG+V+LWRGNTANVIRYFPTQALN
Sbjct  118  QNQDEMIKTGRLSEPYKGIGDCFKRTMADEGVVALWRGNTANVIRYFPTQALN  170



>ref|XP_010547255.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial [Tarenaya 
hassleriana]
Length=384

 Score =   200 bits (508),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            +DQ    +V +K A +  LRS+    D+ ++   F +P +  +   +GNY+N+  Q P  
Sbjct  2    VDQVQHPSVMQKAAHQF-LRSSVS-QDIHAYDGVFQRPSMYQRRAAYGNYSNAAFQYPIV  59

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             S+  +  ASPVFV APSEKGF  FA DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  60   PSSRVTSTASPVFVAAPSEKGFAHFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  119

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+++EG  SLWRGNTANVIRYFPTQALN
Sbjct  120  KAGRLSEPYKGISDCFKRTIQEEGFGSLWRGNTANVIRYFPTQALN  165



>gb|KHG01208.1| ADP,ATP carrier 3, mitochondrial -like protein [Gossypium arboreum]
Length=379

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (85%), Gaps = 6/124 (5%)
 Frame = -2

Query  354  GNYTNS----MLQPRNLSTARSY--AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTA  193
            G YTN      LQP   ST  +Y    SP+FVQAPSEKGF GF +DF+MGGVSAAVSKTA
Sbjct  37   GAYTNGGIHVALQPSRHSTGLAYMPTVSPIFVQAPSEKGFTGFMVDFLMGGVSAAVSKTA  96

Query  192  AAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPT  13
            AAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF+RT+KDEG++SLWRGNTANV+RYFPT
Sbjct  97   AAPIERVKLLIQNQDEMIKAGRLSEPYKGITDCFARTIKDEGVISLWRGNTANVLRYFPT  156

Query  12   QALN  1
            QALN
Sbjct  157  QALN  160



>gb|KHN39926.1| ADP,ATP carrier protein 1, mitochondrial [Glycine soja]
Length=389

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 126/173 (73%), Gaps = 12/173 (7%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----  328
            +DQ    T+ +KVAG+LHLRS      ++S+   +  P +  +    GNY+N+ LQ    
Sbjct  2    VDQVQHPTIMDKVAGQLHLRSGLS-SGIRSYDGAYRHPAMYQRP-SFGNYSNAALQFPVM  59

Query  327  PRNLST----ARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
            P   +T    A + +ASPVFV AP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  60   PTCKATMDLSATATSASPVFVAAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  117

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLSEPYKGI DCF RT+ DEG +SLWRGNTANVIRYFPTQALN
Sbjct  118  QNQDEMIKTGRLSEPYKGIGDCFKRTMADEGAISLWRGNTANVIRYFPTQALN  170



>ref|XP_010260254.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nelumbo 
nucifera]
 ref|XP_010260255.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=379

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 111/143 (78%), Gaps = 6/143 (4%)
 Frame = -2

Query  411  QSFRDCFYQPFLNSKTFK----HGNYTNSMLQPRNLSTAR--SYAASPVFVQAPSEKGFV  250
            QS+      P L+++ F      G Y N  LQ  +LS  R  +   SPVFVQAPSEKGF 
Sbjct  17   QSYLFSSLSPNLHARHFATYNLSGAYMNGGLQSSHLSACRGSNMPLSPVFVQAPSEKGFG  76

Query  249  GFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDE  70
            GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RT+KDE
Sbjct  77   GFVIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGITDCFGRTIKDE  136

Query  69   GIVSLWRGNTANVIRYFPTQALN  1
            G +SLWRGNTANV+RYFPTQALN
Sbjct  137  GFISLWRGNTANVLRYFPTQALN  159



>emb|CDX78525.1| BnaA03g04370D [Brassica napus]
Length=377

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 122/166 (73%), Gaps = 9/166 (5%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            ++Q    T+ +K +G++ LRS     D+  +   F       +   +GNY+N+  Q    
Sbjct  2    VEQTQQPTIFQKASGQI-LRSGVS-QDIHGYTSGF------QRRATYGNYSNAAFQYPLA  53

Query  315  STARSYAA-SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
            +++R  A  SPVFVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  54   ASSRIVATTSPVFVQAPGEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  113

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  114  KAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  159



>ref|XP_007014994.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao]
 ref|XP_007014995.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao]
 gb|EOY32613.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao]
 gb|EOY32614.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao]
Length=391

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 126/171 (74%), Gaps = 8/171 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D+    +V +KVAG+LHL + +   D+Q     F +P L+ + F  G+   ++  P   +
Sbjct  3    DRHQHPSVMQKVAGQLHL-TPSLSQDVQYRYGGFQRPALHQRRFASGSCNAALRYPMAQA  61

Query  312  TARSY-------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
               +Y       ++SP+ VQAPSEK F  FA+DF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  62   CPANYDLSMVGSSSSPICVQAPSEKSFSSFAVDFLMGGVSAAVSKTAAAPIERVKLLIQN  121

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMI+AGRLSEPYKGI DCF RT++DEG+VSLWRGNTANVIRYFPTQALN
Sbjct  122  QDEMIRAGRLSEPYKGIGDCFKRTIQDEGMVSLWRGNTANVIRYFPTQALN  172



>emb|CDX69638.1| BnaA10g19870D [Brassica napus]
Length=372

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 104/123 (85%), Gaps = 4/123 (3%)
 Frame = -2

Query  357  HGNYTNSMLQPRNLSTARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAA  190
            +GNYTN+  Q    +T+R  A     SPVFVQAPSEKGF  FAIDF+MGGVSAAVSKTAA
Sbjct  32   YGNYTNAAFQYPLAATSRIVATTTTTSPVFVQAPSEKGFSSFAIDFLMGGVSAAVSKTAA  91

Query  189  APIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQ  10
            APIERVKLLIQNQDEM+KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQ
Sbjct  92   APIERVKLLIQNQDEMLKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQ  151

Query  9    ALN  1
            ALN
Sbjct  152  ALN  154



>ref|NP_001276257.1| ADP,ATP carrier protein 1, mitochondrial-like [Glycine max]
 gb|ACU18447.1| unknown [Glycine max]
Length=389

 Score =   197 bits (502),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 126/173 (73%), Gaps = 12/173 (7%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ----  328
            +DQ    T+ +KVAG+LHLRS      ++S+   +  P +  +    GNY+N+ LQ    
Sbjct  2    VDQVQHPTIMDKVAGQLHLRSGLS-SGIRSYDGAYRHPAMYQRP-SFGNYSNAALQFPVM  59

Query  327  PRNLST----ARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
            P   +T    A + +ASPVFV AP+EKG   F +DF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  60   PTCKATMDLSATATSASPVFVAAPAEKGH--FLLDFLMGGVSAAVSKTAAAPIERVKLLI  117

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLSEPYKGI DCF RT+ DEG +SLWRGNTANVIRYFPTQALN
Sbjct  118  QNQDEMIKTGRLSEPYKGIGDCFKRTMADEGAISLWRGNTANVIRYFPTQALN  170



>emb|CDX70507.1| BnaC03g05910D [Brassica napus]
Length=377

 Score =   197 bits (501),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 121/166 (73%), Gaps = 9/166 (5%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            ++Q    T+ +K +G++ LRS     D+  +   F       +   +GNY+N+  Q    
Sbjct  2    VEQTQQPTIFQKASGQI-LRSGVS-QDIHGYTSGF------QRRATYGNYSNAAFQYPLA  53

Query  315  STAR-SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
            +T+R     SPVFVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  54   ATSRIVTTTSPVFVQAPGEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  113

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  114  KAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  159



>ref|XP_007148866.1| hypothetical protein PHAVU_005G020700g [Phaseolus vulgaris]
 gb|ESW20860.1| hypothetical protein PHAVU_005G020700g [Phaseolus vulgaris]
Length=385

 Score =   197 bits (501),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 123/169 (73%), Gaps = 8/169 (5%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    T+ +KVAG+LHLRS      ++S+   +  P +  +    GNY+N+ L P   
Sbjct  2    VDQVQHPTIMDKVAGQLHLRSG-FSSGIKSYDGAYRHPAMYQRP-SFGNYSNAALMPSCK  59

Query  315  STARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  148
            +T    AA    SPVFV AP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLIQNQD
Sbjct  60   TTMDLSAAVATPSPVFVAAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQD  117

Query  147  EMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            EM+K GRLSEPYKGI DCF RT+ +EG VSLWRGNTANVIRYFPTQALN
Sbjct  118  EMLKTGRLSEPYKGIGDCFKRTMAEEGAVSLWRGNTANVIRYFPTQALN  166



>emb|CDX91117.1| BnaC02g04800D [Brassica napus]
Length=381

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 120/171 (70%), Gaps = 13/171 (8%)
 Frame = -2

Query  504  EMTIDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQP  325
            E T  QP  L   +K +    +RS     D+  +   F       +   +GNY+N+  Q 
Sbjct  3    EQTQQQPSIL---QKASSGQLMRSGVS-QDIHGYASGF------QRRATYGNYSNAAFQY  52

Query  324  RNLSTARSYAA---SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
               +++R  A    SPVFVQAPSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  53   PLAASSRIVATTTTSPVFVQAPSEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQN  112

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEM+KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  113  QDEMLKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  163



>emb|CAN81107.1| hypothetical protein VITISV_008170 [Vitis vinifera]
Length=377

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 117/163 (72%), Gaps = 10/163 (6%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRN  319
            IDQP   T+ +KVAG LH     H  ++Q+F   F QP L  +   +GNYTN+ LQ P  
Sbjct  2    IDQPQYPTIMQKVAGHLH-----HSQNIQAFHGRFQQPTLQQRHSAYGNYTNAALQYPMC  56

Query  318  LSTAR----SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
             +T          SPVFV AP EKG  GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  57   GATFDPLMVGSNVSPVFVPAPKEKGLAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ  116

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRY  22
            DEMIK GRLSEPYKGI +CFSRT+KDEG +SLWRGNTAN + +
Sbjct  117  DEMIKTGRLSEPYKGIGECFSRTIKDEGFMSLWRGNTANALNF  159



>ref|XP_009131345.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial [Brassica 
rapa]
Length=377

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 121/166 (73%), Gaps = 9/166 (5%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            ++Q    T+ +K +G++ LRS     D+  +   F       +   +GNY+N+  Q    
Sbjct  2    VEQTQQPTIFQKASGQI-LRSGVS-QDIHGYASGF------QRRATYGNYSNAAFQYPLA  53

Query  315  STARSYAA-SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
            +++R  A  SPVFVQAP EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  54   ASSRIVATTSPVFVQAPGEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEML  113

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+KDEG  SLWRGN ANVIRYFPTQALN
Sbjct  114  KAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNAANVIRYFPTQALN  159



>gb|KEH33219.1| ADP/ATP carrier protein [Medicago truncatula]
Length=393

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 123/173 (71%), Gaps = 12/173 (7%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    T+ EKV G+LH RS      ++ +   +  P + ++ F +GNY+N+ L     
Sbjct  6    VDQVKQPTIMEKVTGQLHRRSGLS-SGIRGYEGTYRHPAM-AQRFSYGNYSNAALMNPMA  63

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
             T R+          ASPVFV AP+EK    F IDF+MGGVSAAVSKTAAAPIER+KLLI
Sbjct  64   PTCRATVDLSAVATTASPVFVAAPAEKSH--FVIDFLMGGVSAAVSKTAAAPIERIKLLI  121

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK+GRLSEPYKGI DCF RT+ DEG+V+LWRGNTANVIRYFPTQALN
Sbjct  122  QNQDEMIKSGRLSEPYKGIGDCFKRTMADEGVVALWRGNTANVIRYFPTQALN  174



>gb|KEH33218.1| ADP/ATP carrier protein [Medicago truncatula]
Length=389

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 123/173 (71%), Gaps = 12/173 (7%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    T+ EKV G+LH RS      ++ +   +  P + ++ F +GNY+N+ L     
Sbjct  2    VDQVKQPTIMEKVTGQLHRRSGLS-SGIRGYEGTYRHPAM-AQRFSYGNYSNAALMNPMA  59

Query  315  STARSY--------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
             T R+          ASPVFV AP+EK    F IDF+MGGVSAAVSKTAAAPIER+KLLI
Sbjct  60   PTCRATVDLSAVATTASPVFVAAPAEKSH--FVIDFLMGGVSAAVSKTAAAPIERIKLLI  117

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK+GRLSEPYKGI DCF RT+ DEG+V+LWRGNTANVIRYFPTQALN
Sbjct  118  QNQDEMIKSGRLSEPYKGIGDCFKRTMADEGVVALWRGNTANVIRYFPTQALN  170



>ref|XP_004306529.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=385

 Score =   195 bits (495),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 125/173 (72%), Gaps = 16/173 (9%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    TV +KVAG+L  +S      +QS+   F +  +  +   +GNY+N+ LQ   +
Sbjct  2    VDQVQHPTVMQKVAGQLFQQS------IQSYDTGFQRQGMYQRRPAYGNYSNAALQYPVM  55

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R+ A        ASPVFVQAP+EK    F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  56   PACRATADLSMIPSTASPVFVQAPAEKSH--FVIDFLMGGVSAAVSKTAAAPIERVKLLI  113

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIKAGRLSEPYKGI +CFSRT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  114  QNQDEMIKAGRLSEPYKGIGECFSRTIKEEGFGSLWRGNTANVIRYFPTQALN  166



>ref|XP_002517886.1| ADP,ATP carrier protein, putative [Ricinus communis]
 gb|EEF44404.1| ADP,ATP carrier protein, putative [Ricinus communis]
Length=379

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 104/126 (83%), Gaps = 2/126 (2%)
 Frame = -2

Query  372  SKTFKHGNYTNSMLQP--RNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSK  199
            S T  +GN   + L P  R  S A +   SPVFVQAPSEKG  GF IDF+MGGVSAAVSK
Sbjct  34   SMTGLYGNGLQNHLHPALRGTSLAVASPLSPVFVQAPSEKGVSGFLIDFLMGGVSAAVSK  93

Query  198  TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYF  19
            TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RT+KDEG++SLWRGNTANVIRYF
Sbjct  94   TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGITDCFGRTMKDEGVLSLWRGNTANVIRYF  153

Query  18   PTQALN  1
            PTQALN
Sbjct  154  PTQALN  159



>ref|XP_007043627.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
 ref|XP_007043628.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
 ref|XP_007043629.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
 gb|EOX99458.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
 gb|EOX99459.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
 gb|EOX99460.1| ADP/ATP carrier 3 isoform 1 [Theobroma cacao]
Length=380

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 113/144 (78%), Gaps = 7/144 (5%)
 Frame = -2

Query  411  QSFRDCFYQPFLNSKTFK-HGNYTNS----MLQPRNLSTARSYAA--SPVFVQAPSEKGF  253
            QS+      P L++K +   G Y N      LQP    T  ++ +  SP+FVQAP+EKGF
Sbjct  17   QSYFISRLSPNLHAKNYNVTGAYANGGIHVALQPSCQDTGFAHVSPVSPIFVQAPAEKGF  76

Query  252  VGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKD  73
             GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF+RT+KD
Sbjct  77   SGFMVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGITDCFARTIKD  136

Query  72   EGIVSLWRGNTANVIRYFPTQALN  1
            EG+++LWRGNTANVIRYFPTQALN
Sbjct  137  EGVLALWRGNTANVIRYFPTQALN  160



>ref|XP_009336233.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Pyrus x 
bretschneideri]
 ref|XP_009336234.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Pyrus x 
bretschneideri]
Length=380

 Score =   192 bits (488),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 111/144 (77%), Gaps = 7/144 (5%)
 Frame = -2

Query  411  QSFRDCFYQPFLNSKTFK-HGNYTNSMLQPRNLSTARSYAA------SPVFVQAPSEKGF  253
            QS+  C   P ++++ +  +G Y N  LQ   L T  S A       SP+ VQAP+EKG 
Sbjct  17   QSYLICRLSPRIHTRNYGVNGAYANGALQSPLLPTFDSTALAQVSSLSPIMVQAPAEKGA  76

Query  252  VGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKD  73
             GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQ+EMIKAGRLSEPYKGI DCF+RT+KD
Sbjct  77   AGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQNEMIKAGRLSEPYKGITDCFARTIKD  136

Query  72   EGIVSLWRGNTANVIRYFPTQALN  1
            EG+ SLWRGNTANVIRYFPTQA N
Sbjct  137  EGVFSLWRGNTANVIRYFPTQAFN  160



>ref|XP_009121762.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Brassica 
rapa]
Length=373

 Score =   192 bits (487),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 103/124 (83%), Gaps = 5/124 (4%)
 Frame = -2

Query  357  HGNYTNSMLQPRNLSTARSYAA-----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTA  193
            +GNYTN+  Q    +T+R  A      SPVFVQAPSEKGF  FAID +MGGVSAAVSKTA
Sbjct  32   YGNYTNAAFQYPLAATSRIVATTTTTTSPVFVQAPSEKGFSSFAIDLLMGGVSAAVSKTA  91

Query  192  AAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPT  13
            AAPIER+KLLIQN+DEM+KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPT
Sbjct  92   AAPIERLKLLIQNRDEMLKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPT  151

Query  12   QALN  1
            QALN
Sbjct  152  QALN  155



>dbj|BAD91181.1| putative mitochondrial adenylate transporter [Mesembryanthemum 
crystallinum]
Length=388

 Score =   192 bits (488),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 118/166 (71%), Gaps = 12/166 (7%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHV---PDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTAR  304
            +V +K AG+ HL S       P L   +     P L+ + F +GNY+N+  Q    ST +
Sbjct  9    SVIQKAAGQFHLSSGLSQITQPRLGGSQG----PALHQRRFAYGNYSNAAFQYPTSSTTQ  64

Query  303  SYA-----ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
              +     ASPV   AP+EK F  FAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM+
Sbjct  65   DLSFVNTMASPVVAHAPAEKNFKTFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEML  124

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            ++GRLSEPYKGI DCF RT  DEG+++LWRGNTANVIRYFPTQALN
Sbjct  125  RSGRLSEPYKGIGDCFKRTTADEGMIALWRGNTANVIRYFPTQALN  170



>ref|XP_008342894.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Malus domestica]
 ref|XP_008362445.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Malus 
domestica]
 ref|XP_008368648.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Malus 
domestica]
Length=380

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 111/144 (77%), Gaps = 7/144 (5%)
 Frame = -2

Query  411  QSFRDCFYQPFLNSKTFK-HGNYTNSMLQPRNLST------ARSYAASPVFVQAPSEKGF  253
            QS+  C   P ++++ +  +G Y N  LQ   L T      A+  + SPV   AP+EKG 
Sbjct  17   QSYLICRLSPKIHTRNYGVNGAYANGALQSPLLPTFDSTALAQXSSLSPVMAXAPAEKGA  76

Query  252  VGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKD  73
             GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF+RT+KD
Sbjct  77   AGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGITDCFARTIKD  136

Query  72   EGIVSLWRGNTANVIRYFPTQALN  1
            EG++SLWRGNTANVIRYFPTQA N
Sbjct  137  EGVLSLWRGNTANVIRYFPTQAFN  160



>ref|XP_008346928.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Malus domestica]
Length=384

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 125/173 (72%), Gaps = 17/173 (10%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    +V +KVAG+L  +S      +Q + + F +P +  +   +GNYTN+ LQ   +
Sbjct  2    VDQVQHPSVVQKVAGQLLQQS------IQGYDNGFQRPGMYQRR-AYGNYTNAALQYPFM  54

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R+          ASP+FVQAP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  55   PACRATTDMSLVPSTASPIFVQAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  112

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLS+PYKGI +CFSRT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  113  QNQDEMIKTGRLSQPYKGIGECFSRTIKEEGFGSLWRGNTANVIRYFPTQALN  165



>ref|XP_004306530.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=385

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 124/173 (72%), Gaps = 16/173 (9%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    TV +KVAG+L  +S      +Q +   F +  +  +   +GNY+N+  Q   +
Sbjct  2    VDQVQHPTVMQKVAGQLLQQS------IQGYDTGFQRQGMYQRRPAYGNYSNAASQYPVM  55

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
            +  R+ A        ASPVFVQAP+EKG   F +DF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  56   TACRATADLSMIPSTASPVFVQAPAEKGH--FFVDFLMGGVSAAVSKTAAAPIERVKLLI  113

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIKAGRLSEPYKGI +CFSRT+K+EG  SLWRGNTANVIRYFPTQA N
Sbjct  114  QNQDEMIKAGRLSEPYKGIGECFSRTIKEEGFSSLWRGNTANVIRYFPTQAFN  166



>ref|XP_009354735.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Pyrus x 
bretschneideri]
Length=384

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 125/173 (72%), Gaps = 17/173 (10%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    +V +KVAG+L  +S      +Q + + F +P +  +   +GNYTN+ LQ   +
Sbjct  2    VDQVQHPSVVQKVAGQLLQQS------IQGYDNGFQRPGMYQRR-AYGNYTNAALQYPFM  54

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R+          ASP+FVQAP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  55   PACRATTDMSLVPSTASPIFVQAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  112

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLS+PYKGI +CFSRT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  113  QNQDEMIKTGRLSQPYKGIGECFSRTIKEEGFGSLWRGNTANVIRYFPTQALN  165



>ref|XP_008375169.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Malus domestica]
 ref|XP_008364706.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Malus domestica]
Length=384

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 125/173 (72%), Gaps = 17/173 (10%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    +V +KVAG+L  +S      +Q + + F +P +  +   +GNYTN+ LQ   +
Sbjct  2    VDQVQHPSVVQKVAGQLLQQS------IQGYDNGFQRPGMYQRR-AYGNYTNAALQYPFM  54

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R+          ASP+FVQAP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  55   PACRATTDMSLVPSTASPIFVQAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  112

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLS+PYKGI +CFSRT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  113  QNQDEMIKTGRLSQPYKGIGECFSRTIKEEGFGSLWRGNTANVIRYFPTQALN  165



>ref|XP_008346927.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Malus 
domestica]
Length=384

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 125/173 (72%), Gaps = 17/173 (10%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    +V +KVAG+L  +S      +Q + + F +P +  +   +GNYTN+ LQ   +
Sbjct  2    VDQVQHPSVVQKVAGQLLQQS------IQGYDNGFQRPGMYQRR-AYGNYTNAALQYPFM  54

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R+          ASP+FVQAP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  55   PACRATTDMSLVPSTASPIFVQAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  112

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLS+PYKGI +CFSRT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  113  QNQDEMIKXGRLSQPYKGIGECFSRTIKEEGFGSLWRGNTANVIRYFPTQALN  165



>ref|XP_011011044.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Populus 
euphratica]
Length=389

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 121/174 (70%), Gaps = 16/174 (9%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSF--RDCFYQPFLNSKTFKHGNYTNSMLQ---  328
            DQ    +V +KVAG+  L S +     Q F     F +P L  +   +GNY+N   Q   
Sbjct  3    DQIQHPSVMKKVAGQFLLSSVS-----QDFGCDGAFQRPALYQRR-AYGNYSNPAFQYPM  56

Query  327  PRNLSTARSYA-----ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLL  163
             R  + A   +     AS V VQAP+EKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLL
Sbjct  57   GRTWAAASDLSIVPPTASSVLVQAPAEKGFASFAIDFLMGGVSAAVSKTAAAPIERVKLL  116

Query  162  IQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IQNQDEMIK+GRLSEPYKGI DCF RT++DEG  SLWRGNTANVIRYFPTQALN
Sbjct  117  IQNQDEMIKSGRLSEPYKGIGDCFKRTIQDEGFGSLWRGNTANVIRYFPTQALN  170



>ref|XP_007218125.1| hypothetical protein PRUPE_ppa007062mg [Prunus persica]
 gb|EMJ19324.1| hypothetical protein PRUPE_ppa007062mg [Prunus persica]
Length=384

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 123/173 (71%), Gaps = 17/173 (10%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    +V +KVAG+L  +S      +Q +   F +P +  +   +GNY+N+ LQ   +
Sbjct  2    VDQVQHPSVVQKVAGQLLQQS------IQGYDSGFQRPGMYQRR-AYGNYSNAALQYPFM  54

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R+          ASP+FVQAP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  55   PACRATTDLSLVPSTASPIFVQAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  112

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLSEPYKGI DCF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  113  QNQDEMIKTGRLSEPYKGIGDCFGRTIKEEGFGSLWRGNTANVIRYFPTQALN  165



>ref|XP_003542855.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X1 [Glycine max]
 ref|XP_006594416.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X2 [Glycine max]
 gb|KHN37613.1| ADP,ATP carrier protein 2, mitochondrial [Glycine soja]
Length=369

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 118/166 (71%), Gaps = 18/166 (11%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ     + EKVAG+ HLR  T +P    +R                NY+N  LQ   +
Sbjct  2    VDQVQHPRIIEKVAGQQHLR--TGLPLYHQWRS-------------FANYSNGALQYPVM  46

Query  315  STARSY-AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
               R+  AAS VFV APSEKG   F IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  47   PACRAATAASHVFVAAPSEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  104

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+++EG+VSLWRGNTANVIRYFPTQALN
Sbjct  105  KAGRLSEPYKGIGDCFKRTMQEEGVVSLWRGNTANVIRYFPTQALN  150



>ref|XP_010534246.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Tarenaya 
hassleriana]
 ref|XP_010534247.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Tarenaya 
hassleriana]
Length=379

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 122/167 (73%), Gaps = 10/167 (6%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRD-CFYQPFLNSKTFKHGNYTNSMLQPRN  319
            +DQ    TV +K A +  LRS+      Q   D  F +P   S+   +GNY+N+ +Q   
Sbjct  2    VDQVQHPTVMQKAACQF-LRSSIS----QDINDGAFQRP---SRCAAYGNYSNAAIQYPL  53

Query  318  LSTAR-SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM  142
            + T+R +  ASPV   APSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM
Sbjct  54   VPTSRVASTASPVSAAAPSEKGFTSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEM  113

Query  141  IKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IKAGRLSEPYKGI DCF RT+++E   SLWRGNTANVIRYFPTQALN
Sbjct  114  IKAGRLSEPYKGIGDCFKRTIQEESFGSLWRGNTANVIRYFPTQALN  160



>emb|CDX85645.1| BnaA02g01680D [Brassica napus]
Length=696

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 121/168 (72%), Gaps = 10/168 (6%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            ++Q    ++ +K A    +RS     D+  +   F       +   +GNY+N+  Q    
Sbjct  2    VEQTQQPSIFQKAASGQLMRSGVS-QDIHGYASGF------QRRATYGNYSNAAFQYPLA  54

Query  315  STARSYA---ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDE  145
            +T+R  A   ASPVFVQAPSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDE
Sbjct  55   ATSRIVATTTASPVFVQAPSEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDE  114

Query  144  MIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            M+KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  115  MLKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  162



>ref|XP_008375168.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Malus 
domestica]
Length=384

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 125/173 (72%), Gaps = 17/173 (10%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    +V +KVAG+L  +S      +Q + + F +P +  +   +GNYTN+ LQ   +
Sbjct  2    VDQVQHPSVVQKVAGQLLQQS------IQGYDNGFQRPGMYQRR-AYGNYTNAALQYPFM  54

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R+          ASP+FVQAP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  55   PACRATTDMSLVPSTASPIFVQAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  112

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK+GRLS+PYKGI +CFSR +K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  113  QNQDEMIKSGRLSQPYKGIGECFSRXIKEEGFGSLWRGNTANVIRYFPTQALN  165



>ref|XP_009354733.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=384

 Score =   190 bits (483),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 125/173 (72%), Gaps = 17/173 (10%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    +V +KVAG+L  +S      +Q + + F +P +  +   +GNY+N+ LQ   +
Sbjct  2    VDQVQHPSVVQKVAGQLLQQS------IQGYDNGFQRPGMYQRR-AYGNYSNAALQYPFM  54

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R+          ASP+FVQAP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  55   PACRATTDMSLVPSTASPIFVQAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  112

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLS+PYKGI +CFSRT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  113  QNQDEMIKTGRLSQPYKGIGECFSRTIKEEGFGSLWRGNTANVIRYFPTQALN  165



>emb|CAG17934.1| adenosine nucleotide translocator [Brassica oleracea var. viridis]
Length=322

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -2

Query  303  SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRL  124
            S + SPVFVQAPSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAGRL
Sbjct  4    STSTSPVFVQAPSEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRL  63

Query  123  SEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            SEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  64   SEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  104



>ref|XP_010272403.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like isoform 
X2 [Nelumbo nucifera]
 ref|XP_010272404.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like isoform 
X2 [Nelumbo nucifera]
Length=381

 Score =   190 bits (482),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 116/168 (69%), Gaps = 13/168 (8%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D     ++  K+ G+ +L S    P+LQ+     Y           G Y N  LQ   LS
Sbjct  3    DGSQHSSIFYKIHGQSYLFSRLS-PNLQARNSTIYNI--------SGAYMNGGLQSHLLS  53

Query  312  TARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDE  145
            + +   +    SPV+VQAPSEKG   F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDE
Sbjct  54   SYQGNMSIMPLSPVYVQAPSEKGVGAFMVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDE  113

Query  144  MIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            MIKAGRLSEPYKGI DCF RT+KDEG +SLWRGNTANVIRYFPTQALN
Sbjct  114  MIKAGRLSEPYKGIGDCFGRTIKDEGFISLWRGNTANVIRYFPTQALN  161



>ref|XP_010268073.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=368

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 121/167 (72%), Gaps = 23/167 (14%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRS--TTHVPDLQSFRDC-FYQPFLNSKTFKHGNYTNSMLQPR  322
            D P   +V++K   ++ LRS  + HV      R+C FY+P            ++   Q  
Sbjct  3    DWPRQPSVTQKFGSQILLRSCNSQHVQA----RNCSFYKP------------SHERTQAF  46

Query  321  NLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM  142
            ++ T++S    PVFVQAPSEKG   F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM
Sbjct  47   SMPTSKS----PVFVQAPSEKGPSAFVVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEM  102

Query  141  IKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IKAGRL+EPYKGI DCF+RT+KDEG +SLWRGNTANVIRYFPTQALN
Sbjct  103  IKAGRLTEPYKGIGDCFARTIKDEGFISLWRGNTANVIRYFPTQALN  149



>ref|XP_008455276.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Cucumis 
melo]
Length=378

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 116/168 (69%), Gaps = 16/168 (10%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFR--DCFYQPFLNS--KTFKHGNYTNSMLQP  325
            D  H  +V +K+ G  +L S    PDL S R    F    L +  KT  HG      + P
Sbjct  3    DSSHQSSVFQKICGHSYLTSRLS-PDLHSTRLTGVFANGVLENPLKTAYHGTGLVG-VSP  60

Query  324  RNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDE  145
                       SP  VQAPSEKG  GFA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDE
Sbjct  61   ----------TSPFLVQAPSEKGAAGFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDE  110

Query  144  MIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            M+K GRLSEPYKGI DCF+RT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  111  MLKTGRLSEPYKGITDCFARTIKDEGVISLWRGNTANVIRYFPTQALN  158



>ref|XP_010272402.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like isoform 
X1 [Nelumbo nucifera]
Length=398

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 116/168 (69%), Gaps = 13/168 (8%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D     ++  K+ G+ +L S    P+LQ+     Y           G Y N  LQ   LS
Sbjct  20   DGSQHSSIFYKIHGQSYLFSRLS-PNLQARNSTIYNI--------SGAYMNGGLQSHLLS  70

Query  312  TARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDE  145
            + +   +    SPV+VQAPSEKG   F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDE
Sbjct  71   SYQGNMSIMPLSPVYVQAPSEKGVGAFMVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDE  130

Query  144  MIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            MIKAGRLSEPYKGI DCF RT+KDEG +SLWRGNTANVIRYFPTQALN
Sbjct  131  MIKAGRLSEPYKGIGDCFGRTIKDEGFISLWRGNTANVIRYFPTQALN  178



>ref|XP_004303109.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=379

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 117/157 (75%), Gaps = 16/157 (10%)
 Frame = -2

Query  450  KLHLRSTTHVPDLQSFRDCFYQPFLNSKTFK-HGNYTNSMLQ----PRNLST--ARSYAA  292
            KLH +S+  +P L         P LNS+ +   G Y N  LQ    P   ST  A+    
Sbjct  13   KLHGQSSL-IPKLS--------PNLNSRNYGLTGAYANGGLQGPLLPACQSTPLAQLSPL  63

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            S + VQAP+EKG  GFA+DF+MGGVSAAVSKTAAAPIER+KLLIQNQDEMIKAGRLSEPY
Sbjct  64   STILVQAPAEKGAAGFAVDFLMGGVSAAVSKTAAAPIERIKLLIQNQDEMIKAGRLSEPY  123

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  124  KGITDCFARTMKDEGVIALWRGNTANVIRYFPTQALN  160



>ref|XP_010091485.1| ADP,ATP carrier protein 3 [Morus notabilis]
 gb|EXB44636.1| ADP,ATP carrier protein 3 [Morus notabilis]
Length=373

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = -2

Query  357  HGNYTNSMLQPRNLSTARSYAA--SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAP  184
            +G      L P   ST  ++ +  SPVFVQAPSEKG  GF +DF+MGGVSAAVSKTAAAP
Sbjct  33   YGVDVQGSLHPMCQSTGLAHVSYLSPVFVQAPSEKGATGFVVDFLMGGVSAAVSKTAAAP  92

Query  183  IERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQAL  4
            IERVKLLIQNQDEMIKAGRLSEPYKGI DCF+RT+KDEG ++LWRGNTANVIRYFPTQAL
Sbjct  93   IERVKLLIQNQDEMIKAGRLSEPYKGITDCFARTIKDEGFLALWRGNTANVIRYFPTQAL  152

Query  3    N  1
            N
Sbjct  153  N  153



>ref|XP_002299948.1| adenine nucleotide translocator family protein [Populus trichocarpa]
 gb|EEE84753.1| adenine nucleotide translocator family protein [Populus trichocarpa]
Length=389

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 120/174 (69%), Gaps = 16/174 (9%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSF--RDCFYQPFLNSKTFKHGNYTNSMLQ---  328
            DQ    +V +KVAG+  L S +     Q F     F +P L  +   +GNY+N   Q   
Sbjct  3    DQIQHPSVMKKVAGQFLLSSVS-----QDFGCDGAFQRPALYQRR-AYGNYSNPAFQYPM  56

Query  327  PRNLSTARSYA-----ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLL  163
             R  + A   +     AS V VQAP+EKG   FAIDF+MGGVSAAVSKTAAAPIERVKLL
Sbjct  57   GRTCAVATDLSIVPSTASSVLVQAPAEKGLASFAIDFLMGGVSAAVSKTAAAPIERVKLL  116

Query  162  IQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IQNQDEMIK+GRLSEPYKGI DCF RT++DEG  SLWRGNTANVIRYFPTQALN
Sbjct  117  IQNQDEMIKSGRLSEPYKGIGDCFKRTIQDEGFGSLWRGNTANVIRYFPTQALN  170



>ref|NP_001241092.1| uncharacterized protein LOC100802974 [Glycine max]
 gb|ACU18379.1| unknown [Glycine max]
Length=372

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 115/165 (70%), Gaps = 16/165 (10%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKH-GNYTNSMLQPRNL  316
            D P   +V +K+AG+ +L S                P  NS  +   G+Y N  L    L
Sbjct  3    DGPQHPSVVQKLAGQSYLVSRL-------------SPNFNSGNYSSTGSYFNGGLHSSGL  49

Query  315  STARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  136
            +       SPV V AP+EKG  GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK
Sbjct  50   AVVSP--GSPVTVHAPAEKGVSGFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  107

Query  135  AGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            +GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  108  SGRLSEPYKGIGDCFARTMKDEGVIALWRGNTANVIRYFPTQALN  152



>ref|XP_004173083.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like, partial 
[Cucumis sativus]
Length=261

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 120/173 (69%), Gaps = 13/173 (8%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-----  328
            DQ    T+ +KVAG+L L+S       ++  D F  P L  +     NY+N+  Q     
Sbjct  3    DQVQHPTIYQKVAGQLSLQSRV-ASGFRACDDGFRNPALYQRRAPITNYSNAAFQYPAVQ  61

Query  327  ----PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
                  +LS   S  ASP+FV AP+EKG   F +DF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  62   SCVATTDLSRVSS-TASPIFVAAPAEKG--NFMLDFLMGGVSAAVSKTAAAPIERVKLLI  118

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK+GRLSEPYKGI DCF RT+++EG  SLWRGNTANVIRYFPTQALN
Sbjct  119  QNQDEMIKSGRLSEPYKGIGDCFKRTMQEEGFGSLWRGNTANVIRYFPTQALN  171



>ref|XP_004136845.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004170130.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Cucumis 
sativus]
 gb|KGN43648.1| hypothetical protein Csa_7G050790 [Cucumis sativus]
Length=378

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 115/168 (68%), Gaps = 16/168 (10%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFR--DCFYQPFLNS--KTFKHGNYTNSMLQP  325
            D  H  +V +K+ G  +L S    P+L S R    F    L +  KT  HG         
Sbjct  3    DSSHQSSVFQKICGHSYLTSRLS-PNLHSTRLTGVFANGVLENPLKTAYHGT--------  53

Query  324  RNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDE  145
                 A     SP  VQAPSEKG  GFA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDE
Sbjct  54   ---GLAGVSPTSPFLVQAPSEKGAAGFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDE  110

Query  144  MIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            M+K GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  111  MLKTGRLSEPYKGITDCFARTIKDEGVIALWRGNTANVIRYFPTQALN  158



>dbj|BAE71236.1| putative ADP,ATP carrier-like protein [Trifolium pratense]
Length=371

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 117/164 (71%), Gaps = 14/164 (9%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D P   +V++K+ G  +L S    P+L S      + +  S TF +G   NS L      
Sbjct  3    DGPQYPSVAQKLGGHSYLVSRLS-PNLNS------RSYSTSGTFAYGGLQNSGL------  49

Query  312  TARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKA  133
             A     S + V APSEKG  GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K+
Sbjct  50   -AIGSPLSSIMVPAPSEKGAAGFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKS  108

Query  132  GRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  109  GRLSEPYKGIGDCFARTMKDEGVIALWRGNTANVIRYFPTQALN  152



>gb|KDP24106.1| hypothetical protein JCGZ_25763 [Jatropha curcas]
Length=379

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 2/126 (2%)
 Frame = -2

Query  372  SKTFKHGNYTNSMLQPRNLSTARSYAA--SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSK  199
            S T  +GN  ++ L P    T  +  +  SPVFVQAPSEKG   F +DF+MGGVSAAVSK
Sbjct  34   SVTGAYGNGVHNHLHPALQGTGMALMSPLSPVFVQAPSEKGAGAFMVDFLMGGVSAAVSK  93

Query  198  TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYF  19
            TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYF
Sbjct  94   TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTIKDEGVLALWRGNTANVIRYF  153

Query  18   PTQALN  1
            PTQALN
Sbjct  154  PTQALN  159



>gb|EPS71896.1| hypothetical protein M569_02862, partial [Genlisea aurea]
Length=316

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SP FVQAP+EKGF GFAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAGRLSEPY
Sbjct  1    SPFFVQAPAEKGFSGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLSEPY  60

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI DCF RT++DEG  SLWRGNTANVIRYFPTQALN
Sbjct  61   KGIGDCFRRTIQDEGFGSLWRGNTANVIRYFPTQALN  97



>ref|XP_008381597.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Malus 
domestica]
Length=380

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 108/144 (75%), Gaps = 7/144 (5%)
 Frame = -2

Query  411  QSFRDCFYQPFLNSKTFK-HGNYTNSMLQPRNLST------ARSYAASPVFVQAPSEKGF  253
            QS+      P L++  +   G Y N  LQ   L T      A+    SP+  QAP+EKG 
Sbjct  17   QSYLISXLSPKLHTSNYAVTGAYANGALQSPLLRTFDGTALAQVSPLSPIMAQAPAEKGA  76

Query  252  VGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKD  73
             GFA+DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK GRLSEPYKGI DCF+RT+KD
Sbjct  77   AGFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKTGRLSEPYKGISDCFARTIKD  136

Query  72   EGIVSLWRGNTANVIRYFPTQALN  1
            EG++SLWRGNTANVIRYFPTQALN
Sbjct  137  EGVLSLWRGNTANVIRYFPTQALN  160



>gb|KDP43465.1| hypothetical protein JCGZ_16752 [Jatropha curcas]
Length=383

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 121/176 (69%), Gaps = 24/176 (14%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    ++ +KVAG+ HL S     D+Q  R   YQ         +GNY+N+  Q    
Sbjct  2    VDQARNPSLMQKVAGQ-HLHSGIS-QDIQ--RPALYQ------RRAYGNYSNAAFQ---Y  48

Query  315  STARSYAAS-----------PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVK  169
              A+SY AS            V + APSEKGF  FAIDF+MGGVSAAVSKTAAAPIERVK
Sbjct  49   PLAQSYTASTDISIIPSTASSVCLHAPSEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVK  108

Query  168  LLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LLIQNQDEMIK+GRLSEPYKGI DCF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  109  LLIQNQDEMIKSGRLSEPYKGIGDCFKRTIKEEGFGSLWRGNTANVIRYFPTQALN  164



>ref|XP_011047661.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Populus 
euphratica]
 ref|XP_011047662.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Populus 
euphratica]
 ref|XP_011047663.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Populus 
euphratica]
Length=380

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 109/135 (81%), Gaps = 7/135 (5%)
 Frame = -2

Query  384  PFLNSKTFK--HGNYTN---SMLQPRNLSTARSYA--ASPVFVQAPSEKGFVGFAIDFMM  226
            P L+S+ +    G ++N   S + P    T  ++    SP+FV+APSEKG  GF IDF+M
Sbjct  26   PNLHSRNYHMTSGAFSNGFHSHMHPAIQGTGLAFVPHVSPIFVEAPSEKGAKGFVIDFLM  85

Query  225  GGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRG  46
            GGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF+RT+KDEG+++LWRG
Sbjct  86   GGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGITDCFARTIKDEGVLALWRG  145

Query  45   NTANVIRYFPTQALN  1
            NTANVIRYFPTQALN
Sbjct  146  NTANVIRYFPTQALN  160



>ref|XP_006412961.1| hypothetical protein EUTSA_v10025467mg [Eutrema salsugineum]
 gb|ESQ54414.1| hypothetical protein EUTSA_v10025467mg [Eutrema salsugineum]
Length=379

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 111/156 (71%), Gaps = 13/156 (8%)
 Frame = -2

Query  450  KLHLRSTT---HVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTARS---YAAS  289
            KLH +ST      P +Q++       ++N           S+LQ  N     S   + + 
Sbjct  12   KLHGQSTLINRLSPSVQTYSYGVSGAYVNGGL-------QSLLQSSNHGIGSSLLPHGSL  64

Query  288  PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYK  109
            PVF QAPSEK   GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYK
Sbjct  65   PVFAQAPSEKTGTGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYK  124

Query  108  GIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            GI DCF RTVKDEG+++LWRGNTANVIRYFPTQALN
Sbjct  125  GITDCFGRTVKDEGMIALWRGNTANVIRYFPTQALN  160



>gb|ADN33719.1| adenine nucleotide translocator [Cucumis melo subsp. melo]
Length=390

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 119/173 (69%), Gaps = 13/173 (8%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-----  328
            DQ    T+ +KVAG+L L+S       ++  D F  P L  +     NY+N   Q     
Sbjct  3    DQVQHPTIYQKVAGQLSLQSRV-ASGFRACDDGFRNPALYQRRAPITNYSNGAFQYPAVQ  61

Query  327  ----PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
                  +LS   +  ASP+FV AP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  62   SCVATTDLSRVAT-TASPIFVAAPAEKG--NFMIDFLMGGVSAAVSKTAAAPIERVKLLI  118

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK+GRLSEPYKGI DCF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  119  QNQDEMIKSGRLSEPYKGIGDCFKRTIKEEGFGSLWRGNTANVIRYFPTQALN  171



>ref|XP_002310404.2| hypothetical protein POPTR_0007s01010g [Populus trichocarpa]
 gb|EEE90854.2| hypothetical protein POPTR_0007s01010g [Populus trichocarpa]
Length=380

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 109/135 (81%), Gaps = 7/135 (5%)
 Frame = -2

Query  384  PFLNSKTFK--HGNYTN---SMLQPRNLSTARSYA--ASPVFVQAPSEKGFVGFAIDFMM  226
            P L+S+ +    G ++N   S + P    T  ++    SP+FV+APSEKG  GF IDF+M
Sbjct  26   PNLHSRNYHMTSGAFSNGFHSHMHPAIQGTGLAFVPHVSPIFVEAPSEKGAKGFMIDFLM  85

Query  225  GGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRG  46
            GGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF+RT+KDEG+++LWRG
Sbjct  86   GGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGITDCFARTIKDEGVLALWRG  145

Query  45   NTANVIRYFPTQALN  1
            NTANVIRYFPTQALN
Sbjct  146  NTANVIRYFPTQALN  160



>gb|ABK24587.1| unknown [Picea sitchensis]
 gb|ABK25127.1| unknown [Picea sitchensis]
 gb|ACN39892.1| unknown [Picea sitchensis]
 gb|ACN39958.1| unknown [Picea sitchensis]
Length=390

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 123/170 (72%), Gaps = 7/170 (4%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPF-----LNSKTFKHGNYTNSMLQ  328
            ++P   +V +K++ + +L S    P  Q  ++   QPF     L++    +G   ++ L 
Sbjct  3    ERPKYPSVVQKMSCQTYLGSRI-TPSWQVRQNGALQPFKYDGALSAPVQSYGGLQSAFLH  61

Query  327  P-RNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
              R  + A +   SPVF+ AP+EKGF GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  62   ASRASNVALAPGHSPVFIPAPAEKGFKGFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ  121

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEM+K+GRL+EPYKGI DCF RT+KDEG ++LWRGNTANVIRYFPTQALN
Sbjct  122  DEMLKSGRLAEPYKGIGDCFGRTIKDEGFIALWRGNTANVIRYFPTQALN  171



>gb|ADN33720.1| adenine nucleotide translocator [Cucumis melo subsp. melo]
Length=390

 Score =   187 bits (475),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 121/176 (69%), Gaps = 19/176 (11%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDC---FYQPFLNSKTFKHGNYTNSMLQ--  328
            DQ    T+ +KV+G+L L+S   +     FR C   F  P L  +     NY+N+  Q  
Sbjct  3    DQVQHPTLYQKVSGQLSLQSRVAL----GFRACDDGFRNPALYQRRAPITNYSNAAFQYP  58

Query  327  -------PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVK  169
                     +LS   S  ASP+FV AP+EKG   F IDF+MGGVSAAVSKTAAAPIERVK
Sbjct  59   AVQSCAATTDLSRVAS-TASPIFVAAPAEKG--NFMIDFLMGGVSAAVSKTAAAPIERVK  115

Query  168  LLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LLIQNQDEMIK+GRLSEPYKGI DCF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  116  LLIQNQDEMIKSGRLSEPYKGIGDCFKRTIKEEGFGSLWRGNTANVIRYFPTQALN  171



>ref|XP_006372724.1| ADP/ATP CARRIER 3 family protein [Populus trichocarpa]
 gb|ERP50521.1| ADP/ATP CARRIER 3 family protein [Populus trichocarpa]
Length=379

 Score =   187 bits (474),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SP+FV+APSEKG  GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY
Sbjct  64   SPIFVEAPSEKGAKGFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  123

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI DCF+RT+KDEGI++LWRGNTANVIRYFPTQALN
Sbjct  124  KGITDCFARTIKDEGILALWRGNTANVIRYFPTQALN  160



>ref|XP_010673613.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=391

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 116/162 (72%), Gaps = 16/162 (10%)
 Frame = -2

Query  456  AGKLHLRSTTHVPDLQSFRDCFYQPFLNS----KTFKHGNYTNSMLQ------PRNLSTA  307
            AG+LHL S      L       Y  F N+    + F +GNYTN+ LQ       ++LS  
Sbjct  16   AGQLHLTS-----GLSQITQPRYGGFQNTAMVQRRFAYGNYTNAALQNPACHATQDLSFV  70

Query  306  RSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGR  127
             +  A PV   AP+EKG   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+KAGR
Sbjct  71   SNIGA-PVVAYAPAEKGPAAFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGR  129

Query  126  LSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LSEPYKGI DCF RTV +EG+++LWRGNTANVIRYFPTQALN
Sbjct  130  LSEPYKGIGDCFKRTVGEEGMIALWRGNTANVIRYFPTQALN  171



>ref|XP_007133838.1| hypothetical protein PHAVU_011G213200g [Phaseolus vulgaris]
 gb|ESW05832.1| hypothetical protein PHAVU_011G213200g [Phaseolus vulgaris]
Length=385

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 121/173 (70%), Gaps = 16/173 (9%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ     V EKVAG+LHLR  T +P     R   +  + N  +F  G ++N+  Q   +
Sbjct  2    VDQVQHPRVIEKVAGQLHLR--TGLPLYHQRRS--FGNYSNGVSF--GKHSNAAFQVPVM  55

Query  315  STAR--------SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R        +  ASPVFV AP+EKG   F +DF+MGGVSAAVSKTAAAPIER+KLLI
Sbjct  56   PACRGGIDVSAVAATASPVFVAAPAEKG--NFLLDFLMGGVSAAVSKTAAAPIERIKLLI  113

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIKAGRLSEPYKGI +CFSRT+ +EG  SLWRGNTANVIRYFPTQALN
Sbjct  114  QNQDEMIKAGRLSEPYKGIGECFSRTINEEGFGSLWRGNTANVIRYFPTQALN  166



>ref|XP_002513475.1| ADP,ATP carrier protein, putative [Ricinus communis]
 gb|EEF48878.1| ADP,ATP carrier protein, putative [Ricinus communis]
Length=363

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = -2

Query  393  FYQPFLNSKTFKHGNYTNSMLQPRNLSTARSYAASP---VFVQAPSEKGFVGFAIDFMMG  223
            F  P L+   F +  Y N  LQ     T R+  ASP   V VQAPSEKG  GFA+DF+MG
Sbjct  14   FQSPALHQGQFAYSKYCNPGLQ---CPTTRTCQASPDLSVLVQAPSEKGLAGFAVDFVMG  70

Query  222  GVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGN  43
            GVSA VSKTAAAPIERVKLLIQNQ+EMIKAGRLSEPYKGI DCFSRTVKDEG +SLWRGN
Sbjct  71   GVSATVSKTAAAPIERVKLLIQNQNEMIKAGRLSEPYKGIGDCFSRTVKDEGFLSLWRGN  130

Query  42   TANVIRYFPTQALN  1
            T N+IRY PTQA N
Sbjct  131  TTNIIRYLPTQAFN  144



>ref|XP_006282649.1| hypothetical protein CARUB_v10005047mg [Capsella rubella]
 gb|EOA15547.1| hypothetical protein CARUB_v10005047mg [Capsella rubella]
Length=379

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = -2

Query  354  GNYTN----SMLQPRNLSTARS---YAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKT  196
            G Y N    S+ Q  N     S   Y + PV VQAPSEK   GF IDF+MGGVSAAVSKT
Sbjct  36   GAYVNGGLHSLFQSTNQGIGSSLLPYGSLPVSVQAPSEKTGTGFLIDFLMGGVSAAVSKT  95

Query  195  AAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFP  16
            AAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RTVKDEG+V+LWRGNTANVIRYFP
Sbjct  96   AAAPIERVKLLIQNQDEMIKAGRLSEPYKGITDCFGRTVKDEGLVALWRGNTANVIRYFP  155

Query  15   TQALN  1
            TQALN
Sbjct  156  TQALN  160



>ref|XP_011025426.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Populus 
euphratica]
Length=389

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 118/167 (71%), Gaps = 14/167 (8%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ---------PR  322
            +V +KVAG+  LRS+  V +       F +P L+ +   +GNY+N   Q           
Sbjct  9    SVMQKVAGQF-LRSS--VSNDFGCDGAFQRPALHQRC-AYGNYSNPAFQYPMGRACVAAT  64

Query  321  NLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM  142
             LS   S  AS V VQAPSEKG   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM
Sbjct  65   ELSIVPS-TASSVLVQAPSEKGLASFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEM  123

Query  141  IKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            +K GRLSEPY+GI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  124  LKTGRLSEPYRGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALN  170



>ref|XP_002867450.1| hypothetical protein ARALYDRAFT_491934 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43709.1| hypothetical protein ARALYDRAFT_491934 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (79%), Gaps = 8/126 (6%)
 Frame = -2

Query  354  GNYTNSMLQPRNLSTARSYAAS--------PVFVQAPSEKGFVGFAIDFMMGGVSAAVSK  199
            G Y N  LQ    ST+    +S        PV  QAPSEK   GF IDF+MGGVSAAVSK
Sbjct  36   GAYVNGGLQSLLQSTSHGIGSSLIPHHGSFPVLAQAPSEKTGTGFLIDFLMGGVSAAVSK  95

Query  198  TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYF  19
            TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF+RTVKDEG+++LWRGNTANVIRYF
Sbjct  96   TAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGVIALWRGNTANVIRYF  155

Query  18   PTQALN  1
            PTQALN
Sbjct  156  PTQALN  161



>ref|NP_001150672.1| LOC100284305 [Zea mays]
 gb|ACF85000.1| unknown [Zea mays]
 gb|ACG39962.1| ADP,ATP carrier protein [Zea mays]
 tpg|DAA43102.1| TPA: ADP,ATP carrier protein isoform 1 [Zea mays]
 tpg|DAA43103.1| TPA: ADP,ATP carrier protein isoform 2 [Zea mays]
Length=380

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  297  AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSE  118
            A SPVF  AP EKGF GF IDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM+K GRLSE
Sbjct  63   APSPVFASAPKEKGFSGFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKTGRLSE  122

Query  117  PYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            PYKGI DCF RT++DEG VSLWRGNTANVIRYFPTQALN
Sbjct  123  PYKGIGDCFGRTIRDEGFVSLWRGNTANVIRYFPTQALN  161



>ref|XP_002468591.1| hypothetical protein SORBIDRAFT_01g048660 [Sorghum bicolor]
 gb|EER95589.1| hypothetical protein SORBIDRAFT_01g048660 [Sorghum bicolor]
Length=380

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  297  AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSE  118
            A SPVF  AP EKGF GF IDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEM+K GRLSE
Sbjct  63   APSPVFASAPKEKGFSGFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKTGRLSE  122

Query  117  PYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            PYKGI DCF RT++DEG VSLWRGNTANVIRYFPTQALN
Sbjct  123  PYKGIGDCFGRTIRDEGFVSLWRGNTANVIRYFPTQALN  161



>ref|XP_007198831.1| hypothetical protein PRUPE_ppa007166mg [Prunus persica]
 gb|EMJ00030.1| hypothetical protein PRUPE_ppa007166mg [Prunus persica]
Length=379

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 102/124 (82%), Gaps = 7/124 (6%)
 Frame = -2

Query  354  GNYTNSMLQPRNLSTARSYAAS------PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTA  193
            G Y N  LQ R L T  S A +      P+ VQAP EKG  GFA+DF+MGGVSAAVSKTA
Sbjct  37   GAYANGGLQ-RPLLTFESTALAQVSPLPPIVVQAPVEKGAAGFAVDFLMGGVSAAVSKTA  95

Query  192  AAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPT  13
            AAPIERVKLLIQNQDEMIKAGRLS+PYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPT
Sbjct  96   AAPIERVKLLIQNQDEMIKAGRLSQPYKGITDCFARTIKDEGVLALWRGNTANVIRYFPT  155

Query  12   QALN  1
            QALN
Sbjct  156  QALN  159



>ref|XP_004142870.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Cucumis 
sativus]
Length=390

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 120/173 (69%), Gaps = 13/173 (8%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-----  328
            DQ    T+ +KVAG+L L+S       ++  D F  P L  +     NY+N+  Q     
Sbjct  3    DQVQHPTIYQKVAGQLSLQSRV-ASGFRACDDGFRNPALYQRRAPITNYSNAAFQYPAVQ  61

Query  327  ----PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
                  +LS   S  ASP+FV AP+EKG   F +DF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  62   SCVATTDLSRVAS-TASPIFVAAPAEKG--NFMLDFLMGGVSAAVSKTAAAPIERVKLLI  118

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK+GRLSEPYKGI DCF RT+++EG  SLWRGNTANVIRYFPTQALN
Sbjct  119  QNQDEMIKSGRLSEPYKGIGDCFKRTMQEEGFGSLWRGNTANVIRYFPTQALN  171



>ref|XP_010259400.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=393

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 118/172 (69%), Gaps = 9/172 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFR-DCFYQPFLNSKTF-----KHGNYTNSML  331
            D+P   +V +KV  +  LR   +  D+Q+      Y+P    + F     +HG   N  +
Sbjct  3    DRPRRPSVVQKVGSQFRLR-FCYSQDVQARNGSSLYKPSGCERRFTFGSYRHGGPNNPSM  61

Query  330  QPRNLSTARSYAAS--PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            Q    S   S  +S  P  V+APSEKG   F +DF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  62   QAYGGSRCISVPSSLSPFLVEAPSEKGSGAFIVDFLMGGVSAAVSKTAAAPIERVKLLIQ  121

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIKAGRLSEPYKGI DCF+RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  122  NQDEMIKAGRLSEPYKGIGDCFARTIKDEGFASLWRGNTANVIRYFPTQALN  173



>gb|KHN01114.1| ADP,ATP carrier protein 3, mitochondrial [Glycine soja]
Length=372

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 114/170 (67%), Gaps = 26/170 (15%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYT------NSML  331
            D P   +V +K+AG+ +L S                    S  F  GNY+      N  L
Sbjct  3    DGPQHPSVVQKLAGQSYLVSRL------------------SPNFNSGNYSSTVSYFNGGL  44

Query  330  QPRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
                L+       SPV V AP+EKG  GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  45   HSSGLAVVSP--GSPVTVHAPAEKGVSGFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQ  102

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEMIK+GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  103  DEMIKSGRLSEPYKGIGDCFARTMKDEGVIALWRGNTANVIRYFPTQALN  152



>emb|CDX97439.1| BnaC08g13040D [Brassica napus]
Length=377

 Score =   184 bits (468),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 118/166 (71%), Gaps = 9/166 (5%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +++P   +V +KV G+  L ST   P +Q         ++N           S+LQP + 
Sbjct  1    MNEPRHPSVFQKVHGQTSLISTLS-PSVQPRNHSVSGAYVNGGL-------QSLLQPTSH  52

Query  315  STARSYAAS-PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             T+     S PV  QAP+EK   GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  53   DTSLIPRGSLPVLAQAPTEKTSTGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  112

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            +AGRLSEPYKGI DCF+RTVKDEG+++LWRGNTANV+RYFPTQALN
Sbjct  113  RAGRLSEPYKGITDCFTRTVKDEGVLALWRGNTANVLRYFPTQALN  158



>ref|XP_004985877.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Setaria 
italica]
Length=381

 Score =   184 bits (468),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = -2

Query  297  AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSE  118
            A SPVF  AP EKGF GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K+GRLSE
Sbjct  63   APSPVFASAPKEKGFSGFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKSGRLSE  122

Query  117  PYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            PYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  123  PYKGIGDCFTRTMKDEGVIALWRGNTANVIRYFPTQALN  161



>ref|XP_004505560.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Cicer 
arietinum]
Length=371

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 117/165 (71%), Gaps = 16/165 (10%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFK-HGNYTNSMLQPRNL  316
            D P   +V++K+AG  +L S                P  NS+ +   G +TN  LQ   L
Sbjct  3    DGPQYPSVAQKLAGHSYLVSRL-------------SPNYNSRNYSTSGTFTNGGLQTPGL  49

Query  315  STARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  136
            + A     S + V +P+EKG  GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K
Sbjct  50   AFASHL--SSITVPSPAEKGATGFMVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLK  107

Query  135  AGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            +GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANV+RYFPTQALN
Sbjct  108  SGRLSEPYKGISDCFARTMKDEGVIALWRGNTANVLRYFPTQALN  152



>ref|XP_006855242.1| hypothetical protein AMTR_s00183p00019870 [Amborella trichopoda]
 gb|ERN16709.1| hypothetical protein AMTR_s00183p00019870 [Amborella trichopoda]
Length=394

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 102/123 (83%), Gaps = 4/123 (3%)
 Frame = -2

Query  357  HGNYT--NSMLQPRNLSTARSYAA--SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAA  190
            +GN T  NS L+      + S AA  SPV VQAPSEKG  GF IDF+MGGVSAAVSKTAA
Sbjct  52   YGNTTLQNSFLEACRGGQSLSMAAPISPVLVQAPSEKGAKGFVIDFLMGGVSAAVSKTAA  111

Query  189  APIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQ  10
            APIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RT+K+EG ++LWRGNTANVIRYFPTQ
Sbjct  112  APIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKEEGFLALWRGNTANVIRYFPTQ  171

Query  9    ALN  1
            ALN
Sbjct  172  ALN  174



>dbj|BAE71194.1| putative ADP ATP carrier protein [Trifolium pratense]
Length=371

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 116/164 (71%), Gaps = 14/164 (9%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D P   +V++K+    +L S    P+L S      + +  S TF +G   NS L      
Sbjct  3    DGPQYPSVAQKLGRHSYLVSRLS-PNLNS------RSYSTSGTFAYGGLQNSGL------  49

Query  312  TARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKA  133
             A     S + V APSEKG  GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K+
Sbjct  50   -AIGSPLSSIMVPAPSEKGAAGFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKS  108

Query  132  GRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  109  GRLSEPYKGIGDCFARTMKDEGVIALWRGNTANVIRYFPTQALN  152



>ref|XP_010235895.1| PREDICTED: ADP,ATP carrier protein, mitochondrial [Brachypodium 
distachyon]
Length=384

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 114/166 (69%), Gaps = 2/166 (1%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPR-N  319
            +DQ +  TV +K  G+ HL S+     +++   C   P    +       T S   P  +
Sbjct  1    MDQANQPTVLQKFGGQFHLGSS-FSEGVRARNMCPSAPAYERRYTTSNYMTQSHFGPAMS  59

Query  318  LSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
                   ++SP+F  AP+EKG   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  60   AINVPMVSSSPIFANAPAEKGVKSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  119

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  120  KAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  165



>ref|XP_004156402.1| PREDICTED: LOW QUALITY PROTEIN: ADP,ATP carrier protein 1, mitochondrial-like 
[Cucumis sativus]
Length=276

 Score =   181 bits (460),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 118/173 (68%), Gaps = 13/173 (8%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-----  328
            DQ    T+ +KVAG+L L+S       ++  D    P L  +     NY+N   Q     
Sbjct  3    DQVQHPTIYQKVAGQLSLQSRV-ASGFRASDDGLRNPALYQRRAPITNYSNVAFQYPAVQ  61

Query  327  ----PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
                  +LS   S  ASP+FV AP+EKG   F +DF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  62   SCVATTDLSRVAS-TASPIFVAAPAEKG--NFMLDFLMGGVSAAVSKTAAAPIERVKLLI  118

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK+GRLSEPYKGI DCF RT+++EG  SLWRGNTANVIRYFPTQALN
Sbjct  119  QNQDEMIKSGRLSEPYKGIGDCFKRTMQEEGFGSLWRGNTANVIRYFPTQALN  171



>gb|ACU21147.1| unknown [Glycine max]
Length=203

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 116/165 (70%), Gaps = 16/165 (10%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKH-GNYTNSMLQPRNL  316
            D P   +V +K+AG+ +L S                P  NS+ +   G+Y N  +    L
Sbjct  3    DGPQHPSVVQKLAGQSYLVSRL-------------SPNFNSRNYSATGSYANGGMHSPGL  49

Query  315  STARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  136
              A     SPV V AP+EKG  GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK
Sbjct  50   --AVVSPVSPVTVHAPAEKGVSGFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  107

Query  135  AGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            +GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  108  SGRLSEPYKGIGDCFARTMKDEGVIALWRGNTANVIRYFPTQALN  152



>ref|XP_003543333.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Glycine 
max]
Length=367

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 100/128 (78%), Gaps = 11/128 (9%)
 Frame = -2

Query  351  NYTNSMLQP---RNLSTARSY--------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAV  205
            +Y  S L P   RN ST  SY           PV   AP+EKG  GF +DFMMGGVSAAV
Sbjct  20   SYLLSRLAPTHSRNYSTTGSYFNGGLQSSGLVPVMAHAPAEKGVSGFLLDFMMGGVSAAV  79

Query  204  SKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIR  25
            SKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGI DCFSRT+KDEG+++LWRGNTANVIR
Sbjct  80   SKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFSRTMKDEGVIALWRGNTANVIR  139

Query  24   YFPTQALN  1
            YFPTQALN
Sbjct  140  YFPTQALN  147



>ref|XP_008229069.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Prunus mume]
Length=379

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 101/124 (81%), Gaps = 7/124 (6%)
 Frame = -2

Query  354  GNYTNSMLQPRNLSTARSYAAS------PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTA  193
            G Y N  LQ R L T  S   +      P+ VQAP EKG  GFA+DF+MGGVSAAVSKTA
Sbjct  37   GAYANGGLQ-RPLLTFESTVLAQVSPLPPIMVQAPVEKGAAGFAVDFLMGGVSAAVSKTA  95

Query  192  AAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPT  13
            AAPIERVKLLIQNQDEMIKAGRLS+PYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPT
Sbjct  96   AAPIERVKLLIQNQDEMIKAGRLSQPYKGITDCFARTIKDEGVLALWRGNTANVIRYFPT  155

Query  12   QALN  1
            QALN
Sbjct  156  QALN  159



>ref|XP_011100347.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Sesamum 
indicum]
 ref|XP_011100349.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Sesamum 
indicum]
Length=383

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 108/153 (71%), Gaps = 18/153 (12%)
 Frame = -2

Query  405  FRDCFYQPFLNSKTFKH------------GNYTNSMLQPRNLSTARSYA------ASPVF  280
            FR    Q +L S+   H            G Y N  L+  ++ + +          SP  
Sbjct  11   FRKIHGQSYLFSQISPHTHSRSAGLQYLTGGYVNGGLRSLSMPSFQGTGLEIVSPVSPFL  70

Query  279  VQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIM  100
            +QAP+EKG  GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI+AGRLSEPYKGI 
Sbjct  71   IQAPTEKGLSGFMVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIRAGRLSEPYKGIS  130

Query  99   DCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DCF+RT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  131  DCFARTIKDEGVLSLWRGNTANVIRYFPTQALN  163



>ref|XP_004510962.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X1 [Cicer arietinum]
 ref|XP_004510963.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X2 [Cicer arietinum]
 ref|XP_004510964.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X3 [Cicer arietinum]
 ref|XP_004510965.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X4 [Cicer arietinum]
Length=364

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 98/117 (84%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  NYTNSMLQPRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERV  172
            NY+N   Q   +   R+  ASP+FV AP+EKG   F +DF+MGGVSAAVSKTAAAPIER+
Sbjct  30   NYSNPAFQYPMMPACRATTASPIFVAAPAEKG--NFVVDFLMGGVSAAVSKTAAAPIERI  87

Query  171  KLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KLLIQNQDEMIKAGRLSEPYKGI DCF RT+ DEG+V+LWRGNTANVIRYFPTQALN
Sbjct  88   KLLIQNQDEMIKAGRLSEPYKGIGDCFKRTMADEGVVALWRGNTANVIRYFPTQALN  144



>ref|XP_010526510.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Tarenaya 
hassleriana]
Length=375

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 100/117 (85%), Gaps = 4/117 (3%)
 Frame = -2

Query  339  SMLQP-RNLSTARSYA---ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERV  172
            S+LQP R   T  S     +SPVFVQAP+EKG   F +DF+MGGVSAAVSKTAAAPIERV
Sbjct  46   SLLQPTRQEGTDSSLVPKVSSPVFVQAPAEKGGSTFLVDFLMGGVSAAVSKTAAAPIERV  105

Query  171  KLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KLLIQNQDEMIKAGRLSEPYKGI DCF+RT+K EG++SLWRGNTANVIRYFPTQALN
Sbjct  106  KLLIQNQDEMIKAGRLSEPYKGIGDCFARTIKGEGVLSLWRGNTANVIRYFPTQALN  162



>ref|XP_010555114.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial isoform X1 
[Tarenaya hassleriana]
Length=397

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 113/166 (68%), Gaps = 15/166 (9%)
 Frame = -2

Query  456  AGKLHLRSTT-----HVPDLQSFRDCFYQPFLNSKTFKHGNYTN----SMLQPRNLSTAR  304
            AG L L S T     H P  Q            S +   G Y N    S+LQP       
Sbjct  14   AGHLSLVSKTMDGSRHPPVFQKLHGQSLLISRLSSSVHTGAYVNGGLQSLLQP-TCQQGT  72

Query  303  SYA-----ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             Y+     +SPVFVQAP+EKG   F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  73   GYSLVPNISSPVFVQAPAEKGGSAFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  132

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+K+EG+++LWRGNTANVIRYFPTQALN
Sbjct  133  KAGRLSEPYKGIGDCFGRTIKEEGVLALWRGNTANVIRYFPTQALN  178



>ref|XP_010035773.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Eucalyptus 
grandis]
 gb|KCW47236.1| hypothetical protein EUGRSUZ_K01045 [Eucalyptus grandis]
Length=382

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYK  109
            PVFVQAPSEKG  GF  DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK GRLSEPYK
Sbjct  68   PVFVQAPSEKGVKGFLTDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKTGRLSEPYK  127

Query  108  GIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            GI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  128  GIGDCFARTIKDEGVIALWRGNTANVIRYFPTQALN  163



>ref|NP_194568.1| ADP/ATP carrier 3 protein [Arabidopsis thaliana]
 sp|O49447.1|ADT3_ARATH RecName: Full=ADP,ATP carrier protein 3, mitochondrial; AltName: 
Full=ADP/ATP translocase 3; AltName: Full=Adenine nucleotide 
translocator 3; Short=ANT 3; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA16877.1| ADP, ATP carrier-like protein [Arabidopsis thaliana]
 emb|CAB79641.1| ADP, ATP carrier-like protein [Arabidopsis thaliana]
 dbj|BAC42650.1| putative ADP,ATP carrier [Arabidopsis thaliana]
 gb|AEE85477.1| ADP/ATP carrier 3 protein [Arabidopsis thaliana]
Length=379

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 115/161 (71%), Gaps = 11/161 (7%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTARS--  301
            +V +K+ G+ +L +    P +Q+   C    ++N           S+LQP +     S  
Sbjct  8    SVFQKLHGQSYLINRLS-PSVQARGYCVSGAYVNGGL-------QSLLQPTSHGVGSSLI  59

Query  300  -YAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRL  124
             + + PV   APSEK   GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRL
Sbjct  60   PHGSFPVLAHAPSEKTGTGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRL  119

Query  123  SEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            SEPYKGI DCF+RTVKDEG+++LWRGNTANVIRYFPTQALN
Sbjct  120  SEPYKGISDCFARTVKDEGMLALWRGNTANVIRYFPTQALN  160



>emb|CAA33743.1| adenine nucleotide translocator [Zea mays]
Length=387

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 117/169 (69%), Gaps = 8/169 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDC-FYQPFLNSKTFKHGNYTNSMLQPRNL  316
            DQ +  TV  K+ G+ HL S++    +++   C  + P+   + F   NY    L   ++
Sbjct  3    DQANQPTVLHKLGGQFHL-SSSFSEGVRARNICPSFSPY--ERRFATRNYMTQSLWGPSM  59

Query  315  STARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  148
            S +         +P+F  AP+EKG   F IDFMMGGVSAAVSKTAAAPIERVKLLIQNQD
Sbjct  60   SVSGGINVPVMPTPLFANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  119

Query  147  EMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            EMIK+GRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  120  EMIKSGRLSEPYKGIADCFKRTIKDEGFSSLWRGNTANVIRYFPTQALN  168



>ref|NP_001105434.1| ADP,ATP carrier protein 2, mitochondrial precursor [Zea mays]
 ref|XP_008677791.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial isoform X1 
[Zea mays]
 sp|P12857.2|ADT2_MAIZE RecName: Full=ADP,ATP carrier protein 2, mitochondrial; AltName: 
Full=ADP/ATP translocase 2; AltName: Full=Adenine nucleotide 
translocator 2; Short=ANT 2; Flags: Precursor [Zea mays]
 emb|CAA41812.1| adenine nucleotide translocator [Zea mays]
 gb|ACL53589.1| unknown [Zea mays]
 gb|ACR35796.1| unknown [Zea mays]
 gb|AFW63699.1| adenine nucleotide translocator2 isoform 1 [Zea mays]
 gb|AFW63700.1| adenine nucleotide translocator2 isoform 2 [Zea mays]
Length=387

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 117/169 (69%), Gaps = 8/169 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDC-FYQPFLNSKTFKHGNYTNSMLQPRNL  316
            DQ +  TV  K+ G+ HL S++    +++   C  + P+   + F   NY    L   ++
Sbjct  3    DQANQPTVLHKLGGQFHL-SSSFSEGVRARNICPSFSPY--ERRFATRNYMTQSLWGPSM  59

Query  315  STARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  148
            S +         +P+F  AP+EKG   F IDFMMGGVSAAVSKTAAAPIERVKLLIQNQD
Sbjct  60   SVSGGINVPVMPTPLFANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  119

Query  147  EMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            EMIK+GRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  120  EMIKSGRLSEPYKGIADCFKRTIKDEGFSSLWRGNTANVIRYFPTQALN  168



>ref|XP_007149829.1| hypothetical protein PHAVU_005G102000g [Phaseolus vulgaris]
 ref|XP_007149830.1| hypothetical protein PHAVU_005G102000g [Phaseolus vulgaris]
 gb|ESW21823.1| hypothetical protein PHAVU_005G102000g [Phaseolus vulgaris]
 gb|ESW21824.1| hypothetical protein PHAVU_005G102000g [Phaseolus vulgaris]
Length=367

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 102/128 (80%), Gaps = 11/128 (9%)
 Frame = -2

Query  351  NYTNSMLQP---RNLSTARSY--------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAV  205
            +Y  S L P   RN ST+ SY          +PV   AP+EKG  GF +DF+MGGVSAAV
Sbjct  20   SYFVSRLAPNHSRNYSTSGSYFNGGLQSLGYAPVTAHAPAEKGVTGFLVDFLMGGVSAAV  79

Query  204  SKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIR  25
            SKTAAAPIERVKLLIQNQDEM+K+GRLSEPYKGI DCFSRT+KDEG+++LWRGNTANVIR
Sbjct  80   SKTAAAPIERVKLLIQNQDEMLKSGRLSEPYKGIGDCFSRTMKDEGVIALWRGNTANVIR  139

Query  24   YFPTQALN  1
            YFPTQALN
Sbjct  140  YFPTQALN  147



>ref|XP_004953705.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial-like [Setaria 
italica]
Length=388

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 121/171 (71%), Gaps = 11/171 (6%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNS--KTFKHGNYTNSMLQPRN  319
            DQ +  TV  K+ G+ HL S++    +++   C   P ++S  + F   NY    L   +
Sbjct  3    DQVNQPTVLHKLGGQFHL-SSSFSEGVRARNIC---PSVSSYERRFPTRNYMTQSLWGPS  58

Query  318  LSTAR-----SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQN  154
            +S +      + ++SP+F  AP+EKG   F +DF+MGGVSAAVSKTAAAPIERVKLLIQN
Sbjct  59   MSVSGGINVPAVSSSPLFANAPAEKGGKNFMVDFLMGGVSAAVSKTAAAPIERVKLLIQN  118

Query  153  QDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QDEMIKAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  119  QDEMIKAGRLSEPYKGIGDCFKRTIKDEGFSSLWRGNTANVIRYFPTQALN  169



>gb|AGZ15404.1| ADP, ATP carrier 3 protein [Phaseolus vulgaris]
Length=367

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 102/128 (80%), Gaps = 11/128 (9%)
 Frame = -2

Query  351  NYTNSMLQP---RNLSTARSY--------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAV  205
            +Y  S L P   RN ST+ SY          +PV   AP+EKG  GF +DF+MGGVSAAV
Sbjct  20   SYFVSRLAPNHSRNYSTSGSYFNGGLQSLGYAPVTAHAPAEKGVTGFLVDFLMGGVSAAV  79

Query  204  SKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIR  25
            SKTAAAPIERVKLLIQNQDEM+K+GRLSEPYKGI DCFSRT+KDEG+++LWRGNTANVIR
Sbjct  80   SKTAAAPIERVKLLIQNQDEMLKSGRLSEPYKGIGDCFSRTMKDEGVIALWRGNTANVIR  139

Query  24   YFPTQALN  1
            YFPTQALN
Sbjct  140  YFPTQALN  147



>gb|AGZ15396.1| ADP, ATP carrier-like protein [Phaseolus vulgaris]
Length=367

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 102/128 (80%), Gaps = 11/128 (9%)
 Frame = -2

Query  351  NYTNSMLQP---RNLSTARSY--------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAV  205
            +Y  S L P   RN ST+ SY          +PV   AP+EKG  GF +DF+MGGVSAAV
Sbjct  20   SYFVSRLAPNHSRNYSTSGSYFNGGLQSLGYAPVTAHAPAEKGVTGFLVDFLMGGVSAAV  79

Query  204  SKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIR  25
            SKTAAAPIERVKLLIQNQDEM+K+GRLSEPYKGI DCFSRT+KDEG+++LWRGNTANVIR
Sbjct  80   SKTAAAPIERVKLLIQNQDEMLKSGRLSEPYKGIGDCFSRTMKDEGVIALWRGNTANVIR  139

Query  24   YFPTQALN  1
            YFPTQALN
Sbjct  140  YFPTQALN  147



>ref|XP_010555116.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial isoform X2 
[Tarenaya hassleriana]
Length=374

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 102/127 (80%), Gaps = 10/127 (8%)
 Frame = -2

Query  354  GNYTN----SMLQPRNLSTARSYA-----ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVS  202
            G Y N    S+LQP        Y+     +SPVFVQAP+EKG   F +DF+MGGVSAAVS
Sbjct  30   GAYVNGGLQSLLQP-TCQQGTGYSLVPNISSPVFVQAPAEKGGSAFLVDFLMGGVSAAVS  88

Query  201  KTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRY  22
            KTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RT+K+EG+++LWRGNTANVIRY
Sbjct  89   KTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKEEGVLALWRGNTANVIRY  148

Query  21   FPTQALN  1
            FPTQALN
Sbjct  149  FPTQALN  155



>ref|NP_001047941.1| Os02g0718900 [Oryza sativa Japonica Group]
 sp|P31691.1|ADT_ORYSJ RecName: Full=ADP,ATP carrier protein, mitochondrial; AltName: 
Full=ADP/ATP translocase; AltName: Full=Adenine nucleotide 
translocator; Short=ANT; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA02161.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 dbj|BAD12908.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 dbj|BAF09855.1| Os02g0718900 [Oryza sativa Japonica Group]
 gb|ABL74578.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 gb|EAZ24408.1| hypothetical protein OsJ_08162 [Oryza sativa Japonica Group]
 dbj|BAG93461.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86857.1| ATP/ADP translocator [Oryza sativa Japonica Group]
 gb|AFI71837.1| ATP/ADP translocator protein [Oryza sativa]
 gb|AFI71838.1| ATP/ADP translocator protein [Oryza sativa]
Length=382

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 113/172 (66%), Gaps = 19/172 (11%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHL--------RSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNS  337
            +Q +  TV +K  G+ HL        R+    P + S+   F      ++   +G     
Sbjct  3    EQANQPTVLQKFGGQFHLGSSFSEGVRARNICPSVSSYDRRFTTRSYMTQGLVNGGINVP  62

Query  336  MLQPRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            M+           ++SP+F  AP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  63   MM-----------SSSPIFANAPAEKGGKNFMIDFLMGGVSAAVSKTAAAPIERVKLLIQ  111

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIKAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  112  NQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFASLWRGNTANVIRYFPTQALN  163



>ref|XP_006379099.1| ADP family protein [Populus trichocarpa]
 gb|ERP56896.1| ADP family protein [Populus trichocarpa]
Length=385

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 115/163 (71%), Gaps = 10/163 (6%)
 Frame = -2

Query  474  TVSEKVAGK-LHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-PRNLSTARS  301
            +V  KVAG+ LH    + V +       F +P L+ +   +GNY+N   Q P   +   +
Sbjct  9    SVMRKVAGQFLH----SSVSNDFGCDGAFQRPALHQRC-AYGNYSNPAFQYPMGWACVAA  63

Query  300  Y---AASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAG  130
                 AS V VQAPSEKG   F IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K G
Sbjct  64   TELSTASSVLVQAPSEKGLASFGIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKTG  123

Query  129  RLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            RLSEPYKGI DCF RT+K+EG  SLWRGNTANVIRYFPTQALN
Sbjct  124  RLSEPYKGIGDCFKRTMKEEGFGSLWRGNTANVIRYFPTQALN  166



>gb|KGN62492.1| hypothetical protein Csa_2G356660 [Cucumis sativus]
Length=390

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 118/173 (68%), Gaps = 13/173 (8%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-----  328
            DQ    T+ +KVAG+L L+S       ++  D    P L  +     NY+N   Q     
Sbjct  3    DQVQHPTIYQKVAGQLSLQSRV-ASGFRASDDGLRNPALYQRRAPITNYSNVAFQYPAVQ  61

Query  327  ----PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
                  +LS   S  ASP+FV AP+EKG   F +DF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  62   SCVATTDLSRVSS-TASPIFVAAPAEKG--NFMLDFLMGGVSAAVSKTAAAPIERVKLLI  118

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK+GRLSEPYKGI DCF RT+++EG  SLWRGNTANVIRYFPTQALN
Sbjct  119  QNQDEMIKSGRLSEPYKGIGDCFKRTMQEEGFGSLWRGNTANVIRYFPTQALN  171



>ref|NP_001055139.1| Os05g0302700 [Oryza sativa Japonica Group]
 dbj|BAF17053.1| Os05g0302700 [Oryza sativa Japonica Group]
 gb|EAY97443.1| hypothetical protein OsI_19373 [Oryza sativa Indica Group]
 dbj|BAG88044.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63157.1| hypothetical protein OsJ_17966 [Oryza sativa Japonica Group]
Length=380

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 93/114 (82%), Gaps = 2/114 (2%)
 Frame = -2

Query  342  NSMLQPRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLL  163
            N M      S+  S   SPVF  AP EKG  GF IDFMMGGVSAAVSKTAAAPIER+KLL
Sbjct  50   NGMDGNNGFSSVTS--VSPVFASAPKEKGLSGFMIDFMMGGVSAAVSKTAAAPIERIKLL  107

Query  162  IQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IQNQDEMIK+GRLS PYKGI DCF RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  108  IQNQDEMIKSGRLSHPYKGIADCFGRTIKDEGVIALWRGNTANVIRYFPTQALN  161



>ref|XP_004142869.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Cucumis 
sativus]
Length=390

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 118/173 (68%), Gaps = 13/173 (8%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-----  328
            DQ    T+ +KVAG+L L+S       ++  D    P L  +     NY+N   Q     
Sbjct  3    DQVQHPTIYQKVAGQLSLQSRV-ASGFRASDDGLRNPALYQRRAPITNYSNVAFQYPAVQ  61

Query  327  ----PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
                  +LS   S  ASP+FV AP+EKG   F +DF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  62   SCVATTDLSRVAS-TASPIFVAAPAEKG--NFMLDFLMGGVSAAVSKTAAAPIERVKLLI  118

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK+GRLSEPYKGI DCF RT+++EG  SLWRGNTANVIRYFPTQALN
Sbjct  119  QNQDEMIKSGRLSEPYKGIGDCFKRTMQEEGFGSLWRGNTANVIRYFPTQALN  171



>ref|XP_006654224.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Oryza 
brachyantha]
Length=379

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SPVF  AP EKGF GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLS PY
Sbjct  64   SPVFACAPKEKGFSGFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSHPY  123

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI DCF RT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  124  KGIGDCFGRTIKDEGMISLWRGNTANVIRYFPTQALN  160



>gb|EEC73899.1| hypothetical protein OsI_08713 [Oryza sativa Indica Group]
Length=382

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 113/172 (66%), Gaps = 19/172 (11%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHL--------RSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNS  337
            +Q +  TV +K  G+ HL        R+    P + S+   F      ++   +G     
Sbjct  3    EQANHPTVLQKFGGQFHLGSSFSEGVRARNICPSVSSYDRRFTTRSYMTQGLVNGGINVP  62

Query  336  MLQPRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            M+           ++SP+F  AP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  63   MM-----------SSSPIFANAPAEKGGKNFMIDFLMGGVSAAVSKTAAAPIERVKLLIQ  111

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEMIKAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  112  NQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFASLWRGNTANVIRYFPTQALN  163



>gb|ACU24302.1| unknown [Glycine max]
Length=367

 Score =   181 bits (460),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 100/128 (78%), Gaps = 11/128 (9%)
 Frame = -2

Query  351  NYTNSMLQP---RNLSTARSY--------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAV  205
            +Y  S L P   RN ST  SY           PV   AP+EKG  GF +DFMMGGVSAAV
Sbjct  20   SYLLSRLAPTHSRNYSTTGSYFNGGLQSSGLVPVMAHAPAEKGVSGFLLDFMMGGVSAAV  79

Query  204  SKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIR  25
            SKTAAAPIERVKLLIQNQDE+IK+GRLSEPYKGI DCFSRT+KDEG+++LWRGNTANVIR
Sbjct  80   SKTAAAPIERVKLLIQNQDEVIKSGRLSEPYKGIGDCFSRTMKDEGVIALWRGNTANVIR  139

Query  24   YFPTQALN  1
            YFPTQALN
Sbjct  140  YFPTQALN  147



>ref|XP_006447271.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
 ref|XP_006447272.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
 ref|XP_006469891.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Citrus 
sinensis]
 gb|ESR60511.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
 gb|ESR60512.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
Length=379

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SP+FVQAPSEK    F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLS PY
Sbjct  63   SPIFVQAPSEKSLSSFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSHPY  122

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI DCF RTVKDEGI+SLWRGNTANVIRYFPTQALN
Sbjct  123  KGISDCFGRTVKDEGILSLWRGNTANVIRYFPTQALN  159



>ref|NP_001105431.1| ADP,ATP carrier protein 1, mitochondrial precursor [Zea mays]
 sp|P04709.3|ADT1_MAIZE RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocator 1; Short=ANT 1; Flags: Precursor [Zea mays]
 emb|CAA40781.1| adenine nucleotide translocator [Zea mays]
 gb|ACF88121.1| unknown [Zea mays]
 gb|ACG24998.1| ADP,ATP carrier protein [Zea mays]
Length=387

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 117/170 (69%), Gaps = 10/170 (6%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNS--KTFKHGNYTNSMLQPRN  319
            DQ +  TV  K+ G+ HLRS      +++   C   P ++S  + F   NY    L   +
Sbjct  3    DQANQPTVLHKLGGQFHLRSIIS-EGVRARNIC---PSVSSYERRFATRNYMTQSLWGPS  58

Query  318  LSTARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
            +S +         +P+   AP+EKG   F IDFMMGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  59   MSVSGGINVPVMQTPLCANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  118

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEMIK+GRLSEPYKGI+DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  119  DEMIKSGRLSEPYKGIVDCFKRTIKDEGFSSLWRGNTANVIRYFPTQALN  168



>gb|AFW63697.1| adenine nucleotide translocator2 [Zea mays]
Length=464

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 117/169 (69%), Gaps = 8/169 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDC-FYQPFLNSKTFKHGNYTNSMLQPRNL  316
            DQ +  TV  K+ G+ HL S++    +++   C  + P+   + F   NY    L   ++
Sbjct  80   DQANQPTVLHKLGGQFHL-SSSFSEGVRARNICPSFSPY--ERRFATRNYMTQSLWGPSM  136

Query  315  STARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  148
            S +         +P+F  AP+EKG   F IDFMMGGVSAAVSKTAAAPIERVKLLIQNQD
Sbjct  137  SVSGGINVPVMPTPLFANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  196

Query  147  EMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            EMIK+GRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  197  EMIKSGRLSEPYKGIADCFKRTIKDEGFSSLWRGNTANVIRYFPTQALN  245



>ref|XP_009109094.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Brassica 
rapa]
 ref|XP_009109095.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Brassica 
rapa]
 emb|CDY14242.1| BnaA08g13730D [Brassica napus]
Length=377

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 113/159 (71%), Gaps = 9/159 (6%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTARSYA  295
            +V +K+ G+  L ST   P +Q         F+N           S+LQ  +  T+    
Sbjct  8    SVFQKIRGQTSLISTLS-PTVQPRNHSISGAFVNGGL-------QSLLQSTSHGTSLIPR  59

Query  294  AS-PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSE  118
             S PV  QAP+EK   GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM++AGRLSE
Sbjct  60   GSLPVLAQAPTEKSSTGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLRAGRLSE  119

Query  117  PYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            PYKGI DCF+RTVKDEG++SLWRGNTANV+RYFPTQALN
Sbjct  120  PYKGITDCFTRTVKDEGVLSLWRGNTANVLRYFPTQALN  158



>gb|KDO42766.1| hypothetical protein CISIN_1g016996mg [Citrus sinensis]
 gb|KDO42767.1| hypothetical protein CISIN_1g016996mg [Citrus sinensis]
 gb|KDO42768.1| hypothetical protein CISIN_1g016996mg [Citrus sinensis]
Length=379

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SP+FVQAPSEK    F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK GRLS PY
Sbjct  63   SPIFVQAPSEKSLSSFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKNGRLSHPY  122

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI DCF+RTVKDEGI+SLWRGNTANVIRYFPTQALN
Sbjct  123  KGISDCFARTVKDEGILSLWRGNTANVIRYFPTQALN  159



>ref|XP_003539937.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Glycine 
max]
 gb|KHN28117.1| ADP,ATP carrier protein 3, mitochondrial [Glycine soja]
Length=371

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 116/165 (70%), Gaps = 16/165 (10%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKH-GNYTNSMLQPRNL  316
            D P   +V +K+AG+ +L S                P  NS+ +   G+Y N  +    L
Sbjct  3    DGPQHPSVVQKLAGQSYLVSRL-------------SPNFNSRNYSATGSYVNGGMHSPGL  49

Query  315  STARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  136
              A     SPV V AP+EKG  GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK
Sbjct  50   --AVVSPVSPVTVHAPAEKGVSGFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK  107

Query  135  AGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            +GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  108  SGRLSEPYKGIGDCFARTMKDEGVIALWRGNTANVIRYFPTQALN  152



>ref|XP_004985876.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Setaria 
italica]
Length=381

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEP  115
            +SP F  AP EK F GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEP
Sbjct  64   SSPFFASAPKEKSFSGFMVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEP  123

Query  114  YKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            YKGI DCF+RT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  124  YKGIGDCFARTMKDEGVISLWRGNTANVIRYFPTQALN  161



>ref|XP_003540370.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Glycine 
max]
 gb|KHN27900.1| ADP,ATP carrier protein 3, mitochondrial [Glycine soja]
Length=367

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 100/128 (78%), Gaps = 11/128 (9%)
 Frame = -2

Query  351  NYTNSMLQP---RNLSTARSY--------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAV  205
            +Y  S L P   RN ST  SY           PV   AP+EKG  GF +DF+MGGVSAAV
Sbjct  20   SYLVSRLAPNHSRNCSTTGSYFNGGLQSSGLVPVTAHAPAEKGVSGFLLDFLMGGVSAAV  79

Query  204  SKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIR  25
            SKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIR
Sbjct  80   SKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFTRTMKDEGVIALWRGNTANVIR  139

Query  24   YFPTQALN  1
            YFPTQALN
Sbjct  140  YFPTQALN  147



>gb|ACU24185.1| unknown [Glycine max]
Length=367

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 100/128 (78%), Gaps = 11/128 (9%)
 Frame = -2

Query  351  NYTNSMLQP---RNLSTARSY--------AASPVFVQAPSEKGFVGFAIDFMMGGVSAAV  205
            +Y  S L P   RN ST  SY           PV   AP+EKG  GF +DF+MGGVSAAV
Sbjct  20   SYLVSRLAPNHSRNCSTTGSYFNGGLQSSGLVPVTAHAPAEKGVSGFLLDFLMGGVSAAV  79

Query  204  SKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIR  25
            SKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIR
Sbjct  80   SKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFTRTMKDEGVIALWRGNTANVIR  139

Query  24   YFPTQALN  1
            YFPTQALN
Sbjct  140  YFPTQALN  147



>ref|XP_010438469.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Camelina 
sativa]
Length=380

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = -2

Query  342  NSMLQPRNLSTARS---YAASPVF-VQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIER  175
            +S+LQ  N     S   + + PV  VQAPSEK   GF IDF+MGGVSAAVSKTAAAPIER
Sbjct  44   HSLLQSTNQGVGSSLLPHGSLPVVSVQAPSEKTGTGFLIDFLMGGVSAAVSKTAAAPIER  103

Query  174  VKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            VKLLIQNQDEMIKAGRLSEPYKGI DCF RTVKDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  104  VKLLIQNQDEMIKAGRLSEPYKGISDCFCRTVKDEGMVALWRGNTANVIRYFPTQALN  161



>gb|AFW63698.1| adenine nucleotide translocator2 [Zea mays]
Length=416

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 117/169 (69%), Gaps = 8/169 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDC-FYQPFLNSKTFKHGNYTNSMLQPRNL  316
            DQ +  TV  K+ G+ HL S++    +++   C  + P+   + F   NY    L   ++
Sbjct  80   DQANQPTVLHKLGGQFHL-SSSFSEGVRARNICPSFSPY--ERRFATRNYMTQSLWGPSM  136

Query  315  STARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  148
            S +         +P+F  AP+EKG   F IDFMMGGVSAAVSKTAAAPIERVKLLIQNQD
Sbjct  137  SVSGGINVPVMPTPLFANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  196

Query  147  EMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            EMIK+GRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  197  EMIKSGRLSEPYKGIADCFKRTIKDEGFSSLWRGNTANVIRYFPTQALN  245



>gb|ABV25603.1| putative mitochondrial ADP/ATP translocase [Marchantia polymorpha]
Length=388

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 126/172 (73%), Gaps = 16/172 (9%)
 Frame = -2

Query  489  QPHCLTVSEKVAGKLHL------RSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ  328
            Q +  +++++ +G+ +L      R +  VP++ ++    ++P +  +T  +     + L 
Sbjct  4    QQYTTSLAQRFSGQTYLGSKIVPRRSLAVPEINNYGA--FRPGVLPRTSMY-----NPLC  56

Query  327  PRNLSTARSYA---ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQ  157
            P +LS   + A   +S VFV AP+EKG  GF IDFMMGGVSAAVSKTAAAPIERVKLLIQ
Sbjct  57   PIDLSKGPNMAPSVSSSVFVPAPAEKGVAGFMIDFMMGGVSAAVSKTAAAPIERVKLLIQ  116

Query  156  NQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            NQDEM+K+GRLSEPYKGI +CFSRT+KDEG+++LWRGN ANV+RYFPTQALN
Sbjct  117  NQDEMLKSGRLSEPYKGIGECFSRTIKDEGVIALWRGNLANVLRYFPTQALN  168



>ref|XP_006447270.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
 gb|ESR60510.1| hypothetical protein CICLE_v10015260mg [Citrus clementina]
Length=442

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SP+FVQAPSEK    F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLS PY
Sbjct  126  SPIFVQAPSEKSLSSFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSHPY  185

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI DCF RTVKDEGI+SLWRGNTANVIRYFPTQALN
Sbjct  186  KGISDCFGRTVKDEGILSLWRGNTANVIRYFPTQALN  222



>ref|XP_010447988.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Camelina 
sativa]
 ref|XP_010447990.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Camelina 
sativa]
Length=380

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 111/152 (73%), Gaps = 17/152 (11%)
 Frame = -2

Query  405  FRDCFYQPFLNSK------TFKHG---NYTN----SMLQPRNLSTARS---YAASPVF-V  277
            F+  + QP+L S+        ++G    Y N    S+LQ  N     S   + + PV  V
Sbjct  10   FQKLYGQPYLISRLSPSVPAREYGVSDAYVNGGLKSLLQSTNQGVGFSLLPHGSLPVVSV  69

Query  276  QAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMD  97
            QAPSEK   GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGI D
Sbjct  70   QAPSEKTGTGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISD  129

Query  96   CFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            CF RTVKDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  130  CFGRTVKDEGMVALWRGNTANVIRYFPTQALN  161



>gb|AAM65696.1| ADP,ATP carrier-like protein [Arabidopsis thaliana]
Length=379

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 114/161 (71%), Gaps = 11/161 (7%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLSTARS--  301
            +V +K+ G+ +L +    P +Q+   C    ++N           S+LQP +     S  
Sbjct  8    SVFQKLHGQSYLINRLS-PSVQARGYCVSGAYVNGGL-------QSLLQPTSHGVGSSLI  59

Query  300  -YAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRL  124
             + + PV   APSEK   GF I F+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRL
Sbjct  60   PHGSFPVLAHAPSEKTGTGFLIYFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRL  119

Query  123  SEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            SEPYKGI DCF+RTVKDEG+++LWRGNTANVIRYFPTQALN
Sbjct  120  SEPYKGISDCFARTVKDEGMLALWRGNTANVIRYFPTQALN  160



>emb|CAA33742.1| adenine nucleotide translocator [Zea mays]
Length=387

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 117/170 (69%), Gaps = 10/170 (6%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNS--KTFKHGNYTNSMLQPRN  319
            DQ +  TV  K+ G+ HLRS      +++   C   P ++S  + F   NY    L   +
Sbjct  3    DQANQPTVLHKLGGQFHLRSIIS-EGVRARNIC---PSVSSYERRFATRNYMTQSLWGPS  58

Query  318  LSTARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
            +S +         +P+   AP+EKG   F IDFMMGGVSAAVS+TAAAPIERVKLLIQNQ
Sbjct  59   MSVSGGINVPVMQTPLCANAPAEKGGKNFMIDFMMGGVSAAVSETAAAPIERVKLLIQNQ  118

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEMIK+GRLSEPYKGI+DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  119  DEMIKSGRLSEPYKGIVDCFKRTIKDEGFSSLWRGNTANVIRYFPTQALN  168



>gb|KEH30700.1| ADP/ATP carrier protein [Medicago truncatula]
Length=371

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 118/164 (72%), Gaps = 14/164 (9%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D P+  ++++K+ G  +L     V  L S  +  Y+ +  S TF     TN  +Q   L+
Sbjct  3    DGPNHPSIAQKLGGYSYL-----VSRLSS--NSNYRNYSTSGTF-----TNGGVQTSGLA  50

Query  312  TARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKA  133
             A     S   V +P+EKG  GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K+
Sbjct  51   LASPL--SSFTVPSPAEKGPAGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKS  108

Query  132  GRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  109  GRLSEPYKGIGDCFARTMKDEGVIALWRGNTANVIRYFPTQALN  152



>ref|XP_010433228.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Camelina 
sativa]
 ref|XP_010433229.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Camelina 
sativa]
Length=380

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 97/118 (82%), Gaps = 4/118 (3%)
 Frame = -2

Query  342  NSMLQPRNLSTARS---YAASPVF-VQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIER  175
            +S+L   N     S   + + PV  VQAPSEK   GF IDF+MGGVSAAVSKTAAAPIER
Sbjct  44   HSLLHSTNQGVGSSSLPHGSLPVVSVQAPSEKTGTGFLIDFLMGGVSAAVSKTAAAPIER  103

Query  174  VKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            VKLLIQNQDEMIKAGRLSEPYKGI DCF RTVKDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  104  VKLLIQNQDEMIKAGRLSEPYKGISDCFGRTVKDEGMVALWRGNTANVIRYFPTQALN  161



>ref|XP_009397774.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397775.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=384

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            +PVF  AP EKG  GF IDF+MGGVSAA+SKTAAAPIERVKLLIQNQDEMI+AGRLSEPY
Sbjct  68   TPVFACAPKEKGSTGFLIDFLMGGVSAAISKTAAAPIERVKLLIQNQDEMIRAGRLSEPY  127

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI DCFSRT+KDEG ++LWRGNTANVIRYFPTQALN
Sbjct  128  KGIRDCFSRTIKDEGFLALWRGNTANVIRYFPTQALN  164



>ref|XP_008677790.1| PREDICTED: ADP,ATP carrier protein 2, mitochondrial isoform X2 
[Zea mays]
Length=519

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 117/169 (69%), Gaps = 8/169 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDC-FYQPFLNSKTFKHGNYTNSMLQPRNL  316
            DQ +  TV  K+ G+ HL S++    +++   C  + P+   + F   NY    L   ++
Sbjct  135  DQANQPTVLHKLGGQFHL-SSSFSEGVRARNICPSFSPY--ERRFATRNYMTQSLWGPSM  191

Query  315  STARSYAA----SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  148
            S +         +P+F  AP+EKG   F IDFMMGGVSAAVSKTAAAPIERVKLLIQNQD
Sbjct  192  SVSGGINVPVMPTPLFANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQD  251

Query  147  EMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            EMIK+GRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  252  EMIKSGRLSEPYKGIADCFKRTIKDEGFSSLWRGNTANVIRYFPTQALN  300



>gb|ACJ84706.1| unknown [Medicago truncatula]
 gb|AFK47019.1| unknown [Medicago truncatula]
Length=371

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 118/164 (72%), Gaps = 14/164 (9%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D P+  ++++K+ G  +L     V  L S  +  Y+ +  S TF     TN  +Q   L+
Sbjct  3    DGPNHPSIAQKLGGYSYL-----VSRLSS--NSNYRNYSTSGTF-----TNGGVQTSGLA  50

Query  312  TARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKA  133
             A     S   V +P+EKG  GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDE++K+
Sbjct  51   LASPL--SSFTVPSPAEKGPAGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEILKS  108

Query  132  GRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            GRLSEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  109  GRLSEPYKGIGDCFARTMKDEGVIALWRGNTANVIRYFPTQALN  152



>ref|XP_006849411.1| hypothetical protein AMTR_s00160p00071720 [Amborella trichopoda]
 gb|ERN10992.1| hypothetical protein AMTR_s00160p00071720 [Amborella trichopoda]
Length=383

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = -2

Query  357  HGNYTNSMLQPRNLSTARSYA--ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAP  184
            H    NS+ Q  ++    S A   SPV  QAPSEKG  GF IDF MGGVSAAVSKTAAAP
Sbjct  44   HVGIPNSLYQASHIGHTLSVATHVSPVLFQAPSEKGVSGFNIDFFMGGVSAAVSKTAAAP  103

Query  183  IERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQAL  4
            IERVKLLIQN DEMIKAGRL +PYKGI +CF RT+KDEG V+LWRGNTANVIRYFPTQAL
Sbjct  104  IERVKLLIQNSDEMIKAGRLLKPYKGIGNCFGRTIKDEGFVALWRGNTANVIRYFPTQAL  163

Query  3    N  1
            N
Sbjct  164  N  164



>ref|XP_008231276.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Prunus 
mume]
Length=384

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 119/173 (69%), Gaps = 17/173 (10%)
 Frame = -2

Query  495  IDQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNL  316
            +DQ    +V +KVAG+L  +S      +Q +   F +P +  +   +GNY+N+ LQ   +
Sbjct  2    VDQVQHPSVVQKVAGQLLQQS------IQGYDSGFQRPGMYQRR-AYGNYSNAALQYPFM  54

Query  315  STARSYA--------ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               R+          ASP+FVQAP+EKG   F IDF+MGGVSAAVSKTAAAPIERVKLLI
Sbjct  55   PACRATTDLSLVPSTASPIFVQAPAEKGH--FLIDFLMGGVSAAVSKTAAAPIERVKLLI  112

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIK GRLSEPYKGI DCF RT+K+EG  SLWRGNTANVI +   QALN
Sbjct  113  QNQDEMIKTGRLSEPYKGIGDCFGRTIKEEGFGSLWRGNTANVISWNLLQALN  165



>ref|XP_006647801.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006647802.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like isoform 
X2 [Oryza brachyantha]
Length=387

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 115/176 (65%), Gaps = 25/176 (14%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRST--------THVPDLQSFRDCFYQPFLNSKTFKHGNY-TN  340
            +QP   TV +K+ G+ HL S+           P + S+           + F   +Y T 
Sbjct  6    NQP---TVLQKLGGQFHLASSFSEGVRVRNTCPSVSSY----------DRRFTTRSYMTQ  52

Query  339  SMLQPR---NLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVK  169
            S+  P    N        +SP++  AP+EKG   F +DF+MGGVSAAVSKTAAAPIERVK
Sbjct  53   SLWGPAMSVNGGINVPMMSSPIYANAPAEKGGKNFMVDFLMGGVSAAVSKTAAAPIERVK  112

Query  168  LLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            LLIQNQDEMIKAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  113  LLIQNQDEMIKAGRLSEPYKGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALN  168



>ref|XP_007150379.1| hypothetical protein PHAVU_005G148300g [Phaseolus vulgaris]
 gb|ESW22373.1| hypothetical protein PHAVU_005G148300g [Phaseolus vulgaris]
Length=392

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 125/173 (72%), Gaps = 6/173 (3%)
 Frame = -2

Query  501  MTIDQPHCLTVSEKVAGKLHLRSTTHV-PDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQ-  328
            M ID+    T+ +K AG+LHLRS +++ P + +      +  L  + F   NY+N+ LQ 
Sbjct  1    MMIDKQQYPTIEQKFAGQLHLRSNSNLSPHVGTCYGDLKRIALFQQRFSLENYSNAGLQF  60

Query  327  ---PRNLSTARSYA-ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLI  160
               P    T   ++  SPVFV +P EK +  FA DF+MGGVSAAVSK+AAAPIERVKLLI
Sbjct  61   PVMPACKPTNNMHSIGSPVFVPSPLEKNWGTFATDFLMGGVSAAVSKSAAAPIERVKLLI  120

Query  159  QNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            QNQDEMIKAGRLSEPYKGI DCF RT+KDEG VSLWRGNTANVIRYFPTQALN
Sbjct  121  QNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFVSLWRGNTANVIRYFPTQALN  173



>gb|EMT17760.1| ADP,ATP carrier protein, mitochondrial [Aegilops tauschii]
Length=380

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 116/166 (70%), Gaps = 9/166 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D+ +  +V +K  G+ HL +++    +++   C   P    +      +T S    +NL 
Sbjct  3    DRANHPSVMQKFGGQFHL-ASSFSEGVRARNICPSVPSYERR------FTTSSYMTQNLG  55

Query  312  -TARSYAASPVFVQAPSEK-GFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             +    ++SP+F  AP EK G   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  56   ISVPMMSSSPLFANAPPEKKGVKNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  115

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  116  KAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  161



>gb|EMS54584.1| ADP,ATP carrier protein, mitochondrial [Triticum urartu]
Length=380

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 116/166 (70%), Gaps = 9/166 (5%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D+ +  +V +K  G+ HL +++    +++   C   P    +      +T S    +NL 
Sbjct  3    DRANHPSVMQKFGGQFHL-ASSFSEGVRARNICPSVPSYERR------FTTSSYMTQNLG  55

Query  312  -TARSYAASPVFVQAPSEK-GFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
             +    ++SP+F  AP EK G   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  56   ISVPMMSSSPLFANAPPEKKGVKNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  115

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  116  KAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  161



>gb|AFK44525.1| unknown [Medicago truncatula]
Length=365

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 98/119 (82%), Gaps = 3/119 (3%)
 Frame = -2

Query  354  GNYTNSMLQ-PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIE  178
            G+Y+N   Q P   +   +  ASP+FV AP+EKG   F +DF+MGGVSAAVSKTAAAPIE
Sbjct  29   GSYSNPAFQYPMMPACNAATTASPIFVAAPAEKG--NFLVDFLMGGVSAAVSKTAAAPIE  86

Query  177  RVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            R+KLLIQNQDEMIKAGRLSEPYKGI DCF RT  +EG+V+LWRGNTANVIRYFPTQALN
Sbjct  87   RIKLLIQNQDEMIKAGRLSEPYKGIGDCFKRTTAEEGVVALWRGNTANVIRYFPTQALN  145



>emb|CAA56325.1| ATP/ADP carrier protein [Triticum turgidum]
Length=331

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = -2

Query  297  AASPVFVQAPSEK-GFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLS  121
            ++SP+F  AP EK G   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLS
Sbjct  13   SSSPMFANAPPEKKGVKNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLS  72

Query  120  EPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            EPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  73   EPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  112



>dbj|BAJ99879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SP+   AP EKGF GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLS PY
Sbjct  63   SPMCAPAPEEKGFSGFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSHPY  122

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            K I DCFSRT+KDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  123  KSIGDCFSRTIKDEGVVALWRGNTANVIRYFPTQALN  159



>gb|EMS49632.1| ADP,ATP carrier protein, mitochondrial [Triticum urartu]
Length=378

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SP+   AP EKGF GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLS PY
Sbjct  63   SPIRAPAPEEKGFSGFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSHPY  122

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            K I DCF+RT+KDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  123  KSIGDCFTRTIKDEGVVALWRGNTANVIRYFPTQALN  159



>ref|XP_010943967.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
 ref|XP_010943968.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Elaeis 
guineensis]
Length=387

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SP+   AP EKG  GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY
Sbjct  71   SPISACAPQEKGISGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  130

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI DCF RT+K+EG++SLWRGNTANVIRYFPTQALN
Sbjct  131  KGIGDCFGRTIKNEGMLSLWRGNTANVIRYFPTQALN  167



>sp|Q41630.1|ADT2_WHEAT RecName: Full=ADP,ATP carrier protein 2, mitochondrial; AltName: 
Full=ADP/ATP translocase 2; AltName: Full=Adenine nucleotide 
translocator 2; Short=ANT 2; Flags: Precursor [Triticum 
aestivum]
 emb|CAA65120.1| adenine nucleotide translocator [Triticum turgidum]
Length=331

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = -2

Query  297  AASPVFVQAPSEK-GFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLS  121
            ++SP+F  AP EK G   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLS
Sbjct  13   SSSPLFANAPPEKKGVKNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLS  72

Query  120  EPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            EPYKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  73   EPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  112



>ref|XP_003627715.1| ADP,ATP carrier protein [Medicago truncatula]
 gb|AET02191.1| ADP/ATP carrier protein [Medicago truncatula]
Length=399

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 98/119 (82%), Gaps = 3/119 (3%)
 Frame = -2

Query  354  GNYTNSMLQ-PRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIE  178
            G+Y+N   Q P   +   +  ASP+FV AP+EKG   F +DF+MGGVSAAVSKTAAAPIE
Sbjct  63   GSYSNPAFQYPMMPACNAATTASPIFVAAPAEKG--NFLVDFLMGGVSAAVSKTAAAPIE  120

Query  177  RVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            R+KLLIQNQDEMIKAGRLSEPYKGI DCF RT  +EG+V+LWRGNTANVIRYFPTQALN
Sbjct  121  RIKLLIQNQDEMIKAGRLSEPYKGIGDCFKRTTAEEGVVALWRGNTANVIRYFPTQALN  179



>ref|XP_007132806.1| hypothetical protein PHAVU_011G126000g [Phaseolus vulgaris]
 gb|ESW04800.1| hypothetical protein PHAVU_011G126000g [Phaseolus vulgaris]
Length=371

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 104/138 (75%), Gaps = 3/138 (2%)
 Frame = -2

Query  411  QSFRDCFYQPFLNSKTFKH-GNYTNSMLQPRNLSTARSYAASPVFVQAPSEKGFVGFAID  235
            QS+      P  +S+ +   G+  N  L    L+   S   SP+   AP+EKG   F +D
Sbjct  17   QSYLVSRLSPNFHSRNYSATGSCFNGGLHSSGLAALSS--VSPITAHAPAEKGPGAFMVD  74

Query  234  FMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSL  55
            F+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGI DCF+RT+KDEG+++L
Sbjct  75   FLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFARTMKDEGVIAL  134

Query  54   WRGNTANVIRYFPTQALN  1
            WRGNTANVIRYFPTQALN
Sbjct  135  WRGNTANVIRYFPTQALN  152



>gb|AFW73141.1| hypothetical protein ZEAMMB73_486171 [Zea mays]
Length=144

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            +P+   AP+EKG   F IDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPY
Sbjct  23   TPLCANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPY  82

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQ  10
            KGI+DCF RT+KDEG  SLWRGNTANVIRYFPTQ
Sbjct  83   KGIVDCFKRTIKDEGFSSLWRGNTANVIRYFPTQ  116



>gb|EPS69506.1| hypothetical protein M569_05258, partial [Genlisea aurea]
Length=378

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 115/166 (69%), Gaps = 22/166 (13%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSML-----QPRNLST  310
            +V++K+ G+ +L S    P +QS                  NYTN  L     Q  +++ 
Sbjct  9    SVTQKIYGQSYLLSRIS-PHMQSGNSSL-------------NYTNGGLLSISSQSFHVTG  54

Query  309  ARSYA-ASPVFVQAPSEKG--FVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
               ++ ASP  V AP EKG  F  F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI
Sbjct  55   NEIFSPASPFPVHAPVEKGKGFNSFMVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  114

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            +AGRLSEPYKGI DCF RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  115  RAGRLSEPYKGISDCFGRTIKDEGVIALWRGNTANVIRYFPTQALN  160



>ref|XP_010689049.1| PREDICTED: ADP,ATP carrier protein [Beta vulgaris subsp. vulgaris]
 ref|XP_010689050.1| PREDICTED: ADP,ATP carrier protein [Beta vulgaris subsp. vulgaris]
Length=383

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 119/161 (74%), Gaps = 8/161 (5%)
 Frame = -2

Query  474  TVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSML---QPRNLSTAR  304
            +V +K+ GK +  S    P LQ+ R+C    F   ++F +G + + +L   Q   L T  
Sbjct  9    SVYKKIQGKSYFMSQVS-PSLQA-RNCTVHNF--RRSFFNGEFQSPVLYSYQGTGL-TDV  63

Query  303  SYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRL  124
            S  ++P+ V A +EK    F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K+GRL
Sbjct  64   SPVSTPILVPAVAEKAQKNFWVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKSGRL  123

Query  123  SEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            SEPYKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  124  SEPYKGISDCFARTMKDEGMIALWRGNTANVIRYFPTQALN  164



>sp|Q41629.1|ADT1_WHEAT RecName: Full=ADP,ATP carrier protein 1, mitochondrial; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocator 1; Short=ANT 1; Flags: Precursor [Triticum 
aestivum]
 emb|CAA65119.1| adenine nucleotide translocator [Triticum turgidum]
Length=331

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -2

Query  291  SPVFVQAPSEK-GFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEP  115
            SP+F  AP EK G   FAIDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEP
Sbjct  15   SPMFANAPPEKKGVKNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEP  74

Query  114  YKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            YKGI DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  75   YKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALN  112



>ref|XP_008810549.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008810550.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008810551.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008810552.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=387

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 117/170 (69%), Gaps = 11/170 (6%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHL------RSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSML  331
            D+ H  ++ +K+ G+ +L       S        +F   +    LNS   K  +Y +++ 
Sbjct  3    DELHPPSIVQKIHGESYLFSRLSPYSQARSASFHNFPGTYINGGLNSALLK--SYHSNI-  59

Query  330  QPRNLSTARSYAASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ  151
               +L  +     SP+   AP EKG  GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQ
Sbjct  60   --ESLGFSSFSHLSPICACAPQEKGISGFLMDFLMGGVSAAVSKTAAAPIERVKLLIQNQ  117

Query  150  DEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            DEMIK+GRLSEPYKGI DCF+RT+K+EG++SLWRGNTANVIRYFPTQALN
Sbjct  118  DEMIKSGRLSEPYKGIGDCFARTIKNEGMLSLWRGNTANVIRYFPTQALN  167



>gb|AFW73142.1| adenine nucleotide translocator, mRNA [Zea mays]
Length=338

 Score =   173 bits (439),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            +P+   AP+EKG   F IDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPY
Sbjct  23   TPLCANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPY  82

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI+DCF RT+KDEG  SLWRGNTANVIRYFPTQALN
Sbjct  83   KGIVDCFKRTIKDEGFSSLWRGNTANVIRYFPTQALN  119



>dbj|BAJ98173.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SP+   AP EKGF GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLS PY
Sbjct  63   SPMCAPAPEEKGFSGFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSHPY  122

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            K I DCFSRT+KDEG+V+LWRGN ANVIRYFPTQALN
Sbjct  123  KSIGDCFSRTIKDEGVVALWRGNAANVIRYFPTQALN  159



>ref|XP_006366306.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Solanum 
tuberosum]
Length=349

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 6/123 (5%)
 Frame = -2

Query  351  NYTNSMLQPRNLST--ARSYAASPVFVQAPSE----KGFVGFAIDFMMGGVSAAVSKTAA  190
             Y N +++   ++T  A   +  PV VQ+PSE    K    F +DF MGGVSAAVSKTAA
Sbjct  4    GYVNEIIKGHFVATRQASEQSRGPVLVQSPSEAPLEKKMTSFMVDFFMGGVSAAVSKTAA  63

Query  189  APIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQ  10
            APIERVKLLIQNQDEMIK+GRLSEPYKGI DCF+RT+KDEG++SLWRGN+ANVIRYFPTQ
Sbjct  64   APIERVKLLIQNQDEMIKSGRLSEPYKGITDCFTRTIKDEGVLSLWRGNSANVIRYFPTQ  123

Query  9    ALN  1
            ALN
Sbjct  124  ALN  126



>gb|EMT13243.1| ADP,ATP carrier protein, mitochondrial [Aegilops tauschii]
Length=378

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            SP+   AP EKGF GF IDF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLS PY
Sbjct  63   SPIRAPAPEEKGFSGFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSHPY  122

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            K I  CF+RT+KDEG+V+LWRGNTANVIRYFPTQALN
Sbjct  123  KSIGHCFTRTIKDEGVVALWRGNTANVIRYFPTQALN  159



>ref|XP_009606916.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=384

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = -2

Query  354  GNYTNSMLQPRNLSTARSYAA------SPVFVQAPSE-KGFVGFAIDFMMGGVSAAVSKT  196
            G Y N +L+   +++  +         +P+ +QAPSE K    F +DF+MGGVSAAVSKT
Sbjct  40   GGYVNEVLRGAFMTSCHANILEIQSLRNPILIQAPSEEKKANSFIVDFLMGGVSAAVSKT  99

Query  195  AAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFP  16
            AAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RT+KDEG+++LWRGNTANVIRYFP
Sbjct  100  AAAPIERVKLLIQNQDEMIKAGRLSEPYKGITDCFGRTIKDEGVIALWRGNTANVIRYFP  159

Query  15   TQALN  1
            TQALN
Sbjct  160  TQALN  164



>emb|CAA26600.1| unnamed protein product [Zea mays]
Length=318

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  291  SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPY  112
            +P+   AP+EKG   F IDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPY
Sbjct  3    TPLCANAPAEKGGKNFMIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPY  62

Query  111  KGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KGI+DCF RT+KDEG  SLWRG TANVIRYFPTQALN
Sbjct  63   KGIVDCFKRTIKDEGFSSLWRGYTANVIRYFPTQALN  99



>ref|XP_009781621.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=384

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = -2

Query  354  GNYTNSMLQPRNLSTARS------YAASPVFVQAPSEKGFVG-FAIDFMMGGVSAAVSKT  196
            G Y N +L+   +++  +         +P+ +QAPSE+     F +DF+MGGVSAAVSKT
Sbjct  40   GGYVNEVLRGAFMTSCHANILEFPLLHNPILIQAPSEEKKANYFIVDFLMGGVSAAVSKT  99

Query  195  AAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFP  16
            AAAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RT+KDEG+++LWRGNTANVIRYFP
Sbjct  100  AAAPIERVKLLIQNQDEMIKAGRLSEPYKGIADCFGRTIKDEGVIALWRGNTANVIRYFP  159

Query  15   TQALN  1
            TQALN
Sbjct  160  TQALN  164



>ref|XP_001779965.1| predicted protein [Physcomitrella patens]
 ref|XP_001779995.1| predicted protein [Physcomitrella patens]
 gb|EDQ55174.1| predicted protein [Physcomitrella patens]
 gb|EDQ55204.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   169 bits (429),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEP  115
            +S VFV A +EK F  F  DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K+GRLS P
Sbjct  2    SSQVFVPAANEKTFASFMTDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKSGRLSHP  61

Query  114  YKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            YKGI +CFSRTVKDEG++SLWRGNTANVIRYFPTQALN
Sbjct  62   YKGIGECFSRTVKDEGMMSLWRGNTANVIRYFPTQALN  99



>ref|XP_001764599.1| predicted protein [Physcomitrella patens]
 gb|EDQ70581.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  294  ASPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEP  115
            +S VFV A +EK F  F  DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K+GRLS P
Sbjct  2    SSQVFVPAANEKTFASFMTDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKSGRLSHP  61

Query  114  YKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            YKGI +CFSRT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  62   YKGIGECFSRTIKDEGMMSLWRGNTANVIRYFPTQALN  99



>ref|XP_008789809.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008789810.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008789811.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Phoenix 
dactylifera]
Length=384

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -2

Query  273  APSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDC  94
            AP EKG  GF  DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK GRLSEPYKGI DC
Sbjct  74   APQEKGISGFLTDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKTGRLSEPYKGIGDC  133

Query  93   FSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            F+RT+K+EG VSLWRGNTANVIRYFPTQALN
Sbjct  134  FARTIKNEGFVSLWRGNTANVIRYFPTQALN  164



>ref|XP_001784997.1| predicted protein [Physcomitrella patens]
 ref|XP_001785007.1| predicted protein [Physcomitrella patens]
 ref|XP_001785009.1| predicted protein [Physcomitrella patens]
 gb|EDQ50178.1| predicted protein [Physcomitrella patens]
 gb|EDQ50188.1| predicted protein [Physcomitrella patens]
 gb|EDQ50190.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  285  VFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKG  106
            VFV A SEK F  F  DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEM+K+GRLS PYKG
Sbjct  5    VFVPAASEKTFTAFMTDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKSGRLSHPYKG  64

Query  105  IMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            I +CF RT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  65   IGECFGRTIKDEGVMSLWRGNTANVIRYFPTQALN  99



>ref|XP_006367480.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Solanum 
tuberosum]
Length=384

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 97/127 (76%), Gaps = 11/127 (9%)
 Frame = -2

Query  354  GNYTNSML--------QPRNLSTARSYAASPVFVQAPSE-KGFVGFAIDFMMGGVSAAVS  202
            G Y N +L        Q  NL   +     P+ +QAPSE K    F +DF+MGGVSAAVS
Sbjct  40   GGYVNEVLGGACMTNCQAANLKVRQ--LGIPILIQAPSEEKKANSFVVDFLMGGVSAAVS  97

Query  201  KTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRY  22
            KTAAAPIERVKLLIQNQDEMIKAGRLSEP+KGI DCF RT+KDEG+++LWRGNTANVIRY
Sbjct  98   KTAAAPIERVKLLIQNQDEMIKAGRLSEPFKGISDCFGRTIKDEGVLALWRGNTANVIRY  157

Query  21   FPTQALN  1
            FPTQALN
Sbjct  158  FPTQALN  164



>ref|XP_004243366.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial [Solanum 
lycopersicum]
Length=383

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 97/124 (78%), Gaps = 6/124 (5%)
 Frame = -2

Query  354  GNYTNSMLQPRNLSTARSY-----AASPVFVQAPSE-KGFVGFAIDFMMGGVSAAVSKTA  193
            G Y N +L+   ++  ++          + +QAPSE K    F +DF+MGGVSAAVSKTA
Sbjct  40   GGYVNEILRGACMTNCQAANLEVRQLGNILIQAPSEEKKANSFVVDFLMGGVSAAVSKTA  99

Query  192  AAPIERVKLLIQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPT  13
            AAPIERVKLLIQNQDEMIKAGRLSEPYKGI DCF RT+KDEG+++LWRGNTANVIRYFPT
Sbjct  100  AAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFGRTIKDEGVLALWRGNTANVIRYFPT  159

Query  12   QALN  1
            QALN
Sbjct  160  QALN  163



>emb|CAN66307.1| hypothetical protein VITISV_009087 [Vitis vinifera]
Length=383

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 119/166 (72%), Gaps = 7/166 (4%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D     ++ +K+ G+ +L ST   P+LQS     +     S  + +G    S+L P    
Sbjct  3    DGSQHSSIFQKINGQSYLFSTLS-PNLQSRNTSVHSL---SSAYVNGGLQTSLL-PAGXG  57

Query  312  TARSYAA--SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
               +  +  SP+F  AP+EKG  GF IDF+MGGVSAAVSK+AAAPIERVKLLIQNQDEMI
Sbjct  58   NGLALVSPLSPIFAHAPAEKGAKGFMIDFLMGGVSAAVSKSAAAPIERVKLLIQNQDEMI  117

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF+RT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  118  KAGRLSEPYKGITDCFARTIKDEGVISLWRGNTANVIRYFPTQALN  163



>emb|CDP14814.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 110/174 (63%), Gaps = 12/174 (7%)
 Frame = -2

Query  486  PHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGN------YTNSMLQP  325
            P       K+A  LH  S       QS+      PF++S+     N      Y N  L  
Sbjct  29   PRSPDYQAKMADGLHHPSVLEKLHGQSYFFAQISPFMHSRNASAQNFSSVYGYANGGLCS  88

Query  324  RNLSTARSYAA------SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLL  163
              +S             SP+ + A +E+ F  F +DF+MGGVSAAVSKTAAAPIERVKLL
Sbjct  89   PFMSAFHGSGLEIVSQLSPIVIPAANERSFSSFMVDFLMGGVSAAVSKTAAAPIERVKLL  148

Query  162  IQNQDEMIKAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            IQNQDEMIKAGRLSE YKGI DCF+RT+KDEG+++LWRGNTANVIRYFPTQALN
Sbjct  149  IQNQDEMIKAGRLSERYKGITDCFARTIKDEGVLALWRGNTANVIRYFPTQALN  202



>ref|XP_010656992.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Vitis vinifera]
Length=383

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 119/166 (72%), Gaps = 7/166 (4%)
 Frame = -2

Query  492  DQPHCLTVSEKVAGKLHLRSTTHVPDLQSFRDCFYQPFLNSKTFKHGNYTNSMLQPRNLS  313
            D     ++ +K+ G+ +L ST   P+LQS     +     S  + +G    S+L P    
Sbjct  3    DGSQHSSIFQKINGQSYLFSTLS-PNLQSRNTSVHSL---SSAYVNGGLQTSLL-PAGSG  57

Query  312  TARSYAA--SPVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMI  139
               +  +  SP+F  AP+EKG  GF IDF+MGGVSAAVSK+AAAPIERVKLLIQNQDEMI
Sbjct  58   NGLALVSPLSPIFAHAPAEKGAKGFMIDFLMGGVSAAVSKSAAAPIERVKLLIQNQDEMI  117

Query  138  KAGRLSEPYKGIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            KAGRLSEPYKGI DCF+RT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  118  KAGRLSEPYKGITDCFARTIKDEGVISLWRGNTANVIRYFPTQALN  163



>ref|XP_009759661.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=387

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  QAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMD  97
            +AP EK    F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGI D
Sbjct  76   EAPLEKKTTSFIVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGITD  135

Query  96   CFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            CF+RT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  136  CFTRTIKDEGVLSLWRGNTANVIRYFPTQALN  167



>ref|XP_009759659.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009759660.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like isoform 
X1 [Nicotiana sylvestris]
Length=392

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  QAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIMD  97
            +AP EK    F +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMIK+GRLSEPYKGI D
Sbjct  76   EAPLEKKTTSFIVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGITD  135

Query  96   CFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            CF+RT+KDEG++SLWRGNTANVIRYFPTQALN
Sbjct  136  CFTRTIKDEGVLSLWRGNTANVIRYFPTQALN  167



>ref|XP_002982134.1| hypothetical protein SELMODRAFT_115674 [Selaginella moellendorffii]
 gb|EFJ16802.1| hypothetical protein SELMODRAFT_115674 [Selaginella moellendorffii]
Length=370

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 85/96 (89%), Gaps = 2/96 (2%)
 Frame = -2

Query  288  PVFVQAPSEKGFVGFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYK  109
            PVFV   SEK   GF +DF+MGGVSAAVSKTAAAPIERVKLLIQNQDEMI+ GRLSEPYK
Sbjct  53   PVFVPGASEK--PGFVVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIRMGRLSEPYK  110

Query  108  GIMDCFSRTVKDEGIVSLWRGNTANVIRYFPTQALN  1
            GI+DCF RT++DEG +SLWRGN ANVIRYFPTQALN
Sbjct  111  GILDCFGRTMRDEGAMSLWRGNLANVIRYFPTQALN  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 657324745168