BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8236_g1_i1 len=1766 path=[1744:0-1765]

Length=1766
                                                                      Score     E

ref|XP_009767132.1|  PREDICTED: mitogen-activated protein kinase ...    377   2e-122   
ref|XP_009623765.1|  PREDICTED: mitogen-activated protein kinase ...    376   8e-122   
ref|XP_007222400.1|  hypothetical protein PRUPE_ppa008119mg             372   1e-120   
ref|XP_006349303.1|  PREDICTED: mitogen-activated protein kinase ...    371   6e-120   
ref|XP_004230432.1|  PREDICTED: mitogen-activated protein kinase ...    366   6e-118   
ref|XP_004301562.1|  PREDICTED: mitogen-activated protein kinase ...    365   1e-117   
ref|XP_008218686.1|  PREDICTED: mitogen-activated protein kinase ...    362   2e-116   
ref|XP_010246145.1|  PREDICTED: mitogen-activated protein kinase ...    362   2e-116   
ref|XP_002528847.1|  ATP binding protein, putative                      360   1e-115   Ricinus communis
ref|XP_008365330.1|  PREDICTED: mitogen-activated protein kinase ...    357   2e-114   
ref|XP_009355446.1|  PREDICTED: mitogen-activated protein kinase ...    357   2e-114   
ref|XP_007041162.1|  NPK1-related protein kinase 3, putative            357   3e-114   
ref|XP_002304509.1|  hypothetical protein POPTR_0003s13010g             353   5e-113   Populus trichocarpa [western balsam poplar]
ref|XP_002264624.2|  PREDICTED: mitogen-activated protein kinase ...    353   5e-113   Vitis vinifera
ref|XP_011022649.1|  PREDICTED: mitogen-activated protein kinase ...    350   1e-111   
emb|CDO97638.1|  unnamed protein product                                350   1e-111   
gb|EYU35020.1|  hypothetical protein MIMGU_mgv1a019444mg                348   4e-111   
ref|XP_008339420.1|  PREDICTED: mitogen-activated protein kinase ...    348   5e-111   
ref|XP_011042456.1|  PREDICTED: mitogen-activated protein kinase ...    345   1e-109   
ref|XP_011087640.1|  PREDICTED: mitogen-activated protein kinase ...    343   9e-109   
gb|KDP42471.1|  hypothetical protein JCGZ_00268                         334   7e-106   
ref|XP_003548345.1|  PREDICTED: mitogen-activated protein kinase ...    330   2e-104   
ref|XP_010910534.1|  PREDICTED: mitogen-activated protein kinase ...    325   6e-102   
ref|XP_003539385.1|  PREDICTED: mitogen-activated protein kinase ...    322   3e-101   
ref|XP_007148585.1|  hypothetical protein PHAVU_006G220800g             320   1e-100   
ref|XP_008806975.1|  PREDICTED: mitogen-activated protein kinase ...    320   3e-100   
gb|ABE91852.1|  Protein kinase                                          311   2e-96    Medicago truncatula
ref|XP_003592879.1|  Mitogen-activated protein kinase kinase kinase     311   7e-96    
ref|XP_004485420.1|  PREDICTED: mitogen-activated protein kinase ...    304   5e-94    
gb|KHN11050.1|  Mitogen-activated protein kinase kinase kinase 2        288   1e-88    
ref|XP_006836834.1|  hypothetical protein AMTR_s00099p00063540          287   1e-86    
gb|KDO43268.1|  hypothetical protein CISIN_1g042809mg                   277   4e-85    
ref|XP_002960952.1|  hypothetical protein SELMODRAFT_74353              266   2e-80    
ref|XP_002967055.1|  hypothetical protein SELMODRAFT_86715              264   1e-79    
ref|XP_002960951.1|  hypothetical protein SELMODRAFT_73444              248   2e-73    
ref|XP_006431510.1|  hypothetical protein CICLE_v10003096mg             243   4e-72    
ref|XP_001780526.1|  predicted protein                                  239   2e-70    
ref|XP_002967056.1|  hypothetical protein SELMODRAFT_408419             247   2e-70    
ref|XP_001768190.1|  predicted protein                                  238   7e-70    
ref|XP_001760609.1|  predicted protein                                  238   1e-69    
ref|XP_001755952.1|  predicted protein                                  236   4e-69    
ref|XP_001755249.1|  predicted protein                                  233   7e-68    
ref|XP_009383559.1|  PREDICTED: mitogen-activated protein kinase ...    238   1e-67    
ref|XP_009404796.1|  PREDICTED: mitogen-activated protein kinase ...    237   2e-67    
ref|XP_009394082.1|  PREDICTED: mitogen-activated protein kinase ...    235   6e-67    
ref|XP_010916795.1|  PREDICTED: mitogen-activated protein kinase ...    236   3e-66    
ref|XP_009352665.1|  PREDICTED: mitogen-activated protein kinase ...    234   3e-66    
ref|XP_006346260.1|  PREDICTED: mitogen-activated protein kinase ...    234   5e-66    
ref|XP_009405196.1|  PREDICTED: mitogen-activated protein kinase ...    233   6e-66    
ref|XP_004134977.1|  PREDICTED: mitogen-activated protein kinase ...    230   3e-65    
ref|XP_010926215.1|  PREDICTED: mitogen-activated protein kinase ...    233   4e-65    
gb|KGN49092.1|  hypothetical protein Csa_6G513560                       229   4e-65    
ref|XP_009357591.1|  PREDICTED: mitogen-activated protein kinase ...    230   5e-65    
ref|XP_008784479.1|  PREDICTED: mitogen-activated protein kinase ...    232   6e-65    
ref|XP_004170035.1|  PREDICTED: mitogen-activated protein kinase ...    226   7e-65    
ref|XP_004151935.1|  PREDICTED: mitogen-activated protein kinase ...    229   1e-64    
ref|XP_002304913.2|  hypothetical protein POPTR_0004s00910g             228   1e-64    Populus trichocarpa [western balsam poplar]
ref|XP_004173671.1|  PREDICTED: mitogen-activated protein kinase ...    227   1e-64    
ref|XP_008441103.1|  PREDICTED: mitogen-activated protein kinase ...    229   2e-64    
ref|XP_002321133.2|  kinase family protein                              226   3e-64    Populus trichocarpa [western balsam poplar]
ref|XP_006389580.1|  hypothetical protein POPTR_0021s00300g             226   4e-64    
ref|XP_002524836.1|  Mitogen-activated protein kinase kinase kina...    228   5e-64    Ricinus communis
ref|XP_004244346.1|  PREDICTED: mitogen-activated protein kinase ...    228   6e-64    
ref|XP_008782219.1|  PREDICTED: serine/threonine-protein kinase 4...    230   8e-64    
ref|XP_008455899.1|  PREDICTED: mitogen-activated protein kinase ...    227   9e-64    
ref|XP_010099184.1|  Mitogen-activated protein kinase kinase kina...    227   9e-64    
ref|XP_010556997.1|  PREDICTED: mitogen-activated protein kinase ...    224   1e-63    
ref|XP_007026132.1|  Mitogen-activated protein kinase kinase kina...    228   2e-63    
ref|XP_008349313.1|  PREDICTED: mitogen-activated protein kinase ...    225   3e-63    
ref|XP_002269660.1|  PREDICTED: mitogen-activated protein kinase ...    225   3e-63    Vitis vinifera
ref|XP_011095801.1|  PREDICTED: mitogen-activated protein kinase ...    226   4e-63    
ref|XP_009403738.1|  PREDICTED: mitogen-activated protein kinase ...    226   5e-63    
ref|XP_008384252.1|  PREDICTED: mitogen-activated protein kinase ...    225   6e-63    
ref|XP_011006457.1|  PREDICTED: mitogen-activated protein kinase ...    224   7e-63    
ref|XP_001772494.1|  predicted protein                                  220   7e-63    
ref|XP_009403739.1|  PREDICTED: mitogen-activated protein kinase ...    225   8e-63    
ref|XP_011097967.1|  PREDICTED: mitogen-activated protein kinase ...    225   1e-62    
ref|XP_002302871.2|  hypothetical protein POPTR_0002s21350g             223   1e-62    Populus trichocarpa [western balsam poplar]
ref|XP_008371167.1|  PREDICTED: mitogen-activated protein kinase ...    224   2e-62    
ref|XP_003521050.1|  PREDICTED: mitogen-activated protein kinase ...    221   2e-62    
ref|XP_002518446.1|  ATP binding protein, putative                      221   2e-62    Ricinus communis
emb|CAN65217.1|  hypothetical protein VITISV_024689                     223   3e-62    Vitis vinifera
ref|XP_010244478.1|  PREDICTED: mitogen-activated protein kinase ...    223   3e-62    
gb|EEE56860.1|  hypothetical protein OsJ_06484                          221   4e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002529924.1|  Mitogen-activated protein kinase kinase kina...    223   6e-62    Ricinus communis
gb|EYU33654.1|  hypothetical protein MIMGU_mgv1a021391mg                219   1e-61    
ref|XP_007212556.1|  hypothetical protein PRUPE_ppa015439mg             219   1e-61    
ref|XP_011046960.1|  PREDICTED: mitogen-activated protein kinase ...    222   1e-61    
ref|XP_007020769.1|  Mitogen-activated protein kinase kinase kina...    222   1e-61    
ref|XP_010644538.1|  PREDICTED: mitogen-activated protein kinase ...    221   2e-61    
ref|XP_009421493.1|  PREDICTED: mitogen-activated protein kinase ...    221   2e-61    
ref|XP_003560747.1|  PREDICTED: mitogen-activated protein kinase ...    223   2e-61    
ref|XP_009037802.1|  hypothetical protein AURANDRAFT_2528               216   2e-61    
ref|NP_001046691.2|  Os02g0322400                                       221   2e-61    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD15943.1|  protein kinase-like                                    221   2e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011008032.1|  PREDICTED: mitogen-activated protein kinase ...    223   2e-61    
gb|EEC73042.1|  hypothetical protein OsI_06987                          221   3e-61    Oryza sativa Indica Group [Indian rice]
gb|KDP24854.1|  hypothetical protein JCGZ_24448                         220   3e-61    
ref|XP_009144845.1|  PREDICTED: mitogen-activated protein kinase ...    221   4e-61    
emb|CDX89295.1|  BnaA01g15980D                                          220   5e-61    
ref|XP_004295838.1|  PREDICTED: mitogen-activated protein kinase ...    220   5e-61    
ref|XP_007213446.1|  hypothetical protein PRUPE_ppa025047mg             219   8e-61    
ref|XP_006849466.1|  hypothetical protein AMTR_s00024p00089950          214   8e-61    
ref|XP_004954858.1|  PREDICTED: serine/threonine-protein kinase D...    222   1e-60    
ref|XP_008229972.1|  PREDICTED: mitogen-activated protein kinase ...    219   1e-60    
ref|XP_008224751.1|  PREDICTED: mitogen-activated protein kinase ...    219   1e-60    
ref|XP_006843642.1|  hypothetical protein AMTR_s00007p00166380          217   1e-60    
ref|XP_003517304.1|  PREDICTED: mitogen-activated protein kinase ...    216   2e-60    
ref|XP_006283707.1|  hypothetical protein CARUB_v10004778mg             218   3e-60    
ref|XP_010096874.1|  Mitogen-activated protein kinase kinase kina...    218   3e-60    
ref|XP_006843641.1|  hypothetical protein AMTR_s00007p00165610          216   3e-60    
ref|XP_003058436.1|  predicted protein                                  213   4e-60    
ref|XP_009614381.1|  PREDICTED: mitogen-activated protein kinase ...    218   4e-60    
ref|XP_009616882.1|  PREDICTED: mitogen-activated protein kinase ...    214   4e-60    
ref|XP_011003930.1|  PREDICTED: mitogen-activated protein kinase ...    218   6e-60    
ref|NP_180810.1|  mitogen-activated protein kinase kinase kinase 17     215   6e-60    Arabidopsis thaliana [mouse-ear cress]
emb|CDX97370.1|  BnaC08g12350D                                          216   7e-60    
ref|XP_010543009.1|  PREDICTED: mitogen-activated protein kinase ...    214   7e-60    
ref|XP_009790439.1|  PREDICTED: mitogen-activated protein kinase ...    215   8e-60    
ref|XP_005827279.1|  hypothetical protein GUITHDRAFT_47402              211   9e-60    
gb|KDO54709.1|  hypothetical protein CISIN_1g015500mg                   215   9e-60    
ref|XP_010252458.1|  PREDICTED: mitogen-activated protein kinase ...    217   1e-59    
ref|XP_010522353.1|  PREDICTED: mitogen-activated protein kinase ...    213   1e-59    
ref|XP_009109958.1|  PREDICTED: mitogen-activated protein kinase ...    216   1e-59    
tpg|DAA57972.1|  TPA: putative MAPKKK family protein kinase             216   1e-59    
ref|XP_003539360.1|  PREDICTED: mitogen-activated protein kinase ...    213   1e-59    
ref|XP_006447587.1|  hypothetical protein CICLE_v10015460mg             215   1e-59    
ref|XP_010089475.1|  Mitogen-activated protein kinase kinase kina...    215   2e-59    
ref|XP_009394653.1|  PREDICTED: mitogen-activated protein kinase ...    214   2e-59    
ref|XP_010484689.1|  PREDICTED: mitogen-activated protein kinase ...    213   2e-59    
ref|XP_009793037.1|  PREDICTED: mitogen-activated protein kinase ...    217   2e-59    
ref|XP_008385962.1|  PREDICTED: mitogen-activated protein kinase ...    217   2e-59    
ref|XP_006364162.1|  PREDICTED: mitogen-activated protein kinase ...    213   2e-59    
ref|XP_008676309.1|  PREDICTED: mitogen-activated protein kinase ...    216   2e-59    
gb|ACH99694.1|  NPKL2                                                   214   2e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002966267.1|  hypothetical protein SELMODRAFT_230838             217   2e-59    
ref|XP_008379645.1|  PREDICTED: mitogen-activated protein kinase ...    215   2e-59    
ref|XP_010236368.1|  PREDICTED: mitogen-activated protein kinase ...    216   3e-59    
ref|XP_002881230.1|  MAPKKK17                                           213   3e-59    
ref|XP_004243852.1|  PREDICTED: mitogen-activated protein kinase ...    212   3e-59    
ref|XP_004289177.1|  PREDICTED: mitogen-activated protein kinase ...    214   3e-59    
gb|AGA37258.1|  mitogen activated kinase kinase kinase 18.2             212   3e-59    
ref|XP_004243851.1|  PREDICTED: mitogen-activated protein kinase ...    211   3e-59    
emb|CDY18290.1|  BnaC05g03130D                                          212   3e-59    
ref|XP_009361098.1|  PREDICTED: mitogen-activated protein kinase ...    216   3e-59    
ref|XP_004243483.1|  PREDICTED: mitogen-activated protein kinase ...    212   3e-59    
ref|NP_001043978.1|  Os01g0699400                                       214   4e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008226949.1|  PREDICTED: mitogen-activated protein kinase ...    216   4e-59    
gb|EAZ13219.1|  hypothetical protein OsJ_03139                          214   4e-59    Oryza sativa Japonica Group [Japonica rice]
gb|EAY75501.1|  hypothetical protein OsI_03400                          214   5e-59    Oryza sativa Indica Group [Indian rice]
ref|XP_009119207.1|  PREDICTED: mitogen-activated protein kinase ...    211   6e-59    
ref|XP_003611720.1|  Protein kinase-like protein                        212   6e-59    
ref|XP_010469578.1|  PREDICTED: mitogen-activated protein kinase ...    212   6e-59    
gb|EYU27355.1|  hypothetical protein MIMGU_mgv1a026298mg                214   6e-59    
ref|XP_004167046.1|  PREDICTED: mitogen-activated protein kinase ...    212   7e-59    
ref|XP_002313986.2|  hypothetical protein POPTR_0009s07730g             213   7e-59    Populus trichocarpa [western balsam poplar]
gb|EPS71117.1|  hypothetical protein M569_03641                         211   7e-59    
ref|XP_008342026.1|  PREDICTED: mitogen-activated protein kinase ...    209   8e-59    
ref|XP_010457586.1|  PREDICTED: mitogen-activated protein kinase ...    211   8e-59    
ref|XP_004144594.1|  PREDICTED: mitogen-activated protein kinase ...    212   8e-59    
ref|XP_001421079.1|  predicted protein                                  210   9e-59    Ostreococcus lucimarinus CCE9901
emb|CDP10763.1|  unnamed protein product                                213   1e-58    
ref|XP_006295854.1|  hypothetical protein CARUB_v10024983mg             211   1e-58    
ref|XP_002503300.1|  predicted protein                                  208   1e-58    Micromonas commoda
ref|XP_009790438.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    210   1e-58    
ref|XP_007132528.1|  hypothetical protein PHAVU_011G102000g             211   1e-58    
ref|XP_010413987.1|  PREDICTED: mitogen-activated protein kinase ...    211   1e-58    
ref|XP_009770794.1|  PREDICTED: mitogen-activated protein kinase ...    218   2e-58    
gb|KHN08178.1|  Mitogen-activated protein kinase kinase kinase 3        210   2e-58    
emb|CDY19144.1|  BnaA04g18840D                                          211   2e-58    
gb|ACH99695.1|  NPKL2                                                   212   2e-58    Oryza sativa Indica Group [Indian rice]
gb|ABK06427.1|  HA-tagged protein kinase domain of putative mitog...    209   2e-58    
ref|XP_002978306.1|  hypothetical protein SELMODRAFT_108118             208   2e-58    
ref|XP_010035556.1|  PREDICTED: mitogen-activated protein kinase ...    212   2e-58    
ref|XP_007225680.1|  hypothetical protein PRUPE_ppa002856mg             217   2e-58    
ref|XP_008455448.1|  PREDICTED: mitogen-activated protein kinase ...    211   2e-58    
ref|XP_006364161.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-58    
ref|XP_009141244.1|  PREDICTED: mitogen-activated protein kinase ...    210   2e-58    
ref|XP_010264778.1|  PREDICTED: mitogen-activated protein kinase ...    214   2e-58    
ref|XP_002869589.1|  hypothetical protein ARALYDRAFT_492112             213   2e-58    
gb|KFK40368.1|  hypothetical protein AALP_AA3G364600                    209   3e-58    
emb|CDY14295.1|  BnaA08g14260D                                          213   3e-58    
ref|XP_004243853.1|  PREDICTED: mitogen-activated protein kinase ...    209   3e-58    
ref|XP_006342282.1|  PREDICTED: mitogen-activated protein kinase ...    209   3e-58    
emb|CDY53387.1|  BnaAnng12350D                                          209   3e-58    
gb|AGA37215.1|  mitogen-activated protein kinase kinase kinase 18.1     209   3e-58    
ref|XP_008222965.1|  PREDICTED: mitogen-activated protein kinase ...    217   4e-58    
ref|XP_008380362.1|  PREDICTED: mitogen-activated protein kinase ...    211   5e-58    
ref|XP_010096875.1|  Mitogen-activated protein kinase kinase kina...    209   5e-58    
ref|XP_008348361.1|  PREDICTED: mitogen-activated protein kinase ...    211   5e-58    
ref|XP_010475182.1|  PREDICTED: mitogen-activated protein kinase ...    209   6e-58    
ref|XP_009353299.1|  PREDICTED: mitogen-activated protein kinase ...    211   6e-58    
ref|XP_004486314.1|  PREDICTED: mitogen-activated protein kinase ...    211   7e-58    
ref|XP_009796297.1|  PREDICTED: mitogen-activated protein kinase ...    211   7e-58    
gb|KDP20719.1|  hypothetical protein JCGZ_21190                         211   7e-58    
ref|NP_001067464.1|  Os11g0207200                                       214   8e-58    Oryza sativa Japonica Group [Japonica rice]
gb|ABK06426.1|  HA-tagged protein kinase domain of putative mitog...    207   8e-58    
gb|KDP39158.1|  hypothetical protein JCGZ_00915                         210   9e-58    
ref|XP_005845602.1|  hypothetical protein CHLNCDRAFT_25736              209   9e-58    
ref|XP_010323839.1|  PREDICTED: mitogen-activated protein kinase ...    209   9e-58    
ref|XP_006419859.1|  hypothetical protein CICLE_v10004485mg             216   1e-57    
ref|XP_006410384.1|  hypothetical protein EUTSA_v10016838mg             209   1e-57    
gb|KHN09317.1|  Mitogen-activated protein kinase kinase kinase 2        218   1e-57    
ref|XP_003548172.1|  PREDICTED: mitogen-activated protein kinase ...    218   1e-57    
ref|XP_009766368.1|  PREDICTED: mitogen-activated protein kinase ...    216   1e-57    
ref|XP_009593508.1|  PREDICTED: mitogen-activated protein kinase ...    216   1e-57    
gb|KDO76248.1|  hypothetical protein CISIN_1g013380mg                   211   1e-57    
ref|XP_009396715.1|  PREDICTED: mitogen-activated protein kinase ...    213   1e-57    
ref|XP_004298165.1|  PREDICTED: mitogen-activated protein kinase ...    216   1e-57    
ref|XP_010451165.1|  PREDICTED: mitogen-activated protein kinase ...    211   1e-57    
sp|Q40541.1|NPK1_TOBAC  RecName: Full=Mitogen-activated protein k...    216   1e-57    Nicotiana tabacum [American tobacco]
gb|AHW50674.1|  mitogen-activated protein kinase kinase kinase a        209   1e-57    
ref|XP_006419860.1|  hypothetical protein CICLE_v10004485mg             215   2e-57    
ref|XP_009625848.1|  PREDICTED: mitogen-activated protein kinase ...    215   2e-57    
ref|XP_006418061.1|  hypothetical protein EUTSA_v10008116mg             207   2e-57    
ref|XP_006590517.1|  PREDICTED: mitogen-activated protein kinase ...    215   2e-57    
ref|XP_009600573.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-57    
ref|NP_200320.1|  mitogen-activated protein kinase kinase kinase 15     210   2e-57    Arabidopsis thaliana [mouse-ear cress]
gb|KDO74738.1|  hypothetical protein CISIN_1g005944mg                   215   2e-57    
emb|CDY12200.1|  BnaC04g12300D                                          208   2e-57    
ref|XP_009347129.1|  PREDICTED: mitogen-activated protein kinase ...    209   3e-57    
ref|XP_010928554.1|  PREDICTED: mitogen-activated protein kinase ...    215   3e-57    
ref|XP_001699564.1|  hypothetical protein CHLREDRAFT_121660             205   3e-57    Chlamydomonas reinhardtii
gb|KDO78298.1|  hypothetical protein CISIN_1g040569mg                   208   3e-57    
ref|XP_004487421.1|  PREDICTED: mitogen-activated protein kinase ...    209   3e-57    
gb|ABG22410.1|  mitogen-activated kinase kinase kinase alpha, put...    212   3e-57    
ref|XP_008351233.1|  PREDICTED: mitogen-activated protein kinase ...    215   3e-57    
ref|XP_006305299.1|  hypothetical protein CARUB_v10009674mg             206   3e-57    
ref|XP_008390850.1|  PREDICTED: mitogen-activated protein kinase ...    215   3e-57    
ref|XP_004229416.1|  PREDICTED: mitogen-activated protein kinase ...    214   3e-57    
gb|EPS63016.1|  hypothetical protein M569_11769                         208   4e-57    
emb|CDY42094.1|  BnaA05g10920D                                          207   4e-57    
emb|CDY52049.1|  BnaCnng21650D                                          207   4e-57    
ref|XP_006349218.1|  PREDICTED: mitogen-activated protein kinase ...    214   4e-57    
ref|XP_006452414.1|  hypothetical protein CICLE_v10010150mg             209   5e-57    
dbj|BAJ92652.1|  predicted protein                                      208   5e-57    
ref|XP_004231271.1|  PREDICTED: mitogen-activated protein kinase ...    214   5e-57    
dbj|BAA21855.1|  NPK1-related protein kinase 1S                         207   5e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146783.1|  hypothetical protein PHAVU_006G069600g             209   6e-57    
ref|XP_003520809.1|  PREDICTED: mitogen-activated protein kinase ...    214   6e-57    
gb|EEC67854.1|  hypothetical protein OsI_35471                          213   6e-57    Oryza sativa Indica Group [Indian rice]
gb|AAF34436.1|AF172282_25  similar to mitogen-activated protein k...    213   6e-57    Oryza sativa [red rice]
ref|XP_007143215.1|  hypothetical protein PHAVU_007G053700g             213   6e-57    
ref|XP_011090760.1|  PREDICTED: mitogen-activated protein kinase ...    214   7e-57    
ref|XP_003538696.1|  PREDICTED: mitogen-activated protein kinase ...    215   7e-57    
gb|KEH36902.1|  MAP kinase kinase kinase                                206   7e-57    
ref|XP_011100411.1|  PREDICTED: mitogen-activated protein kinase ...    206   7e-57    
gb|ABK06428.1|  HA-tagged protein kinase domain of putative mitog...    204   8e-57    
gb|EYU45626.1|  hypothetical protein MIMGU_mgv1a017805mg                214   8e-57    
gb|EEE51829.1|  hypothetical protein OsJ_33308                          213   8e-57    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130692.1|  mitogen activated protein kinase kinase kinase     212   8e-57    Zea mays [maize]
ref|XP_010093989.1|  Mitogen-activated protein kinase kinase kina...    214   9e-57    
emb|CAN71722.1|  hypothetical protein VITISV_012221                     208   9e-57    Vitis vinifera
ref|XP_006449765.1|  hypothetical protein CICLE_v10014400mg             214   9e-57    
ref|XP_009627903.1|  PREDICTED: mitogen-activated protein kinase ...    215   9e-57    
ref|XP_003539857.1|  PREDICTED: mitogen-activated protein kinase ...    206   1e-56    
ref|XP_009627909.1|  PREDICTED: mitogen-activated protein kinase ...    215   1e-56    
ref|XP_007147046.1|  hypothetical protein PHAVU_006G091500g             213   1e-56    
ref|XP_010445108.1|  PREDICTED: mitogen-activated protein kinase ...    208   1e-56    
ref|XP_009143997.1|  PREDICTED: mitogen-activated protein kinase ...    206   1e-56    
ref|XP_010913499.1|  PREDICTED: mitogen-activated protein kinase ...    212   1e-56    
gb|KHN41598.1|  Mitogen-activated protein kinase kinase kinase 2        215   1e-56    
gb|EAY77607.1|  hypothetical protein OsI_32649                          210   1e-56    Oryza sativa Indica Group [Indian rice]
ref|XP_010541461.1|  PREDICTED: mitogen-activated protein kinase ...    206   1e-56    
ref|XP_006413128.1|  hypothetical protein EUTSA_v10027219mg             209   1e-56    
ref|XP_006852523.1|  hypothetical protein AMTR_s00021p00177530          205   1e-56    
ref|XP_003533990.1|  PREDICTED: mitogen-activated protein kinase ...    215   1e-56    
ref|XP_010046333.1|  PREDICTED: mitogen-activated protein kinase ...    207   1e-56    
sp|Q54R82.2|MKKA_DICDI  RecName: Full=Mitogen-activated protein k...    215   1e-56    Dictyostelium discoideum
ref|XP_004295280.1|  PREDICTED: mitogen-activated protein kinase ...    207   2e-56    
ref|XP_009416709.1|  PREDICTED: mitogen-activated protein kinase ...    207   2e-56    
emb|CDP18097.1|  unnamed protein product                                213   2e-56    
gb|AAM23244.1|AC092553_10  Putative NPK1-related protein kinase         210   2e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385293.1|  PREDICTED: mitogen-activated protein kinase ...    213   2e-56    
emb|CDP09212.1|  unnamed protein product                                210   2e-56    
ref|XP_006364160.1|  PREDICTED: mitogen-activated protein kinase ...    204   2e-56    
ref|XP_010913498.1|  PREDICTED: mitogen-activated protein kinase ...    212   2e-56    
ref|XP_010546855.1|  PREDICTED: mitogen-activated protein kinase ...    212   2e-56    
ref|XP_007207308.1|  hypothetical protein PRUPE_ppa002436mg             212   2e-56    
ref|XP_010651429.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-56    
ref|XP_010546854.1|  PREDICTED: mitogen-activated protein kinase ...    212   2e-56    
gb|ABK06424.1|  HA-tagged protein kinase domain of putative mitog...    203   2e-56    
ref|XP_008804443.1|  PREDICTED: mitogen-activated protein kinase ...    213   2e-56    
ref|XP_010528879.1|  PREDICTED: mitogen-activated protein kinase ...    212   3e-56    
dbj|BAA21856.1|  NPK1-related protein kinase 2                          211   3e-56    
ref|XP_006364180.1|  PREDICTED: mitogen-activated protein kinase ...    205   3e-56    
ref|XP_003596952.1|  Mitogen-activated protein kinase kinase kina...    206   3e-56    
ref|XP_002298485.2|  kinase family protein                              204   3e-56    
ref|XP_010528878.1|  PREDICTED: mitogen-activated protein kinase ...    212   3e-56    
ref|XP_008806510.1|  PREDICTED: mitogen-activated protein kinase ...    212   3e-56    
ref|XP_002891923.1|  hypothetical protein ARALYDRAFT_314880             211   3e-56    
ref|XP_004243854.1|  PREDICTED: mitogen-activated protein kinase ...    204   3e-56    
ref|XP_008246474.1|  PREDICTED: mitogen-activated protein kinase ...    212   3e-56    
ref|XP_008246473.1|  PREDICTED: mitogen-activated protein kinase ...    212   3e-56    
ref|XP_005650722.1|  Pkinase-domain-containing protein                  213   3e-56    
ref|XP_009364204.1|  PREDICTED: mitogen-activated protein kinase ...    212   3e-56    
gb|AAL87297.1|  unknown protein                                         206   3e-56    
gb|KHN02691.1|  Mitogen-activated protein kinase kinase kinase 3        211   3e-56    
ref|XP_008806508.1|  PREDICTED: mitogen-activated protein kinase ...    211   3e-56    
emb|CBI26208.3|  unnamed protein product                                212   4e-56    
gb|KDO62067.1|  hypothetical protein CISIN_1g045508mg                   207   4e-56    
ref|XP_009418854.1|  PREDICTED: mitogen-activated protein kinase ...    206   4e-56    
ref|XP_010253855.1|  PREDICTED: mitogen-activated protein kinase ...    208   4e-56    
ref|XP_009758259.1|  PREDICTED: mitogen-activated protein kinase ...    213   4e-56    
ref|XP_006468187.1|  PREDICTED: mitogen-activated protein kinase ...    208   4e-56    
ref|XP_002523600.1|  ATP binding protein, putative                      204   4e-56    
ref|XP_009758258.1|  PREDICTED: mitogen-activated protein kinase ...    213   4e-56    
ref|XP_008383179.1|  PREDICTED: mitogen-activated protein kinase ...    212   4e-56    
ref|XP_006606040.1|  PREDICTED: mitogen-activated protein kinase ...    211   4e-56    
gb|KHN15796.1|  Mitogen-activated protein kinase kinase kinase 3        211   4e-56    
ref|XP_006439527.1|  hypothetical protein CICLE_v10018781mg             212   4e-56    
ref|XP_639165.2|  protein serine/threonine kinase                       216   4e-56    
ref|XP_003535661.1|  PREDICTED: mitogen-activated protein kinase ...    211   5e-56    
ref|XP_008383178.1|  PREDICTED: mitogen-activated protein kinase ...    211   5e-56    
ref|XP_003634098.1|  PREDICTED: mitogen-activated protein kinase ...    213   5e-56    
ref|XP_004979130.1|  PREDICTED: mitogen-activated protein kinase ...    211   5e-56    
ref|XP_003082588.1|  putative MAP3K alpha 1 protein kinase (ISS)        210   6e-56    
ref|XP_010932081.1|  PREDICTED: mitogen-activated protein kinase ...    211   6e-56    
ref|XP_008804442.1|  PREDICTED: mitogen-activated protein kinase ...    213   6e-56    
ref|NP_175894.4|  NPK1-related protein kinase 2                         210   7e-56    
ref|XP_006475134.1|  PREDICTED: mitogen-activated protein kinase ...    207   7e-56    
ref|XP_002311605.2|  hypothetical protein POPTR_0008s14880g             211   7e-56    
ref|XP_001428335.1|  hypothetical protein                               207   7e-56    
ref|XP_010553736.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    210   7e-56    
ref|XP_004494615.1|  PREDICTED: mitogen-activated protein kinase ...    210   8e-56    
dbj|BAJ98346.1|  predicted protein                                      206   8e-56    
ref|XP_006379822.1|  hypothetical protein POPTR_0008s14880g             211   8e-56    
ref|NP_194419.2|  mitogen-activated protein kinase kinase kinase 16     206   8e-56    
ref|XP_003526335.1|  PREDICTED: mitogen-activated protein kinase ...    203   8e-56    
gb|KHN12154.1|  Mitogen-activated protein kinase kinase kinase 2        213   8e-56    
ref|XP_009401849.1|  PREDICTED: mitogen-activated protein kinase ...    212   8e-56    
ref|XP_006439528.1|  hypothetical protein CICLE_v10018781mg             212   9e-56    
ref|XP_008675135.1|  PREDICTED: mitogen-activated protein kinase ...    204   9e-56    
emb|CDY69540.1|  BnaCnng64060D                                          206   9e-56    
ref|XP_002866074.1|  MAPKKK15                                           206   9e-56    
gb|EYU41516.1|  hypothetical protein MIMGU_mgv1a002030mg                211   9e-56    
emb|CAB36535.1|  putative NPK1-related protein kinase                   206   9e-56    
gb|KEH43906.1|  MAP kinase kinase kinase                                207   9e-56    
gb|KDO56325.1|  hypothetical protein CISIN_1g005936mg                   208   9e-56    
ref|XP_003556116.1|  PREDICTED: mitogen-activated protein kinase ...    212   1e-55    
dbj|BAF00528.1|  putative NPK1-related protein kinase                   205   1e-55    
ref|XP_006433319.1|  hypothetical protein CICLE_v10000482mg             207   1e-55    
ref|XP_003553724.1|  PREDICTED: mitogen-activated protein kinase ...    210   1e-55    
ref|XP_006652633.1|  PREDICTED: mitogen-activated protein kinase ...    212   1e-55    
ref|XP_011080940.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    212   1e-55    
ref|XP_006392473.1|  hypothetical protein EUTSA_v10023309mg             211   1e-55    
gb|EEC77790.1|  hypothetical protein OsI_16964                          212   1e-55    
ref|XP_006476546.1|  PREDICTED: mitogen-activated protein kinase ...    212   1e-55    
ref|XP_011084438.1|  PREDICTED: mitogen-activated protein kinase ...    212   1e-55    
ref|XP_010545229.1|  PREDICTED: mitogen-activated protein kinase ...    206   1e-55    
sp|Q9FZ36.1|M3K2_ARATH  RecName: Full=Mitogen-activated protein k...    210   1e-55    
emb|CEG00082.1|  Serine/threonine-protein kinase, active site           209   1e-55    
ref|XP_008345614.1|  PREDICTED: mitogen-activated protein kinase ...    210   1e-55    
emb|CDY17301.1|  BnaA10g09350D                                          205   1e-55    
emb|CAH68053.1|  B0103C08-B0602B01.10                                   212   1e-55    
ref|XP_004972121.1|  PREDICTED: mitogen-activated protein kinase ...    206   1e-55    
ref|XP_010325400.1|  PREDICTED: mitogen-activated protein kinase ...    211   1e-55    
gb|KDP22253.1|  hypothetical protein JCGZ_26084                         212   1e-55    
ref|XP_006663285.1|  PREDICTED: mitogen-activated protein kinase ...    209   1e-55    
gb|KHN21769.1|  Mitogen-activated protein kinase kinase kinase ANP1     212   1e-55    
ref|NP_001053542.1|  Os04g0559800                                       212   1e-55    
dbj|BAK02955.1|  predicted protein                                      210   2e-55    
ref|XP_008793818.1|  PREDICTED: mitogen-activated protein kinase ...    210   2e-55    
ref|XP_003536457.1|  PREDICTED: mitogen-activated protein kinase ...    211   2e-55    
ref|XP_006401496.1|  hypothetical protein EUTSA_v10015237mg             205   2e-55    
ref|XP_008441055.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-55    
ref|XP_008388573.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-55    
ref|XP_008454667.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-55    
ref|XP_004972119.1|  PREDICTED: mitogen-activated protein kinase ...    206   2e-55    
ref|XP_003626287.1|  Mitogen-activated protein kinase kinase kinase     209   2e-55    
ref|XP_008441054.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-55    
ref|XP_011021583.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-55    
ref|XP_001784035.1|  predicted protein                                  199   2e-55    
ref|XP_011030147.1|  PREDICTED: mitogen-activated protein kinase ...    211   2e-55    
ref|XP_009418122.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-55    
ref|XP_011026028.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    210   2e-55    
ref|XP_009121273.1|  PREDICTED: mitogen-activated protein kinase ...    204   2e-55    
ref|NP_001047125.2|  Os02g0555900                                       210   2e-55    
ref|XP_010325398.1|  PREDICTED: mitogen-activated protein kinase ...    211   2e-55    
ref|XP_004170912.1|  PREDICTED: mitogen-activated protein kinase ...    202   2e-55    
dbj|BAD15457.1|  putative MEK kinase                                    210   2e-55    
gb|EEE57187.1|  hypothetical protein OsJ_07130                          210   2e-55    
ref|XP_001430164.1|  hypothetical protein                               203   2e-55    
ref|XP_010938267.1|  PREDICTED: mitogen-activated protein kinase ...    206   2e-55    
ref|XP_008454646.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-55    
gb|AFW62188.1|  hypothetical protein ZEAMMB73_282261                    209   2e-55    
ref|XP_008454660.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-55    
ref|XP_004240726.1|  PREDICTED: mitogen-activated protein kinase ...    211   2e-55    
ref|XP_010539223.1|  PREDICTED: mitogen-activated protein kinase ...    211   2e-55    
ref|XP_011021581.1|  PREDICTED: mitogen-activated protein kinase ...    209   2e-55    
ref|XP_006472012.1|  PREDICTED: mitogen-activated protein kinase ...    207   2e-55    
gb|ABK06423.1|  HA-tagged protein kinase domain of putative mitog...    200   3e-55    
ref|XP_004496768.1|  PREDICTED: mitogen-activated protein kinase ...    209   3e-55    
ref|XP_007147708.1|  hypothetical protein PHAVU_006G148000g             204   3e-55    
ref|XP_008454655.1|  PREDICTED: mitogen-activated protein kinase ...    209   3e-55    
ref|XP_011021580.1|  PREDICTED: mitogen-activated protein kinase ...    209   3e-55    
ref|XP_007149981.1|  hypothetical protein PHAVU_005G115900g             203   3e-55    
gb|EPS67034.1|  mitogen activated protein kinase kinase kinase kkk 3    203   3e-55    
ref|XP_009758194.1|  PREDICTED: mitogen-activated protein kinase ...    202   3e-55    
ref|XP_009039695.1|  hypothetical protein AURANDRAFT_59332              199   3e-55    
ref|XP_007152223.1|  hypothetical protein PHAVU_004G112000g             211   3e-55    
ref|XP_004139869.1|  PREDICTED: mitogen-activated protein kinase ...    202   3e-55    
gb|KGN60904.1|  hypothetical protein Csa_2G021750                       209   3e-55    
gb|KEH43905.1|  MAP kinase kinase kinase                                208   3e-55    
ref|XP_011071554.1|  PREDICTED: mitogen-activated protein kinase ...    209   4e-55    
ref|XP_001698436.1|  hypothetical protein CHLREDRAFT_98709              199   4e-55    
ref|XP_010435160.1|  PREDICTED: mitogen-activated protein kinase ...    208   4e-55    
gb|KHG00648.1|  Mitogen-activated protein kinase kinase kinase ANP1     208   4e-55    
ref|XP_010486085.1|  PREDICTED: mitogen-activated protein kinase ...    208   4e-55    
ref|XP_004975671.1|  PREDICTED: mitogen-activated protein kinase ...    209   4e-55    
ref|XP_010696266.1|  PREDICTED: mitogen-activated protein kinase ...    210   4e-55    
ref|XP_004308240.1|  PREDICTED: G-type lectin S-receptor-like ser...    209   4e-55    
ref|XP_004975670.1|  PREDICTED: mitogen-activated protein kinase ...    209   4e-55    
ref|XP_009398018.1|  PREDICTED: mitogen-activated protein kinase ...    210   4e-55    
gb|EEC73396.1|  hypothetical protein OsI_07647                          209   4e-55    
ref|XP_004973457.1|  PREDICTED: mitogen-activated protein kinase ...    209   4e-55    
ref|XP_009398019.1|  PREDICTED: mitogen-activated protein kinase ...    210   4e-55    
ref|XP_010464167.1|  PREDICTED: mitogen-activated protein kinase ...    208   5e-55    
ref|XP_004953389.1|  PREDICTED: mitogen-activated protein kinase ...    210   5e-55    
ref|XP_004973456.1|  PREDICTED: mitogen-activated protein kinase ...    209   5e-55    
ref|XP_004975669.1|  PREDICTED: mitogen-activated protein kinase ...    209   5e-55    
ref|XP_006361897.1|  PREDICTED: mitogen-activated protein kinase ...    207   5e-55    
ref|XP_011029295.1|  PREDICTED: mitogen-activated protein kinase ...    210   5e-55    
emb|CDY08319.1|  BnaC09g12770D                                          210   5e-55    
ref|XP_008676486.1|  PREDICTED: uncharacterized protein LOC100192...    208   5e-55    
ref|XP_010277976.1|  PREDICTED: mitogen-activated protein kinase ...    208   5e-55    
ref|XP_003580313.1|  PREDICTED: mitogen-activated protein kinase ...    210   5e-55    
ref|XP_010436369.1|  PREDICTED: mitogen-activated protein kinase ...    203   5e-55    
ref|XP_006364163.1|  PREDICTED: mitogen-activated protein kinase ...    200   5e-55    
ref|XP_002953195.1|  hypothetical protein VOLCADRAFT_43062              198   6e-55    
ref|XP_009112760.1|  PREDICTED: mitogen-activated protein kinase ...    210   6e-55    
ref|XP_003291523.1|  hypothetical protein DICPUDRAFT_49896              210   6e-55    
ref|XP_006368758.1|  hypothetical protein POPTR_0001s09520g             209   6e-55    
ref|XP_003611723.1|  Mitogen-activated protein kinase kinase kina...    199   6e-55    
emb|CDP04692.1|  unnamed protein product                                207   6e-55    
emb|CDP15776.1|  unnamed protein product                                204   6e-55    
gb|ACH99698.1|  NPKL4                                                   202   6e-55    
ref|XP_008676487.1|  PREDICTED: uncharacterized protein LOC100192...    208   6e-55    
ref|XP_010277980.1|  PREDICTED: mitogen-activated protein kinase ...    207   6e-55    
ref|XP_002889536.1|  MAPKKK18                                           201   6e-55    
gb|KDO56324.1|  hypothetical protein CISIN_1g005936mg                   208   6e-55    
ref|XP_010239934.1|  PREDICTED: mitogen-activated protein kinase ...    208   6e-55    
ref|XP_009406130.1|  PREDICTED: mitogen-activated protein kinase ...    208   6e-55    
ref|XP_010536673.1|  PREDICTED: mitogen-activated protein kinase ...    203   7e-55    
ref|XP_002448319.1|  hypothetical protein SORBIDRAFT_06g025160          210   7e-55    
ref|XP_003631415.1|  PREDICTED: mitogen-activated protein kinase ...    210   7e-55    
ref|XP_003581251.1|  PREDICTED: mitogen-activated protein kinase ...    208   7e-55    
emb|CDX95018.1|  BnaC05g06530D                                          207   7e-55    
ref|XP_004156070.1|  PREDICTED: mitogen-activated protein kinase ...    207   7e-55    
ref|XP_006433320.1|  hypothetical protein CICLE_v10000482mg             208   7e-55    
ref|XP_009600056.1|  PREDICTED: mitogen-activated protein kinase ...    209   8e-55    
ref|XP_004237756.1|  PREDICTED: mitogen-activated protein kinase ...    202   8e-55    
ref|XP_010089088.1|  Mitogen-activated protein kinase kinase kina...    209   8e-55    
ref|XP_004140156.1|  PREDICTED: mitogen-activated protein kinase ...    207   8e-55    
ref|XP_010907216.1|  PREDICTED: mitogen-activated protein kinase ...    209   8e-55    
ref|XP_004512214.1|  PREDICTED: mitogen-activated protein kinase ...    199   8e-55    
ref|XP_008449571.1|  PREDICTED: mitogen-activated protein kinase ...    207   9e-55    
ref|XP_006472011.1|  PREDICTED: mitogen-activated protein kinase ...    208   9e-55    
ref|XP_008449572.1|  PREDICTED: mitogen-activated protein kinase ...    207   9e-55    
gb|AES62717.2|  MAP kinase kinase kinase                                207   9e-55    
ref|XP_010277958.1|  PREDICTED: mitogen-activated protein kinase ...    207   9e-55    
ref|XP_010907217.1|  PREDICTED: mitogen-activated protein kinase ...    209   9e-55    
ref|NP_001043980.1|  Os01g0699600                                       202   1e-54    
gb|KEH16526.1|  MAP3K-like kinase                                       200   1e-54    
emb|CDY19916.1|  BnaC09g31820D                                          203   1e-54    
ref|XP_010277972.1|  PREDICTED: mitogen-activated protein kinase ...    207   1e-54    
gb|KHN16812.1|  Mitogen-activated protein kinase kinase kinase 2        210   1e-54    
ref|XP_003532415.1|  PREDICTED: mitogen-activated protein kinase ...    210   1e-54    
ref|XP_010277967.1|  PREDICTED: mitogen-activated protein kinase ...    207   1e-54    
gb|KEH16527.1|  MAP3K-like kinase                                       199   1e-54    
ref|XP_002513678.1|  ATP binding protein, putative                      209   1e-54    
ref|XP_008789177.1|  PREDICTED: mitogen-activated protein kinase ...    203   1e-54    
ref|XP_004148657.1|  PREDICTED: serine/threonine-protein kinase K...    206   1e-54    
ref|XP_006432223.1|  hypothetical protein CICLE_v10000585mg             204   1e-54    
ref|XP_004173609.1|  PREDICTED: mitogen-activated protein kinase ...    200   1e-54    
ref|XP_008440288.1|  PREDICTED: mitogen-activated protein kinase ...    200   1e-54    
ref|XP_006297166.1|  hypothetical protein CARUB_v10013171mg             207   1e-54    
ref|XP_002509819.1|  ATP binding protein, putative                      209   1e-54    
ref|XP_008238964.1|  PREDICTED: mitogen-activated protein kinase ...    209   1e-54    
ref|XP_006339890.1|  PREDICTED: mitogen-activated protein kinase ...    200   1e-54    
ref|XP_007030848.1|  NPK1-related protein kinase 1                      207   1e-54    
gb|EPS70155.1|  hypothetical protein M569_04605                         207   2e-54    
ref|XP_001447826.1|  hypothetical protein                               201   2e-54    
ref|XP_010480210.1|  PREDICTED: mitogen-activated protein kinase ...    207   2e-54    
ref|XP_003534712.1|  PREDICTED: mitogen-activated protein kinase ...    202   2e-54    
gb|EYU19566.1|  hypothetical protein MIMGU_mgv1a001116mg                208   2e-54    
gb|AFW71792.1|  putative MAPKKK family protein kinase                   206   2e-54    
ref|XP_002322482.1|  hypothetical protein POPTR_0015s12870g             208   2e-54    
ref|XP_009607835.1|  PREDICTED: mitogen-activated protein kinase ...    199   2e-54    
gb|EEC83597.1|  hypothetical protein OsI_29280                          207   2e-54    
ref|XP_003526863.1|  PREDICTED: mitogen-activated protein kinase ...    206   2e-54    
gb|KFK38038.1|  hypothetical protein AALP_AA3G062200                    206   2e-54    
ref|NP_001061823.1|  Os08g0421800                                       207   2e-54    
ref|XP_009347263.1|  PREDICTED: mitogen-activated protein kinase ...    206   2e-54    
ref|NP_001052859.1|  Os04g0437600                                       207   2e-54    
ref|XP_006368759.1|  hypothetical protein POPTR_0001s09520g             208   2e-54    
emb|CAD40821.2|  OSJNBa0006B20.13                                       207   2e-54    
ref|XP_011024931.1|  PREDICTED: mitogen-activated protein kinase ...    202   2e-54    
ref|XP_002500991.1|  predicted protein                                  202   2e-54    
ref|XP_006343968.1|  PREDICTED: mitogen-activated protein kinase ...    208   3e-54    



>ref|XP_009767132.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana sylvestris]
Length=356

 Score =   377 bits (969),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 209/365 (57%), Positives = 266/365 (73%), Gaps = 28/365 (8%)
 Frame = +2

Query  353   KCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESL  532
             KCSC +P +W+KGK +GSGSFGS+HLAM+KATGGLFVVKSA+S++GL+ LE+E +ILE+L
Sbjct  6     KCSCPQPTKWLKGKVIGSGSFGSIHLAMDKATGGLFVVKSADSEAGLKCLENEVKILENL  65

Query  533   DSPHVVKCIGK----EMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
              SPH+VK IGK    E  G +KL+LFIEYM GGSLADV ++FGG LDE VI LYT+ IL 
Sbjct  66    GSPHIVKFIGKDFSFEANGKRKLSLFIEYMTGGSLADVAEKFGGFLDEEVISLYTKGILK  125

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHP---NPIPLA-GVAGSPL  868
             GLKY+HENGIVH DLKC+N+LL +SG+VKLADFGC+KR+K +    +P  L+  + G+PL
Sbjct  126   GLKYIHENGIVHCDLKCKNILLGTSGEVKLADFGCAKRIKDNKVNGSPKSLSKSIGGTPL  185

Query  869   WMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKI-SNPVSAVLRIACSEDRPNF  1045
             WMAPE LRN+  LD A+DIWSLGCTIIEMATG  PW G I +NP++AVL+IACS D P F
Sbjct  186   WMAPEILRNE-ELDFAADIWSLGCTIIEMATGKPPWGGDICTNPLAAVLKIACSNDMPQF  244

Query  1046  PSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVNpese-----efaasspasVLDRSI  1210
             P+HFS +GLDFL KCLERD +KRW+ E+LL HPFV+  S+     +  AS+PASVLD   
Sbjct  245   PAHFSDDGLDFLAKCLERDTKKRWRVEQLLDHPFVSKMSKGKNLEKIDASTPASVLDARF  304

Query  1211  FPetdysdesdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEW  1390
             F E D+           L     +  +    PFS+ C+++F +S +  +      +SE W
Sbjct  305   FSEMDF-----------LDESSDEDDSMSGNPFSMRCDHEFWISRRGGK--NDLESSESW  351

Query  1391  ITVRT  1405
             ITVR 
Sbjct  352   ITVRN  356



>ref|XP_009623765.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana tomentosiformis]
Length=356

 Score =   376 bits (965),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 205/367 (56%), Positives = 263/367 (72%), Gaps = 28/367 (8%)
 Frame = +2

Query  347   YSKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILE  526
             + KCSC +P +W+KGK +GSGSFGS+HLAM+KATGGLFVVKSA+S++GL+ LE+E +ILE
Sbjct  4     FCKCSCPQPTKWMKGKVIGSGSFGSIHLAMDKATGGLFVVKSADSEAGLKCLENEVKILE  63

Query  527   SLDSPHVVKCIGK----EMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREI  694
             +LDSPH+VK IGK    E  G +KL+LFIEYM GGSLADV ++FGG LDE VI LY++ I
Sbjct  64    NLDSPHIVKFIGKDFSFEANGKRKLSLFIEYMTGGSLADVAEKFGGSLDEEVISLYSKGI  123

Query  695   LLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKH----PNPIPLAGVAGS  862
             L GLKYLHENGIVH DLKC+N+LL +SG++KLADFGC+KR+K +            + G+
Sbjct  124   LKGLKYLHENGIVHCDLKCKNILLGTSGEIKLADFGCAKRIKDNKVNGSRKSLSKSIGGT  183

Query  863   PLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKI-SNPVSAVLRIACSEDRP  1039
             PLWMAPE LRN+  LD A+DIWSLGCTIIEMATG  PW G I +NP++AVL+IACS + P
Sbjct  184   PLWMAPEILRNE-ELDFAADIWSLGCTIIEMATGKPPWGGDICTNPLAAVLKIACSNEMP  242

Query  1040  NFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVNpeseefa-----asspasVLDR  1204
              FP+HFS +GLDFL KCLERD +KRW+ E+LL HPFV+ +S+        AS+PASVLD 
Sbjct  243   QFPAHFSDDGLDFLAKCLERDTKKRWRVEQLLDHPFVSKKSKVKNLEKIDASTPASVLDA  302

Query  1205  SIFPetdysdesdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSE  1384
               F E D+           L     +  +    PFS+ C+++F +S +  +      +SE
Sbjct  303   RFFSEMDF-----------LDESSDEDDSMSGNPFSMRCDSEFWISRRGGK--NDLESSE  349

Query  1385  EWITVRT  1405
              W TVR 
Sbjct  350   SWFTVRN  356



>ref|XP_007222400.1| hypothetical protein PRUPE_ppa008119mg [Prunus persica]
 gb|EMJ23599.1| hypothetical protein PRUPE_ppa008119mg [Prunus persica]
Length=344

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 246/363 (68%), Gaps = 38/363 (10%)
 Frame = +2

Query  353   KCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESL  532
             +C+   P  W+KGK VGSG+FGSVHLAM+KATG LFVVKSA S  G+Q LE+EA+ILESL
Sbjct  7     QCTSPLPGAWMKGKLVGSGAFGSVHLAMSKATGALFVVKSAVSGHGVQALENEAKILESL  66

Query  533   DSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKY  712
             +S +VV+C+GKE   GK +N+F+EYMAGGSL+DV+Q FGG L+E V+RLYTREILLGLKY
Sbjct  67    NSQYVVRCLGKENGEGKCINVFMEYMAGGSLSDVSQIFGGALEEEVVRLYTREILLGLKY  126

Query  713   LHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPN-----PIPLAGVAGSPLWMA  877
             LHENGIVH DLKC+NVL+ SSG+VKLADFG +KR+K          + +  + G+PLWMA
Sbjct  127   LHENGIVHCDLKCKNVLVGSSGNVKLADFGSAKRLKDSKAHGVSVQVAVQSIGGTPLWMA  186

Query  878   PETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHF  1057
             PE LRN+ GLD A DIWSLGCT+IEMATG  PW  K SNPV+AVL IAC  ++P FP HF
Sbjct  187   PEVLRNE-GLDFALDIWSLGCTVIEMATGRPPWGTKASNPVAAVLEIACGNEKPQFPRHF  245

Query  1058  SQEGLDFLEKCLERDPRKRWKAEELLHHPFVNpeseefaasspa--------sVLDRSIF  1213
             S  GLDFL +CLERDP++RW AEELL+HPFV+  S   +    A         + DR  F
Sbjct  246   SDNGLDFLARCLERDPKRRWSAEELLNHPFVSGNSMRVSRKGVACSPANHGMGIRDRDDF  305

Query  1214  PetdysdesdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWI  1393
             P              P R+P  K            C ++   S +  +   H  +SE WI
Sbjct  306   P------------SIPSRNPFSK------------CCDEGNRSTRTQQTESHLESSENWI  341

Query  1394  TVR  1402
             TVR
Sbjct  342   TVR  344



>ref|XP_006349303.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum tuberosum]
Length=355

 Score =   371 bits (952),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/278 (65%), Positives = 221/278 (79%), Gaps = 10/278 (4%)
 Frame = +2

Query  347   YSKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILE  526
             +SKCSC +P +W+KGK +GSGSFGSVHLAM+KATGG FV+KS ES++G + LE+E EILE
Sbjct  4     FSKCSCLKPTKWLKGKVIGSGSFGSVHLAMDKATGGFFVLKSTESEAGFKCLENEVEILE  63

Query  527   SLDSPHVVKCIGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREI  694
             +LDSPH+VK IGK++     G +KL+LF+E+M GGSLADV ++FGG LDE VI LYT+ I
Sbjct  64    NLDSPHIVKFIGKDLSFEANGKRKLSLFLEFMTGGSLADVAEKFGGSLDEEVICLYTKGI  123

Query  695   LLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHP----NPIPLAGVAGS  862
             L GLKYLHENGIVH DLKC+N+LL +SG++KLAD GC+KR+K H            + G+
Sbjct  124   LKGLKYLHENGIVHCDLKCKNILLGTSGEIKLADLGCAKRIKDHKVKGITKSLSKSIGGT  183

Query  863   PLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKI-SNPVSAVLRIACSEDRP  1039
             PLWMAPE LRN+  LD A+DIWSLGCTIIEMATG  PW G I +NP++AVL+IACS + P
Sbjct  184   PLWMAPEILRNE-ELDFAADIWSLGCTIIEMATGKTPWGGDICTNPLAAVLKIACSNEMP  242

Query  1040  NFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              FPSHFS  GLDFL KCLERD +KRWK E+LL HPFV+
Sbjct  243   QFPSHFSDVGLDFLAKCLERDSKKRWKVEQLLDHPFVS  280



>ref|XP_004230432.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum lycopersicum]
Length=359

 Score =   366 bits (939),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/280 (63%), Positives = 221/280 (79%), Gaps = 12/280 (4%)
 Frame = +2

Query  347   YSKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILE  526
             YSKCSC +P +W+KGK +GSGSFGSVHLAM+KATGG FV+KS ES++G + LE+E EILE
Sbjct  4     YSKCSCLKPTKWLKGKVIGSGSFGSVHLAMDKATGGFFVLKSTESEAGFKCLENEIEILE  63

Query  527   SLDSPHVVKCIGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREI  694
              LDSPH+VK IGK++     G +KL+LF+E+M GGSLADV ++FGG LDE VI LYT+ I
Sbjct  64    DLDSPHIVKFIGKDLSFEANGKRKLSLFLEFMTGGSLADVAEKFGGSLDEEVICLYTKGI  123

Query  695   LLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPL------AGVA  856
             L GL+YLHENGIVH D+KC+N+LL SSG++KLAD GC+KR+K + + +            
Sbjct  124   LKGLRYLHENGIVHCDVKCKNILLGSSGEIKLADLGCAKRIKDYYHEVKCNTKSLSKSTG  183

Query  857   GSPLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKI-SNPVSAVLRIACSED  1033
             G+PLWMAPE LRN+  LD A+DIWSLGCTIIEMATG  PW G I +NP++AV++IAC+ +
Sbjct  184   GTPLWMAPEILRNE-ELDFAADIWSLGCTIIEMATGKTPWGGDICTNPLAAVMKIACTNE  242

Query  1034  RPNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              P FPS+FS  GLDFL KCLERD +KRW  E+LLHHPFV+
Sbjct  243   MPQFPSNFSDVGLDFLAKCLERDSKKRWNVEQLLHHPFVS  282



>ref|XP_004301562.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Fragaria vesca subsp. vesca]
Length=339

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 217/271 (80%), Gaps = 6/271 (2%)
 Frame = +2

Query  341   GYYSKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEI  520
             G   +C+   P EW+KGK VGSGSFGSVHLAM+K+TGGLFVVKS++S  G   LE+EA+I
Sbjct  2     GRNDECTSPLPGEWMKGKLVGSGSFGSVHLAMSKSTGGLFVVKSSQSCDGALALENEAKI  61

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             LESL+SP+VV+CIG E   GK  N+F+EYMAGGSL+DV Q FGG  DE ++RLY+REIL 
Sbjct  62    LESLNSPYVVRCIGIENGRGKLCNVFMEYMAGGSLSDVAQIFGGAFDEDMVRLYSREILH  121

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GLKYLHENGI+H DLKC+NVLLSSSG+VKLADFGC++R+K            G+PLWMAP
Sbjct  122   GLKYLHENGIMHCDLKCKNVLLSSSGNVKLADFGCARRLKDSTTT-----TGGTPLWMAP  176

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E LRN+ GLD   DIWSLGCT+IEMATG  PWA +IS+PV+AVL+IACS +RP FP  FS
Sbjct  177   EVLRNE-GLDFPCDIWSLGCTVIEMATGRPPWAAEISDPVAAVLKIACSSERPQFPRQFS  235

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              EG DFL KCLERDP++RW AE+LL+HPFV+
Sbjct  236   NEGSDFLAKCLERDPKRRWSAEQLLNHPFVS  266



>ref|XP_008218686.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Prunus mume]
Length=360

 Score =   362 bits (930),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 200/359 (56%), Positives = 248/359 (69%), Gaps = 14/359 (4%)
 Frame = +2

Query  353   KCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESL  532
             +C+   P  W+KGK VGSG+FGSVHLAM+KATG LFVVKSA S  G+Q LE+EA+IL+SL
Sbjct  7     QCTSPLPGAWMKGKLVGSGAFGSVHLAMSKATGALFVVKSAASGHGVQALENEAKILKSL  66

Query  533   DSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKY  712
             +S +VV+C+GKE   GK +N+F+EYMAGGSL+DV+Q FGG L+E V+RLYTREIL GLK+
Sbjct  67    NSQYVVRCLGKENGEGKCINVFMEYMAGGSLSDVSQIFGGALEEEVVRLYTREILHGLKH  126

Query  713   LHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHP-----NPIPLAGVAGSPLWMA  877
             LHENGIVH DLKC+NVL+ SSG+VKLADFG +KR+K          + +  V G+PLWMA
Sbjct  127   LHENGIVHCDLKCKNVLVGSSGNVKLADFGSAKRLKDSKADGVSVQVAVQSVGGTPLWMA  186

Query  878   PETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHF  1057
             PE LRN+ GLD A DIWSLGCT+IEMATG  PW  K SNPV+AVL IAC  ++P FP HF
Sbjct  187   PEVLRNE-GLDFALDIWSLGCTVIEMATGRPPWGTKTSNPVAAVLEIACGNEKPQFPRHF  245

Query  1058  SQEGLDFLEKCLERDPRKRWKAEELLHHPFVNpeseefaassp----asVLDRSIFPetd  1225
             S EGLDFL +CLERDP++RW AEELL+HPFV+  S   +        AS LD  I  E  
Sbjct  246   SDEGLDFLARCLERDPKRRWSAEELLNHPFVSGNSMRVSRKGVACSPASTLDIRICEEGS  305

Query  1226  ysdesdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVR  1402
                         +R     P+     PFS  C+ +   S +  +   H  +SE W+TVR
Sbjct  306   DYSSDHGMG---IRDRDDFPSIPSRNPFSKCCD-EGNRSTRRQQTESHLESSENWVTVR  360



>ref|XP_010246145.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nelumbo nucifera]
Length=352

 Score =   362 bits (929),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 219/269 (81%), Gaps = 7/269 (3%)
 Frame = +2

Query  362   CSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSP  541
             CS+P EW+KG  +GSGSFG V+LA+NKATGG+FVVKSA S +G+Q LE+EA ILE LDSP
Sbjct  5     CSQPREWIKGNVIGSGSFGVVNLAINKATGGIFVVKSASSGAGVQSLENEANILELLDSP  64

Query  542   HVVKCIGKEMCGG----KKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLK  709
             ++V+C+G++   G    +KLNLF+EYMAGGSLAD+ Q+FGG LDE VI++YTREIL GL 
Sbjct  65    YIVRCLGRDFSTGANGERKLNLFLEYMAGGSLADLAQKFGGALDETVIQVYTREILQGLS  124

Query  710   YLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVK--KHPNPIPLAGVAGSPLWMAPE  883
             YLH  GIVH+DLKC+NVLL  +G++KLADFGC+KR+   +  + +    + G+PLWMAPE
Sbjct  125   YLHRRGIVHNDLKCKNVLLGPTGNIKLADFGCAKRLNSSQAGSKVSQQSICGTPLWMAPE  184

Query  884   TLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQ  1063
              LRN+G LD ASDIWSLGC+IIEMATG  PWA ++SNP++ +L+IACS   P FP++FS+
Sbjct  185   VLRNEG-LDTASDIWSLGCSIIEMATGRPPWADEVSNPMALLLKIACSSGVPQFPTNFSK  243

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             EGLDFL KCL+RDP+ RW +EELL+HPF+
Sbjct  244   EGLDFLAKCLQRDPKLRWTSEELLNHPFI  272



>ref|XP_002528847.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33521.1| ATP binding protein, putative [Ricinus communis]
Length=357

 Score =   360 bits (924),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 197/364 (54%), Positives = 259/364 (71%), Gaps = 26/364 (7%)
 Frame = +2

Query  353   KCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESL  532
             KCS  +P EWVKGK +GSGS G+VHLAMNK+TG LF+VK ++S + ++ LE+EA  LESL
Sbjct  6     KCSSPQPGEWVKGKVIGSGSHGNVHLAMNKSTGELFIVKYSQSKNSIRSLENEANFLESL  65

Query  533   DSPHVVKCIGKEMC-----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREIL  697
             +SP+VV+ +G+         GK L++F+EYM GGSL+DV ++FGG LD+ VIRLYTREIL
Sbjct  66    NSPYVVRYLGRNSSKGSSNDGKTLSIFMEYMPGGSLSDVAEKFGGALDQEVIRLYTREIL  125

Query  698   LGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAG--------V  853
              GLKY+HE GIVH D+KC+NVLL SSG++KLADFGC+KR+K     + + G        +
Sbjct  126   CGLKYIHEQGIVHCDVKCKNVLLGSSGNIKLADFGCAKRIKD----VDINGDFSDSCQDI  181

Query  854   AGSPLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSED  1033
              G+PLWMAPE LR +  LD ASDIWSLGCT+IEMATG  PW G++S+P++AVL+IACS++
Sbjct  182   GGTPLWMAPEVLRKEE-LDFASDIWSLGCTVIEMATGKAPWCGQVSDPMAAVLKIACSDE  240

Query  1034  RPNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVNpeseefaasspasVLDRSIF  1213
             +P FP+HFS+EGLDFL KCLER+P +RW AEELL HPF++ +S+  +ASSPASV D  I 
Sbjct  241   KPKFPTHFSKEGLDFLAKCLERNPERRWTAEELLDHPFISGKSQRKSASSPASVFDFGIL  300

Query  1214  PetdysdesdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWI  1393
              E   SDES+   E   R   P  T +        CE    + ++       + +SE WI
Sbjct  301   EEGYDSDESESPSEDDYRGKNPFSTRH--------CEEWKRIEKRQHSMESDFGSSENWI  352

Query  1394  TVRT  1405
             TVR+
Sbjct  353   TVRS  356



>ref|XP_008365330.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=350

 Score =   357 bits (916),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/272 (65%), Positives = 212/272 (78%), Gaps = 6/272 (2%)
 Frame = +2

Query  353   KCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESL  532
             +C+   P EW+KGK VGSGS+GSVHLAMNKATG LFVVKSA+S  G + LE+E +ILES 
Sbjct  7     QCTSPLPGEWMKGKMVGSGSYGSVHLAMNKATGALFVVKSAQSRDGAEALENEVKILESX  66

Query  533   DSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKY  712
             +SPHVVKC+G+E   GK  N+F+EYMAGGSL+DV Q FGG L+E V+RLYTREIL GLKY
Sbjct  67    NSPHVVKCMGRENGEGKCTNVFMEYMAGGSLSDVMQIFGGALEEEVVRLYTREILHGLKY  126

Query  713   LHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPN-----PIPLAGVAGSPLWMA  877
             LHE+GIVH DLKC NVLL SSG+VKLADFG + R+K            L  + G+PLWMA
Sbjct  127   LHESGIVHCDLKCSNVLLGSSGNVKLADFGFAXRLKASKADGVSVQHSLQCIGGTPLWMA  186

Query  878   PETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHF  1057
             PE LRN+ GLD ASDIWSLGCT+IEM TG  PW  +I NPV+AVL+IAC  ++P FP   
Sbjct  187   PEVLRNE-GLDFASDIWSLGCTVIEMXTGRPPWGNEIWNPVAAVLKIACGNEKPQFPQKL  245

Query  1058  SQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             S EGLDFL +CLERDP++RW A+ELL+HPFV+
Sbjct  246   SDEGLDFLARCLERDPKRRWSAKELLNHPFVS  277



>ref|XP_009355446.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Pyrus x bretschneideri]
Length=350

 Score =   357 bits (915),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/272 (65%), Positives = 215/272 (79%), Gaps = 6/272 (2%)
 Frame = +2

Query  353   KCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESL  532
             +C+   P EW+KGK VGSGS+GSVHLAM+KATG LFVVKSA+S  G + LE+E +ILESL
Sbjct  7     QCTSPLPGEWMKGKMVGSGSYGSVHLAMSKATGALFVVKSAQSRDGAEALENEVKILESL  66

Query  533   DSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKY  712
             +SPHVVKC+G+E   GK  N+F+EYMAGGSL+DV+Q FGG L+E V+RLYTREIL GL+Y
Sbjct  67    NSPHVVKCMGRENGDGKCTNVFMEYMAGGSLSDVSQIFGGALEEEVVRLYTREILHGLEY  126

Query  713   LHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPN-----PIPLAGVAGSPLWMA  877
             LHE+GIVH DLKC NVLL SSG+VKLADFG +KR+K            L  + G+PLWMA
Sbjct  127   LHESGIVHCDLKCNNVLLGSSGNVKLADFGFAKRLKGSKADGVSVQHSLQCIGGTPLWMA  186

Query  878   PETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHF  1057
             PE LRN+ GL+ +SDIWSLGCT+IEM TG  PW  +I NPV+AVL+IAC  +RP FP   
Sbjct  187   PEVLRNE-GLEFSSDIWSLGCTVIEMVTGRPPWGNEIWNPVAAVLKIACGNERPQFPQKL  245

Query  1058  SQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             S EGLDFL +CLERDP++RW A+ELL+HPFV+
Sbjct  246   SDEGLDFLARCLERDPKRRWSAKELLNHPFVS  277



>ref|XP_007041162.1| NPK1-related protein kinase 3, putative [Theobroma cacao]
 gb|EOX96993.1| NPK1-related protein kinase 3, putative [Theobroma cacao]
Length=376

 Score =   357 bits (916),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 215/273 (79%), Gaps = 9/273 (3%)
 Frame = +2

Query  356   CSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLD  535
             CS   P EWVKGK +GSGSFG+VHLAMNK TG LFVVKS ES +GL+ LE+EA IL+ L 
Sbjct  7     CSFPFPGEWVKGKVIGSGSFGTVHLAMNKVTGALFVVKSTESRAGLESLENEATILDGLT  66

Query  536   SPHVVKCIGKEMCGG----KKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLG  703
             SP VV+ IGKE+  G    +++N+F+EYMAGGSL DV ++FGG L E VIRLYTREIL G
Sbjct  67    SPFVVQSIGKELSRGSNGERRINIFMEYMAGGSLFDVAEKFGGALGEEVIRLYTREILQG  126

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPN---PIPLAGVA-GSPLW  871
             LKYLHENGIVH DLKC+NVLL SSGDVKL DFGC+KR+K   N     P    A G+PLW
Sbjct  127   LKYLHENGIVHCDLKCKNVLLGSSGDVKLTDFGCAKRLKYMKNNGESGPSKQYAGGTPLW  186

Query  872   MAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPS  1051
             MAPE LRN+ GLD ASDIWSLGCT+IEMATG  PW+ ++SNP +A+L+IACS + P FPS
Sbjct  187   MAPEVLRNE-GLDYASDIWSLGCTVIEMATGRPPWSDEVSNPAAAMLKIACSNEMPRFPS  245

Query  1052  HFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             +FS+EGLDFL KCL+R P++R  AEELL HPF+
Sbjct  246   NFSKEGLDFLSKCLDRHPKRRCTAEELLEHPFI  278



>ref|XP_002304509.1| hypothetical protein POPTR_0003s13010g [Populus trichocarpa]
 gb|EEE79488.1| hypothetical protein POPTR_0003s13010g [Populus trichocarpa]
Length=355

 Score =   353 bits (907),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 198/357 (55%), Positives = 244/357 (68%), Gaps = 19/357 (5%)
 Frame = +2

Query  359   SCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDS  538
             S  +P +WVKGK +GSGS G+VHLA+NK TGGLFV KSA S    ++LE EA ILESLDS
Sbjct  9     SLQQPCKWVKGKVIGSGSHGTVHLAINKVTGGLFVAKSALSGVDSKYLEHEANILESLDS  68

Query  539   PHVVKCIGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGL  706
             P++++C+GK       G  KLN+FIEYMAGGSL+D+ ++FGG L+E VIRLYT++IL GL
Sbjct  69    PYMIRCMGKGWQKGSDGDAKLNVFIEYMAGGSLSDMAEKFGGALEEEVIRLYTKQILNGL  128

Query  707   KYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLA----GVAGSPLWM  874
             KYLHENGIVH DLKC+NVLL  SG++KLADFGC+KR+K        A     V G+PLWM
Sbjct  129   KYLHENGIVHCDLKCKNVLLGLSGNIKLADFGCAKRLKDLDRNGKFAYSWQSVGGTPLWM  188

Query  875   APETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSH  1054
             APE LR +G LD ASDIWSLGC +IEMATG  PW  K SNP++ VL+IACS +RPNFP H
Sbjct  189   APEVLRKEG-LDFASDIWSLGCAVIEMATGRPPWGYKASNPMAVVLKIACSNERPNFPVH  247

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFVNpeseefaasspasVLDRSIFPetdysd  1234
             FS+EG+DFL KCLER+P  RW AEELL HPF+   S++    SPASVLD           
Sbjct  248   FSEEGMDFLAKCLERNPESRWTAEELLDHPFITGNSQKKYVCSPASVLDN---------I  298

Query  1235  esdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRT  1405
              + EED     S  P     R+ PFS+    K  +          + +S +WITVR+
Sbjct  299   GTYEEDYDSDESGNPDEHL-RWNPFSMRNCGKPKIIAMRQHADNDFVSSGDWITVRS  354



>ref|XP_002264624.2| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1 
[Vitis vinifera]
 emb|CBI29680.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   353 bits (907),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 219/275 (80%), Gaps = 9/275 (3%)
 Frame = +2

Query  353   KCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESL  532
             +C   +P EWVKGK VGSGSFG+VHLAM+KATGGLFVVKSA+   GL+ LE+EA +LE L
Sbjct  6     QCLAPQPGEWVKGKMVGSGSFGTVHLAMSKATGGLFVVKSAQEGPGLKSLENEATMLEKL  65

Query  533   DSPHVVKCIGKEMCGGK----KLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
              SP++V+C+G++   G+    +LNLF+EYMAGGSL++V  +FGG L+E VIRLYTREIL 
Sbjct  66    HSPYIVRCMGRDSFVGRQGEGRLNLFMEYMAGGSLSNVADKFGGILEEKVIRLYTREILQ  125

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVK----KHPNPIPLAGVAGSPL  868
             GL+YLH+N IVH DLKC+NVLL SSG+VKLADFGC+KR++    K  +      ++G+PL
Sbjct  126   GLEYLHKNEIVHCDLKCQNVLLGSSGNVKLADFGCAKRLRDLKSKGASMTSWQSISGTPL  185

Query  869   WMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFP  1048
             WMAPE LRN+G +  ASDIWSLGCTIIEMATG  PW+G++SNP++AV+ IACS   P  P
Sbjct  186   WMAPEVLRNEG-VTLASDIWSLGCTIIEMATGRPPWSGEVSNPMAAVMMIACSNKIPQIP  244

Query  1049  SHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             +H S+EGLDFL KCL+R+P KRW AEELL HPFV+
Sbjct  245   THLSKEGLDFLAKCLDRNPAKRWTAEELLSHPFVS  279



>ref|XP_011022649.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Populus euphratica]
Length=355

 Score =   350 bits (898),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 194/357 (54%), Positives = 245/357 (69%), Gaps = 19/357 (5%)
 Frame = +2

Query  359   SCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDS  538
             S  +P +WVKGK +GSG+ G+VHLA+NK TG LFV KSA S +  ++LE EA+ILESLDS
Sbjct  9     SLQKPCKWVKGKVIGSGAHGTVHLAINKVTGELFVAKSALSGADSKYLEHEADILESLDS  68

Query  539   PHVVKCIGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGL  706
             P++++C+GK       G  +LN+FIEYMAGGSL+D+ ++FGG L+E VIRLYT++IL GL
Sbjct  69    PYMIRCMGKGWQKGSDGDAELNVFIEYMAGGSLSDMAEKFGGALEEEVIRLYTKQILNGL  128

Query  707   KYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLA----GVAGSPLWM  874
             KYLHENGIVH DLKC+NVLL  SG++KLADFGC+KR+K        A     V G+PLWM
Sbjct  129   KYLHENGIVHCDLKCKNVLLGLSGNIKLADFGCAKRLKDLDRNGKFAYSWQSVGGTPLWM  188

Query  875   APETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSH  1054
             APE LR +G LD ASDIWSLGC +IEMATG  PW  K SNP++ VL+IACS +RPNFP H
Sbjct  189   APEVLREEG-LDFASDIWSLGCAVIEMATGRPPWGYKASNPMAVVLKIACSNERPNFPVH  247

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFVNpeseefaasspasVLDRSIFPetdysd  1234
             FS+EG+DFL KCLER+P  RW AEELL HPF+   S++    SPASVLD           
Sbjct  248   FSEEGMDFLAKCLERNPESRWTAEELLDHPFITGNSQKKYVCSPASVLDN---------I  298

Query  1235  esdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRT  1405
              + +ED     S  P     R+ PFS+    K  +          + +S +WITVR+
Sbjct  299   GTYKEDYDSDESGNPDKHL-RWNPFSMRNCGKPKIIAMRQHADNDFVSSGDWITVRS  354



>emb|CDO97638.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   350 bits (897),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 249/363 (69%), Gaps = 30/363 (8%)
 Frame = +2

Query  353   KCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESL  532
             +C   +P +WVKG+ VGSGSFG+VHLA+ KATG LFVVKSAES+ G+Q LE+EA+ILE+L
Sbjct  6     QCVSPQPTDWVKGEVVGSGSFGTVHLAIEKATGALFVVKSAESEIGIQSLENEADILENL  65

Query  533   DSPHVVKCIGKEMCGG----KKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             DS +++K +GK+   G    +KLNLFIEYMAGGSLA+V ++FGG +DE +IRLYT++IL 
Sbjct  66    DSQYIIKFLGKDFSSGANRYRKLNLFIEYMAGGSLAEVVEKFGGAVDEKLIRLYTKKILQ  125

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVK-KHPNPIPLA----GVAGSP  865
             GLKYLH+NGIVH DLKC+NVLL  SG+VKLADFG +KR+  +  + I +      + G+P
Sbjct  126   GLKYLHDNGIVHCDLKCKNVLLGLSGNVKLADFGFAKRLNDRKKDKISMQFHKPNIGGTP  185

Query  866   LWMAPETLRNQGGLDCASDIWSLGCTIIEMATG-NLPWAGKISNPVSAVLRIACSEDRPN  1042
              WMAPE LRN+ GLD A+DIWSLGCT+IEMA G   PW    SNP+SA+L+IAC    P 
Sbjct  186   FWMAPEVLRNE-GLDFAADIWSLGCTVIEMANGCRPPWGDNFSNPMSAILKIACGNGVPE  244

Query  1043  FPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV--NpeseefaasspasVLDRSIFP  1216
             FPS+ S EG DFL KCL+R+P+KRW AEELL HPF+       +    SPASVLD     
Sbjct  245   FPSNLSHEGKDFLSKCLQRNPKKRWTAEELLQHPFLLGESSQRKEETCSPASVLDLRFVH  304

Query  1217  etdysdesdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWIT  1396
                              S V +  ++R  PFS+ C+    +  ++     H+ +S+EW+T
Sbjct  305   YDSDG------------SSVDEEFSSRVNPFSMRCQPMKSLVSEY-----HFVSSDEWVT  347

Query  1397  VRT  1405
             VR+
Sbjct  348   VRS  350



>gb|EYU35020.1| hypothetical protein MIMGU_mgv1a019444mg [Erythranthe guttata]
Length=339

 Score =   348 bits (892),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 211/264 (80%), Gaps = 6/264 (2%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             +W+KG  +GSGSFG+VHLA++ +TG LFV KSA++++G+  L++EAEILE+LDS ++VKC
Sbjct  3     DWLKGSVIGSGSFGTVHLAVDTSTGALFVAKSAKTEAGIMSLKNEAEILENLDSRYIVKC  62

Query  557   IGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             +GK++     G    NLF EYMAGGSL+D++Q+FGG LDE +IRLYTREIL GLKYLH+N
Sbjct  63    VGKDVSFTRNGETNYNLFFEYMAGGSLSDLSQKFGGSLDERLIRLYTREILQGLKYLHKN  122

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRV-KKHPNPIPLAGVAGSPLWMAPETLRNQG  901
             GIVHSD+KC+NVL+ S G +K+ADFGC+KR+  K      + G+ G+PLWMAPE +RN+G
Sbjct  123   GIVHSDIKCKNVLVDSLGAIKVADFGCAKRLCDKKSRKSCVIGIGGTPLWMAPEVVRNEG  182

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
              LD A+DIWSLGCTIIEMATG  PW G  +NP++A+L+IA   + P FP HFS EGLDFL
Sbjct  183   -LDFAADIWSLGCTIIEMATGRPPWGGDAANPMAALLKIAKGNEIPEFPRHFSSEGLDFL  241

Query  1082  EKCLERDPRKRWKAEELLHHPFVN  1153
              KCL+RDPRKRW +EELL HPFV 
Sbjct  242   SKCLQRDPRKRWTSEELLCHPFVT  265



>ref|XP_008339420.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Malus domestica]
 ref|XP_008368188.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Malus domestica]
Length=350

 Score =   348 bits (893),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 173/273 (63%), Positives = 214/273 (78%), Gaps = 6/273 (2%)
 Frame = +2

Query  350   SKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILES  529
             ++C+   P EW+KGK VGSGS+G VHLAMNK TG LFVVKSA+S  G+  LE E +ILES
Sbjct  6     NQCTSPLPGEWMKGKLVGSGSYGXVHLAMNKTTGALFVVKSAQSRDGVDALEKEVKILES  65

Query  530   LDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLK  709
             L+SP+VVKC+G+E   GK +N+F+EYMAGGSL+DV+Q FGG L+E V+RLYTREI+ GLK
Sbjct  66    LNSPYVVKCMGRENGEGKCINVFMEYMAGGSLSDVSQIFGGALEEEVVRLYTREIVHGLK  125

Query  710   YLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKH-----PNPIPLAGVAGSPLWM  874
             YLHE+GIVH DLK +NVLL SSG+VKLADFG +KR+K            L  + G+PLWM
Sbjct  126   YLHESGIVHCDLKGKNVLLGSSGNVKLADFGFAKRLKDSKVDGASVQHSLQCIGGTPLWM  185

Query  875   APETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSH  1054
             APE LRN+  LD ASDIWSLGCT+IEMATG  PW  +I NPV+AVL+IAC  ++P+FP  
Sbjct  186   APEVLRNE-ELDFASDIWSLGCTVIEMATGRPPWGNEIWNPVAAVLKIACGNEKPHFPQK  244

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              S EGLDFL +CLERDP++R  A+ELL+HPFV+
Sbjct  245   LSDEGLDFLSRCLERDPKRRXSAKELLNHPFVS  277



>ref|XP_011042456.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Populus euphratica]
 ref|XP_011042457.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Populus euphratica]
Length=355

 Score =   345 bits (884),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 193/357 (54%), Positives = 244/357 (68%), Gaps = 19/357 (5%)
 Frame = +2

Query  359   SCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDS  538
             S  +P +WVKGK +GSG+ G+VHLA+NK TG LFV KSA S +  ++LE EA+ILESLDS
Sbjct  9     SLQKPCKWVKGKVIGSGAHGTVHLAINKVTGELFVAKSALSGADSKYLEHEADILESLDS  68

Query  539   PHVVKCIGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGL  706
             P++++C+GK       G  +LN+FIEYMAGGSL+D+ ++FGG L+E VIRLYT++IL GL
Sbjct  69    PYMIRCMGKGWQKGSDGDAELNVFIEYMAGGSLSDMAEKFGGALEEEVIRLYTKQILNGL  128

Query  707   KYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLA----GVAGSPLWM  874
             KYLHENGIVH DLKC+NVLL  SG++KLADFGC+KR+K        A     V G+PLWM
Sbjct  129   KYLHENGIVHCDLKCKNVLLGLSGNIKLADFGCAKRLKDLDRNGKFAYSWQSVGGTPLWM  188

Query  875   APETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSH  1054
             APE LR +G LD ASDI SLGC +IEMATG  PW  K SNP++ VL+IACS +RPNFP H
Sbjct  189   APEVLREEG-LDFASDIRSLGCAVIEMATGRPPWGYKASNPMAVVLKIACSNERPNFPVH  247

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFVNpeseefaasspasVLDRSIFPetdysd  1234
             FS+EG+DFL KCLER+P  RW AEELL HPF+   S++    SPASVLD           
Sbjct  248   FSEEGMDFLAKCLERNPESRWTAEELLDHPFITGNSQKKYVCSPASVLDN---------I  298

Query  1235  esdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRT  1405
              + +ED     S  P     R+ PFS+    K  +          + +S +WITVR+
Sbjct  299   GTYKEDYDSDESGNPDKHL-RWNPFSMRNCGKPKIIAMRQHADNDFVSSGDWITVRS  354



>ref|XP_011087640.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Sesamum indicum]
Length=363

 Score =   343 bits (879),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 217/286 (76%), Gaps = 15/286 (5%)
 Frame = +2

Query  332   MSGGYYSKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESE  511
             M+G +  +C   +P EW+KGK +GSGSFG+VHLA++ +TG LFV+KSA SD+G+  L++E
Sbjct  1     MAGKW--RCLSRQPTEWLKGKVIGSGSFGTVHLAIDSSTGALFVIKSAISDAGITSLKNE  58

Query  512   AEILESLDSPHVVKCIGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRL  679
             A ILE+LDSP++VKCIGK++     G  K NLF+EYMAGGSL+DV Q FGG L+E +IRL
Sbjct  59    ASILENLDSPYIVKCIGKDVSFAENGEIKHNLFMEYMAGGSLSDVAQNFGGALNEKLIRL  118

Query  680   YTREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKH------PNPIP  841
             YTREIL GL+YLH+NGIVHSD+KC+NVLL +SG VKLADFGC++R+  +       +   
Sbjct  119   YTREILEGLRYLHKNGIVHSDVKCKNVLLGASGAVKLADFGCARRLNDNKVSSHKTSSQR  178

Query  842   LAGVAGSPLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWA--GKISNPVSAVLR  1015
               G+ G+PLWMAPE LRN+  L+ A+DIWSLGCT+IEMATG  PW       NP++A+L+
Sbjct  179   YNGIGGTPLWMAPEVLRNE-ALNFAADIWSLGCTVIEMATGRPPWGLDATSKNPMAALLK  237

Query  1016  IACSEDRPNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             IA   + P FP HFS EGLDFL+KCLERDP KRW +E+L  HPFV 
Sbjct  238   IAKGHELPEFPRHFSDEGLDFLQKCLERDPEKRWTSEKLAGHPFVT  283



>gb|KDP42471.1| hypothetical protein JCGZ_00268 [Jatropha curcas]
Length=343

 Score =   334 bits (857),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 245/357 (69%), Gaps = 23/357 (6%)
 Frame = +2

Query  347   YSKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILE  526
             + + S S+P  WVKGK +G GS G+VHLAMNKAT  +FVVKSA S + L+ LE+EA  LE
Sbjct  5     FQQVSSSQPRGWVKGKAIGFGSQGNVHLAMNKATEEIFVVKSAHSSNNLKSLENEAFFLE  64

Query  527   SLDSPHVVKCIGKEMCGGK-KLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLG  703
             +L+SP++V+ +GK +   + ++++F+EYM+ GS++DV + +G KLDE ++RLYT+EIL G
Sbjct  65    NLNSPYIVQYLGKNISKDENRISIFMEYMSKGSVSDVAETYGRKLDEGIVRLYTKEILHG  124

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKK-HPNPIPLAGVAGSPLWMAP  880
             LKY+HE  IVH D+KC+NVL+ SSG+VKLADFGC+KRV     N   L  + G+PLWMAP
Sbjct  125   LKYIHEQNIVHCDIKCKNVLIDSSGNVKLADFGCAKRVNNLEKNGNLLQDIGGTPLWMAP  184

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E LR +  LD ASDIWSLGCT+IEM +G  PW+ ++ NP++AVL+IA S+++P  P++FS
Sbjct  185   EVLRKER-LDFASDIWSLGCTVIEMVSGMAPWSAQLLNPMAAVLKIAYSDEKPQLPAYFS  243

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFVNpeseefaasspasVLDRSIFPetdysdes  1240
              EGLDFLEKCLER+P KRW AE+LL HPF++ +S+     SP SV D  IF +  Y    
Sbjct  244   DEGLDFLEKCLERNPDKRWTAEQLLDHPFISGKSQREFVRSPVSVFDIGIFEDFYYD---  300

Query  1241  deedetPLRSPVPKPTTNR-FFPFSI-LCENKFGVSEQHPRFGEHWSTSEEWITVRT  1405
                      S +P     R   PFS+  C       E+  R    +  S++WITVR+
Sbjct  301   --------ESEIPNEDDFRGRNPFSMRYC-------EERKRIENDFGASDDWITVRS  342



>ref|XP_003548345.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Glycine max]
 gb|KHN39686.1| Mitogen-activated protein kinase kinase kinase ANP1 [Glycine 
soja]
Length=336

 Score =   330 bits (847),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 203/262 (77%), Gaps = 5/262 (2%)
 Frame = +2

Query  368   RPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDS-PH  544
             +P EWVKGK VG GSFG+VHLAMNK TGGLFVVKS  S  G Q L+ E +IL+SL+S P+
Sbjct  7     QPSEWVKGKLVGCGSFGTVHLAMNKYTGGLFVVKSPHSGVGRQSLDKEVKILKSLNSSPY  66

Query  545   VVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             +VKC+G E     KLN+F+EYMAGG+LAD+  +FGG LDE V+R+YTREIL GLK+LH++
Sbjct  67    IVKCLGTEEEEQGKLNIFMEYMAGGNLADMAHKFGGSLDEEVVRVYTREILHGLKHLHQH  126

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             GIVH DLKC+NVLLSSSG++KLADFG +KRVK+         + G+PLWMAPE LRN+  
Sbjct  127   GIVHCDLKCKNVLLSSSGNIKLADFGSAKRVKE---ANCWQSIGGTPLWMAPEVLRNE-S  182

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
             LD A+DIWSLGCT+IEMATG  PWA ++SNP +AVL IA     P+FP HFS+EGLDFL 
Sbjct  183   LDFAADIWSLGCTVIEMATGTPPWAHQVSNPTTAVLMIAHGHGIPHFPPHFSKEGLDFLT  242

Query  1085  KCLERDPRKRWKAEELLHHPFV  1150
             +C ER P KR   ++LL HPF+
Sbjct  243   RCFERHPNKRPTVQDLLTHPFI  264



>ref|XP_010910534.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Elaeis guineensis]
Length=357

 Score =   325 bits (832),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 159/271 (59%), Positives = 206/271 (76%), Gaps = 14/271 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVV  550
             P +WV+GK VG+GSFG V+LAMN++TG LFVVKS+ S  GLQ L++EA+ILESL+SP++V
Sbjct  11    PKDWVRGKAVGNGSFGIVNLAMNRSTGKLFVVKSSRSGMGLQSLKNEADILESLNSPYIV  70

Query  551   KCIGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             + +G E        ++ NLF+EYMAGGSL D+ ++FGG LDE VIR YTREIL G+ YLH
Sbjct  71    RSLGHEAVDKAGSQQEFNLFMEYMAGGSLLDIVEKFGGALDESVIRSYTREILKGIAYLH  130

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHP-------NPIPLAGVAGSPLWMA  877
              N IVH D+KC+NVLL SSG++KLADFGC++R+           N    +G  G+PLWMA
Sbjct  131   RNDIVHCDIKCKNVLLGSSGNIKLADFGCARRLGGSSEVDACSKNSSQFSG--GTPLWMA  188

Query  878   PETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHF  1057
             PE L+N+G +   SDIWSLGCT+IEMATG  PW  ++SNP++AV +IAC +D P  PS F
Sbjct  189   PEILKNEG-VGFLSDIWSLGCTVIEMATGRPPWTDEVSNPMTAVYKIACCDDLPKLPSGF  247

Query  1058  SQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             S EGLDFL KCL++DP+KRW AE+LL+HPF+
Sbjct  248   SNEGLDFLGKCLQKDPKKRWNAEQLLNHPFI  278



>ref|XP_003539385.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Glycine max]
 gb|KHN15267.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=329

 Score =   322 bits (825),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 204/265 (77%), Gaps = 9/265 (3%)
 Frame = +2

Query  368   RPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDS-PH  544
             +P EWVKGK VG GSFG+VHLAMNK TGGLFVVKS  S +    L+ E +IL +L+S P+
Sbjct  7     QPSEWVKGKLVGCGSFGNVHLAMNKTTGGLFVVKSPHSRAERHALDKEVKILNTLNSSPY  66

Query  545   VVKCIG--KEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             +V+C+G  +E     KLN+F+EYMAGG+LAD+  +FGG LDE V+R+YTREIL GL++LH
Sbjct  67    IVQCLGTEEEEEDQGKLNVFMEYMAGGNLADMVHKFGGSLDEEVVRVYTREILHGLEHLH  126

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQ  898
             ++GIVH DLKC+NVLL SSG++KLADFGC+KRVK+       A   G+PLWMAPE LRN+
Sbjct  127   QHGIVHCDLKCKNVLLGSSGNIKLADFGCAKRVKEDS-----ANCGGTPLWMAPEVLRNE  181

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
               +D A+DIWSLGCT+IEMATG  PWA ++SNP++AVL IA  +  P+FP HFS+EG DF
Sbjct  182   -SVDFAADIWSLGCTVIEMATGTPPWAHQLSNPITAVLMIAHGDGIPHFPPHFSKEGFDF  240

Query  1079  LEKCLERDPRKRWKAEELLHHPFVN  1153
             L +C +R P KR   ++LL HPFV+
Sbjct  241   LSRCFQRQPNKRSTVQDLLTHPFVS  265



>ref|XP_007148585.1| hypothetical protein PHAVU_006G220800g [Phaseolus vulgaris]
 gb|ESW20579.1| hypothetical protein PHAVU_006G220800g [Phaseolus vulgaris]
Length=341

 Score =   320 bits (821),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 199/262 (76%), Gaps = 7/262 (3%)
 Frame = +2

Query  368   RPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHV  547
             +P +WVKGK +G GSFG+VHLAMNK+TG LFVVKS+ S +G + L+ E +IL +L+S H+
Sbjct  11    KPCKWVKGKLIGCGSFGTVHLAMNKSTGSLFVVKSSNSRAGREALDEEVKILNTLNSEHI  70

Query  548   VKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENG  727
             V+ +G E   GK LN+F+EYMAGGSLADV  +FGG LDE V+R+YTREIL GL YLH +G
Sbjct  71    VQYLGAEEEQGK-LNVFMEYMAGGSLADVALKFGGSLDEEVVRVYTREILHGLNYLHLHG  129

Query  728   IVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGL  907
             I H DLKC+NVLL   G+VKLADFGC++RVK       +    G+PLWMAPE LRN+  +
Sbjct  130   IAHCDLKCKNVLLGPPGNVKLADFGCARRVKD-----LVKSSGGTPLWMAPEVLRNE-SV  183

Query  908   DCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEK  1087
             D ++DIWSLGCT+IEMATG  PWA ++SN + AVLRIA  +  P FP HFS+EGLDFL  
Sbjct  184   DLSADIWSLGCTVIEMATGTPPWAHEVSNHIGAVLRIAHGDGIPQFPPHFSKEGLDFLSM  243

Query  1088  CLERDPRKRWKAEELLHHPFVN  1153
             CL+RDP KR  AE+LL HPFV 
Sbjct  244   CLQRDPSKRPTAEQLLSHPFVT  265



>ref|XP_008806975.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Phoenix dactylifera]
Length=356

 Score =   320 bits (821),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 204/270 (76%), Gaps = 9/270 (3%)
 Frame = +2

Query  368   RPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHV  547
             RP +WV+GK VG+GSFG V LAMN++TG LFVVKS+ S +GL  L++EA+ILESL+S ++
Sbjct  10    RPKDWVRGKAVGNGSFGIVSLAMNRSTGELFVVKSSPSGTGLISLKNEADILESLNSSYI  69

Query  548   VKCIGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
             V+ +G E        ++ NLF+EYMAGGSL D+ ++FGG L+E VIR YTR+IL G+ YL
Sbjct  70    VRSLGHEAADRAGSQQEFNLFMEYMAGGSLLDIVEKFGGALEESVIRSYTRQILKGIAYL  129

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAG----VAGSPLWMAPE  883
             H N IVH D+KC+N+LL SSG++KLADFGC++R++        +     V G+PLWMAPE
Sbjct  130   HRNDIVHCDIKCKNLLLGSSGNIKLADFGCARRLRGSSEVDACSKNSSQVGGTPLWMAPE  189

Query  884   TLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQ  1063
              L+N+G +   SDIWSLGCT+IEMATG  PW  ++SNP++AV +IAC +D P  PS FS 
Sbjct  190   ILKNEG-VGFLSDIWSLGCTVIEMATGRPPWTDEVSNPMAAVYKIACCDDLPKLPSSFSD  248

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             EGLDFL KCL++DP+KRW AE+LL HPF+ 
Sbjct  249   EGLDFLRKCLQKDPKKRWNAEQLLSHPFIT  278



>gb|ABE91852.1| Protein kinase [Medicago truncatula]
 gb|ABE91968.1| Protein kinase [Medicago truncatula]
 gb|AES63130.2| MAP kinase kinase kinase [Medicago truncatula]
Length=373

 Score =   311 bits (797),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 208/287 (72%), Gaps = 22/287 (8%)
 Frame = +2

Query  356   CSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLD  535
             C   +  EW+KGK VG GSFGSVHLAMNK+TGGLFVVK A S++G   LE+E  IL +L+
Sbjct  2     CGIIKGSEWMKGKMVGCGSFGSVHLAMNKSTGGLFVVKKAHSEAGRDALENEVNILNTLN  61

Query  536   S---PHVVKCIGKEM-CGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLG  703
             S   P++V+C+G +      +L++F+EYM+GGSLADV+ +FGG L+E V+R+YTR+I+ G
Sbjct  62    SSPSPYIVQCLGTDYDHQDNQLHVFMEYMSGGSLADVSHKFGGSLNEDVVRVYTRQIVHG  121

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIP----LAGVAGSPLW  871
             L +LH++GIVH DLKC+NVLL+SSG+VKLADFGC+KRVKK+ N       +    G+PLW
Sbjct  122   LYHLHQHGIVHCDLKCKNVLLASSGNVKLADFGCAKRVKKNMNMNKSSSCIIANGGTPLW  181

Query  872   MAPETL--RNQGGLD--------CASDIWSLGCTIIEMATGNLPWAG----KISNPVSAV  1009
             MAPE L  +N   ++         A+DIWSLGCT+IEMATG  PW       ISNP++A+
Sbjct  182   MAPEVLLMKNNSSINDESRVVDFAAADIWSLGCTVIEMATGRPPWVDDDLISISNPMAAM  241

Query  1010  LRIACSEDRPNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              +IAC +  P FP HFSQEG DFL +CL RDP+KR  A ELL+HPF+
Sbjct  242   FKIACGDGIPQFPIHFSQEGFDFLRRCLVRDPKKRSTALELLNHPFL  288



>ref|XP_003592879.1| Mitogen-activated protein kinase kinase kinase [Medicago truncatula]
Length=416

 Score =   311 bits (797),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 208/287 (72%), Gaps = 22/287 (8%)
 Frame = +2

Query  356   CSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLD  535
             C   +  EW+KGK VG GSFGSVHLAMNK+TGGLFVVK A S++G   LE+E  IL +L+
Sbjct  2     CGIIKGSEWMKGKMVGCGSFGSVHLAMNKSTGGLFVVKKAHSEAGRDALENEVNILNTLN  61

Query  536   S---PHVVKCIGKEM-CGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLG  703
             S   P++V+C+G +      +L++F+EYM+GGSLADV+ +FGG L+E V+R+YTR+I+ G
Sbjct  62    SSPSPYIVQCLGTDYDHQDNQLHVFMEYMSGGSLADVSHKFGGSLNEDVVRVYTRQIVHG  121

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIP----LAGVAGSPLW  871
             L +LH++GIVH DLKC+NVLL+SSG+VKLADFGC+KRVKK+ N       +    G+PLW
Sbjct  122   LYHLHQHGIVHCDLKCKNVLLASSGNVKLADFGCAKRVKKNMNMNKSSSCIIANGGTPLW  181

Query  872   MAPETL--RNQGGLD--------CASDIWSLGCTIIEMATGNLPWAG----KISNPVSAV  1009
             MAPE L  +N   ++         A+DIWSLGCT+IEMATG  PW       ISNP++A+
Sbjct  182   MAPEVLLMKNNSSINDESRVVDFAAADIWSLGCTVIEMATGRPPWVDDDLISISNPMAAM  241

Query  1010  LRIACSEDRPNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              +IAC +  P FP HFSQEG DFL +CL RDP+KR  A ELL+HPF+
Sbjct  242   FKIACGDGIPQFPIHFSQEGFDFLRRCLVRDPKKRSTALELLNHPFL  288



>ref|XP_004485420.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cicer arietinum]
Length=360

 Score =   304 bits (779),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 196/272 (72%), Gaps = 15/272 (6%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLD-SPHVVKC  556
             WVKGK VGSGSFGSVHLA+NK+ GGLFVVKSA S++G   L +E  IL +L+ SP++V+C
Sbjct  6     WVKGKVVGSGSFGSVHLAINKSNGGLFVVKSANSEAGRHALHNEFNILNTLNYSPYIVQC  65

Query  557   IGKE-MCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIV  733
             +G E    G   N+F+EYM+GGSLADV   FGG LDE ++RLYT+ ILLGL +LH++GIV
Sbjct  66    LGTEYQHQGAINNVFMEYMSGGSLADVAHNFGGSLDEQLVRLYTKHILLGLNHLHQHGIV  125

Query  734   HSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLD-  910
             H DLKC+NVLL+SSG+VKLADFGC++R+K   +    +   G+PLWMAPE L      + 
Sbjct  126   HCDLKCKNVLLASSGNVKLADFGCARRIKS-SSSSSSSSCCGTPLWMAPEVLLLHNNTNE  184

Query  911   ------CASDIWSLGCTIIEMATGNLPWAGKI-----SNPVSAVLRIACSEDRPNFPSHF  1057
                    A+DIWSLGCT+IEMATG  PW   +     SNP++A+ +IA     P FP HF
Sbjct  185   KLDLDLAAADIWSLGCTVIEMATGRPPWIDHLHDSSTSNPMAALFKIARGNAIPQFPLHF  244

Query  1058  SQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             S+EG+DFL +CLERDP KR  A +LL HPF+N
Sbjct  245   SKEGIDFLSRCLERDPNKRSTAHDLLSHPFIN  276



>gb|KHN11050.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=301

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 185/243 (76%), Gaps = 9/243 (4%)
 Frame = +2

Query  434   MNKATGGLFVVKSAESDSGLQFLESEAEILESLDS-PHVVKCIG--KEMCGGKKLNLFIE  604
             MNK TGGLFVVKS  S +    L+ E +IL +L+S P++V+C+G  +E     KLN+F+E
Sbjct  1     MNKTTGGLFVVKSPHSRAERHALDKEVKILNTLNSSPYIVQCLGTEEEEEDQGKLNVFME  60

Query  605   YMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVHSDLKCRNVLLSSSGDV  784
             YMAGG+LAD+  +FGG LDE V+R+YTREIL GL++LH++GIVH DLKC+NVLL SSG++
Sbjct  61    YMAGGNLADMVHKFGGSLDEEVVRVYTREILHGLEHLHQHGIVHCDLKCKNVLLGSSGNI  120

Query  785   KLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLDCASDIWSLGCTIIEMATG  964
             KLADFGC+KRVK+       A   G+PLWMAPE LRN+  +D A+DIWSLGCT+IEMATG
Sbjct  121   KLADFGCAKRVKEDS-----ANCGGTPLWMAPEVLRNE-SVDFAADIWSLGCTVIEMATG  174

Query  965   NLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHP  1144
               PWA ++SNP++AVL IA  +  P+FP HFS+EG DFL +C +R P KR   ++LL HP
Sbjct  175   TPPWAHQLSNPITAVLMIAHGDGIPHFPPHFSKEGFDFLSRCFQRQPNKRSTVQDLLTHP  234

Query  1145  FVN  1153
             FV+
Sbjct  235   FVS  237



>ref|XP_006836834.1| hypothetical protein AMTR_s00099p00063540 [Amborella trichopoda]
 gb|ERM99687.1| hypothetical protein AMTR_s00099p00063540 [Amborella trichopoda]
Length=420

 Score =   287 bits (734),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/270 (55%), Positives = 191/270 (71%), Gaps = 10/270 (4%)
 Frame = +2

Query  368   RPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE---SDSGLQFLESEAEILESLDS  538
             +P+ WV+GK +GSGSFG V LAM+K+TG LFVVKSA+   S    + L++E+ IL  +DS
Sbjct  5     KPISWVRGKPIGSGSFGIVSLAMDKSTGELFVVKSADESLSKPSFEVLQNESHILLGIDS  64

Query  539   PHVVKCIGK---EMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLK  709
             PH+V+ +G    E+ G K+ NLF+EYMAGG+LA++   FGG L E VIR YTREIL GL 
Sbjct  65    PHIVRRLGDDFSEIDGSKRGNLFMEYMAGGNLAEILGNFGGSLAEPVIRSYTREILKGLS  124

Query  710   YLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETL  889
             YLHEN IVH DLKC+NVL    G +KL DFGC+K++ K         V G+PL+MAPE L
Sbjct  125   YLHENQIVHGDLKCKNVLFGPCGKIKLGDFGCAKKINKGKTIERGFTVEGTPLFMAPEVL  184

Query  890   RNQG-GLDCASDIWSLGCTIIEMATGNLPWAGKIS-NPVSAVLRIACSEDRPNFPSHFSQ  1063
             R +  G  C  DIW+LGCT+IEMATG   W+G    +P++A+ RIA S D P FP+ FS+
Sbjct  185   RREELGFGC--DIWALGCTVIEMATGKPAWSGGHEVDPMAAIYRIAFSRDFPEFPARFSR  242

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             EG DFL +C ERDPR+RW  E+LL HPF++
Sbjct  243   EGRDFLRRCFERDPRERWGCEQLLAHPFLS  272



>gb|KDO43268.1| hypothetical protein CISIN_1g042809mg [Citrus sinensis]
Length=241

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/243 (59%), Positives = 176/243 (72%), Gaps = 17/243 (7%)
 Frame = +2

Query  434   MNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMA  613
             MNK TG LFVVKSAES++G+Q L +EAEI +SL+SP+    IG+   G K +N+F+EYMA
Sbjct  1     MNKGTGALFVVKSAESEAGVQALRNEAEIRQSLNSPN----IGRN--GEKTVNIFMEYMA  54

Query  614   GGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLA  793
             GGSL DV ++FGG LD  VIRLYT+EIL      H NGI+H DLKC NVLL S GDVKL 
Sbjct  55    GGSLLDVAEKFGGTLDAGVIRLYTKEIL------HGNGILHCDLKCNNVLLGSHGDVKLP  108

Query  794   DFGCSKRVKKHPNPIPL----AGVAGSPLWMAPETLRNQGGLDCASDIWSLGCTIIEMAT  961
             D GC++RV    N   L      + G+ LWMAPE LRN+G LD A+DIWSLGC +IEMAT
Sbjct  109   DLGCARRVNDLKNNGNLKQSWQSIGGTQLWMAPEVLRNEG-LDFATDIWSLGCMVIEMAT  167

Query  962   GNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHH  1141
             G  PW  KISN  + +L+IACS ++P+FP+ F ++ LDFL KCLER P KRW AEELL+H
Sbjct  168   GRPPWGDKISNAAATLLKIACSNEKPHFPTQFFKKVLDFLAKCLERKPEKRWSAEELLNH  227

Query  1142  PFV  1150
              F+
Sbjct  228   TFI  230



>ref|XP_002960952.1| hypothetical protein SELMODRAFT_74353, partial [Selaginella moellendorffii]
 gb|EFJ38491.1| hypothetical protein SELMODRAFT_74353, partial [Selaginella moellendorffii]
Length=272

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 183/266 (69%), Gaps = 14/266 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSG-LQFLESEAEILESLDSPHVVK  553
             W++GK +G+GSFG+V LA+N+A G LF VKSAE  +SG +  LE+E +ILESLD P V++
Sbjct  12    WIRGKAIGAGSFGTVSLAVNRADGSLFAVKSAEMGNSGEIAALENERQILESLDCPQVIR  71

Query  554   CIGKEMCGGK-----KLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             C+G +    +       N+F+EYM GGSLAD+  + GGKLDE ++R+YTR ILLGL++LH
Sbjct  72    CLGGDDTAAEPSKPAMKNVFLEYMPGGSLADLMAKLGGKLDESLVRIYTRGILLGLEFLH  131

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQ  898
             ++GIVH D+K +N+L+     VKLADFG +KRV          GV G+PLWMAPE +R Q
Sbjct  132   KSGIVHCDIKGKNILVGCE-SVKLADFGAAKRVGAKSMA---GGVKGTPLWMAPEAVR-Q  186

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKI--SNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
                  ASDIWSLGCT+IEM TG  PW   +  S+P+ A+ +IACS + P  PS  S  G 
Sbjct  187   EEQGAASDIWSLGCTVIEMLTGKAPWGEAVSGSSPMVAMYKIACSNEIPELPSFVSSAGR  246

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KCL RDP  R  AEELL HPFV
Sbjct  247   DFLAKCLCRDPCSRASAEELLRHPFV  272



>ref|XP_002967055.1| hypothetical protein SELMODRAFT_86715, partial [Selaginella moellendorffii]
 gb|EFJ31654.1| hypothetical protein SELMODRAFT_86715, partial [Selaginella moellendorffii]
Length=272

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 180/266 (68%), Gaps = 14/266 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSG-LQFLESEAEILESLDSPHVVK  553
             W++GK +G+GSFG+V LA+N+A G LF VKSAE  +SG +  LE+E +ILESLD P V++
Sbjct  12    WIRGKAIGAGSFGTVSLAVNRADGSLFAVKSAEMGNSGEIAALENERQILESLDCPQVIR  71

Query  554   CIGKEMCGGK-----KLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             C+G +    +       N+F+EYM GGSL D+  + GGKLDE ++R+YTR IL GL++LH
Sbjct  72    CLGGDDTAAEPSKPAMKNVFLEYMPGGSLVDLMAKLGGKLDESLVRIYTRGILQGLEFLH  131

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQ  898
              +GIVH D+K +N+L+     VKLADFG +KRV          GV G+PLWMAPE +R Q
Sbjct  132   RSGIVHCDIKGKNILVGCE-SVKLADFGAAKRVGAKSMA---GGVKGTPLWMAPEAVR-Q  186

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKI--SNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
                  ASDIWSLGCT+IEM TG  PW   +  SNP+ A+ +IACS + P  PS  S  G 
Sbjct  187   EEQGAASDIWSLGCTVIEMLTGKAPWGEAVSGSNPMVAMYKIACSNEIPELPSFVSSAGR  246

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KCL RDP  R  AEELL HPFV
Sbjct  247   DFLAKCLCRDPCSRASAEELLRHPFV  272



>ref|XP_002960951.1| hypothetical protein SELMODRAFT_73444, partial [Selaginella moellendorffii]
 gb|EFJ38490.1| hypothetical protein SELMODRAFT_73444, partial [Selaginella moellendorffii]
Length=279

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/274 (49%), Positives = 178/274 (65%), Gaps = 22/274 (8%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE------SDSGLQFLESEAEILESLDS-  538
             WV G  +G+G+FGSV+LA++  TG LF VKS E      SD  L  LE+E  IL+SL S 
Sbjct  9     WVCGGLIGAGAFGSVNLAVDNETGDLFAVKSTECSGGRSSDGALLALENELSILQSLQSS  68

Query  539   PHVVKCIGKEMC-----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLG  703
             P +VKC+G         G    ++F+EYM GGS+AD+  + GGKL E + R+YTR IL G
Sbjct  69    PRIVKCLGSAWSSSAESGQPVRSVFLEYMPGGSIADLMAKLGGKLHESLARIYTRGILEG  128

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVK-----KHPNPIPLAGVAGSPL  868
             L +LH  GIVH D+K +NVL+ ++G VKLADFG +KR+      +H    P+  + G+PL
Sbjct  129   LDFLHRRGIVHCDIKGKNVLVGATG-VKLADFGAAKRLSGAAPYQHHQQSPM--IKGTPL  185

Query  869   WMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFP  1048
             WMAPE +R Q     ASDIWSLGCT++EM TG  PW G + +  SA+ RI CSE+ P  P
Sbjct  186   WMAPEVVR-QEEQGTASDIWSLGCTVLEMITGRAPW-GDVKHTFSALYRIGCSEELPELP  243

Query  1049  SHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
                S++G DF+  CL RDPR+RW + +LL HPFV
Sbjct  244   RWLSEQGKDFVMNCLRRDPRERWTSAQLLQHPFV  277



>ref|XP_006431510.1| hypothetical protein CICLE_v10003096mg [Citrus clementina]
 gb|ESR44750.1| hypothetical protein CICLE_v10003096mg [Citrus clementina]
Length=241

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 162/232 (70%), Gaps = 24/232 (10%)
 Frame = +2

Query  434   MNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMA  613
             MNK TG LFVVKSAES++G+Q L +EAEI +SL+SP++V+       G K +N+F+EYMA
Sbjct  1     MNKGTGALFVVKSAESEAGVQALRNEAEIRQSLNSPNIVQN------GEKTVNIFMEYMA  54

Query  614   GGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLA  793
             GGSL DV ++F G LD  VIRLYT+EI      LH NGI+H DLKC NVLL S  DVKL 
Sbjct  55    GGSLLDVAEKFRGTLDAGVIRLYTKEI------LHGNGILHCDLKCNNVLLGSHEDVKLP  108

Query  794   DFGCSKRVKKHPNPIPL----AGVAGSPLWMAPETLRNQGGLDCASDIWSLGCTIIEMAT  961
             D GC++RV    N   L      + G+PLWMAPE LRN+ GLD A+ IWSLGC +IEMAT
Sbjct  109   DLGCARRVNDLKNNGNLKQSWQSIGGTPLWMAPEVLRNE-GLDFATAIWSLGCMVIEMAT  167

Query  962   GNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCLERDPRKRW  1117
             G       ISN  + +L+IACS ++P+FP+ F ++ LDFL KCLER P KRW
Sbjct  168   G-------ISNGAATLLKIACSNEKPHFPTQFFKKVLDFLAKCLERKPEKRW  212



>ref|XP_001780526.1| predicted protein [Physcomitrella patens]
 ref|XP_001780562.1| predicted protein [Physcomitrella patens]
 gb|EDQ54620.1| predicted protein [Physcomitrella patens]
 gb|EDQ54656.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/274 (47%), Positives = 177/274 (65%), Gaps = 24/274 (9%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSG---------LQFLESEAEILESL  532
             W++G  +G+G+FG+V+LA+N+  G +F VKS   + G         L+ LE+E EIL+SL
Sbjct  1     WIRGNLIGAGTFGTVNLAVNREDGEVFAVKSVRVEQGRMDGAAQPSLEALENEIEILQSL  60

Query  533   DSPHVVKCIGKEMC--GGKKL-NLFIEYMAGGSLADVTQQFGGK---LDEMVIRLYTREI  694
             +S +VV+C+G +    GGK + N ++EYM  G L D  +QF G    LDE +IR YTR I
Sbjct  61    ESKYVVRCLGSDWTEEGGKVMRNAYLEYMPEGCLTDFLKQFAGAEAPLDEHLIRTYTRSI  120

Query  695   LLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWM  874
             + G+ YLH  GIVH D+K +N+L+ + G+VKL DFG +KRV           V G+PLWM
Sbjct  121   VQGIDYLHRQGIVHCDIKGKNILVGN-GNVKLTDFGSAKRVGVGGE----GKVNGTPLWM  175

Query  875   APETLR-NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPS  1051
             APE +R ++ GL  ASDIWSLGCT++EMATG  PW+  + NP  A+ +I C+E  P  P+
Sbjct  176   APEVVRQDEQGL--ASDIWSLGCTVVEMATGKAPWS-DLPNPYVALFQIGCTEGIPAVPA  232

Query  1052  HFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
               S E  DFL  C +RDPR RW + +LL HPF+ 
Sbjct  233   SLSAEAHDFLGHCFQRDPRMRWTSSQLLEHPFLT  266



>ref|XP_002967056.1| hypothetical protein SELMODRAFT_408419 [Selaginella moellendorffii]
 gb|EFJ31655.1| hypothetical protein SELMODRAFT_408419 [Selaginella moellendorffii]
Length=504

 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/274 (49%), Positives = 179/274 (65%), Gaps = 22/274 (8%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE------SDSGLQFLESEAEILESLDS-  538
             WV G  +G+G+FGSV+LA++  TG LF VKS E      SD  L  LE+E  IL+SL S 
Sbjct  9     WVCGGLIGAGAFGSVNLAVDNETGDLFAVKSTECSGGRSSDGALLALENELSILQSLQSS  68

Query  539   PHVVKCIGKEMC-----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLG  703
             P +VKC+G         G    ++F+EYM GGS+AD+  + GGKL E + R+YTR IL G
Sbjct  69    PRIVKCLGSAWSSSAESGQPVRSVFLEYMPGGSIADLMAKLGGKLHESLARIYTRGILEG  128

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVK-----KHPNPIPLAGVAGSPL  868
             L++LH  GIVH D+K +NVL+ ++G VKLADFG +KR+      +H    P+  + G+PL
Sbjct  129   LEFLHRRGIVHCDIKGKNVLVGATG-VKLADFGAAKRLSGAAHYQHHQQSPM--IKGTPL  185

Query  869   WMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFP  1048
             WMAPE +R Q     ASDIWSLGCT++EM TG  PW G + +  SA+ RI CSE+ P  P
Sbjct  186   WMAPEVVR-QEEQGTASDIWSLGCTVLEMITGRAPW-GDVKHTFSALYRIGCSEELPELP  243

Query  1049  SHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
                S++G DF+  CL RDPR+RW + +LL HPFV
Sbjct  244   WWLSEQGKDFVMNCLRRDPRERWTSAQLLQHPFV  277



>ref|XP_001768190.1| predicted protein [Physcomitrella patens]
 gb|EDQ67063.1| predicted protein [Physcomitrella patens]
Length=275

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 175/272 (64%), Gaps = 18/272 (7%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-------SDSGLQFLESEAEILESLDS  538
             W++GK +G+G+FGSV+LA+N+  G +F VKS +       S+  ++ +E+E +ILE LDS
Sbjct  6     WIRGKLLGAGTFGSVNLAINRENGEVFAVKSVQVTERDSRSEVAVRAIENEIDILEKLDS  65

Query  539   PHVVKCIGK---EMCGGKKLNLFIEYMAGGSLADVTQQFG--GKLDEMVIRLYTREILLG  703
              +VV+C+G    E  G    N+F+EYM  G L D  +QF   G L+E ++R YTR I+ G
Sbjct  66    KYVVRCLGSDWTEESGQLMRNVFLEYMPDGCLTDFVKQFANCGALNEHLLRKYTRSIVEG  125

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPL---AGVAGSPLWM  874
             + YLH NGIVH D+K +N+L+ + G VKL DFG SKRV        +   A V G+PLWM
Sbjct  126   IDYLHSNGIVHCDIKGKNILIGN-GSVKLTDFGSSKRVGGAMESDVMNCSATVNGTPLWM  184

Query  875   APETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSH  1054
             APE + NQ     ASDIWSLGCT++EMATG  PW+   +N  +A+  I C+++ P  P+ 
Sbjct  185   APEVV-NQVEQGPASDIWSLGCTVVEMATGRAPWS-NFANHYAALYHIGCTDELPEVPAS  242

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              S E  DFL  C +R+P KRW + +LL HPF+
Sbjct  243   LSAEAHDFLSHCFQREPSKRWTSTQLLQHPFL  274



>ref|XP_001760609.1| predicted protein [Physcomitrella patens]
 gb|EDQ74684.1| predicted protein [Physcomitrella patens]
Length=277

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 177/281 (63%), Gaps = 27/281 (10%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSG---------LQFLESEAEILESL  532
             W++G  +G+G+FG V+LA+N+  G +F VKS   + G         LQ LE+E EIL+SL
Sbjct  1     WIRGNLIGAGAFGKVNLAVNREDGEVFAVKSVRVEEGSGDAGAQVSLQALENEIEILQSL  60

Query  533   DSPHVVKCIGKEMC--GGKKL-NLFIEYMAGGSLADVTQQFGGK----LDEMVIRLYTRE  691
             +S  VV+C+G +    GGK + N ++EYM  G L D  +QF G     LDE +IR YTR 
Sbjct  61    ESKFVVRCLGSDWTEEGGKLMRNAYLEYMPEGCLTDFVRQFAGAGSEPLDEHLIRTYTRS  120

Query  692   ILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPI------PLAGV  853
             I+ G+ YLH  GIVH D+K +N+L+ + G VKL DFG +KRV              L  +
Sbjct  121   IVEGVDYLHRQGIVHCDIKGKNILVGN-GSVKLTDFGSAKRVGAEGRVCGNGSGGSLGRL  179

Query  854   AGSPLWMAPETLR-NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSE  1030
              G+PLWMAPE +R ++ GL  ASDIWSLGCT++EMATG  PW+  ++NP  A+ +I   +
Sbjct  180   NGTPLWMAPEVVRQDEQGL--ASDIWSLGCTVLEMATGKAPWS-HLANPFVAMFQIGYKD  236

Query  1031  DRPNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             + P  P+  S E  DFL +C ERDPRKRW + ELL HPF+ 
Sbjct  237   EIPAVPASLSSEAKDFLRRCFERDPRKRWTSGELLEHPFLT  277



>ref|XP_001755952.1| predicted protein [Physcomitrella patens]
 gb|EDQ79237.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 177/274 (65%), Gaps = 22/274 (8%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-------SDSGLQFLESEAEILESLDS  538
             W++G  +G+G+FGSV+LA+N+  G +F VKS +       S++ ++ +E+E ++L+ LDS
Sbjct  6     WIRGNLLGAGAFGSVNLAINRENGEVFAVKSVQVKVRYAGSEAAVRAIENEIDMLQRLDS  65

Query  539   PHVVKCIGKEMC--GGKKL-NLFIEYMAGGSLADVTQQF--GGKLDEMVIRLYTREILLG  703
              +VV+C+G +    GG+ + NLF+EYM  G L D  +QF   G LDE ++R YTR I+ G
Sbjct  66    KYVVRCLGSDWTEEGGQLMRNLFLEYMPEGCLTDFVKQFTSSGALDEQLLRTYTRSIVEG  125

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPL---AGVAGSPLWM  874
             + YLH NGIVH D+K +N+L+ + G+VKL DFG SKRV        +   A V G+PLWM
Sbjct  126   IDYLHSNGIVHCDIKGKNILIGN-GNVKLTDFGSSKRVGAKVESDVMNCAAKVNGTPLWM  184

Query  875   APETLRN--QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFP  1048
             APE +R   QG     SDIWSLGCT++EMATG  PW+   +N  +A+  I C++  P  P
Sbjct  185   APEVVRQVEQGP---PSDIWSLGCTVVEMATGRAPWS-HFANHFAALYHIGCTDQLPEVP  240

Query  1049  SHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             +  S E  DFL  C +RD  KRW + +LL HPF+
Sbjct  241   ASLSAEAHDFLSHCFQRDSSKRWTSAQLLQHPFL  274



>ref|XP_001755249.1| predicted protein [Physcomitrella patens]
 gb|EDQ79729.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   233 bits (594),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 174/275 (63%), Gaps = 22/275 (8%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA---ESDSG----LQFLESEAEILESLDS  538
             W++GK +G GSFGSV+LA+++  G +F VKS    E D+G    L+ +E+E EIL+ LDS
Sbjct  6     WIRGKLLGVGSFGSVNLAIDREDGEVFAVKSVQLNERDAGSEVALRAIENEIEILQKLDS  65

Query  539   PHVVKCIGKEMC--GGKKL-NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLK  709
               VVK +G +    GG+ + N+F+EYM  G L D  +QFG  LDE ++R YTR I+ G+ 
Sbjct  66    RFVVKYLGNDWTDEGGQLMRNIFLEYMPEGCLTDFVKQFGSSLDEHLLRTYTRSIVEGID  125

Query  710   YLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIP------LAGVAGSPLW  871
             YLH  GIVH D+K +N+L+ + G VKL DFG +KRV               A V G+PLW
Sbjct  126   YLHSQGIVHCDIKGKNILVGN-GSVKLTDFGSAKRVDMEVEVAENDLVNCSAKVNGTPLW  184

Query  872   MAPETLRN--QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNF  1045
             MAPE +R   QG    ASDIWSLGCT++E+A+G  PW     N  +A+  I C+++ P+ 
Sbjct  185   MAPEVVRQVEQGP---ASDIWSLGCTVVELASGRAPWGNLGGNHFAALYHIGCTDELPSV  241

Query  1046  PSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             P+  S    DFL  C +RDPR+RW + +LL HPF+
Sbjct  242   PTSLSAVAHDFLSHCFQRDPRRRWTSAQLLKHPFL  276



>ref|XP_009383559.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=451

 Score =   238 bits (607),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 171/266 (64%), Gaps = 14/266 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G+ +G GS  +V LA    +G +F VKSAE  S    L+ E  IL SLDSP+V+ C 
Sbjct  6     WHRGQVIGRGSSATVSLATALTSGEVFAVKSAEL-SRSAILQREQRILCSLDSPYVISCF  64

Query  560   GKEMC-----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             G ++      GG   +LF+EY  GGSL+D   + GG+LDE+ IR +  ++L GL YLH  
Sbjct  65    GFDLSLPTPSGGLYYDLFMEYAPGGSLSDEIARRGGRLDEVAIRTHACDVLRGLAYLHSR  124

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIP--LAGVAGSPLWMAPETLR--  892
             G+VH D+K RN+L+ S G  K+AD GC+ R++     +      + G+P++MAPE  R  
Sbjct  125   GVVHCDVKGRNILIGSDGRAKIADLGCASRIRGDEEEVEGDCQRLRGTPMFMAPEVARGE  184

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              QG    A+D+W+LGCTIIEMATG  PW   +S+PV A+ RIA S++ P FPS  S EG 
Sbjct  185   EQGP---AADLWALGCTIIEMATGRPPWP-DVSDPVIAIHRIAFSQETPRFPSWLSGEGK  240

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KCL RDPR+RW AE+LLHH FV
Sbjct  241   DFLSKCLRRDPRERWTAEQLLHHEFV  266



>ref|XP_009404796.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=442

 Score =   237 bits (605),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 170/269 (63%), Gaps = 25/269 (9%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             EW +G+ +G G+  +V LA + A+G +F VKS+E    L  L  E  +L +LDSP VV  
Sbjct  5     EWRRGRIIGRGASATVSLATSMASGQVFAVKSSE----LCSLRGEQRLLSALDSPFVVSY  60

Query  557   IGKEMC------GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             +G ++        G   NLF+EY  GGSL+D  ++  G+LDE+ IR Y  +IL GL YLH
Sbjct  61    LGFDVTPPHAPGAGFHYNLFMEYAPGGSLSDAIKRQSGRLDELAIRSYLHDILSGLVYLH  120

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRV-----KKHPNPIPLAGVAGSPLWMAPE  883
              NG+VH DLK +NVL+ S G  K+ADFGC+++V     +  P         G+P++MAPE
Sbjct  121   SNGLVHCDLKSQNVLICSDGRAKIADFGCARKVDGDEERHQPR--------GTPMFMAPE  172

Query  884   TLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQ  1063
               R +      +D+W+LGCT IEMATG  PW   +S+PVSA+ RIA S D P FPS  S 
Sbjct  173   VARGE-EQSAPADVWALGCTTIEMATGRPPWP-NMSDPVSALHRIAFSADVPEFPSWISA  230

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             EG DFL +CL RDPR+RW AE+LL HPFV
Sbjct  231   EGKDFLSRCLRRDPRERWTAEQLLRHPFV  259



>ref|XP_009394082.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Musa acuminata subsp. malaccensis]
Length=407

 Score =   235 bits (599),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 173/259 (67%), Gaps = 8/259 (3%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVVKC  556
             W +G+ VG G+  +V +A + ++G +F VKSAE S SG   L+ E  IL SLDSP+VV  
Sbjct  6     WRRGRIVGRGASATVSVAASLSSGEIFAVKSAELSSSG--DLQREQRILSSLDSPYVVSY  63

Query  557   IGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVH  736
              G E+  G   +LF+EY  GGS++D  ++ GG+LDE+ IR YT ++L GL YLH NG+VH
Sbjct  64    FGFEV--GLCYDLFMEYAPGGSMSDEIKKRGGRLDELNIRSYTCDLLRGLAYLHSNGVVH  121

Query  737   SDLKCRNVLLSSSGDVKLADFGCSKRV-KKHPNPIPLAGVAGSPLWMAPETLRNQGGLDC  913
              DLK +NVL+ S G  K+ADFGC++R  ++  +        G+P++MAPE  R +     
Sbjct  122   CDLKSQNVLICSGGRAKIADFGCARRADEEDKDGGGRVQPRGTPMFMAPEVARGE-EQSA  180

Query  914   ASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCL  1093
              +D+W+LGCT+IEMATG  PW    S+PVSA+ RIA S   P FP   S++G DFL +CL
Sbjct  181   PADVWALGCTVIEMATGQPPWP-HASDPVSALHRIAFSAAVPEFPCWLSEDGNDFLSRCL  239

Query  1094  ERDPRKRWKAEELLHHPFV  1150
              RDPR+RW AE+LL HPFV
Sbjct  240   RRDPRERWSAEQLLRHPFV  258



>ref|XP_010916795.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Elaeis guineensis]
Length=508

 Score =   236 bits (601),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 173/264 (66%), Gaps = 13/264 (5%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVVK  553
             EW +G+T+G GS  +V LA   A+G +F VKSAE S +GL  L+ E  IL +L SPHVV 
Sbjct  5     EWYRGRTIGRGSSATVSLATTSASGEVFAVKSAELSRAGL--LQREQRILANLSSPHVVS  62

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++     G   NLF+EY A GSL+D  ++ GG+LDE+ IR Y+ +IL GL YLH N
Sbjct  63    YLGFDITSETNGVYYNLFMEYAARGSLSDEIKKEGGRLDELAIRSYSCQILHGLAYLHSN  122

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
              I H D+K +NVL+ S G   +AD GC++ +    +   L  + G+P++MAPE  R   Q
Sbjct  123   SIAHCDVKGQNVLIGSDGRAMIADLGCARWMADDHSRDCLQ-LRGTPMYMAPEAARGEEQ  181

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G     +D+W+LGCT++EMATG  PW  ++S+P++A+ RIA S D P  PS  S EG DF
Sbjct  182   G---TPADVWALGCTVVEMATGRAPWP-EVSDPIAALHRIAFSTDVPELPSWISDEGKDF  237

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L+KC  RDP +RW AE+LL HPFV
Sbjct  238   LDKCFRRDPDERWSAEQLLKHPFV  261



>ref|XP_009352665.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Pyrus x bretschneideri]
Length=465

 Score =   234 bits (598),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 143/360 (40%), Positives = 210/360 (58%), Gaps = 26/360 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T+G GS  +V +A +  +G +F VKSA+     QFL+ E  IL +L SPH+V+
Sbjct  1     MDWTRGRTIGLGSSATVSIAKSYVSGEVFAVKSAKLAQS-QFLQKEQTILSTLSSPHIVQ  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G  +    G    NLF+EY  GG+++D  ++ GG LD+  IR Y R+ILLGL++LH N
Sbjct  60    YKGHNISTENGDVLYNLFLEYAPGGTISDAIRRQGGCLDDAAIRCYARQILLGLQHLHSN  119

Query  725   GIVHSDLKCRNVLLSSSG-DVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              I H D+KC+N+L++ +G +VKLAD GC++ V    +    + + G+PL+MAPE  R   
Sbjct  120   QIAHCDVKCQNILVAENGANVKLADLGCARLVNSDCD----SQIGGTPLYMAPEVARGEE  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG    A+D+W+LGCTIIEMATG  PW+  + +PVSA+ RI  S D P  PS  SQ+G D
Sbjct  176   QG---VAADLWALGCTIIEMATGRAPWS-DVCDPVSALYRIGFSGDAPEIPSSLSQQGRD  231

Query  1076  FLEKCLERDPRKRWKAEELLHHPFVNpeseefaasspasVLDRSIFPetdysdesdeede  1255
             F+ KCL  DP +RW A ELL H FV          SP +VLDR ++       E +E + 
Sbjct  232   FVAKCLIGDPLERWSAGELLEHGFV--VEAPNDLLSPTTVLDRGLW-------EEEEFES  282

Query  1256  tPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRTS*GKKKKQEV  1435
               +  P  + + + +     + +   G++   P      S  E W+TVR+      KQ+V
Sbjct  283   DEIWDPTRESSGSDYSAKERIRKLSEGIAASSPEMPNWASDEENWVTVRSD--NINKQDV  340



>ref|XP_006346260.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Solanum tuberosum]
Length=459

 Score =   234 bits (596),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/272 (44%), Positives = 180/272 (66%), Gaps = 18/272 (7%)
 Frame = +2

Query  350   SKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILES  529
             S+   +  +EW++G  +G GS  +V LA N ++G LF VKS E       L+ E  ++  
Sbjct  2     SRAEPNDSMEWIRGPIIGRGSSATVSLATN-SSGVLFAVKSTEQSC----LQREYSLISQ  56

Query  530   LDSPHVVKCIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L+SP +VKC+G ++   +     N+F+EY+ GG+L+D+ ++ GG LDE +I+LY ++IL 
Sbjct  57    LNSPFLVKCLGFDIAYEQNKEVYNMFMEYVQGGTLSDLIKKQGGSLDESMIKLYAQQILQ  116

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL YLH  GIVH D+K +N+L+  +GD+K+AD GC+K ++   N    +G +G+P +MAP
Sbjct  117   GLDYLHSIGIVHCDVKGQNILIGENGDIKIADLGCAKLLRDEKN----SGFSGTPAFMAP  172

Query  881   ETLR--NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSH  1054
             E  R   QG    A+DIW+ GCTIIEMATG++PW+ +I +PVSA+ RI  S D P FP++
Sbjct  173   EVARGEEQG---FAADIWAFGCTIIEMATGSVPWS-EIKDPVSALFRIGYSGDLPQFPNN  228

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              S +  +FL  CL + P +RW A++LL HPF+
Sbjct  229   LSNDAREFLSNCLMKCPNERWTAKQLLQHPFL  260



>ref|XP_009405196.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=453

 Score =   233 bits (595),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 167/264 (63%), Gaps = 16/264 (6%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G+ +G GS  +V LA    +G +F VK AE       L+ E  IL SL SP+VV C+
Sbjct  6     WRRGRVIGRGSSATVSLATALDSGAVFAVKCAELGRS-AILQREQRILSSLRSPYVVSCL  64

Query  560   GKEM-----CGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             G ++      GG   NLF+EY   GSL+D   + GG+LDE  IR Y+ EIL GL YLH  
Sbjct  65    GFDISSHGSTGGLYYNLFLEYAPRGSLSDEIGKQGGRLDEAAIRCYSCEILRGLVYLHSQ  124

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             G+VH D+K RNVL+ + G  K+AD GC++ + +        G+ G+P++MAPE  R   Q
Sbjct  125   GVVHCDVKGRNVLVGTDGHAKIADLGCARLIAQEDE----EGLRGTPMFMAPEVARGEEQ  180

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G     +D+W+LGCTIIEMATG   W G +S+P++A+ R+A S D P FPS  S EG DF
Sbjct  181   GP---PADVWALGCTIIEMATGGPAWPG-VSDPIAAIHRVAFSPDVPAFPSWLSGEGKDF  236

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L KCL+RDPR+RW AE+LL H FV
Sbjct  237   LSKCLKRDPRERWTAEQLLQHEFV  260



>ref|XP_004134977.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis sativus]
Length=396

 Score =   230 bits (586),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/349 (37%), Positives = 205/349 (59%), Gaps = 27/349 (8%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW++G+T+G GS  +V +A +   G +  VKS E  S L FL+ E  IL  L+   V+ 
Sbjct  1     MEWIRGRTIGRGSSAAVSVATDIRFGQVMAVKSVEF-SHLDFLKREQRILSQLNCSRVIG  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    G    NL +E+  GGS+ D  ++ GG+LDE   + YTRE+L GL+Y+H N
Sbjct  60    YKGFDVTLENGNLMCNLLMEFAPGGSILDAMEKAGGRLDEATAQFYTREVLSGLQYVHSN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             G+VH D+KC N+L+   G +K+ADFGC++RV++    +    +AG+P++MAPE  R +  
Sbjct  120   GVVHCDIKCCNILMGEDG-IKIADFGCARRVEE----VSGGNLAGTPIFMAPEVARGE-K  173

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                A+D+WS+GC +I+M TG +PWA  +S+P++A+ RI   +D P  P   S++G DFL 
Sbjct  174   QGFAADVWSVGCAVIQMVTGRVPWA-NLSDPLAAIYRIGSGDDLPEIPRIMSEQGKDFLR  232

Query  1085  KCLERDPRKRWKAEELLHHPFVNpese--efaasspasVLDRSIFPetdysdesdeedet  1258
             +CL RDP +RW   ELL HPFV  +    +  + +P S+LD+ I+     +    E  E+
Sbjct  233   RCLIRDPEERWSVNELLKHPFVQEQKSHPKQNSRTPTSILDQGIW----DTVNDPETVES  288

Query  1259  PLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRT  1405
             P+R  + +    R    + +  +  G+         +W   E+WITVR+
Sbjct  289   PIRPKIQRTPLQRIQQLNEV--STIGIP--------NWECDEDWITVRS  327



>ref|XP_010926215.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Elaeis guineensis]
Length=503

 Score =   233 bits (593),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 127/267 (48%), Positives = 174/267 (65%), Gaps = 15/267 (6%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVVK  553
             +W +G+T+G GS  +V LA    +G +F VKSAE S +GL  L+ E  IL +L+SPHVV 
Sbjct  5     QWCRGRTIGRGSSATVSLATVPVSGEVFAVKSAELSRAGL--LQREQRILSNLNSPHVVS  62

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++   K     NLF+EY A GSL+D  ++ GG+LDE  IR Y+ +ILLGL YLH +
Sbjct  63    YLGFDVTSEKNGLYYNLFMEYAARGSLSDEIKKQGGRLDEPTIRSYSYQILLGLDYLHSS  122

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAG---VAGSPLWMAPETLR-  892
              I H D+K +NVL+ S G   +AD GC++ V    +         + G+P++MAPE  R 
Sbjct  123   RIAHCDVKGQNVLIGSDGRAMIADLGCARWVAGDKDGYDDDNGLQLRGTPMFMAPEVARG  182

Query  893   -NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
               QG     +DIW+LGCTI+EMATG  PW  ++S+P++A+ RIA S D P  PS  S EG
Sbjct  183   EEQG---IPADIWALGCTIVEMATGQAPWP-EVSDPIAALHRIAFSSDVPELPSWISDEG  238

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFV  1150
              DFL++CL RDP++RW AE+LL HPFV
Sbjct  239   KDFLDRCLRRDPKERWTAEQLLKHPFV  265



>gb|KGN49092.1| hypothetical protein Csa_6G513560 [Cucumis sativus]
Length=402

 Score =   229 bits (585),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 130/349 (37%), Positives = 205/349 (59%), Gaps = 27/349 (8%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW++G+T+G GS  +V +A +   G +  VKS E  S L FL+ E  IL  L+   V+ 
Sbjct  1     MEWIRGRTIGRGSSAAVSVATDIRFGQVMAVKSVEF-SHLDFLKREQRILSQLNCSRVIG  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    G    NL +E+  GGS+ D  ++ GG+LDE   + YTRE+L GL+Y+H N
Sbjct  60    YKGFDVTLENGNLMCNLLMEFAPGGSILDAMEKAGGRLDEATAQFYTREVLSGLQYVHSN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             G+VH D+KC N+L+   G +K+ADFGC++RV++    +    +AG+P++MAPE  R +  
Sbjct  120   GVVHCDIKCCNILMGEDG-IKIADFGCARRVEE----VSGGNLAGTPIFMAPEVARGE-K  173

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                A+D+WS+GC +I+M TG +PWA  +S+P++A+ RI   +D P  P   S++G DFL 
Sbjct  174   QGFAADVWSVGCAVIQMVTGRVPWA-NLSDPLAAIYRIGSGDDLPEIPRIMSEQGKDFLR  232

Query  1085  KCLERDPRKRWKAEELLHHPFVNpese--efaasspasVLDRSIFPetdysdesdeedet  1258
             +CL RDP +RW   ELL HPFV  +    +  + +P S+LD+ I+     +    E  E+
Sbjct  233   RCLIRDPEERWSVNELLKHPFVQEQKSHPKQNSRTPTSILDQGIW----DTVNDPETVES  288

Query  1259  PLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRT  1405
             P+R  + +    R    + +  +  G+         +W   E+WITVR+
Sbjct  289   PIRPKIQRTPLQRIQQLNEV--STIGIP--------NWECDEDWITVRS  327



>ref|XP_009357591.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Pyrus x bretschneideri]
Length=437

 Score =   230 bits (587),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 173/265 (65%), Gaps = 15/265 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T+G GS  +V +A +  +G +F VKSAE  S  QFL+ E  IL +L SP++V+
Sbjct  1     MDWTRGRTIGLGSSATVSIAKSHRSGEVFAVKSAEL-SQSQFLQKEQTILATLSSPYIVQ  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G  +    G    NLF+EY  GG+++D  ++ GG L+E V R Y R+ILLGL++LH N
Sbjct  60    YKGHNISNENGAVLYNLFLEYAPGGTISDAIRRQGGCLNEAVTRCYARQILLGLQHLHSN  119

Query  725   GIVHSDLKCRNVLLSSSG-DVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              I H D+KC+N+L++ +G  VKLAD GC+ RV    N    + + G+PL+M PE  R  +
Sbjct  120   QIAHCDVKCQNILVAENGAKVKLADLGCAHRV----NYDRGSPIGGTPLYMPPEVARGED  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG    A+D+W+LGCTIIEMATG  PW   + +PVSA+ RI  S D P  PS  S++G D
Sbjct  176   QG---IAADVWALGCTIIEMATGRAPWP-DVCDPVSALYRIGVSGDAPGIPSSLSKQGRD  231

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             F+ KCL RDP +RW A ELL H F+
Sbjct  232   FVAKCLIRDPLERWSAGELLEHGFL  256



>ref|XP_008784479.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Phoenix dactylifera]
Length=498

 Score =   232 bits (591),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 169/264 (64%), Gaps = 13/264 (5%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVVK  553
             EW +G+T+G GS  +V LA   A+G +F VKSAE S +GL  L  E  IL +L  PHVV 
Sbjct  5     EWYRGRTIGRGSSATVSLATITASGEVFAVKSAELSRAGL--LRREQRILANLSYPHVVS  62

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++     G   NLF+EY A GSL+D  ++ GG+LDE  IR Y+ +IL GL YLH N
Sbjct  63    YLGFDITSETNGVYYNLFMEYAARGSLSDEIEKQGGRLDEPTIRSYSCQILRGLAYLHSN  122

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
              I H D+K RNVL+ S G   +AD GC++ +        L  + G+P++MAPE  R   Q
Sbjct  123   SIAHCDVKGRNVLIGSDGRAMIADLGCARWMADEDGRGCLQ-LRGTPMYMAPEAARGEEQ  181

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G     +D+W+LGCT++EMATG  PW  + S+P++A+ RIA S D P  PS  S EG DF
Sbjct  182   G---TPADVWALGCTVVEMATGRAPWP-EFSDPIAALHRIAFSTDVPELPSWISDEGKDF  237

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L++CL RDP +RW AE+LL HPFV
Sbjct  238   LDRCLRRDPNERWTAEQLLKHPFV  261



>ref|XP_004170035.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis sativus]
Length=304

 Score =   226 bits (576),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 169/263 (64%), Gaps = 11/263 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW++G+T+G GS  +V +A +  +G +  VKS E  S L FL+ E  IL  L+   V+ 
Sbjct  1     MEWIRGRTIGRGSSAAVSVATDIRSGQVMAVKSVEF-SHLDFLKREQRILSQLNCSRVIG  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    G    NL +E+  GGS+ D  ++ GG+LDE   + YTRE+L GL+Y+H N
Sbjct  60    YKGFDVTLENGNLMCNLLMEFAPGGSILDAMEKAGGRLDEATAQFYTREVLSGLQYVHSN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             G+VH D+KC N+L+   G +K+ADFGC++RV++    +    +AG+P++MAPE  R +  
Sbjct  120   GVVHCDIKCCNILMGEDG-IKIADFGCARRVEE----VSGGNLAGTPIFMAPEVARGE-K  173

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                A+D+WS+GC +I+M TG +PWA  +S+P++A+ RI   +D P  P   S++G DFL 
Sbjct  174   QGFAADVWSVGCAVIQMVTGRVPWA-NLSDPLAAIYRIGSGDDLPEIPRIMSEQGKDFLR  232

Query  1085  KCLERDPRKRWKAEELLHHPFVN  1153
             +CL RDP +RW   ELL HPFV 
Sbjct  233   RCLIRDPEERWSVNELLKHPFVQ  255



>ref|XP_004151935.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis sativus]
 gb|KGN63238.1| hypothetical protein Csa_2G416770 [Cucumis sativus]
Length=435

 Score =   229 bits (585),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 172/269 (64%), Gaps = 19/269 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G  +G GS  +V LA +  +  +F VK+A+  S  Q L  E + L SL SP++V 
Sbjct  1     MDWTRGHVIGHGSSATVFLATDSPSRHVFAVKTAQL-SHSQSLRKEQQFLSSLASPYIVS  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGG-KLDEMVIRLYTREILLGLKYLH  718
               G    +E  G    NLF+EY+  GSLAD  ++ GG +LDE  I +YTR+IL+GL+Y+H
Sbjct  60    YRGFEVSREQSGVTMFNLFMEYLPNGSLADTIRRRGGQRLDEATIVIYTRQILMGLQYIH  119

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--  892
               GIVH D+K RN+L+   G+ KLADFGC+KR     +PI      G+PL+MAPE  R  
Sbjct  120   SKGIVHCDIKARNILIGLDGEAKLADFGCAKRATSQTDPI-----CGTPLFMAPEVARGE  174

Query  893   NQGGLDCASDIWSLGCTIIEMAT-GNLPWAGKI--SNPVSAVLRIACSEDRPNFPSHFSQ  1063
             +QG     SDIWS+GCTIIEMA+ G  PW      ++P+SA+ RI  S + P  P + S+
Sbjct  175   HQG---FPSDIWSIGCTIIEMASGGGSPWPKTTDDTDPISALYRIGYSGESPEIPCYLSE  231

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             E  DFLEKCL+R+P +RW A EL++HPF+
Sbjct  232   EAKDFLEKCLKRNPSERWTASELMNHPFL  260



>ref|XP_002304913.2| hypothetical protein POPTR_0004s00910g, partial [Populus trichocarpa]
 gb|EEE85424.2| hypothetical protein POPTR_0004s00910g, partial [Populus trichocarpa]
Length=400

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 174/266 (65%), Gaps = 13/266 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T+G GS  +V +A    +G +F VKSAE  S  + L+ E  +L +L  P +V 
Sbjct  1     MDWTRGQTIGRGSSATVSMARANQSGKVFAVKSAEL-SKSESLQKEQIVLSTLRCPQIVA  59

Query  554   CIGKEMCG--GKKL-NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    GK L NLF+EY +GG+L D  ++ GG LDE +IRLY R ILLGL+YLH N
Sbjct  60    YKGCDITNENGKVLYNLFLEYASGGTLIDAIREGGGCLDEDMIRLYARTILLGLEYLHCN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKK--HPNPIPLAGVAGSPLWMAPETLR--  892
             GIVH D+K  N+L++S G  K+AD GC+KRV +    +      +AG+PL+MAPE  R  
Sbjct  120   GIVHCDIKGHNILVTSDG-AKIADLGCAKRVDEVSEADWGTTTTIAGTPLYMAPEVARAE  178

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
             +QG     +DIW++GCTI+EMATG  PW   +S+PVSA+ +I  S + P  PS  S++  
Sbjct  179   HQG---FPADIWAVGCTIVEMATGQAPWV-NVSDPVSALYQIGFSGNAPEIPSFMSKQAR  234

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KCL+RDP +RW A ELL H F+
Sbjct  235   DFLSKCLKRDPMERWSASELLKHDFI  260



>ref|XP_004173671.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like, 
partial [Cucumis sativus]
Length=353

 Score =   227 bits (578),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 171/270 (63%), Gaps = 19/270 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G  +G GS  +V LA +  +  +F VK+A+  S  Q L  E + L SL SP++V 
Sbjct  1     MDWTRGHVIGHGSSATVFLATDSPSRHVFAVKTAQL-SHSQSLRKEQQFLSSLASPYIVS  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGG-KLDEMVIRLYTREILLGLKYLH  718
               G    +E  G    NLF+EY+  GSLAD  ++ GG +LDE  I +YTR+IL+GL+Y+H
Sbjct  60    YRGFEVSREQSGVTMFNLFMEYLPNGSLADTIRRRGGQRLDEATIVIYTRQILMGLQYIH  119

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--  892
               GIVH D+K RN+L+   G+ KLADFGC+K      +PI      G+PL+MAPE  R  
Sbjct  120   SKGIVHCDIKARNILIGLDGEAKLADFGCAKWATSQTDPI-----CGTPLFMAPEVARGE  174

Query  893   NQGGLDCASDIWSLGCTIIEMAT-GNLPWAGKI--SNPVSAVLRIACSEDRPNFPSHFSQ  1063
             +QG     SDIWS+GCTIIEMA+ G  PW      ++P+SA+ RI  S + P  P + S+
Sbjct  175   HQG---FPSDIWSIGCTIIEMASGGGSPWPKTTDDTDPISALYRIGYSGESPEIPCYLSE  231

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             E  DFLEKCL+R+P +RW A EL++HPF+ 
Sbjct  232   EAKDFLEKCLKRNPSERWTASELMNHPFLR  261



>ref|XP_008441103.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis melo]
Length=463

 Score =   229 bits (585),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/349 (37%), Positives = 203/349 (58%), Gaps = 28/349 (8%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW++G+T+G GS  +V +A +  +G +  VK+ E  S L FL+ E  IL  L+   V+ 
Sbjct  1     MEWIRGRTLGRGSSAAVSVATDLRSGQVMAVKTVEF-SRLDFLKREQRILSQLNCSRVIG  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    G    NL +E+  GGS+ D  ++ GG+LDE   + YTREIL GL Y+H N
Sbjct  60    YKGFDVTLENGNLMCNLLMEFAPGGSILDTMEKAGGRLDEATAQFYTREILSGLHYVHSN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             G+VH D+KC N+L+   G +K+ADFGC++RV+     +    +AG+P++MAPE  R +  
Sbjct  120   GVVHCDIKCCNILVGEDG-IKIADFGCARRVED----VFGGNLAGTPIFMAPEVARGEKQ  174

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                A+D+WS+GC +I+M TG  PWA  +S+P++A+ RI   +D P  P + S++G DFL 
Sbjct  175   -GFAADVWSVGCAVIQMVTGRAPWA-NLSDPLAAIYRIGSGDDLPEIPRNMSEQGKDFLR  232

Query  1085  KCLERDPRKRWKAEELLHHPFVNpese--efaasspasVLDRSIFPetdysdesdeedet  1258
             +CL RDP +RW   ELL HPFV  +    +  + +P S+L++ I+     +    E  E+
Sbjct  233   RCLIRDPEERWSVNELLKHPFVQEQKSNPKQNSRTPTSILEQGIWD----TVNDPETVES  288

Query  1259  PLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRT  1405
             P+R  + +    R    + +  N           G +W   E+WITVR+
Sbjct  289   PIRPKIHRTPLQRIQQLNEVSTN-----------GPNWECDEDWITVRS  326



>ref|XP_002321133.2| kinase family protein [Populus trichocarpa]
 gb|EEE99448.2| kinase family protein [Populus trichocarpa]
Length=348

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 173/266 (65%), Gaps = 20/266 (8%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVV  550
             ++W +G T+G GS  +V +A +  +G +F VKS E S SG  FL+ E +IL S+ SP +V
Sbjct  1     MDWTRGHTIGRGSTATVSVATSIQSGDVFAVKSVELSQSG--FLQREQKILSSIISPFIV  58

Query  551   KCIGKEMCGGKK---LNLFIEYMAGGSLADVTQQF-GGKLDEMVIRLYTREILLGLKYLH  718
                G ++         NLF+EYM  GSL++      GG+LDE +IR++T +IL GL YLH
Sbjct  59    SYKGCDVTRKNNKVMYNLFLEYMPNGSLSNAIHAHDGGRLDESLIRIFTYQILQGLDYLH  118

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--  892
              NG+VH D+K  N+L++ SG  K+ADFGC+KRV++   PI     AG+P++MAPE  R  
Sbjct  119   LNGLVHCDIKSSNILVAQSG-AKIADFGCAKRVEQQ-GPI-----AGTPMFMAPEVARGE  171

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              QG    ASDIW+LGCTIIEMA+G  PW   +S+PVS + R   S   P FP   S++  
Sbjct  172   EQG---FASDIWALGCTIIEMASGGTPWH-NVSDPVSIIYRAGYSGHLPEFPCCLSEQAR  227

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL+KCL RDP++RW A +LL HPF+
Sbjct  228   DFLDKCLRRDPKERWTASQLLEHPFL  253



>ref|XP_006389580.1| hypothetical protein POPTR_0021s00300g, partial [Populus trichocarpa]
 gb|ERP48494.1| hypothetical protein POPTR_0021s00300g, partial [Populus trichocarpa]
Length=364

 Score =   226 bits (575),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 172/268 (64%), Gaps = 14/268 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T+G GS  +V +A    +G +F VKSAE     + L+ E  IL +L  P +V 
Sbjct  1     MDWTRGQTIGHGSSATVSMAKANRSGQVFAVKSAELLKS-ESLQREQSILSTLKCPQIVV  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    G    NLF+EY++GG+L D  ++ GG LDE +IRLY R ILLGL+YLH N
Sbjct  60    YKGCDITNENGKLFYNLFLEYISGGTLIDAIREGGGCLDEAMIRLYARTILLGLEYLHCN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPL---AGVAGSPLWMAPETLR-  892
             GIVH D+K  N+L++  G  K+AD GC+KRV +      L   A +AG+PL+MAPE  R 
Sbjct  120   GIVHCDIKGHNILVTGDG-AKIADLGCAKRVDEVSGGTALKTTAPIAGTPLYMAPEVARG  178

Query  893   -NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
              +QG     +DIWS+GCT++EMATG  PW   +S+PVSA+ +I  S + P  PS  S++ 
Sbjct  179   EHQG---FPADIWSVGCTVVEMATGQAPWV-NVSDPVSALYQIGFSGNVPEIPSFMSKQA  234

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              DFL KCL+RDP +RW A ELL H F+ 
Sbjct  235   KDFLSKCLKRDPGERWSASELLKHDFIT  262



>ref|XP_002524836.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus 
communis]
 gb|EEF37556.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus 
communis]
Length=436

 Score =   228 bits (580),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 167/262 (64%), Gaps = 13/262 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W++G +VG GS  +V LA +  +  +F VKSAE  S  +FL+ E +IL S+ SPH+V   
Sbjct  4     WIRGNSVGHGSTATVSLATSFHSAEIFAVKSAEL-SLSEFLQREQKILSSVASPHIVSYR  62

Query  560   GKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGI  730
             G ++         NLF+EYM+GGSL D  Q  GG+L E +I  YT +I+ GL YLH NG+
Sbjct  63    GCDITRENNKVMYNLFLEYMSGGSLVDTIQAHGGRLGESMIGYYTCQIVQGLDYLHSNGL  122

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQGG  904
             VH D+K  N+L+  +G  K+ADFGC+KRV    +     G  G+P++MAPE  R   QG 
Sbjct  123   VHCDIKSSNILIGDAG-AKIADFGCAKRVVATVDVAETIG--GTPMFMAPEVARGAEQG-  178

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                ASDIW+LGCTIIEMATG  PW    ++PVS + RI   +  P FP   S++  DFLE
Sbjct  179   --FASDIWALGCTIIEMATGCAPWPNA-NDPVSVMYRIGFMDQLPEFPCCLSEQAKDFLE  235

Query  1085  KCLERDPRKRWKAEELLHHPFV  1150
             KCL RDP++RW A +LL HPF+
Sbjct  236   KCLRRDPKQRWTANQLLKHPFL  257



>ref|XP_004244346.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Solanum lycopersicum]
Length=437

 Score =   228 bits (580),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 176/259 (68%), Gaps = 12/259 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW++G  +G GS  +V LA + ++G +F VKS E       L+ E  ++  L+SP +VK
Sbjct  1     MEWIRGPIIGRGSSATVSLATD-SSGVVFAVKSTEQSC----LQREYSLVSQLNSPFLVK  55

Query  554   CIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIV  733
             C G E    +  N+F+EY+ GG+L+D+ ++ GG L+E +I+LY ++IL GL YLH  GIV
Sbjct  56    CFGFEQ-NEQVYNMFMEYVQGGTLSDLIKRQGGSLNECMIKLYAQQILQGLDYLHSIGIV  114

Query  734   HSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLDC  913
             H D+K +N+L+  +G+VK+AD GC+K +K   N    +G +G+P +MAPE  R++     
Sbjct  115   HCDVKGQNILICENGNVKIADLGCAKLMKDGKN----SGFSGTPAFMAPEVARSEEQ-GF  169

Query  914   ASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCL  1093
             A+DIW+ GCTIIEMATG +PW  +I++PVSA+ RI  S D P FP++ S++  +FL KCL
Sbjct  170   AADIWAFGCTIIEMATGLVPWC-EINDPVSALYRIGYSGDMPQFPNNMSKDATEFLGKCL  228

Query  1094  ERDPRKRWKAEELLHHPFV  1150
              + P +RW A++LL HPF+
Sbjct  229   MKCPNQRWTAKQLLQHPFL  247



>ref|XP_008782219.1| PREDICTED: serine/threonine-protein kinase 4-like [Phoenix dactylifera]
Length=551

 Score =   230 bits (587),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 174/268 (65%), Gaps = 15/268 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVV  550
             VEW +G+T+G GS  +V LA   A+G +F VKSAE + +GL  L+ E  IL +L+SPHVV
Sbjct  4     VEWCRGRTIGRGSSATVSLATVPASGEVFAVKSAEIARAGL--LQREQRILSNLNSPHVV  61

Query  551   KCIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               +G ++   K     NLF EY A GSL+D  ++ GG LDE  IR Y+  IL GL YLH 
Sbjct  62    SYLGCDVTSEKNGVYYNLFTEYAARGSLSDEIKKQGGCLDEPTIRSYSYHILRGLAYLHS  121

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAG---VAGSPLWMAPETLR  892
             + I H D+K +NVL+ S G   +AD GC++RV    +         + G+P++MAPE  R
Sbjct  122   SRIAHCDVKGQNVLIGSDGRAIIADLGCARRVAGDEDDYDDDDGLQLRGTPMFMAPEVAR  181

Query  893   --NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQE  1066
                QG     +DIW+LGCTI+EMATG+ PW  ++S+P++A+ RIA S D P  PS  S E
Sbjct  182   GEEQG---IPADIWALGCTIVEMATGHAPWP-EVSDPIAALHRIAFSSDVPELPSWISDE  237

Query  1067  GLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             G DF +KCL RDP++RW AE+LL+HPFV
Sbjct  238   GKDFSDKCLRRDPKERWTAEQLLNHPFV  265



>ref|XP_008455899.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Cucumis melo]
Length=434

 Score =   227 bits (578),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 170/269 (63%), Gaps = 19/269 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G  +G GS  +V LA +  +G +F VK+A+  S  Q L  E   L SL SP++V 
Sbjct  1     MDWTRGHVIGHGSSATVFLATDSPSGDVFAVKTAQL-SQSQSLRKEQHFLSSLASPYIVS  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGG-KLDEMVIRLYTREILLGLKYLH  718
               G    +E  G    NLF+EY+  GSLAD  ++ GG +LDE  I +YTR++L+GL+Y+H
Sbjct  60    YRGFEVRREQSGVMMFNLFMEYLPNGSLADTIRRRGGQRLDEATIAIYTRQLLMGLQYIH  119

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--  892
               G+VH D+K RN+L+   G+ KLADFGC+K      +PI      G+PL+MAPE  R  
Sbjct  120   SKGVVHCDIKARNILIGLDGEAKLADFGCAKWATSQTDPI-----GGTPLFMAPEVARGE  174

Query  893   NQGGLDCASDIWSLGCTIIEMAT-GNLPWAGKI--SNPVSAVLRIACSEDRPNFPSHFSQ  1063
             +QG     SDIWS+GCTIIEM T G  PW      ++P+SA+ RI  S + P  P + S+
Sbjct  175   HQG---FPSDIWSIGCTIIEMGTGGGSPWPKTTDDTDPISALYRIGYSGESPEIPCYLSE  231

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             E  DFLEKCL+R+P +RW A EL++HPF+
Sbjct  232   EAKDFLEKCLKRNPSERWTANELMNHPFL  260



>ref|XP_010099184.1| Mitogen-activated protein kinase kinase kinase 2 [Morus notabilis]
 gb|EXB77056.1| Mitogen-activated protein kinase kinase kinase 2 [Morus notabilis]
Length=443

 Score =   227 bits (579),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 175/266 (66%), Gaps = 21/266 (8%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVV-  550
             ++W +G+T+G GS  +V +A  + +G +F VKS +  S  + L+ E +IL SL+ PH++ 
Sbjct  1     MDWTRGRTIGRGSSAAVSVATARGSGEIFAVKSIQL-SRSETLQREQKILSSLNCPHIIG  59

Query  551   -KCIGKEMCGGKKL-NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +  G     G+ L NLF+E+  GGSL+D  ++ GG L++ VIR  T+EILLGL+YLH  
Sbjct  60    YRGFGVSSENGELLYNLFMEFAPGGSLSDQIRRSGGSLNDAVIRSCTKEILLGLEYLHSV  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAG---VAGSPLWMAPETLRN  895
             GI H D+K RNVL++  G +K+AD GC+K          LAG   + G+P++MAPE  R 
Sbjct  120   GIAHCDVKARNVLVTGEG-LKIADLGCAK----------LAGDVAIGGTPVYMAPEVARG  168

Query  896   -QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              Q G   A+D+W+LGCT+IEMATG  PWAG   NPVSA+ +I  S D P  PS  S++G 
Sbjct  169   EQQGF--AADVWALGCTVIEMATGRAPWAGCDVNPVSALFKIGFSGDGPEIPSFVSKQGR  226

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KCL+RDP +RW A ELL HPF+
Sbjct  227   DFLGKCLKRDPSERWSASELLKHPFL  252



>ref|XP_010556997.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Tarenaya hassleriana]
Length=354

 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 164/266 (62%), Gaps = 14/266 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVV  550
             +EW +G+T+G GS  +V+ A    +G +  VKSAE S SG  FL+ EA+IL SL+SP+VV
Sbjct  1     MEWTRGRTLGRGSSATVYAATCHNSGEIIAVKSAELSRSG--FLQREAKILSSLNSPYVV  58

Query  551   KCIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
                G    K        NL +EY   G++ADV  + G  L E +   YTR+I+ GL+YLH
Sbjct  59    GYRGCHITKMRSDSAVYNLLMEYAPSGTVADVAAKNGSGLGETMFAKYTRQIIRGLEYLH  118

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--  892
               GIVH D+K  NVL+  SGD  +ADFGC+KRV   P P     + G+P +MAPE  R  
Sbjct  119   SKGIVHCDIKGSNVLIGESGDAMIADFGCAKRVD--PEPDSAEPIRGTPAFMAPEAARGE  176

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              QG     SDIW++GCT+IEMATG+ PW  +  +P S + R+  S + P  P   +++  
Sbjct  177   KQGK---ESDIWAVGCTVIEMATGSPPWTAEAGDPFSVIYRVGYSGESPEIPCFLTEQAK  233

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL +CLER P +RW A +LL+HPFV
Sbjct  234   DFLRRCLERKPEERWTASQLLNHPFV  259



>ref|XP_007026132.1| Mitogen-activated protein kinase kinase kinase 15, putative [Theobroma 
cacao]
 gb|EOY28754.1| Mitogen-activated protein kinase kinase kinase 15, putative [Theobroma 
cacao]
Length=482

 Score =   228 bits (580),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 165/263 (63%), Gaps = 11/263 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+T+G GS  +V +A    +G +F VKS E  S  + L  E  IL +L  P V+ 
Sbjct  1     MEWTRGRTIGRGSTATVSIATADQSGDVFAVKSCEL-SQSESLRREQRILSTLSCPRVLA  59

Query  554   CIGKEMCGGKKL---NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             C G ++     +   NL +EY  GG++ D  Q+ GG+LDE ++R YTR IL GL++LH +
Sbjct  60    CKGCDISSENGMLVYNLLLEYAPGGTITDAIQKQGGRLDEAMVRSYTRGILQGLEFLHSS  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQG  901
             GIVH D+K RNVL++  G VK+AD GC++R    P       VAG+P++MAPE  R  Q 
Sbjct  120   GIVHCDIKGRNVLVTDDG-VKIADLGCARRADVVPGAA--WSVAGTPVYMAPEVARGEQQ  176

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
             G    +D+W+LGCT+IEMATG  PW   + +PVSA+ RI  S D P  PS  S++  DFL
Sbjct  177   GF--PADVWALGCTVIEMATGRAPWP-DVGDPVSALYRIGFSRDMPEIPSDLSKQAKDFL  233

Query  1082  EKCLERDPRKRWKAEELLHHPFV  1150
              KCL RDP +RW A +LL H FV
Sbjct  234   SKCLRRDPVERWTATQLLAHDFV  256



>ref|XP_008349313.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=420

 Score =   225 bits (574),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 170/264 (64%), Gaps = 13/264 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T G GS  +V +A +  +G +F VKSAE  S  QFL+ E  IL +L SP+ V+
Sbjct  1     MDWTRGRTXGLGSSATVSIAKSHRSGEVFAVKSAEL-SQSQFLQKEQTILSTLSSPYXVQ  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G  +    G    NLF+EY  GG ++D  ++ GG L+E   R Y R+ILL L++LH N
Sbjct  60    YKGXNISNENGAVLYNLFLEYAPGGXVSDAIRRQGGCLNEAATRCYARQILLXLQHLHSN  119

Query  725   GIVHSDLKCRNVLLSSSG-DVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQ  898
              I H D+KC+N+L++ +G  VKLAD GC++RV    N    + + G+PL+MAPE  R  +
Sbjct  120   QIAHCDVKCQNILVAENGAKVKLADLGCARRV----NSDRGSPIGGTPLYMAPEVARXEE  175

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
              G+  A+D+W+LGCTIIEMATG  PW   + +PVSA+ RI  S D P  PS  S++G DF
Sbjct  176   QGI--AADVWALGCTIIEMATGRAPWP-DVCDPVSALYRIGFSGDAPGIPSSLSKQGRDF  232

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             + KCL RDP +RW A ELL H F+
Sbjct  233   VAKCLIRDPLERWSAVELLEHGFL  256



>ref|XP_002269660.1| PREDICTED: mitogen-activated protein kinase kinase kinase A [Vitis 
vinifera]
 emb|CBI28820.3| unnamed protein product [Vitis vinifera]
Length=420

 Score =   225 bits (574),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 206/357 (58%), Gaps = 37/357 (10%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+GSGS  +V LA +  +G +F VKS E  S  + L+ E  IL SL SP++V 
Sbjct  1     MDWTRGHTLGSGSSATVSLANSLRSGDVFAVKSVEL-SRSESLQREERILSSLRSPYIVG  59

Query  554   CIGKEMC-GGKKL--NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    KKL  NLFIEYM GG+L D  ++ GG+L E +I +Y R+I+ GL Y+H  
Sbjct  60    YKGCDITRENKKLMYNLFIEYMPGGTLGDAIRRGGGQLHESMIGIYARQIVQGLDYIHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVK-KHPNPIPLAGVAGSPLWMAPETLR--N  895
             G+VH D+K +NVL+   G  K+ADFGC+K    K    +P   +AG+P +MAPE  R  +
Sbjct  120   GLVHCDIKGQNVLIGEDG-AKIADFGCAKWTNGKDDRKVP---IAGTPFFMAPEVARGED  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG     SD+W+LGCTIIEMATG  PW   ++N V+A+ RI  SE+ P  PS  S +  D
Sbjct  176   QG---YPSDVWALGCTIIEMATGGAPWP-NVANAVAALYRIGFSEELPWIPSFLSDQAKD  231

Query  1076  FLEKCLERDPRKRWKAEELLHHPFVN------peseefaasspasVLDRSIFPetdysde  1237
             FL KCL RDP++RW A +LL HPFV        + +E  + SP S+LD++ +   + S+ 
Sbjct  232   FLSKCLRRDPKERWTASQLLKHPFVGELNPQAKQVQESYSDSPTSILDQNFWSSLEESEA  291

Query  1238  sdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRTS  1408
                  +    S  P     + + FS +               E+W+  + W+T+R S
Sbjct  292   QGYLKQASF-SNSPAERIRKLWTFSRV---------------ENWTRDDNWVTIRGS  332



>ref|XP_011095801.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Sesamum 
indicum]
Length=441

 Score =   226 bits (575),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 167/263 (63%), Gaps = 13/263 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G T+G GS   V LA   A G +F VKSA   S    L++E  ++  L SP VVK
Sbjct  1     MEWRRGPTIGRGSSAVVSLA-TTAAGCVFAVKSASFSSSC-LLQNEQCLMSQLSSPFVVK  58

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             C G ++      +  NLF+EY+AGG+L+D+ +  GG LDE VIR YT ++L GL YLH  
Sbjct  59    CFGSDVSWEDNKRVYNLFLEYVAGGTLSDLIRSQGGCLDENVIRFYTHQMLQGLNYLHLK  118

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             G+VH D+K +NVL+   G +K+ADFGC+K          +   AG+P +MAPE  R +  
Sbjct  119   GVVHCDVKGQNVLIGDDG-LKIADFGCAKWSGS-----AVPAFAGTPAYMAPEVARGEEQ  172

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                A+D+W++GCT+IEMATG+ PW  ++ +P SA+ R+A S D P FP  FS    DFL 
Sbjct  173   -SFAADVWAMGCTVIEMATGSNPWP-EMKDPASALYRVAYSGDVPEFPIWFSDCAKDFLS  230

Query  1085  KCLERDPRKRWKAEELLHHPFVN  1153
             KCL RDP++RW A ELL HPF+N
Sbjct  231   KCLMRDPKERWTAAELLQHPFLN  253



>ref|XP_009403738.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Musa acuminata subsp. malaccensis]
Length=455

 Score =   226 bits (575),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 168/262 (64%), Gaps = 9/262 (3%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G+ +G G+  +V LA + ++G +F VKS+E  S    L+ E  IL +LDSP VV   
Sbjct  6     WRRGRIIGRGTSATVSLATSVSSGDVFAVKSSEL-SRSWLLQREQRILSALDSPFVVSYF  64

Query  560   GKEMCG-----GKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             G ++       G   NLF+EY A GSL+D  ++ GG+LDE+ IR Y  +IL GL YLH N
Sbjct  65    GFDVAAQTPGAGLCYNLFMEYAARGSLSDEIRKQGGRLDELAIRSYACDILGGLAYLHSN  124

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             G+ H DLK +NVL+ S G  K+ADFGC++  ++  +      + G+P++MAPE  R +  
Sbjct  125   GVFHCDLKSQNVLICSGGRAKVADFGCARSAEEE-DEDERGWMRGTPMFMAPEVARGEEQ  183

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                 +DIW+LGCT+IEMATG  PW   +S+ +SA+ +IA + D P FP   S+EG DFL 
Sbjct  184   -SAPADIWALGCTVIEMATGRPPWP-LVSDALSALHQIAFATDVPEFPRWISEEGRDFLS  241

Query  1085  KCLERDPRKRWKAEELLHHPFV  1150
             +CL RDP +RW AE+LL HPFV
Sbjct  242   RCLRRDPLERWTAEQLLQHPFV  263



>ref|XP_008384252.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=441

 Score =   225 bits (573),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 169/265 (64%), Gaps = 15/265 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T G GS  +V +A +  +G +F VKSAE  S  QFL+ E  IL +L SP+ V+
Sbjct  1     MDWTRGRTXGLGSSATVSIAKSHRSGEVFAVKSAEL-SQSQFLQKEQTILSTLSSPYXVQ  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G  +    G    NLF+EY  GG ++D  ++ GG L+E   R Y R+ILL L++LH N
Sbjct  60    YKGXNISNENGAVLYNLFLEYAPGGXVSDAIRRQGGCLNEAATRCYARQILLXLQHLHSN  119

Query  725   GIVHSDLKCRNVLLSSSG-DVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              I H D+KC+N+L++ +G  VKLAD GC++RV    N    + + G+PL+MAPE  R   
Sbjct  120   QIAHCDVKCQNILVAENGAKVKLADLGCARRV----NSDRGSPIGGTPLYMAPEVARGEE  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG    A+D+W+LGCTIIEMATG  PW   + +PVSA+ RI  S D P  PS  S++G D
Sbjct  176   QG---IAADVWALGCTIIEMATGRAPWP-DVCDPVSALYRIGFSGDAPGIPSSLSKQGRD  231

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             F+ KCL RDP +RW A ELL H F+
Sbjct  232   FVAKCLIRDPLERWSAVELLEHGFL  256



>ref|XP_011006457.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Populus euphratica]
Length=408

 Score =   224 bits (570),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 118/264 (45%), Positives = 169/264 (64%), Gaps = 17/264 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G ++G GS  +V LA +  +G +F VKS E     +FL+ E +IL SL SP +V 
Sbjct  1     MDWTRGHSIGHGSTATVSLATSIQSGDIFAVKSVELCQS-EFLQREQQILSSLTSPFIVS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NLF+EYM  G+L++     GG+LDE +IR YT ++L GL Y+H N
Sbjct  60    YRGCDITRENSKVMYNLFLEYMPNGTLSNAIHAHGGRLDESLIRNYTSQVLQGLDYIHLN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             G+VH D+K  N+L+  SG  K+ADFGC+KRV +      +  +AG+P++MAPE  R   Q
Sbjct  120   GLVHCDIKSSNILVGPSG-AKIADFGCAKRVDQ------VGQIAGTPMFMAPEVARGEEQ  172

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G    ASDIW+LGC IIEMA+G+ PW   +++PVS + R+  S   P+FP   S++  D 
Sbjct  173   G---FASDIWALGCAIIEMASGSTPWH-NVNDPVSIIYRVGYSGHLPDFPCCLSEQARDL  228

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L+KCL RDPR+RW A +LL HPF+
Sbjct  229   LDKCLRRDPRERWTASQLLKHPFL  252



>ref|XP_001772494.1| predicted protein [Physcomitrella patens]
 ref|XP_001772510.1| predicted protein [Physcomitrella patens]
 gb|EDQ62670.1| predicted protein [Physcomitrella patens]
 gb|EDQ62686.1| predicted protein [Physcomitrella patens]
Length=277

 Score =   220 bits (560),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 172/277 (62%), Gaps = 14/277 (5%)
 Frame = +2

Query  350   SKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQF  499
             S+    R + W KG+ +G+G++G V++ +N  +G L  VK             + S ++ 
Sbjct  5     SRLGSPRAIRWRKGELIGAGAYGRVYMGLNLDSGELIAVKQVCIAQNNVTKDRAQSHIRE  64

Query  500   LESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRL  679
             LE E ++L++L  P++V+ +G      + LN+F+E++ GGS+A +  +FG    E VIR+
Sbjct  65    LEEEVKLLQNLSHPNIVRYLGTAR-EEEALNIFLEFVPGGSIASLLGKFGS-FTETVIRM  122

Query  680   YTREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAG  859
             YTR++LLGL+YLH N I+H D+K  N+L+ + G +KLADFG SK+V +         + G
Sbjct  123   YTRQLLLGLEYLHSNHIMHRDIKGANILVDNKGCIKLADFGASKKVVELATISEAKSMKG  182

Query  860   SPLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRP  1039
             +P WMAPE +R Q G +  +D+WS+GCT+IEMATG  PW+ +    V+A+  I  ++  P
Sbjct  183   TPYWMAPEVIR-QTGHNWQADMWSVGCTVIEMATGKPPWSQQFQE-VAALFHIGTTKSHP  240

Query  1040  NFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
               P H S +G DFL K L+R+PR R  A E+L HPFV
Sbjct  241   PIPEHLSADGKDFLLKLLQREPRLRPSAAEMLKHPFV  277



>ref|XP_009403739.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   225 bits (573),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 167/262 (64%), Gaps = 9/262 (3%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G+ +G G+  +V LA +  +G +F VKS+E  S    L+ E  IL +LDSP VV   
Sbjct  6     WRRGRIIGRGTSATVSLATSVPSGEVFAVKSSEL-SRSWLLQREQRILSALDSPFVVSYF  64

Query  560   GKEMCG-----GKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             G ++       G   NLF+EY   GSL+D  ++ GG+LDE+ IR Y  +IL GL YLH N
Sbjct  65    GFDVAAQTPGAGLCYNLFMEYAPRGSLSDEIRKQGGRLDELAIRSYACDILGGLAYLHSN  124

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             G+VH DLK +NVL+ S G  K+ADFGC++  ++  +      + G+P++MAPE  R +  
Sbjct  125   GVVHCDLKSQNVLICSGGRAKVADFGCARSAEEE-DEDERGWMRGTPMFMAPEVARGEEQ  183

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                 +DIW+LGCT+IEMATG  PW   +S+ +SA+ +IA S D P FP   S+EG DFL 
Sbjct  184   -SAPADIWALGCTVIEMATGRPPWP-LVSDALSALHQIAFSTDVPEFPRWISEEGRDFLS  241

Query  1085  KCLERDPRKRWKAEELLHHPFV  1150
             +CL RDP +RW AE+LL HPFV
Sbjct  242   RCLRRDPLERWTAEQLLQHPFV  263



>ref|XP_011097967.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Sesamum indicum]
Length=477

 Score =   225 bits (574),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 168/263 (64%), Gaps = 10/263 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G  +G GS   V +A   A+G +F VKS +  S    L+ E  ++  L SP+VVK
Sbjct  1     MEWTRGPMIGRGSSAVVFIATT-ASGDVFAVKSTDLSSS-TLLQREERLVSQLCSPYVVK  58

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             C G E+   +     NLF+EY+ GG+L+D   + GG L E VIR Y RE+LLGL YLH  
Sbjct  59    CFGSEITWEENKHVYNLFLEYVPGGTLSDQIGKQGGSLGESVIRFYAREMLLGLSYLHLM  118

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             G+VH D+K +NVL+ S G +K+ADFGC+K  +   +  P+   +G+P +MAPE  R +  
Sbjct  119   GLVHCDIKGQNVLIGSDG-LKIADFGCAKWGESDGSGKPV--FSGTPAYMAPEVARGEEQ  175

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                 +DIW+LGCTIIEMATG+ PW  ++ +P SA+ RIA S D P FPS FS    D L 
Sbjct  176   -SFPADIWALGCTIIEMATGSNPWQ-EMKDPASALYRIAFSGDVPEFPSWFSDNAKDLLA  233

Query  1085  KCLERDPRKRWKAEELLHHPFVN  1153
             KCL+RDP++RW A ELL HPF +
Sbjct  234   KCLKRDPKERWTATELLQHPFFS  256



>ref|XP_002302871.2| hypothetical protein POPTR_0002s21350g [Populus trichocarpa]
 gb|EEE82144.2| hypothetical protein POPTR_0002s21350g [Populus trichocarpa]
Length=409

 Score =   223 bits (569),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 171/265 (65%), Gaps = 19/265 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVV  550
             ++W +G ++G GS  +V LA +  +G +F VKS E   SG  FL+ E +IL SL SP +V
Sbjct  1     MDWTRGHSIGHGSTATVSLATSIQSGDVFAVKSVELFQSG--FLQREQQILSSLTSPFIV  58

Query  551   KCIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
                G ++         NLF+EYM  G+L++     GG+LDE +IR YT ++L GL Y+H 
Sbjct  59    SYRGCDITRENSKVMYNLFLEYMPNGTLSNAIHAHGGRLDEPLIRNYTSQVLQGLDYIHL  118

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
             NG+VH D+K  N+L+  SG  K+ADFGC+KRV++      +  +AG+P++MAPE  R   
Sbjct  119   NGLVHCDIKSSNILVGPSG-AKIADFGCAKRVEQ------VGQIAGTPMFMAPEVARGEE  171

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG    ASDIW+LGC IIEMA+G+ PW   +++PVS + R+  S   P+FP   S++  D
Sbjct  172   QG---FASDIWALGCAIIEMASGSTPWH-NVNDPVSIIYRVGYSGHLPDFPCCLSEQARD  227

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
              L+KCL RDPR+RW A +LL HPF+
Sbjct  228   LLDKCLRRDPRERWTASQLLKHPFL  252



>ref|XP_008371167.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Malus domestica]
Length=476

 Score =   224 bits (572),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 169/264 (64%), Gaps = 13/264 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T+G GS  +V +A +  +G +F VKSA+     QFL+ E  IL +L SPH+V 
Sbjct  1     MDWTRGRTIGLGSSATVSIAKSHVSGEVFAVKSAKLAQS-QFLQKEXAILSTLSSPHIVH  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G  +    G    NLF+EY  GG+++D  ++ GG L E  I  Y ++IL GL++LH N
Sbjct  60    YKGHNISTENGDVLYNLFLEYAPGGTISDAIRRQGGCLXEAAIXCYAKQILXGLQHLHSN  119

Query  725   GIVHSDLKCRNVLLSSSG-DVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQ  898
              I H D+KCRN+L++ +G +VKLAD GC++ V    +    + + G+PL+MAPE  R  +
Sbjct  120   QIAHCDVKCRNILVAENGANVKLADLGCARLVNXDCD----SPIGGTPLYMAPEVARGEE  175

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
              G+  A+D+W+LGCTIIEMATG  PW   + +PVSA+ RI  S D P  PS  SQ+G DF
Sbjct  176   QGI--AADVWALGCTIIEMATGRAPW-NDVCDPVSALYRIGFSGDAPEIPSSLSQQGRDF  232

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             + KCL  DP +RW A ELL H FV
Sbjct  233   VAKCLIGDPLERWSAGELLEHGFV  256



>ref|XP_003521050.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Glycine max]
Length=348

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 171/267 (64%), Gaps = 11/267 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQ---FLESEAEILESLD-SP  541
             + WV+G+++GSGSF +V++A+   T   F+  +A   S +Q    L++E EIL+ L  SP
Sbjct  1     MNWVRGESLGSGSFATVNIAIPTNTSTQFLSSTAVKSSHVQTSSMLKNEKEILDRLGASP  60

Query  542   HVVKCIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKY  712
             +V+ C G +     G +  N+F+EY AGGSLAD  ++ GG+L E  +R  TR ++ GLK+
Sbjct  61    YVINCFGDDHTVENGEEYYNIFLEYAAGGSLADQVKKHGGRLPESYVRRCTRSLVEGLKH  120

Query  713   LHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR  892
             +H+NG VH D+K +N+L+  +GDVK+ADFG +K   + P  +      G+PL+M+PE++ 
Sbjct  121   IHDNGYVHCDVKLQNILVFQNGDVKIADFGLAKEKGEKPGKLE---CRGTPLFMSPESV-  176

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
             N    +  +DIW+LGC ++EM TG   W  + SN  S ++RI   E+ P  P   S+EG 
Sbjct  177   NDNEYESPADIWALGCAVVEMVTGKPAWDVRGSNIWSLLIRIGAGEELPKIPEELSEEGK  236

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFVN  1153
             DFL KC  +DP KRW AE LL+HPFVN
Sbjct  237   DFLLKCFVKDPMKRWSAEMLLNHPFVN  263



>ref|XP_002518446.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43833.1| ATP binding protein, putative [Ricinus communis]
Length=344

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 169/263 (64%), Gaps = 15/263 (6%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G+ +G GS  +V +A  + +G  F VKSAE  S  + L+ E  IL +L  P ++   
Sbjct  4     WTRGQILGQGSQATVSIATVQQSGLAFAVKSAEL-SQSELLQKEQRILSTLSCPQIIAYE  62

Query  560   GKEMC--GGKKL-NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGI  730
             G ++    GK L N+F+EY  GG+L D  ++ GG LDE +IR Y R+ILLGL +LH NGI
Sbjct  63    GYDVTREDGKLLFNIFLEYAPGGTLIDTIRKHGGFLDEGMIRSYARDILLGLHHLHSNGI  122

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQGG  904
             VH D+K  N+L++S G  K+AD GC+++V    N +    +AG+P++MAPE  R  +QG 
Sbjct  123   VHCDIKGHNILVTSDG-AKIADLGCARKV----NQVSKTPIAGTPVYMAPEVARGEHQG-  176

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                 +D+W+LGCTIIEMATG  PW   IS+PVSA+ +I  S   P  PS  S++ +DF+ 
Sbjct  177   --FPADVWALGCTIIEMATGRPPWT-TISDPVSALYQIGYSGMVPEIPSFMSKQAIDFVS  233

Query  1085  KCLERDPRKRWKAEELLHHPFVN  1153
             KCL+RDP +RW A ELL H FV 
Sbjct  234   KCLKRDPVERWSASELLRHAFVT  256



>emb|CAN65217.1| hypothetical protein VITISV_024689 [Vitis vinifera]
Length=420

 Score =   223 bits (567),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 202/356 (57%), Gaps = 35/356 (10%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+GSGS  +V LA +  +G +F VKS E  S  + L+ E  IL SL SP++V 
Sbjct  1     MDWTRGHTLGSGSSATVSLANSLRSGDVFAVKSVEL-SRSESLQREERILSSLRSPYIVG  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    K    NLFIEYM GG+L D  ++ GG+L E +I +Y R+I+ GL Y+H  
Sbjct  60    YKGCDITRENKKLMYNLFIEYMPGGTLGDAIRRGGGQLHESMIGIYARQIVQGLDYIHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             G+VH D+K +NVL+   G  K+ADFGC+K      +      +AG+P +MAPE  R  +Q
Sbjct  120   GLVHCDIKGQNVLIGEDG-AKIADFGCAKWTNGKDD--RKVQIAGTPFFMAPEVARGEDQ  176

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G     SD+W+LGCTIIEMATG  PW   ++N V+A+ RI  SE+ P  PS  S +  DF
Sbjct  177   G---YPSDVWALGCTIIEMATGGAPWP-NVANAVAALYRIGFSEELPWIPSFLSDQAKDF  232

Query  1079  LEKCLERDPRKRWKAEELLHHPFVN------peseefaasspasVLDRSIFPetdysdes  1240
             L KCL RDP++RW A +LL HPFV        + +E  + SP S+LD++ +   + S+  
Sbjct  233   LSKCLRRDPKERWTASQLLKHPFVGELNPQAKQVQESYSDSPTSILDQNFWSSLEESEAQ  292

Query  1241  deedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRTS  1408
                 +    S  P     + + FS +               E+W+  + W+T+R S
Sbjct  293   GYLKQASF-SNSPAERIRKLWTFSRV---------------ENWTRDDNWVTIRGS  332



>ref|XP_010244478.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nelumbo nucifera]
Length=439

 Score =   223 bits (568),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 142/357 (40%), Positives = 207/357 (58%), Gaps = 33/357 (9%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGG--LFVVKSAESDSGLQFLESEAEILESLDSPHV  547
             ++W +G+T+G GS  +V LA    +G   +F VKS E  S  +FL+ E  IL S+    +
Sbjct  1     MDWTRGRTLGRGSSATVSLATAVRSGETEIFAVKSVEL-SRSEFLQREQRILSSIRCSRI  59

Query  548   VKCIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             V   G ++    G    NLF+EY+ GGSL D  Q+ GG+LDE  IRL+ R+IL G+ YLH
Sbjct  60    VGYRGCDITSENGQLLYNLFMEYVPGGSLTDAIQKQGGRLDESAIRLHLRQILGGIHYLH  119

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-N  895
              +G+VH D+K RNVL+   G  K+AD GC++ V +    +    +AG+P++MAPE  R +
Sbjct  120   TSGLVHCDIKGRNVLIGKDG-AKIADLGCARWVDQVSESM---SIAGTPVFMAPEVARGD  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             + G    +D+W++GCT+IEMATG LPW+   S+PVSA+ RIA +ED P  P+  S++  D
Sbjct  176   EQGF--PADVWAIGCTVIEMATGRLPWS-DASDPVSALYRIAFTEDTPELPNCLSEQAKD  232

Query  1076  FLEKCLERDPRKRWKAEELLHHPFVN------peseefaasspasVLDRSIFPetdysde  1237
             FL KCL RDP+ RW   +LL HPFV+       + ++ A+ SP S+LD++ +   +  + 
Sbjct  233   FLSKCLRRDPKDRWTISQLLKHPFVDEPSSGLNQIQDSASKSPTSILDQAFWDSLEEPET  292

Query  1238  sdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRTS  1408
                     L SP  +           LC N    S   PR  + WS    WITVR++
Sbjct  293   PRSLRS--LNSPAER--------IQQLCGNI--SSSSSPRLPD-WSWDNSWITVRSN  336



>gb|EEE56860.1| hypothetical protein OsJ_06484 [Oryza sativa Japonica Group]
Length=393

 Score =   221 bits (564),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 163/264 (62%), Gaps = 9/264 (3%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             EW +G  +G G+  +V +A ++ TGG+F VKS +  +    L  E  +L +L SP VV C
Sbjct  6     EWRRGPVIGRGATATVSIATDRRTGGVFAVKSVDV-ARAGALRREQGMLSALASPFVVPC  64

Query  557   IGK------EMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             +G       +  GG   +LF+EY  GGSLAD  ++ GG+ +E +IR    ++L GL Y+H
Sbjct  65    VGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRCGGRCEEPLIRSRVGDVLRGLAYVH  124

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQ  898
               GI H D+K RNVL+ + G   LADFGC++ +           + G+P+++APE  R +
Sbjct  125   AAGIAHCDVKGRNVLVGADGRAMLADFGCARWMAAEDCNAGGVTIRGTPMFLAPEAARGE  184

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
                  A+DIW+LGCT+IEMATG  PW  + ++PV+A+  +A S D P  P+ FS EG DF
Sbjct  185   -AQGTAADIWALGCTVIEMATGGAPWP-RFADPVAALHHVAHSVDVPESPAWFSAEGKDF  242

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L +CL RDP KRW AE+LL HPFV
Sbjct  243   LARCLIRDPAKRWTAEQLLEHPFV  266



>ref|XP_002529924.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus 
communis]
 gb|EEF32478.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus 
communis]
Length=449

 Score =   223 bits (567),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 172/269 (64%), Gaps = 15/269 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G  +G GS  +V LA +  +G LF +KS E    + FL+ E   L  ++SPH+VK
Sbjct  1     MEWTRGPVIGRGSTATVSLATSVFSGELFALKSTELSKSM-FLQKEQSFLSKINSPHIVK  59

Query  554   CIGKEMCGGKKLNLF---IEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG ++      +L+   +EY+ GG+L DV  + GG+LDE +I  YTR IL GL YLH N
Sbjct  60    YIGYDITNENTQSLYNICLEYVPGGTLHDVILRHGGQLDEPMIGSYTRNILQGLDYLHRN  119

Query  725   -GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKK--HPNPIPLAGVAGSPLWMAPETLR-  892
              G+VH D+K +NVL+S  G  K+ADFGC+K V++         +  +G+P +M+PE  R 
Sbjct  120   IGLVHCDIKSKNVLISKDG-AKIADFGCAKFVEQVARNGGGDASAFSGTPAFMSPEVARG  178

Query  893   -NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISN--PVSAVLRIACSEDRPNFPSHFSQ  1063
               QG     +DIW++GCT+IEMATG++PWA  + N  P+S + RI  S + P FPS  S+
Sbjct  179   EEQG---FPADIWAVGCTVIEMATGSIPWAEIMKNDDPLSVLYRIGFSSEAPEFPSWLSE  235

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             +G DFL KCL RD ++RW A+ELL HPF+
Sbjct  236   KGKDFLSKCLRRDSKERWTAKELLDHPFL  264



>gb|EYU33654.1| hypothetical protein MIMGU_mgv1a021391mg [Erythranthe guttata]
Length=343

 Score =   219 bits (557),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 164/262 (63%), Gaps = 15/262 (6%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G T+G GS  SV LA   A G +F    +   S    L+ E  ++  L SP++VKC+
Sbjct  5     WTRGPTIGRGSSASVSLATT-AGGEVFAAVKSTDLSSSASLQKEGILISQLSSPYIVKCL  63

Query  560   GKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGI  730
             G ++     G   NLF+EY+ GG+L+D  ++ GG LDE  I  +   IL+GL YLH  G+
Sbjct  64    GSDITCEESGHVYNLFLEYLPGGTLSDRIKKQGGSLDETAIGKHAHGILMGLNYLHTKGL  123

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRN--QGG  904
             VH D+K  N+LL  +G VK+ADFGC+KRV         +G +G+P +MAPET R   QG 
Sbjct  124   VHCDIKGENILLGENGSVKIADFGCAKRVGSG-----GSGFSGTPAYMAPETARGEEQG-  177

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                A+D+W+LGCT++EMATG+ PW  ++ +P +A+ R+  S D P  P+ FS +  DFL+
Sbjct  178   --FAADVWALGCTVVEMATGSHPWP-EMKDPAAALYRVGFSGDVPETPAWFSGQARDFLD  234

Query  1085  KCLERDPRKRWKAEELLHHPFV  1150
              CL RDPR+RW A ELL HPF+
Sbjct  235   NCLTRDPRERWTAAELLRHPFM  256



>ref|XP_007212556.1| hypothetical protein PRUPE_ppa015439mg, partial [Prunus persica]
 gb|EMJ13755.1| hypothetical protein PRUPE_ppa015439mg, partial [Prunus persica]
Length=339

 Score =   219 bits (557),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 170/265 (64%), Gaps = 15/265 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G GS  +V +A +  +G +F VKSA+  S    L+ E  IL +L S  +V 
Sbjct  1     MDWTRGPTIGHGSSATVSIAKSHGSGEVFAVKSAKL-SQSHSLQMEQTILSTLSSAQIVS  59

Query  554   ---CIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
                C      G    N+F+EY  GG+L+D  ++ GG L+E  IR YTR+ILLGL +LH N
Sbjct  60    YKGCNTSTENGTVFYNIFLEYAPGGTLSDAIRRQGGCLNEAAIRSYTRQILLGLHHLHSN  119

Query  725   GIVHSDLKCRNVLLSSSG-DVKLADFGCSKRVK-KHPNPIPLAGVAGSPLWMAPETLR-N  895
              I H D+K +NVL++++G +VKLAD GC+KRV   H  PI      G+P++MAPE  R  
Sbjct  120   QIAHCDIKGQNVLVTNNGAEVKLADLGCAKRVNFAHGLPI-----GGTPVYMAPEVARGE  174

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             Q GL  A+D+W+LGCT+IEMATG  PW   +S+PVSA+ RI  S + P  PS  S++G D
Sbjct  175   QQGL--AADVWALGCTVIEMATGRAPWPC-VSDPVSAMYRIGFSGEVPEIPSSLSKQGRD  231

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             F+ KCL RDP +RW A ELL H F+
Sbjct  232   FVTKCLMRDPMERWSAGELLKHEFL  256



>ref|XP_011046960.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Populus euphratica]
Length=472

 Score =   222 bits (566),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 174/266 (65%), Gaps = 13/266 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+ +G GS  +V +A    +G +F VKSAE  S  + L+ E  +L +L  P +V 
Sbjct  1     MDWTRGQIIGRGSSATVSMARANLSGQVFAVKSAEL-SKSESLQKEQIVLSTLRCPQIVA  59

Query  554   CIGKEMCG--GKKL-NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    GK L NLF+EY +GG+L DV ++ GG LDE +IR Y R ILLGL+YLH N
Sbjct  60    YKGCDITNENGKVLYNLFLEYASGGTLIDVIREGGGCLDEDMIRSYARTILLGLEYLHCN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKK--HPNPIPLAGVAGSPLWMAPETLR--  892
             GIVH D+K  N+L++S G  K+AD GC+KRV +    +    A ++G+PL+MAPE  R  
Sbjct  120   GIVHCDIKGHNILVTSDG-AKIADLGCAKRVDEVSEADWGTTATISGTPLYMAPEAARAE  178

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
             +QG     +DIW++GCT++EMATG  PW   +S+PVSA+ +I  S + P  PS  S++  
Sbjct  179   HQG---FPADIWAVGCTMVEMATGQAPWL-NVSDPVSALYQIGFSGNAPEIPSFMSKQAR  234

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KCL+RDP +RW A ELL H F+
Sbjct  235   DFLSKCLKRDPMERWSASELLKHDFI  260



>ref|XP_007020769.1| Mitogen-activated protein kinase kinase kinase 18, putative [Theobroma 
cacao]
 gb|EOY12294.1| Mitogen-activated protein kinase kinase kinase 18, putative [Theobroma 
cacao]
Length=455

 Score =   222 bits (565),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 137/362 (38%), Positives = 201/362 (56%), Gaps = 37/362 (10%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW++G  +G G+  +V LA    +G +F VKS+E    +  L+ E+ +L  L  P +VK
Sbjct  1     MEWIRGPAIGRGATATVSLATAVPSGEVFAVKSSELCHSM-LLQRESYLLSKLSCPRIVK  59

Query  554   CIGKEMCGGKK--------LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLK  709
              IG   CG +          NL +EY+AGG+L +  Q+ GG+L E  +RLYTR+IL GL 
Sbjct  60    YIG---CGVRNETSSNKPTYNLCMEYVAGGTLFEEIQRVGGRLGEEKVRLYTRQILQGLD  116

Query  710   YLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKK--HPNPIPLAGVAGSPLWMAPE  883
             YLH NG+VH D+K +N+L+   G  K+AD GC+K + K    +    +  +G+P +MAPE
Sbjct  117   YLHGNGVVHCDIKSQNILIGEEG-AKIADLGCAKLMGKVGGDDRFDTSAFSGTPAFMAPE  175

Query  884   TLR--NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHF  1057
               R   QG     +DIW+LGCTIIEM TGN PW  ++++PVSA+ +I  SED P  P  F
Sbjct  176   VARGKEQG---YGADIWALGCTIIEMGTGNSPWP-ELNDPVSALYKIGFSEDVPEIPKWF  231

Query  1058  SQEGLDFLEKCLERDPRKRWKAEELLHHPFVNpese------efaasspasVLDRSIFPe  1219
              ++G DF+ KCL RD R+RW A+ELL HPFV           +    SP+SVLD++ +  
Sbjct  232   CEKGKDFVSKCLRRDARERWTAKELLQHPFVEELDTHLKEVKDSTMDSPSSVLDQAFWDS  291

Query  1220  tdysdesdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITV  1399
              D  +         + S  P     +    ++                 +W+ +E+WITV
Sbjct  292   LDVVESPKNLIPEGISSSSPANRIKKLLQATL----------SPASNASNWTWNEDWITV  341

Query  1400  RT  1405
             R+
Sbjct  342   RS  343



>ref|XP_010644538.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Vitis 
vinifera]
Length=437

 Score =   221 bits (563),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 170/264 (64%), Gaps = 14/264 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G G+  ++ LA+   +G LF VKS E  S  + L+ E   L  L S  +VK
Sbjct  1     MDWTRGPTIGRGASATISLAIVSTSGELFAVKSTEL-SRSKLLQREQSFLSQLSSERIVK  59

Query  554   CIGKEM-CGGKKL--NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G    C G  +  N+F+EY+ GG+L+D  ++ G +LDE  IRLYTR+I+LGL+YL  N
Sbjct  60    YLGSNTTCEGDTMLYNVFMEYVPGGALSDEIRRRGNRLDEDWIRLYTRQIVLGLEYLQFN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             G+VH D+K  NVL+   G V +AD GC+K V  +      +  +G+P++MAPE  R   Q
Sbjct  120   GLVHCDIKSENVLIREDGAV-IADLGCAKSVHGNGGG---SVFSGTPVFMAPEVARGEEQ  175

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G     +D+W+LGCT+IEMATG  PW  ++ +PVSA+ RI  S D P FP   S+ G DF
Sbjct  176   G---FPADVWALGCTVIEMATGRNPWP-EVDDPVSALYRIGFSGDVPEFPMWLSENGRDF  231

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L+KCL R+PR+RW A+ELL HPF+
Sbjct  232   LDKCLRRNPRERWTAKELLEHPFL  255



>ref|XP_009421493.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Musa acuminata subsp. malaccensis]
Length=432

 Score =   221 bits (563),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 160/263 (61%), Gaps = 9/263 (3%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G+ +G GS  +V LA +  +G +F VKS E  S    L+ E  IL SL SP+VV C 
Sbjct  6     WRRGRVIGRGSSATVLLATDLDSGEVFAVKSVEL-SRSAVLQREQRILSSLGSPYVVSCF  64

Query  560   G-----KEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             G       + GG   NLF+EY   GSL+D   + GG+LDE  IR YT +IL GL Y+H  
Sbjct  65    GFDVSSHRLAGGLYYNLFMEYAPRGSLSDEIVRHGGRLDEAAIRSYTYQILRGLAYIHSE  124

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPN-PIPLAGVAGSPLWMAPETLRNQG  901
             G+VH D+K RNVL+ S G  K+AD GC+  + +         G+ G+P++MAPE  R + 
Sbjct  125   GVVHCDVKGRNVLIGSDGRAKIADLGCASLIDEDDRGGGECRGLRGTPMFMAPEVARGEE  184

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
                 A D+W+LGCT+IEMATG  PW   + N +  V RIA S   P+FPS  S EG DFL
Sbjct  185   QGPPA-DVWALGCTVIEMATGCPPWP-DVPNAIGVVHRIAFSRVVPDFPSWLSAEGKDFL  242

Query  1082  EKCLERDPRKRWKAEELLHHPFV  1150
              KCL+RDP +RW AE+LL H FV
Sbjct  243   SKCLKRDPSERWTAEQLLRHEFV  265



>ref|XP_003560747.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Brachypodium distachyon]
Length=507

 Score =   223 bits (568),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/257 (43%), Positives = 161/257 (63%), Gaps = 4/257 (2%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             EW +G  +G GS   V LA+++ TG +F VKS  +    + L  E  IL  L SP+VV+C
Sbjct  5     EWTRGPAIGRGSSAVVSLAVDRVTGVVFAVKSVGAGRAAE-LRREQSILRGLSSPYVVRC  63

Query  557   IGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVH  736
             +G    G  ++   +EY AGGSLAD  ++ GG+  E +IR   R++L GL + H  G+ H
Sbjct  64    LGYVADGSGEM--LMEYAAGGSLADEIRRCGGRCPEALIRCRARDVLRGLAHAHGAGVAH  121

Query  737   SDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLDCA  916
              D+K RNVL+ S G   LADFGC++R+        L G+ G+P++MAPE  R +     A
Sbjct  122   CDVKARNVLVGSHGRAMLADFGCARRIVASSREPQLMGMGGTPMFMAPEAARGE-ERGAA  180

Query  917   SDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCLE  1096
             +D+W++GCT+IEMATG  PW  + ++PV+A+  +A S + P  P   S+ G +FL +CL 
Sbjct  181   ADVWAVGCTVIEMATGGAPWRSRFADPVAALHHVAFSGEAPELPPWLSEAGKEFLGRCLR  240

Query  1097  RDPRKRWKAEELLHHPF  1147
             +DPR+RW AE+LL HP+
Sbjct  241   QDPRERWTAEQLLEHPW  257



>ref|XP_009037802.1| hypothetical protein AURANDRAFT_2528, partial [Aureococcus anophagefferens]
 gb|EGB07246.1| hypothetical protein AURANDRAFT_2528 [Aureococcus anophagefferens]
Length=271

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/276 (42%), Positives = 173/276 (63%), Gaps = 21/276 (8%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE----SDSGLQFLESEAEILESLDSP  541
             + W +G+ +G G+FGSV+L++N  TG L  VK  +    S      LE+E  +++ L  P
Sbjct  1     IRWQRGEMIGKGAFGSVYLSLNLDTGELMAVKHLDCAEVSSRERSALENEVSMMKGLCHP  60

Query  542   HVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
             ++V+ +G +      L +F+EY+ GGSL  +  +FG KL+E ++RLY+R+ILLGL+YLH 
Sbjct  61    NIVRYLGVD-SSNDALAIFLEYVPGGSLRSLLDKFG-KLEEDIVRLYSRQILLGLEYLHG  118

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPN--------PIPLAGVAGSPLWMA  877
             N I H D+K  NVL+S+ G VKLADFG SKR+    N         +   G  G+PLWMA
Sbjct  119   NAIAHRDIKAANVLVSNDGSVKLADFGASKRMAAPSNLNGGGAVGALQTGGAKGTPLWMA  178

Query  878   PETL----RNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNF  1045
             PE +    ++QG     +D+WS+GCT+IEM+TG  PW+ + SNPV+A+  IAC E+ P+ 
Sbjct  179   PEVIKAAPKSQGWRK--ADVWSVGCTVIEMSTGRPPWS-QYSNPVTAMYHIACVEELPDM  235

Query  1046  PSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             P + S +G+ FL  C +R+PR R +   LL   FV+
Sbjct  236   PPNLSDDGIQFLWLCFQREPRLRPEVTALLLQGFVS  271



>ref|NP_001046691.2| Os02g0322400 [Oryza sativa Japonica Group]
 dbj|BAF08605.2| Os02g0322400 [Oryza sativa Japonica Group]
Length=425

 Score =   221 bits (562),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 163/264 (62%), Gaps = 9/264 (3%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             EW +G  +G G+  +V +A ++ TGG+F VKS +  +    L  E  +L +L SP VV C
Sbjct  6     EWRRGPVIGRGATATVSIATDRRTGGVFAVKSVDV-ARAGALRREQGMLSALASPFVVPC  64

Query  557   IGK------EMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             +G       +  GG   +LF+EY  GGSLAD  ++ GG+ +E +IR    ++L GL Y+H
Sbjct  65    VGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRCGGRCEEPLIRSRVGDVLRGLAYVH  124

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQ  898
               GI H D+K RNVL+ + G   LADFGC++ +           + G+P+++APE  R +
Sbjct  125   AAGIAHCDVKGRNVLVGADGRAMLADFGCARWMAAEDCNAGGVTIRGTPMFLAPEAARGE  184

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
                  A+DIW+LGCT+IEMATG  PW  + ++PV+A+  +A S D P  P+ FS EG DF
Sbjct  185   -AQGTAADIWALGCTVIEMATGGAPWP-RFADPVAALHHVAHSVDVPESPAWFSAEGKDF  242

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L +CL RDP KRW AE+LL HPFV
Sbjct  243   LARCLIRDPAKRWTAEQLLEHPFV  266



>dbj|BAD15943.1| protein kinase-like [Oryza sativa Japonica Group]
 dbj|BAD28858.1| protein kinase-like [Oryza sativa Japonica Group]
Length=453

 Score =   221 bits (564),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 163/264 (62%), Gaps = 9/264 (3%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             EW +G  +G G+  +V +A ++ TGG+F VKS +  +    L  E  +L +L SP VV C
Sbjct  6     EWRRGPVIGRGATATVSIATDRRTGGVFAVKSVDV-ARAGALRREQGMLSALASPFVVPC  64

Query  557   IGK------EMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             +G       +  GG   +LF+EY  GGSLAD  ++ GG+ +E +IR    ++L GL Y+H
Sbjct  65    VGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRCGGRCEEPLIRSRVGDVLRGLAYVH  124

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQ  898
               GI H D+K RNVL+ + G   LADFGC++ +           + G+P+++APE  R +
Sbjct  125   AAGIAHCDVKGRNVLVGADGRAMLADFGCARWMAAEDCNAGGVTIRGTPMFLAPEAARGE  184

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
                  A+DIW+LGCT+IEMATG  PW  + ++PV+A+  +A S D P  P+ FS EG DF
Sbjct  185   -AQGTAADIWALGCTVIEMATGGAPWP-RFADPVAALHHVAHSVDVPESPAWFSAEGKDF  242

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L +CL RDP KRW AE+LL HPFV
Sbjct  243   LARCLIRDPAKRWTAEQLLEHPFV  266



>ref|XP_011008032.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Populus euphratica]
Length=539

 Score =   223 bits (569),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 172/267 (64%), Gaps = 13/267 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T+G GS  +V +A    +G +F VKSAE     + L+ E  IL +L  P +V 
Sbjct  1     MDWTRGQTIGHGSSATVSMAKASQSGQVFAVKSAELLKS-ESLQREQSILSTLKCPQIVV  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    G    NLF+EY++GG+L D  ++ GG LDE +IRLY R ILLGL+YLH N
Sbjct  60    YKGCDITNENGKLFYNLFLEYISGGTLIDAIREGGGCLDEAMIRLYARTILLGLEYLHCN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKK--HPNPIPLAGVAGSPLWMAPETLR--  892
             GIVH D+K  N+L++  G  K+AD GC+KRV +    +    A +AG+PL+MAPE  R  
Sbjct  120   GIVHCDIKGHNILVTGDG-AKIADLGCAKRVDEVSGDDLNTTAPIAGTPLYMAPEVARGE  178

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
             +QG     +DIWS+GCT++EMATG  PW   +S+PVSA+ +I  S + P  PS  S++  
Sbjct  179   HQG---FPADIWSVGCTVVEMATGQAPWV-DVSDPVSALYQIGFSGNVPEIPSFMSKQAK  234

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFVN  1153
             DFL KCL+RDP +RW A ELL H F+ 
Sbjct  235   DFLSKCLKRDPGERWSASELLKHDFIT  261



>gb|EEC73042.1| hypothetical protein OsI_06987 [Oryza sativa Indica Group]
Length=448

 Score =   221 bits (562),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 163/264 (62%), Gaps = 9/264 (3%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             EW +G  +G G+  +V +A ++ TGG+F VKS +  +    L  E  +L +L SP VV C
Sbjct  6     EWRRGPVIGRGATATVSIATDRRTGGVFAVKSVDV-ARAGALRREQGMLSALASPFVVPC  64

Query  557   IGK------EMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             +G       +  GG   +LF+EY  GGSLAD  ++ GG+ +E +IR    ++L GL Y+H
Sbjct  65    VGSGVSAAVDGSGGACYDLFLEYAPGGSLADEIKRCGGRCEEPLIRSRVGDVLRGLAYVH  124

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQ  898
               GI H D+K RNVL+ + G   LADFGC++ +           + G+P+++APE  R +
Sbjct  125   AAGIAHCDVKGRNVLVGADGRAMLADFGCARWMAAEDCNAGGVTIRGTPMFLAPEAARGE  184

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
                  A+DIW+LGCT+IEMATG  PW  + ++PV+A+  +A S D P  P+ FS EG DF
Sbjct  185   -AQGTAADIWALGCTVIEMATGGAPWP-RFADPVAALHHVAHSVDVPESPAWFSAEGKDF  242

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L +CL RDP KRW AE+LL HPFV
Sbjct  243   LARCLIRDPAKRWTAEQLLEHPFV  266



>gb|KDP24854.1| hypothetical protein JCGZ_24448 [Jatropha curcas]
Length=421

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 172/267 (64%), Gaps = 14/267 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G GS  +V LA +  +G +F VKSAE     +FL+ E +IL SL+SP++V 
Sbjct  1     MDWTRGHTIGHGSTATVSLATSLQSGNVFAVKSAELFQS-EFLQREQKILSSLNSPYIVG  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGG----KLDEMVIRLYTREILLGLKY  712
               G E+         NL +EYM+GG+L D  +  GG    +++E VI  YT +I+ GL Y
Sbjct  60    YRGCEITKEHNKVMYNLLLEYMSGGTLIDAVKAHGGGDGRRIEESVIGYYTCQIVKGLDY  119

Query  713   LHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR  892
             LH +G+VH D+K RN+L+   G  K+ADFGC+KR+        ++G  G+P++MAPE  R
Sbjct  120   LHSSGLVHCDIKGRNILVGEKG-AKIADFGCAKRIDPVEPADKISG--GTPMFMAPEVAR  176

Query  893   NQGGLDCASDIWSLGCTIIEMAT-GNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
                    ASDIW+LGCTIIEMAT G  PW   +++ VS + RI  S++ P FP   S++G
Sbjct  177   GDE-QSFASDIWALGCTIIEMATGGGAPWV-NVNDAVSVIYRIGFSDELPEFPCWLSEQG  234

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFV  1150
              DFL+KCL RDP++RW A++LL HPF+
Sbjct  235   KDFLDKCLRRDPKERWTAKQLLTHPFL  261



>ref|XP_009144845.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1 
[Brassica rapa]
Length=458

 Score =   221 bits (562),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/264 (45%), Positives = 170/264 (64%), Gaps = 15/264 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +G  +G GS  +V  A++  +G +F VKSA+  S    L++E  +L +L SPH+VK
Sbjct  3     ITWTRGPVIGRGSTATVSTAISN-SGEMFAVKSADFSSS-AILQNEQSVLSTLSSPHIVK  60

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG ++     G   NL +EY++GGSL D+ +  GGKL E  IR YTR+IL GL YLHE 
Sbjct  61    YIGSDVTPEKDGLVYNLLMEYVSGGSLHDLIKNAGGKLPEPAIRSYTRQILRGLSYLHER  120

Query  725   GIVHSDLKCRNVLLSSSGDV-KLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
             GIVH DLK +NVL+  +G V K+AD GC+K       P+  +G +G+P +MAPE  R + 
Sbjct  121   GIVHCDLKSQNVLVEENGVVCKIADMGCAK-------PVLNSGFSGTPAFMAPEVARGEE  173

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
                  +D+W+LGCT+IEM TG+ PW  ++++ V+A+ +I  S + P  P   S++G DFL
Sbjct  174   QR-FPADVWALGCTVIEMMTGSSPWQ-ELNDVVAAMYKIGFSGESPEIPEFISEKGKDFL  231

Query  1082  EKCLERDPRKRWKAEELLHHPFVN  1153
               CLE DP++RW  EELL HPF++
Sbjct  232   MNCLENDPKQRWTVEELLKHPFLD  255



>emb|CDX89295.1| BnaA01g15980D [Brassica napus]
Length=458

 Score =   220 bits (561),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 183/284 (64%), Gaps = 15/284 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +G  +G GS  +V  A++  +G +F VKSA+  S    L++E  +L +L SPH+VK
Sbjct  3     ITWTRGPVIGRGSTATVSTAISN-SGEMFAVKSADFSSS-AILQNEQSVLSTLSSPHIVK  60

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG ++   K+    NL +EY++GGSL D+ +  G KL E VIR YTR+IL GL YLHE 
Sbjct  61    YIGSDVTPEKEGLVYNLLMEYVSGGSLHDLIKNSGRKLPEPVIRSYTRQILRGLSYLHER  120

Query  725   GIVHSDLKCRNVLLSSSGDV-KLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
             GIVH DLK +NVL+  +G V K+AD GC+K       P+  +G +G+P +MAPE  R + 
Sbjct  121   GIVHCDLKSQNVLVEENGVVCKIADMGCAK-------PVLKSGFSGTPAFMAPEVARGEE  173

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
                  +D+W+LGCT+IEM TG+ PW  ++++ V+A+ +I  S + P  P   S++G DFL
Sbjct  174   QR-FPADVWALGCTVIEMVTGSSPWP-ELNDVVAAMYKIGYSGESPEVPEWISEKGKDFL  231

Query  1082  EKCLERDPRKRWKAEELLHHPFVNpeseefaasspasVLDRSIF  1213
               CLE DP++RW  EELL HPF++ ES     SSP++VLD+  +
Sbjct  232   MSCLENDPKQRWTVEELLKHPFLDEESHLRITSSPSTVLDQRFW  275



>ref|XP_004295838.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Fragaria vesca subsp. vesca]
Length=447

 Score =   220 bits (560),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 174/265 (66%), Gaps = 14/265 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+T+G GS   V LA +  +G +F VKSAE  S   FL  E   L  L SPHVV+
Sbjct  3     MEWTRGRTIGRGSTAVVSLATDAFSGEVFAVKSAEL-SRSSFLRKEQCFLSKLSSPHVVR  61

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++   +     N+F+EY+ GG+L+D  ++ G +L+E VI+ +T +I+ GL+YLH N
Sbjct  62    YLGCDVSTEQNEPMYNIFMEYVPGGTLSDAVRRNGKQLEEGVIQSFTHQIVQGLEYLHSN  121

Query  725   GIVHSDLKCRNVLL-SSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQ  898
             G+ H D+K +N+L+   SG +K+AD GC+K V + P     +  +G+P++MAPE  R  +
Sbjct  122   GLAHCDIKSQNILVCQESGKIKIADLGCAKLVHESPT----SAFSGTPVFMAPEVARGEE  177

Query  899   GGLDCASDIWSLGCTIIEMAT-GNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
              G +  +DIW+LGCT+IEMAT G+ PW  ++S+PVSA+  I  S D P  P   S+EG D
Sbjct  178   QGFE--ADIWALGCTLIEMATGGSSPWT-EVSDPVSALYLIGFSSDLPELPRWLSKEGKD  234

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FL KCL + PR+RW A+ELL HPF+
Sbjct  235   FLSKCLMKCPRERWTAKELLEHPFL  259



>ref|XP_007213446.1| hypothetical protein PRUPE_ppa025047mg [Prunus persica]
 gb|EMJ14645.1| hypothetical protein PRUPE_ppa025047mg [Prunus persica]
Length=441

 Score =   219 bits (559),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 170/265 (64%), Gaps = 13/265 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G+T+G GS  +V LA    +G LF VKS E  S   FL+ E  +L  L  P++V+ +
Sbjct  4     WTRGRTIGRGSTATVSLATAALSGELFAVKSTEL-SCSSFLQKEQCLLSKLSCPNIVEYL  62

Query  560   GKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGI  730
             G  +         NL +EY+ GG+L D  ++ GG+L+E  I+LYT +I+ GL+YLH NG+
Sbjct  63    GCNVSTENNRPMYNLLMEYVPGGTLFDTIRRHGGRLEEPAIQLYTHQIVQGLEYLHVNGL  122

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVK----KHPNPIPLAGVAGSPLWMAPETLR-N  895
             VH D+K +N+L++    VK+AD GC+K V+       +      ++G+P++MAPE  R  
Sbjct  123   VHCDIKSQNILVAEEC-VKIADLGCAKSVQIVAGDEDSATSSTIISGTPVFMAPEVARGE  181

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             + G +  +DIW+LGCTIIEMATG+ PW  ++++PVSA+ RI  S D P  P+  S +G D
Sbjct  182   EQGFE--ADIWALGCTIIEMATGDGPWP-ELNDPVSALYRIGFSGDLPEIPTRLSNKGKD  238

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FL KCL RDPR+RW A +LL HPF+
Sbjct  239   FLNKCLRRDPRERWTANQLLEHPFL  263



>ref|XP_006849466.1| hypothetical protein AMTR_s00024p00089950 [Amborella trichopoda]
 gb|ERN11047.1| hypothetical protein AMTR_s00024p00089950 [Amborella trichopoda]
Length=284

 Score =   214 bits (546),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 160/261 (61%), Gaps = 31/261 (12%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAES--DSGLQFLESEAEILESLDSPHVVK  553
             W++ KT+G GS+GSV LA N   G LF VKSA S  +  L+ LE E  IL+ LDS  V++
Sbjct  10    WIRLKTIGEGSYGSVSLARNLEDGRLFAVKSATSKNEESLECLEREINILKKLDSRFVIR  69

Query  554   CIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIV  733
              +G+   G  K+NLF+EYM GG+L+ ++ +  G L EM I++YT  IL GL+YLHENGI+
Sbjct  70    YLGQGRDGEGKVNLFMEYMEGGNLSSLSMRSNG-LPEMAIKIYTASILRGLEYLHENGII  128

Query  734   HSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETL--RNQGGL  907
             H D+K  NVL    G+VKLADFG +K V +    I     AG+  WMAPE    R QG  
Sbjct  129   HCDVKGNNVLFGLLGEVKLADFGAAKMVSREFPAIH----AGTLRWMAPEIFKKREQG--  182

Query  908   DCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEK  1087
               ASDIWSLGCT++EMATG LP                  E   NF +  S  G+DFLEK
Sbjct  183   -TASDIWSLGCTVVEMATGILP------------------ELSENF-TGISDSGVDFLEK  222

Query  1088  CLERDPRKRWKAEELLHHPFV  1150
             C   +P +RW A +LLHHPF+
Sbjct  223   CFRLEPSQRWTASQLLHHPFL  243



>ref|XP_004954858.1| PREDICTED: serine/threonine-protein kinase DDB_G0283821-like 
[Setaria italica]
Length=555

 Score =   222 bits (565),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/269 (43%), Positives = 166/269 (62%), Gaps = 14/269 (5%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVVK  553
             EW +G  +G G+  +V +A ++ TGG+F VKS E + +G+  L+ E  +L +L SP+VV 
Sbjct  6     EWQRGPVIGHGASATVSIATDRRTGGVFAVKSVELARAGV--LQREQSVLSALSSPYVVS  63

Query  554   CIGKEMC------GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
             C+G ++       G    +LF+EY  GGSLAD  ++ GG+ +E VIR    ++L GL Y+
Sbjct  64    CLGADVSVAADGSGRMCYDLFLEYAPGGSLADEIKRRGGRCEEAVIRSRAADVLRGLAYV  123

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAG----VAGSPLWMAPE  883
             H +G+ H D+K RNVLL + G   LADFGC++ +        +      V G+P++M+PE
Sbjct  124   HGSGVTHCDVKGRNVLLRADGRAMLADFGCARLMANEDGNAGVGAGGMIVRGTPMFMSPE  183

Query  884   TLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQ  1063
               R +     A+DIW+LGCT+IEMATG  PW  + ++PV+A+  IA S D P  P+  S 
Sbjct  184   AARGEA-QGAAADIWALGCTVIEMATGGAPWQQRFADPVAALHHIAHSGDVPQAPAWLSD  242

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             E  DFL +CL  DP KRW AE+LL H FV
Sbjct  243   EAKDFLSRCLIMDPAKRWSAEQLLQHQFV  271



>ref|XP_008229972.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Prunus 
mume]
Length=442

 Score =   219 bits (558),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 171/264 (65%), Gaps = 12/264 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G GS  +V LA +  +G LF VKSAE  S  +FL+ E +IL +L SPH+V 
Sbjct  1     MDWTRGHTIGHGSSATVSLATSCFSGNLFAVKSAEM-SQSEFLQREQKILSALSSPHIVS  59

Query  554   CIGKEMCG-GKKL--NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G +M     KL  NLF+EYM  G++ D     GG++DE +IR YTR+I+ GL+YLH +
Sbjct  60    YMGHDMTSESNKLMYNLFMEYMPRGTIIDEICNHGGQIDESLIRDYTRDIVKGLEYLHSH  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQG  901
             G+VH D+K RN+L+   G  K+ADFGC++    +P       + G+P++MAPE  R  + 
Sbjct  120   GLVHCDIKGRNILVGDDGP-KIADFGCARWA--NPAGEVAVPIGGTPMFMAPEVARGEEQ  176

Query  902   GLDCASDIWSLGCTIIEMAT-GNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G  C  D+W+LGCTIIEMAT G++PW    +NPVS + +IA S + P  PS  S +  +F
Sbjct  177   GFPC--DVWALGCTIIEMATGGSVPWPNA-ANPVSVLYQIAYSGELPEIPSFLSDQAKEF  233

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L KCL RDP +RW A +LL H F+
Sbjct  234   LGKCLRRDPTERWTASQLLKHSFL  257



>ref|XP_008224751.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Prunus mume]
Length=435

 Score =   219 bits (557),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 169/265 (64%), Gaps = 15/265 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G GS  +V +A +  +G +F VKSA+  S    L+ E  IL +L S  +V 
Sbjct  1     MDWTRGPTIGHGSSATVSIAKSHGSGEVFAVKSAKL-SQSHSLQMEQTILSTLSSAQIVS  59

Query  554   ---CIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
                C      G    NLF+EY  GG+L+D  +  GG+L+E  IR YTR+ILLGL +LH N
Sbjct  60    YKGCNTSTENGTVFYNLFLEYAPGGTLSDAIRSQGGRLNEAAIRSYTRQILLGLHHLHSN  119

Query  725   GIVHSDLKCRNVLLSSSG-DVKLADFGCSKRVK-KHPNPIPLAGVAGSPLWMAPETLR-N  895
              I H D+K +NVL++++G DVKLAD GC+KRV   H  PI      G+P++MAPE  R  
Sbjct  120   QIAHCDIKGQNVLVTNNGADVKLADLGCAKRVNFDHGLPI-----GGTPVYMAPEVARGE  174

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             Q GL  A+D+W+LGCT+IEMATG   W   +S+PVSA+ +I  S + P  PS  S++G D
Sbjct  175   QQGL--AADVWALGCTVIEMATGRATWPC-VSDPVSAMYKIGFSGEVPEIPSSLSKKGRD  231

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             F+ KCL RDP +RW A ELL H F+
Sbjct  232   FVTKCLMRDPMERWSAGELLKHGFL  256



>ref|XP_006843642.1| hypothetical protein AMTR_s00007p00166380 [Amborella trichopoda]
 gb|ERN05317.1| hypothetical protein AMTR_s00007p00166380 [Amborella trichopoda]
Length=380

 Score =   217 bits (552),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 161/261 (62%), Gaps = 31/261 (12%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA--ESDSGLQFLESEAEILESLDSPHVVK  553
             W++ KT+G GS+G+V +A N   GGLF VKSA  + +  L+ LE E +IL+ LDSP VV+
Sbjct  10    WIRLKTIGEGSYGAVSVARNLEDGGLFAVKSATCKDEEFLECLEREIDILKKLDSPFVVR  69

Query  554   CIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIV  733
              +G++  G  K+NLF+EYM GG L  ++ +  G L EM I+ YT  IL GL+YLHE GI+
Sbjct  70    YLGQDRDGEGKVNLFMEYMEGGDLCSLSMRSKG-LPEMAIKTYTAAILRGLEYLHEKGII  128

Query  734   HSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETL--RNQGGL  907
             H D+K RNVLL  SG+VKLADFG +K V      I     AG+  WMAPE L  R QG  
Sbjct  129   HCDVKGRNVLLGLSGEVKLADFGAAKMVSSELPAIH----AGTLRWMAPEILERREQG--  182

Query  908   DCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEK  1087
               ASDIWSLGCT++EMATG +P                     P   S  S  GLDFL+K
Sbjct  183   -TASDIWSLGCTLVEMATGKVP-------------------KLPEKFSGISDSGLDFLDK  222

Query  1088  CLERDPRKRWKAEELLHHPFV  1150
             C   +P +RW A +LLHHPF+
Sbjct  223   CFMPEPSQRWTASQLLHHPFL  243



>ref|XP_003517304.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Glycine max]
Length=346

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/266 (44%), Positives = 168/266 (63%), Gaps = 13/266 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLF----VVKSAESDSGLQFLESEAEILESLD-SPH  544
             WV+G ++G+GSF +V++A+   T   F     VKS++  S    L++E EIL+ L  SP+
Sbjct  3     WVRGDSLGTGSFATVNIAIPTNTSIHFPSPTAVKSSDVHSS-SMLKNEKEILDCLGASPY  61

Query  545   VVKCIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
             V+KC G +     G +  N+F+EY AGGSLAD  ++ GG+L E  +R  TR I+ GLK++
Sbjct  62    VIKCFGHDHTVENGEEYYNIFLEYAAGGSLADQVKRHGGRLPESYVRRCTRSIVEGLKHI  121

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRN  895
             H+NG VH D+K +N+L+  +GDVK+ADFG +K   +           G+PL+M+PE++ N
Sbjct  122   HDNGYVHCDVKLQNILVFENGDVKIADFGLAKEKGEKQGTFE---CRGTPLFMSPESV-N  177

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
                 +  +DIW+LGC ++EM TG   W  + SN  S ++RI   E+ P  P   S+EG D
Sbjct  178   DNEYESPADIWALGCAVVEMLTGKPAWDVRGSNIWSLLIRIGVGEELPKIPEELSEEGKD  237

Query  1076  FLEKCLERDPRKRWKAEELLHHPFVN  1153
             FL KC  +DP KRW AE LLHHPFVN
Sbjct  238   FLLKCFVKDPMKRWSAEMLLHHPFVN  263



>ref|XP_006283707.1| hypothetical protein CARUB_v10004778mg [Capsella rubella]
 gb|EOA16605.1| hypothetical protein CARUB_v10004778mg [Capsella rubella]
Length=454

 Score =   218 bits (556),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 167/263 (63%), Gaps = 14/263 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +G  +G GS  +V LA++   G +F VKSAE  S   FL+ E  IL +L SPH++K
Sbjct  3     MNWTRGPIIGRGSTATVSLAIS-YFGEIFAVKSAELSSS-TFLQKEQSILSTLSSPHILK  60

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG  +    G    N+ +EY++GGSL D+ +  GGKL E  I  YTR+IL GL YLHE 
Sbjct  61    YIGSGLTLESGVMLYNILMEYVSGGSLHDLIKSSGGKLPEPEISSYTRQILNGLVYLHER  120

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             GIVH DLK +NVL+  +G +K+ADFGC+K V K       +  AG+P +MAPE  R +  
Sbjct  121   GIVHCDLKSQNVLVEENGVLKIADFGCAKSVAK-------SDFAGTPAFMAPEVARGEEQ  173

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                 +D+W+LGCT+IEM TG+ PW G +++ V+A+ +I  S + P  P   S++  DFL 
Sbjct  174   -SFPADVWALGCTVIEMMTGSSPWPG-LNDVVAAMYKIGLSGESPEIPVKISEKAKDFLM  231

Query  1085  KCLERDPRKRWKAEELLHHPFVN  1153
              C ++DP++RW  +ELL HPF++
Sbjct  232   NCFKKDPKQRWTVQELLKHPFLD  254



>ref|XP_010096874.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB66328.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=443

 Score =   218 bits (555),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/267 (44%), Positives = 172/267 (64%), Gaps = 13/267 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G T+G G+  +VHLA +  +G  F VKSAE    + FL  E   L  L S  +VK
Sbjct  1     MEWTRGPTIGRGATATVHLATDTRSGEPFAVKSAELCRAV-FLRKEQSFLSKLSSSRIVK  59

Query  554   CIGKEMCGGKKL---NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++     +   NLFIEY+  G+L D  +   G+LDE +I++YT++IL GL ++HEN
Sbjct  60    YLGFDVTTENDVPMYNLFIEYLPNGTLFDAIRSREGRLDESLIKIYTQQILQGLDHIHEN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHP---NPIPLAGVAGSPLWMAPETLR-  892
             G+VH D+K +N+L+   G +K+AD GC+K V +     +P+ L   +G+P +MAPE  R 
Sbjct  120   GLVHCDIKSQNMLIGEEG-IKIADLGCAKFVGEAEFGDSPLVLQ-FSGTPAFMAPEVARG  177

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              + GL+  +D+W+LGCT+IEMATG  PW  ++ +PVSA+ RI  S+  P  P  FS++G 
Sbjct  178   EKQGLE--ADVWALGCTVIEMATGRGPWP-EMDDPVSALYRIGYSDRVPEIPRWFSEKGK  234

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFVN  1153
             DFL KCL+RD R+RW   ELL HPF+ 
Sbjct  235   DFLSKCLKRDWRERWTVNELLEHPFLQ  261



>ref|XP_006843641.1| hypothetical protein AMTR_s00007p00165610 [Amborella trichopoda]
 gb|ERN05316.1| hypothetical protein AMTR_s00007p00165610 [Amborella trichopoda]
Length=380

 Score =   216 bits (550),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 161/261 (62%), Gaps = 31/261 (12%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA--ESDSGLQFLESEAEILESLDSPHVVK  553
             W++ KT+G GS+G+V +A N   GGLF VKSA  + +  L+ LE E +IL+ LDSP VV+
Sbjct  10    WIRLKTIGEGSYGAVSVARNLEDGGLFAVKSATCKDEEFLECLEREIDILKKLDSPFVVR  69

Query  554   CIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIV  733
              +G++  G  K+NLF+EYM GG L  ++ +  G L EM I+ YT  IL GL+YLHE GI+
Sbjct  70    YLGQDRDGEGKVNLFMEYMEGGDLCSLSMRSKG-LPEMAIKTYTASILRGLEYLHEKGII  128

Query  734   HSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETL--RNQGGL  907
             H D+K RNVLL  SG+VKLADFG +K V      I     AG+  WMAPE L  R QG  
Sbjct  129   HCDVKGRNVLLGLSGEVKLADFGAAKMVSSELPAIH----AGTLRWMAPEILERREQG--  182

Query  908   DCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEK  1087
               ASDIWSLGCT++EMATG +P                     P   +  S  GLDFL+K
Sbjct  183   -TASDIWSLGCTLVEMATGKVP-------------------KLPEKFAGISDSGLDFLDK  222

Query  1088  CLERDPRKRWKAEELLHHPFV  1150
             C   +P +RW A +LLHHPF+
Sbjct  223   CFMPEPSQRWTASQLLHHPFL  243



>ref|XP_003058436.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH56891.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=289

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 171/280 (61%), Gaps = 10/280 (4%)
 Frame = +2

Query  332   MSGGYYSKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVK---SAESDSGLQFL  502
             +  G+Y   + ++P  W KG  +G+GSFG V L +N  TG LF VK   +A+    ++ L
Sbjct  9     IRSGFYLAPAPTKPRRWTKGDALGAGSFGRVFLGLNSETGELFAVKEVAAAKRAECIEQL  68

Query  503   ESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLY  682
             E E  +L  L  P++V+ IG E    + L +F+EY+ GGS+A + ++FG + +E V+ +Y
Sbjct  69    EQEVTLLSRLQHPNIVRYIGTERSA-EFLYIFLEYVPGGSIASLLERFG-RFEESVMSVY  126

Query  683   TREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKR-VKKHPNPIPLA--GV  853
             TR+IL+GL YLH    VH D+K  N+L+  SG +KLADFG +K  V++  +P   A  GV
Sbjct  127   TRQILIGLDYLHAQRTVHRDIKGANILVEKSGRIKLADFGMAKTLVERIDDPAARARGGV  186

Query  854   AGSPLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSED  1033
              GS  WMAPE +R Q G    +D+W++GCT++EMATG  PW+   S  V  + +IA + +
Sbjct  187   KGSAYWMAPEVIR-QKGHGSEADVWAVGCTVLEMATGKPPWS-HCSGQVQVLYKIASTME  244

Query  1034  RPNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              P  PS  S +  +F+  CL+RDP  R  A+ LL H F +
Sbjct  245   LPEIPSFLSPDASEFVLLCLQRDPESRPAADRLLTHAFAS  284



>ref|XP_009614381.1| PREDICTED: mitogen-activated protein kinase kinase kinase A {ECO:0000303|PubMed:9832508}-like 
[Nicotiana tomentosiformis]
Length=471

 Score =   218 bits (556),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 171/263 (65%), Gaps = 10/263 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G  +G GS  +V LA N A G LF VKS E  S    L+ E  ++  L+SP +VK
Sbjct  1     MEWTRGPIIGRGSSATVSLATNSA-GELFAVKSIEL-SCSNMLQREYSLISQLNSPFLVK  58

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             C G ++   K     N+F+EY+ GG+L+D+ ++ GG L+E VI+   ++IL GL YLH  
Sbjct  59    CFGFDITSEKNKAMYNMFMEYIPGGTLSDLIKKQGGSLNESVIKSCAQQILQGLDYLHSI  118

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             G+VH D+K +N+L+   G +K+AD GC K +    N +  +G++G+P +MAPE  R +  
Sbjct  119   GLVHCDIKGQNILIGQDG-IKIADLGCGKLLGDE-NAVN-SGISGTPAFMAPEVARGEEQ  175

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                A+DIW+ GCTIIEMATG+ PW   + +PVSA+ RI  S D P FP++ S +  +FL 
Sbjct  176   -KFAADIWAFGCTIIEMATGSPPWT-DMKDPVSALYRIGYSGDVPQFPNYLSTDAREFLA  233

Query  1085  KCLERDPRKRWKAEELLHHPFVN  1153
             KCL++DP++RW A++LL HPF+ 
Sbjct  234   KCLKKDPKERWTAKQLLQHPFLQ  256



>ref|XP_009616882.1| PREDICTED: mitogen-activated protein kinase kinase kinase A {ECO:0000303|PubMed:9832508}-like 
[Nicotiana tomentosiformis]
Length=329

 Score =   214 bits (545),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/262 (44%), Positives = 162/262 (62%), Gaps = 14/262 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G GS  +V +AM++ +G +F VKS E  S  +FL+ E +IL +L SP++V 
Sbjct  1     MDWTRGATIGHGSSAAVSIAMSRCSGEIFAVKSVEL-SQSEFLQKEQKILSTLSSPYIVC  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NL +EYM  G+L D  Q  GG L+E +IR YT++I+ GL YLH  
Sbjct  60    YKGYDVTRENNKDMFNLMMEYMPDGTLTDEIQ--GGPLNEQLIRYYTKQIIHGLNYLHSK  117

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             GIVH D+K  N+LL  +G  K+ADFGC++ V +           G+P++MAPE  R +  
Sbjct  118   GIVHCDIKGHNILLYKTG-AKIADFGCARSVDQ------AKWNGGTPMFMAPEVARGEEQ  170

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                A+DIW+LGCTIIEMATG  PW     +P S +  IA S   P  P   S +  DFL 
Sbjct  171   W-FAADIWALGCTIIEMATGASPWTTVNHSPASLLCHIAFSGQIPEIPKFLSSQARDFLS  229

Query  1085  KCLERDPRKRWKAEELLHHPFV  1150
             +CL RDP++RW A++LL+HPF+
Sbjct  230   ECLRRDPKQRWSAKQLLNHPFL  251



>ref|XP_011003930.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Populus euphratica]
Length=496

 Score =   218 bits (556),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 128/268 (48%), Positives = 168/268 (63%), Gaps = 20/268 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             V WV+GK VG GSFGSV+LA NK TG +F VK+A   + +Q L+SE +IL SL SP +VK
Sbjct  2     VSWVRGKCVGKGSFGSVNLAFNKQTGAVFAVKTASEANQVQALDSEIKILSSLSSPFIVK  61

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADV---TQQFGGKLDEMVIRLYTREILLGLKYL  715
              +G ++         NL +EY+ GG++AD+   TQ+F   ++E  +R +T  I+  LKY+
Sbjct  62    FLGDDVSFENSRACRNLHMEYLPGGTVADLASSTQRF-ADVNEETVRSFTYCIVSALKYI  120

Query  716   HENGIVHSDLKCRNVLLSSSGD-VKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR  892
             H  GIVH D+K RN+LL  S D VKLADFG +         +P     GSPLWMAPE ++
Sbjct  121   HSRGIVHCDVKGRNILLGHSFDSVKLADFGSAIDATCGEPLLP----RGSPLWMAPEVIK  176

Query  893   N--QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQE  1066
                QG     SD+WSLGCTIIEM TG   W     + V ++ RI  S + P  PS  S  
Sbjct  177   REYQGP---ESDVWSLGCTIIEMVTGKPAWE---DHGVDSLSRIGFSNEMPELPSQLSVL  230

Query  1067  GLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             G DFL+KCLER+PRKRW  ++LL HPF+
Sbjct  231   GQDFLKKCLEREPRKRWSCDQLLKHPFL  258



>ref|NP_180810.1| mitogen-activated protein kinase kinase kinase 17 [Arabidopsis 
thaliana]
 gb|AAC25933.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC08695.1| mitogen-activated protein kinase kinase kinase 17 [Arabidopsis 
thaliana]
Length=372

 Score =   215 bits (547),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/268 (43%), Positives = 166/268 (62%), Gaps = 16/268 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+ +G GS  +V+ A    +  +  VKS+E     +FL+ EA+IL SL SP+V+ 
Sbjct  1     MEWTRGRILGRGSTATVYAAAGHNSDEILAVKSSEVHRS-EFLQREAKILSSLSSPYVIG  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G    +E  G    NL +EY   G+L D   + GG++DE  +  YTR+IL GL+Y+H 
Sbjct  60    YRGSETKRESNGVVMYNLLMEYAPYGTLTDAAAKDGGRVDETRVVKYTRDILKGLEYIHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              GIVH D+K  NV++S  G+ K+ADFGC+KRV    +P+  + V G+P +MAPE  R   
Sbjct  120   KGIVHCDVKGSNVVISEKGEAKIADFGCAKRV----DPVFESPVMGTPAFMAPEVARGEK  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPW--AGKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
             QG     SDIW++GCT+IEM TG+ PW  A    +PVS + R+  S + P  P   ++E 
Sbjct  176   QGK---ESDIWAVGCTMIEMVTGSPPWTKADSREDPVSVLYRVGYSSETPELPCLLAEEA  232

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              DFLEKCL+R+  +RW A +LL+HPF+ 
Sbjct  233   KDFLEKCLKREANERWTATQLLNHPFLT  260



>emb|CDX97370.1| BnaC08g12350D [Brassica napus]
Length=403

 Score =   216 bits (549),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 170/264 (64%), Gaps = 15/264 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             V W +G T+G GS  +V +A +  +G +F VKSA+  S   FL+ E  IL +L SPH+VK
Sbjct  3     VTWTRGPTIGRGSTATVSIATSN-SGEIFAVKSADISSS-AFLQKEQSILSTLSSPHIVK  60

Query  554   CIGKEM-CGGKKL--NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG  + C   +L  N+ +EY++GGSL  + +  GGKL E  IR +TR+IL GLKYLHE 
Sbjct  61    YIGSSLTCENDRLVYNILVEYVSGGSLHSLIKNSGGKLPEPAIRSHTRQILKGLKYLHER  120

Query  725   GIVHSDLKCRNVLLSSSGDV-KLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
             GIVH D+K +NVL+  +G V K+AD GC+K       P+  +G +G+P +MAPE  R + 
Sbjct  121   GIVHCDVKSQNVLVGENGVVSKIADLGCAK-------PVFNSGFSGTPAFMAPEVARGE-  172

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
                  +D+W+LGCT+IEM TG+ PW  +++  V+ + +I  S + P  P   S++G DF 
Sbjct  173   EQRFPADVWALGCTVIEMMTGSSPWP-ELTEAVAGIYKIGFSGESPEIPEGISEKGKDFG  231

Query  1082  EKCLERDPRKRWKAEELLHHPFVN  1153
              +CL+ DP++RW  EELL HPF++
Sbjct  232   MRCLKVDPKQRWTVEELLKHPFLD  255



>ref|XP_010543009.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Tarenaya hassleriana]
Length=349

 Score =   214 bits (545),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 163/264 (62%), Gaps = 10/264 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW KG+T+G GS  +V  A    +  +  VKSAE  S  + LE EA+IL SL SP+VV 
Sbjct  1     MEWTKGRTIGRGSCATVSAATYHNSCDIIAVKSAEL-SRSELLEREAKILSSLSSPYVVG  59

Query  554   CIGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G  +     G    ++ +EY   G++AD   + GG L+E ++  YTR IL GL+YLH 
Sbjct  60    YRGCGITNNPDGVDTYSILMEYAPYGTVADKAAKNGGGLEENLVVKYTRHILCGLEYLHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
              GI H D+K  NVL+  +GD K+ADFGC+KRV    +      V G+P +MAPE  R + 
Sbjct  120   KGIAHCDIKGSNVLIGENGDAKIADFGCAKRVDTESDSAET--VRGTPAFMAPEVARGEK  177

Query  902   -GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
              G++  SDIW++GCT+IEMATG+LPW     +PVS + RI  S + P  P   ++   DF
Sbjct  178   QGME--SDIWAVGCTVIEMATGSLPWTIDSGDPVSVLYRIGYSGESPEIPCCLTEPTKDF  235

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L+KCL+R P +RW A +LL+HPF+
Sbjct  236   LQKCLKRHPEERWTANQLLNHPFL  259



>ref|XP_009790439.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Nicotiana sylvestris]
Length=385

 Score =   215 bits (547),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 167/263 (63%), Gaps = 15/263 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W++G T+G GS  +V +A+++ +G +F VKS E  S  + L+ E +IL +L SP++V 
Sbjct  1     MDWIRGATIGHGSSAAVSIAVSRCSGEIFAVKSVEL-SQSECLQKEQKILSTLSSPYIVG  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++ G      LNL +EYM GG+L     + GG+L+E +I  +T++I+ GL YLH  
Sbjct  60    YKGYDVTGENNEDMLNLMMEYMPGGTLTHEIGRQGGRLNEQLIGYFTKQIIQGLDYLHSK  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQG  901
             G+VH D+K RN+LL  +G  K+ADFGC++ V +           G+P++MAPE  R  + 
Sbjct  120   GLVHCDIKGRNILLCETG-AKIADFGCARSVDQ------AKWNGGTPMFMAPEVARGEEQ  172

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
             G   A+DIW+LGCTIIEMATG  PW   +SNP S +  IA S   P  P   S +  DF+
Sbjct  173   GF--AADIWALGCTIIEMATGASPWT-TVSNPASLLYHIAFSGQNPEIPEFLSSKTRDFV  229

Query  1082  EKCLERDPRKRWKAEELLHHPFV  1150
              KCL RDP++RW A++LL HPF+
Sbjct  230   SKCLTRDPKQRWSAKQLLSHPFL  252



>ref|XP_005827279.1| hypothetical protein GUITHDRAFT_47402, partial [Guillardia theta 
CCMP2712]
 gb|EKX40299.1| hypothetical protein GUITHDRAFT_47402, partial [Guillardia theta 
CCMP2712]
Length=261

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 171/265 (65%), Gaps = 14/265 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA--------ESDSGLQFLESEAEILESLD  535
             W +G  +GSGSFG V+L MN  +G +FVVK          +++  LQ LE+E  +L +L+
Sbjct  2     WQRGNLIGSGSFGKVYLGMNLDSGEIFVVKQVMFLQKDKQDAEDVLQ-LEAEIALLGTLN  60

Query  536   SPHVVKCIGKEMCG-GKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKY  712
              P++VK +G E      +L++F+E+M GGS+A++  +FG KLDE VIR YTRE+L GL Y
Sbjct  61    HPNIVKYLGTERNNITNELSIFLEHMPGGSVAELVSRFG-KLDESVIRKYTREVLEGLTY  119

Query  713   LHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR  892
             LH+ GI+H D+K +N+L+ + G  KLADFG S+ ++   +   L+   G+P++M+PE + 
Sbjct  120   LHDKGIIHRDIKGQNILVDNRGVCKLADFGASRYLQSADSAANLS-FKGTPVFMSPEVIM  178

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              Q      SDIWS+GCT+++MATGN P++ + SN ++A+  I  S + P  P+  S+   
Sbjct  179   EQ-RYSKKSDIWSVGCTVLQMATGNPPFS-EFSNHIAALFHITASSEPPPIPAELSESAR  236

Query  1073  DFLEKCLERDPRKRWKAEELLHHPF  1147
             DF+ +C  RDP++R  A  L  HPF
Sbjct  237   DFVSRCFIRDPKERPYARTLRRHPF  261



>gb|KDO54709.1| hypothetical protein CISIN_1g015500mg [Citrus sinensis]
Length=405

 Score =   215 bits (548),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 166/264 (63%), Gaps = 17/264 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G GS  +V LA +  +G +F  KS E     +FL+ E + L SL+SPH+V 
Sbjct  1     MDWTRGHTIGQGSSATVSLATSLRSGDVFAAKSTELPKS-EFLQREQKFLSSLNSPHIVG  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NLF+EY  GG+L D   + GG+LDE +I  YTR+IL GL+YLH N
Sbjct  60    YKGCDVTSEDNKLMYNLFMEYAPGGTLNDEIHRNGGRLDESLIVSYTRQILQGLEYLHSN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
              +VH D+K RN+L++ SG  K+ADFGC+K   +           G+P++MAPE  R  +Q
Sbjct  120   RVVHCDIKSRNILMAESG-AKIADFGCAKWESEALQS------GGTPMFMAPEVARGEHQ  172

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G    ASDIW++GCT+IEMA+G  PW    ++P++ + +IA S + P  P+  S++  DF
Sbjct  173   G---FASDIWAVGCTVIEMASGGAPWPNA-ADPMTVLYKIAYSRELPEVPAFLSKQANDF  228

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L  CL RDP++RW A +LL HPF+
Sbjct  229   LSNCLRRDPKERWAASQLLKHPFL  252



>ref|XP_010252458.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nelumbo nucifera]
Length=476

 Score =   217 bits (553),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 139/355 (39%), Positives = 204/355 (57%), Gaps = 35/355 (10%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W++G+T+G GS  +V LA    +G  F VKS +  S  + L+ E  IL  +    VV 
Sbjct  34    MDWIRGRTLGRGSSATVSLASAVQSGEAFAVKSIQL-SRSECLKREQRILSCIGCSQVVG  92

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++    G    NLF+EY+ GG+L D  Q+ GG+LDE  IR + REIL GL YLH N
Sbjct  93    YKGCDVTSENGQLVYNLFMEYVPGGTLTDAIQKQGGQLDESAIRSHCREILRGLHYLHTN  152

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQG  901
             GIVH D+K RNVL+   G  K+AD GC++ V +      +   AG+P++MAPE  R ++ 
Sbjct  153   GIVHCDIKGRNVLIGKDG-AKIADLGCARWVDE------VTPFAGTPVFMAPEVARGDEQ  205

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
             G+   +D+WS+GCT+IEMATG  PW  ++++PVSA+ RIA S+D P  P+  S++  DFL
Sbjct  206   GI--PADVWSVGCTVIEMATGRPPWP-EVADPVSALYRIAFSKDTPELPNCLSEQARDFL  262

Query  1082  EKCLERDPRKRWKAEELLHHPFVNpesee------faasspasVLDRSIFPetdysdesd  1243
              KCL R+P++RW   +LL HPF+   +          + SP S+LD+  +   + S+   
Sbjct  263   SKCLMRNPKERWTTAQLLKHPFLGESNSHFKQIQGADSDSPTSILDQGFWDSLEESETHI  322

Query  1244  eedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRTS  1408
               +   L SP  +           LC    G+S   PR  + W+  E W+TVR+S
Sbjct  323   NFNS--LNSPAER--------IRRLCG---GISSSSPRLPD-WTWDENWVTVRSS  363



>ref|XP_010522353.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Tarenaya hassleriana]
Length=342

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 162/268 (60%), Gaps = 19/268 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+T+G GS  +V  A    +G +  VKSAE  S L  L+ EA+IL SL+SP+VV 
Sbjct  1     MEWTRGRTIGRGSSATVPAATCHKSGEIIAVKSAEL-SRLDLLQREAKILSSLNSPYVVG  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGGK---LDEMVIRLYTREILLGLKY  712
               G    KE CG    NL +EY   G++A+   +  G    LDE +I  YTR+IL GL+Y
Sbjct  60    YRGWEITKEPCGATTSNLLMEYAPYGTVAEAAAKNNGGGGGLDESLIVKYTRQILRGLEY  119

Query  713   LHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR  892
             LH  GI H D K  NVL+  +G   +ADFGC+KRV     PI      GSP +M+PE  R
Sbjct  120   LHSKGITHCDAKGSNVLIGKNGHAMIADFGCAKRVDSS-EPI-----RGSPAFMSPEAAR  173

Query  893   --NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQE  1066
                QG     SDIW++ CT+IEM+TG+ PW     +PV+ + R+  S + P  P   +++
Sbjct  174   GEKQGK---ESDIWAVACTVIEMSTGSPPWTADYGDPVTVIYRVGYSGESPEIPRFLTEQ  230

Query  1067  GLDFLEKCLERDPRKRWKAEELLHHPFV  1150
               DFLEKCL+R+P +RW A +LL+HPFV
Sbjct  231   AKDFLEKCLKREPEERWTARQLLNHPFV  258



>ref|XP_009109958.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Brassica rapa]
Length=431

 Score =   216 bits (550),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 170/263 (65%), Gaps = 14/263 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +G T+G GS  +V +A +  TG +F VKSA+  S   FL+ E  IL +L SPH+VK
Sbjct  3     IAWTRGPTIGRGSTATVSIATSN-TGEIFAVKSADFLSSSAFLQREQSILSTLSSPHIVK  61

Query  554   CIGKEM-CGGKKL--NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG  + C   +L  N+ +EY++GGSL  + +  GGKL E  IR +TR+IL GLKYLHE 
Sbjct  62    YIGSCLTCEKDRLVYNILMEYVSGGSLHGLIKNSGGKLPEPAIRSHTRQILKGLKYLHER  121

Query  725   GIVHSDLKCRNVLLSSSGDV-KLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
             GIVH DLK +NVL+  +G V K+AD GC+K       P+  +G +G+P +MAPE  R + 
Sbjct  122   GIVHCDLKSQNVLVGENGVVSKIADLGCAK-------PVFNSGFSGTPAFMAPEVARGEE  174

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
                  +D+W+LGCT+IEM TG+ PW  ++++ V+ + +I  S + P  P   S++G DF+
Sbjct  175   Q-RFPADVWTLGCTVIEMVTGSSPWP-ELNDAVARMYKIGYSGESPEIPEGTSEKGRDFV  232

Query  1082  EKCLERDPRKRWKAEELLHHPFV  1150
              +CL  DP++RW  EELL HPF+
Sbjct  233   MRCLRVDPKQRWTVEELLKHPFL  255



>tpg|DAA57972.1| TPA: putative MAPKKK family protein kinase, partial [Zea mays]
Length=435

 Score =   216 bits (550),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 155/259 (60%), Gaps = 7/259 (3%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSV-HLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
              W + +T+G G+ G+V  LA + A+G LF VKSA + SG   L  E  +L  L SPHVV+
Sbjct  6     RWRRLRTLGRGASGAVVSLASDAASGELFAVKSAGA-SGAATLRREHAVLRGLRSPHVVR  64

Query  554   CIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIV  733
             C+G          +F+EY  GGS+AD   + GG L+E  IR    ++L GL YLH   +V
Sbjct  65    CVGGGEGADGSYQVFLEYAPGGSVADAVARGGGALEERAIRALAADVLRGLAYLHGRSVV  124

Query  734   HSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLDC  913
             H D+K RNVLL + G  +LADFGC+ R        PL    G+P +MAPE  R +     
Sbjct  125   HGDVKARNVLLGADGRARLADFGCA-RTPGFSARRPL---GGTPAFMAPEVARGE-AQGP  179

Query  914   ASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCL  1093
             A+D+W+LGCT++EMATG  PW G  ++ ++AV RI  ++  P+ PS  S E  DFL +C 
Sbjct  180   AADVWALGCTVVEMATGRAPWGGADADVLAAVHRIGYTDAVPDAPSWMSAEARDFLARCF  239

Query  1094  ERDPRKRWKAEELLHHPFV  1150
              RD  +RW A +LL HPFV
Sbjct  240   ARDAAERWTAAQLLEHPFV  258



>ref|XP_003539360.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Glycine max]
Length=346

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 168/267 (63%), Gaps = 11/267 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQ---FLESEAEILESLD-SP  541
             + WV+G+ +GSGSF +V++A+   T   F+  +A   S +     L++E EIL+ L  SP
Sbjct  1     MNWVRGEPLGSGSFATVNIAIPTNTSTQFLSSTAVKSSYVHTSSMLKNEKEILDCLGASP  60

Query  542   HVVKCIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKY  712
             +V+ C G +     G +  N+F+EY AGGSLAD  ++ GG+L E  +R  TR ++ GLK+
Sbjct  61    YVINCFGDDHTVENGEEYYNIFLEYAAGGSLADQVKKHGGRLPESYVRRCTRSLVEGLKH  120

Query  713   LHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR  892
             +H+NG VH D+K +N+L+  +GDVK+ADFG +K   +    +      G+PL+M+PE++ 
Sbjct  121   IHDNGYVHCDVKLQNILVFQNGDVKIADFGLAKEKGEKQGKLE---CRGTPLFMSPESV-  176

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
             N    +  +DIW+LGC ++EM TG   W  + SN  S ++RI   E+ P  P   S+EG 
Sbjct  177   NDNEYESPADIWALGCAVVEMLTGKPAWDVRGSNIWSLLIRIGAGEELPKIPEELSEEGK  236

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFVN  1153
             DFL KC  +DP KRW AE LL+HPFVN
Sbjct  237   DFLLKCFVKDPMKRWSAEMLLNHPFVN  263



>ref|XP_006447587.1| hypothetical protein CICLE_v10015460mg [Citrus clementina]
 ref|XP_006469664.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Citrus sinensis]
 gb|ESR60827.1| hypothetical protein CICLE_v10015460mg [Citrus clementina]
Length=405

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 166/264 (63%), Gaps = 17/264 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G GS  +V LA +  +G +F  KS E     +FL+ E + L SL+SPH+V 
Sbjct  1     MDWTRGHTIGQGSSATVSLATSLRSGDVFAAKSTELPKS-EFLQREQKFLSSLNSPHIVG  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NLF+EY  GG+L D   + GG+LDE +I  YTR+IL GL+YLH N
Sbjct  60    YKGCDVTSEDNKLMYNLFMEYAPGGTLNDEIHRNGGRLDESLIVSYTRQILQGLEYLHSN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
              +VH D+K RN+L++ SG  K+ADFGC+K   +           G+P++MAPE  R  +Q
Sbjct  120   RVVHCDIKSRNILMAESG-AKIADFGCAKWESEALQR------GGTPMFMAPEVARGEHQ  172

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G    ASDIW++GCT+IEMA+G  PW    ++P++ + +IA S + P  P+  S++  DF
Sbjct  173   G---FASDIWAVGCTVIEMASGGAPWPNA-ADPMTILYKIAYSRELPEVPAFLSKQANDF  228

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L  CL RDP++RW A +LL HPF+
Sbjct  229   LSNCLRRDPKERWAASQLLKHPFL  252



>ref|XP_010089475.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB37868.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=406

 Score =   215 bits (547),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/264 (45%), Positives = 169/264 (64%), Gaps = 15/264 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+ +G GS  +V +A +  +G +F VKSAE  S  + L+ E +IL SL+SPHVV 
Sbjct  1     MDWNRGQIIGRGSSATVSVATSSISGEIFAVKSAEL-SQSEALQREQKILSSLNSPHVVS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG ++         NL IEY+ GG+L D  ++   + DE  I  YTR+I+ GL+YLH  
Sbjct  60    YIGHDVTRENSHLVYNLLIEYVPGGTLNDALRR-KKRPDEAAIGRYTRKIVQGLEYLHSL  118

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             G+VH D+K  N+L++ +G  K+ADFGC++         P   ++G+P +MAPE  R  +Q
Sbjct  119   GLVHCDIKGANILMAETGP-KIADFGCARWANSGDEERP---ISGTPTFMAPEAARGEHQ  174

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G   CA D+WSLGCTIIEMA+GN PW+    +PVS + R+A S + P FPS  S++  DF
Sbjct  175   G---CAGDVWSLGCTIIEMASGNSPWSNS-GDPVSVLYRVAYSGETPEFPSFLSEKAEDF  230

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L KCL R+P +RW A +LL HPF+
Sbjct  231   LGKCLRRNPEERWTASQLLKHPFL  254



>ref|XP_009394653.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=388

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/267 (45%), Positives = 162/267 (61%), Gaps = 18/267 (7%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             +W +G+T+G GS  +V LA    +G LF VKSAE  S    L+ E  IL SL  P++V C
Sbjct  5     QWRRGQTIGRGSTATVSLAAASPSGHLFAVKSAEL-SLSAHLQREQAILSSLHHPNIVSC  63

Query  557   IGKEM-----CGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
             +G ++     C     NLF+EY   GSL+D   + GG+L+E  IR YT  +L GL YLH 
Sbjct  64    LGFDVAAEAPCAPLSYNLFLEYAPLGSLSDCMMKHGGRLEEAAIRSYTGGMLRGLAYLHA  123

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAG--VAGSPLWMAPETLR-  892
                 H D+K +NVL+   G  K+AD GC++ +    +    AG  +AG+P++MAPE  R 
Sbjct  124   KSFAHCDVKSQNVLIWPDGRAKIADLGCARSIAGDGD----AGQPIAGTPMFMAPEVARG  179

Query  893   -NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
               QG     +D+W+LGCT+IEMATG  PW   + +PV+A+ RI  + D P  P+  S E 
Sbjct  180   EEQGA---PADVWALGCTVIEMATGRPPWP-DVVDPVAALHRIGFTCDVPKRPTWLSDEA  235

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFV  1150
              DFL+KCL RD R+RW AE+LL HPFV
Sbjct  236   KDFLDKCLRRDARERWPAEQLLEHPFV  262



>ref|XP_010484689.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=339

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/272 (43%), Positives = 166/272 (61%), Gaps = 21/272 (8%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +GK +G GS  +V  A  + +G    VKSA+     +FL+ EA+IL SL+SPHV+ 
Sbjct  1     MNWTRGKIIGRGSTATVSAATLQESGETIAVKSADFHRS-EFLQREAKILSSLNSPHVIG  59

Query  554   CIGKEMCG---------GKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGL  706
               G ++               NL +EY   GSLADV  + GG +DE  +  YTR+ILLGL
Sbjct  60    YRGYQITKESFNNYNGEATTYNLLMEYAPYGSLADVASKNGGSIDETRVVKYTRQILLGL  119

Query  707   KYLHEN-GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPE  883
             +Y+H + GI H D+K  NVL+  +G+ K+ADFGC+KR++    P     V G+P +MAPE
Sbjct  120   EYVHNSMGIAHCDIKGSNVLVGENGEAKIADFGCAKRIE----PEITEPVRGTPAFMAPE  175

Query  884   TLR--NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISN-PVSAVLRIACSEDRPNFPSH  1054
               R   QG     SDIW++GCT+IEM TG+ PW+G  SN PVS + R+    + P  P  
Sbjct  176   VARGERQGK---ESDIWAVGCTVIEMVTGSTPWSGADSNDPVSVLYRVGYLGESPELPCS  232

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              +++  DFL KCL++D ++RW A +LL+HPF+
Sbjct  233   LTEQAKDFLGKCLKKDAKERWTASQLLNHPFL  264



>ref|XP_009793037.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Nicotiana 
sylvestris]
Length=489

 Score =   217 bits (552),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/263 (43%), Positives = 169/263 (64%), Gaps = 10/263 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G  +G GS  +V LA N ++G LF VKS E  S    L+ E  ++  L+SP +V 
Sbjct  1     MEWTRGPIIGRGSSATVSLATN-SSGELFAVKSTEL-SCSNILQREYSLISQLNSPFLVN  58

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             C G ++   +     N+F+EY+ GG+L+D+ ++ GG L+E VI+ Y ++IL GL YLH  
Sbjct  59    CFGFDITSEQNKTTYNMFMEYIPGGTLSDLIKKQGGSLNESVIKSYAQQILQGLDYLHSI  118

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             G+VH D+K +N+L+   G +K+AD GC K V+   +    +G++G+P +M+PE  R +  
Sbjct  119   GVVHCDIKGQNILIGQDG-IKIADLGCGKFVRDENSAN--SGISGTPAFMSPEVARGEEQ  175

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                A DIW+ GCTIIEMATG+ PW   + +PVSA+ RI  S D P FP+  S +  +FL 
Sbjct  176   RFTA-DIWAFGCTIIEMATGSPPWT-DMKDPVSALYRIGYSGDVPQFPNSLSNDAREFLA  233

Query  1085  KCLERDPRKRWKAEELLHHPFVN  1153
             KCL +DP++RW A++LL HPF+ 
Sbjct  234   KCLIKDPKERWTAKQLLQHPFLQ  256



>ref|XP_008385962.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1 
[Malus domestica]
 ref|XP_008366461.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=494

 Score =   217 bits (552),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 167/266 (63%), Gaps = 15/266 (6%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G TVG GS  +V LA +  +G  F VKS E  S   FL+ E   L  L  PH+VK +
Sbjct  4     WTRGPTVGRGSTATVSLATSTISGERFAVKSTELSSS-SFLQKEQCFLSKLSCPHIVKYL  62

Query  560   GKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGI  730
             G  +         NL +EY++GG+L D  ++ GG L+E +I+LYT +I+ GL+YLHEN +
Sbjct  63    GCNVSIENNXHMYNLCMEYVSGGTLFDAIRRRGGPLEEAMIQLYTHQIVQGLEYLHENKL  122

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVK----KHPNPIPLAGVAGSPLWMAPETLR--  892
             VH D+K +N+L +     K+AD GC+K V+       +    A ++G+P++MAPE  R  
Sbjct  123   VHCDIKSQNILXTEES-AKIADLGCAKLVQGVAEDEYSVEASATISGTPVFMAPEVARGE  181

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              QG     +DIW+LGCTIIEMATG  PW  +I++PVSA+ RI  S + P  PS  S +G 
Sbjct  182   EQG---FGADIWALGCTIIEMATGGGPWP-EINDPVSAIYRIGFSGEVPEIPSRLSSKGK  237

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KCL +DPR+RW A++LL HPF+
Sbjct  238   DFLSKCLMKDPRERWTAKQLLEHPFL  263



>ref|XP_006364162.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum tuberosum]
Length=336

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/268 (44%), Positives = 167/268 (62%), Gaps = 19/268 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W++G T+G GS  +V  A ++ +G +F VKS E  S  Q L+ E +IL  L SP++V 
Sbjct  1     MDWIRGHTIGHGSSAAVWAAKSRFSGEVFAVKSVEL-SKSQLLQKEQKILSELSSPYIVS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++   K+    NL +EYM  G+L+D  ++  G ++E +I  YT++I+ GL+YLH  
Sbjct  60    YKGYDVTKEKEKLMFNLMMEYMPDGTLSDEIRKQDGWVNEPLIGYYTKQIVQGLEYLHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAG----VAGSPLWMAPETLR  892
             GI H D+K +N+LLS +G  K+ DFGCS+ V    +P  + G    + G+P++MAPE  R
Sbjct  120   GIAHCDIKGQNILLSKTG-AKITDFGCSRWV----DPANMDGGANPIGGTPMFMAPEVAR  174

Query  893   --NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQE  1066
                QG   C +DIW LGCTIIEMATG  PW   ++N  S + +IA S   P  P   S +
Sbjct  175   GEEQG---CPADIWGLGCTIIEMATGGSPWT-NVTNSASLLYKIAFSGQSPEIPKILSLQ  230

Query  1067  GLDFLEKCLERDPRKRWKAEELLHHPFV  1150
               DFL KCL RDPR+RW A+ELL HPF+
Sbjct  231   ARDFLNKCLIRDPRERWTAKELLKHPFL  258



>ref|XP_008676309.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Zea mays]
Length=448

 Score =   216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 155/259 (60%), Gaps = 7/259 (3%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSV-HLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
              W + +T+G G+ G+V  LA + A+G LF VKSA + SG   L  E  +L  L SPHVV+
Sbjct  6     RWRRLRTLGRGASGAVVSLASDAASGELFAVKSAGA-SGAATLRREHAVLRGLRSPHVVR  64

Query  554   CIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIV  733
             C+G          +F+EY  GGS+AD   + GG L+E  IR    ++L GL YLH   +V
Sbjct  65    CVGGGEGADGSYQVFLEYAPGGSVADAVARGGGALEERAIRALAADVLRGLAYLHGRSVV  124

Query  734   HSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLDC  913
             H D+K RNVLL + G  +LADFGC+ R        PL    G+P +MAPE  R +     
Sbjct  125   HGDVKARNVLLGADGRARLADFGCA-RTPGFSARRPL---GGTPAFMAPEVARGE-AQGP  179

Query  914   ASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCL  1093
             A+D+W+LGCT++EMATG  PW G  ++ ++AV RI  ++  P+ PS  S E  DFL +C 
Sbjct  180   AADVWALGCTVVEMATGRAPWGGADADVLAAVHRIGYTDAVPDAPSWMSAEARDFLARCF  239

Query  1094  ERDPRKRWKAEELLHHPFV  1150
              RD  +RW A +LL HPFV
Sbjct  240   ARDAAERWTAAQLLEHPFV  258



>gb|ACH99694.1| NPKL2 [Oryza sativa Japonica Group]
Length=394

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 159/258 (62%), Gaps = 9/258 (3%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSV-HLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             W + +T+G G+ G+V  LA +  +G LF VKSA + +  + L  E  IL  L SPHV+ C
Sbjct  9     WTRVRTLGRGASGAVVSLAADDRSGALFAVKSAAAAAAAEQLVREGRILSGLRSPHVLPC  68

Query  557   IGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVH  736
             +G     G +  LF+E+  GGSLADV  + GG+LDE  IR Y  ++  GL YLH   +VH
Sbjct  69    LGFRAEAGGECQLFLEFAPGGSLADVVARSGGRLDECAIRAYAADVARGLAYLHGMSLVH  128

Query  737   SDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLDCA  916
              D+K RNV++ + G  K+ADFGC++ V     PI      G+P +MAPE  R +   + A
Sbjct  129   GDVKGRNVVVGADGRAKIADFGCARTVGSD-RPI-----GGTPAFMAPEVARGE-EQEPA  181

Query  917   SDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCLE  1096
             +D+W+LGCT+IEMATG  PW+  + + +SAV RI  ++  P  P   S E  DFL +C  
Sbjct  182   ADVWALGCTVIEMATGRAPWS-DMEDILSAVRRIGYTDAVPEVPEWLSAEAKDFLARCFA  240

Query  1097  RDPRKRWKAEELLHHPFV  1150
             R+PR+RW + +LL HPF+
Sbjct  241   RNPRERWTSSQLLEHPFL  258



>ref|XP_002966267.1| hypothetical protein SELMODRAFT_230838 [Selaginella moellendorffii]
 gb|EFJ32294.1| hypothetical protein SELMODRAFT_230838 [Selaginella moellendorffii]
Length=518

 Score =   217 bits (553),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/279 (40%), Positives = 173/279 (62%), Gaps = 16/279 (6%)
 Frame = +2

Query  353   KCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKS------------AESDSGLQ  496
             + +  R + W KG+ +G G++G V++ MN  +G L  VK             A+  + ++
Sbjct  4     QSTSPRAIRWRKGELIGVGAYGRVYMGMNLDSGELIAVKQVLIAASNFAKGKAQLSAHIR  63

Query  497   FLESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIR  676
              LE E ++L++L  P++V+ +G      + LN+F+E++ GGS++ +  +FG    E VIR
Sbjct  64    ELEEEVKLLQNLSHPNIVRYLGTAR-EEEALNIFLEFVPGGSISSLLGKFGS-FTEPVIR  121

Query  677   LYTREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVA  856
             +YTR++LLGL+YLH+N I+H D+K  N+L+ + G +K+ADFG SK+V +         + 
Sbjct  122   MYTRQLLLGLEYLHQNKIMHRDIKGANILVDNQGHIKVADFGASKKVLELATISEAKSMK  181

Query  857   GSPLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDR  1036
             G+P WMAPE +R Q G +  +DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  
Sbjct  182   GTPYWMAPEVVR-QTGHNWQADIWSVGCTVIEMATGKPPWSDQFQE-VAALFHIGTTKSH  239

Query  1037  PNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             P  P H S +   FL KCL+R+PR R  A ELL HPFV+
Sbjct  240   PPIPEHLSPDAKSFLLKCLQREPRLRPTAAELLKHPFVS  278



>ref|XP_008379645.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Malus domestica]
Length=424

 Score =   215 bits (547),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 165/264 (63%), Gaps = 12/264 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G GS  +V LA ++ +G  F VKSAE  S  QFL+ E +I   L SPH+V 
Sbjct  1     MDWTRGCTIGQGSSATVSLATSRHSGDKFAVKSAEM-SHSQFLQREQKIFSVLSSPHIVS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++         NL +EY+ GG++ D  +  GG++DE +IR YTR ++ GL YLH  
Sbjct  60    YMGHDITNENNKLVYNLLMEYVPGGTIIDAIRSRGGQVDESIIRNYTRGMVKGLDYLHSL  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQG  901
             G+VH D+K RN+L+   G  K+ADFGC++    +P    +A + G+P++MAPE  R  + 
Sbjct  120   GLVHCDIKGRNILVGEDG-PKIADFGCARWA--NPAAASVATIGGTPMFMAPEVARGEEQ  176

Query  902   GLDCASDIWSLGCTIIEMAT-GNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G  C  D+W+LGCTIIEMAT G+ PW    ++PV+ + +IA S + P  PS  S +   F
Sbjct  177   GFAC--DVWALGCTIIEMATGGSAPWP-NAADPVTVLYQIAYSNELPEIPSFLSDQAKHF  233

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             LE+CL RDP  RW A +LL H F+
Sbjct  234   LERCLRRDPTDRWTASQLLKHSFL  257



>ref|XP_010236368.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Brachypodium distachyon]
Length=472

 Score =   216 bits (550),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/263 (43%), Positives = 159/263 (60%), Gaps = 12/263 (5%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQF---LESEAEILESLDSPHV  547
             EW +G  +G G+  +V +A +  TG  F VKS     G+     L  E  +L +L SP+V
Sbjct  7     EWRRGPVIGRGASATVSIATDALTGEAFAVKSV----GIALAGALRREQSVLSALSSPYV  62

Query  548   VKCIGKEMCG--GKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
             V C+G       G+   LF+E   GGSLAD  ++ GG+ +E ++     ++L GL ++H 
Sbjct  63    VSCVGSSGASDDGRSYELFLELAPGGSLADEMKRCGGRCEEALVASRAGDVLRGLAHVHG  122

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
              GI H D+K RNVLL + G  KLADFGC++   K         + G+P++M+PE  R + 
Sbjct  123   AGIAHCDVKARNVLLGADGRAKLADFGCARWTTKAKEDGIGNAIMGTPMFMSPEAARGE-  181

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
                 A+DIW+LGCT+IEMATG  PW  + S+PV+A+  +A S D P  PS FS++G DFL
Sbjct  182   AQGAAADIWALGCTVIEMATGGAPW--RFSSPVAALHHVAHSGDVPEAPSWFSEQGKDFL  239

Query  1082  EKCLERDPRKRWKAEELLHHPFV  1150
              +CL RDP +RW AE+LL HPFV
Sbjct  240   ARCLVRDPAQRWTAEQLLEHPFV  262



>ref|XP_002881230.1| MAPKKK17 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57489.1| MAPKKK17 [Arabidopsis lyrata subsp. lyrata]
Length=372

 Score =   213 bits (542),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 167/269 (62%), Gaps = 18/269 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +GK +G GS  +V+ A    +  +  VKS+E     +FL+ EA+IL SL+SP+V+ 
Sbjct  1     MEWTRGKILGRGSTATVYAATCHNSDEILAVKSSELHHS-EFLQREAKILSSLNSPYVIG  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G    +E  G    N+ +EY   G+L D   + GG++DE  +  YTREIL GL+Y+H 
Sbjct  60    YRGSETKRESNGVVTYNILMEYAPYGTLTDAAAKNGGRVDETRVVKYTREILRGLEYVHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKH-PNPIPLAGVAGSPLWMAPETLR--  892
              GIVH D+K  NV+L+  G+ K+ADFGC+KRV +   +P     V G+P +MAPE  R  
Sbjct  120   EGIVHCDVKGSNVVLAEKGEAKIADFGCAKRVDQEFESP-----VMGTPAFMAPEVARGE  174

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPW--AGKISNPVSAVLRIACSEDRPNFPSHFSQE  1066
              QG     SDIW++GCT+IEM TG+ PW  A    +PVS + R+  S + P  P   ++E
Sbjct  175   KQGK---ESDIWAVGCTVIEMVTGSPPWTEANSREDPVSVLYRVGYSGETPELPCLLAEE  231

Query  1067  GLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
               DFLEKCL+R+ ++RW A +LL+HPF+ 
Sbjct  232   AKDFLEKCLKREAKERWTATQLLNHPFLT  260



>ref|XP_004243852.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum lycopersicum]
Length=329

 Score =   212 bits (539),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 166/264 (63%), Gaps = 17/264 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W++G T+G GS  +V  A +  +G +F VKS E  S  Q L+ E +IL  L SP+VV+
Sbjct  1     MDWIRGHTIGRGSSAAVSAAKSILSGEVFAVKSVEL-SKSQLLQKEQKILSQLSSPYVVR  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++   K     N+ +EYM  G+L+D  ++  G+++E +I  YT++++ GL YLH  
Sbjct  60    YMGYDVTKEKDKLMFNVRMEYMPDGTLSDEIRKQSGRMNERLIGYYTKQMVQGLDYLHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             GI H D+K +N+LL  SG  K+ADFGC++ +       P   + G+P++MAPE  R   Q
Sbjct  120   GIAHCDIKGQNILLGESG-AKIADFGCARWIH------PAEPIGGTPMFMAPEVARGAEQ  172

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G   CA+DIW LGCTIIEMATG  PW   ++N  S + +IA SE  P  P   S +  DF
Sbjct  173   G---CAADIWGLGCTIIEMATGGSPWTN-VTNAASLLYKIAFSEQSPEIPKFLSLQATDF  228

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L KCL RDP++RW A++LL HPF+
Sbjct  229   LNKCLTRDPKERWTAKQLLKHPFL  252



>ref|XP_004289177.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Fragaria vesca subsp. vesca]
Length=415

 Score =   214 bits (546),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 168/264 (64%), Gaps = 14/264 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T+G GS   V LA    +  +F VKSAE  S  +FL+ E +IL +L  PHVV 
Sbjct  1     MDWTRGQTIGRGSSAVVSLATGSCSK-VFAVKSAEL-SQSEFLQREQKILSTLSCPHVVS  58

Query  554   CIGKEMCG-GKKL--NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++     KL  N+F+EY+AGG++ D  +  GG+L+E  +R YTREI  GL YLH  
Sbjct  59    YLGHDITRENNKLMYNIFMEYVAGGTIIDAIRNCGGQLEESAVRFYTREIAKGLAYLHSV  118

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQG  901
             G+VH D+K RN+L+   G +K+ADFGC++        +P   + G+P++M+PE  R  + 
Sbjct  119   GLVHCDIKGRNILVGEEG-LKIADFGCARWADPAAEAVP---IGGTPMFMSPEVARGEEQ  174

Query  902   GLDCASDIWSLGCTIIEMAT-GNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G  C  D+W+LGCT+IEMAT G++PW    ++PV+ + RIA S + P  PS  S +  DF
Sbjct  175   GFPC--DVWALGCTVIEMATGGSVPWPNA-ADPVTLLYRIAYSGESPEIPSFLSDQARDF  231

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L KC  RDP++RW   +LL HPF+
Sbjct  232   LGKCFMRDPKERWTVTQLLKHPFL  255



>gb|AGA37258.1| mitogen activated kinase kinase kinase 18.2 [Brassica napus]
Length=342

 Score =   212 bits (540),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 166/264 (63%), Gaps = 14/264 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W + KT+G GS  +V+ A  + +G    VKSAE     +FL+ EA++L S++SP+V+   
Sbjct  3     WTREKTIGRGSSATVYAATCQESGETIAVKSAEFHQS-EFLQREAKLLSSMNSPYVIGYR  61

Query  560   GKEMCGG--KKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN-GI  730
             G E+        NL +EY   G++ADV  + GG +DE  +  YTR+ILLGL+Y+H++ GI
Sbjct  62    GCEVTKEPLATYNLLMEYAPYGTMADVAAKNGGCIDEARVVSYTRQILLGLEYVHDSKGI  121

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQGG  904
              H D+K  NVL+  +G+ K+ADFGC+KRV+    P     V G+P +MAPE  R   QG 
Sbjct  122   AHCDVKGSNVLVGVNGEAKIADFGCAKRVE----PELTEPVRGTPAFMAPEVARGERQGK  177

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKIS-NPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
                 SDIW+LGCT+IEM TG+ PW G  S +PVS + R+    + P  PS  +++  DFL
Sbjct  178   ---ESDIWALGCTVIEMVTGSPPWVGGDSTDPVSVLYRVGYMGESPELPSSLTEQAKDFL  234

Query  1082  EKCLERDPRKRWKAEELLHHPFVN  1153
              KCL RD ++RW A +LL+HPFV 
Sbjct  235   GKCLRRDAKERWTATQLLNHPFVT  258



>ref|XP_004243851.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum lycopersicum]
Length=322

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 130/356 (37%), Positives = 197/356 (55%), Gaps = 48/356 (13%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T+G GS  +V +A ++ +  +F VKS E  S  Q L+ E +IL  L SP++V+
Sbjct  1     MDWTRGRTIGHGSTAAVFVAKSRFSDEVFAVKSVEL-SKSQLLQKEQKILSQLISPYIVR  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NL +EYM  G+L+D  ++ GG+++E +I  YT++++ GL++LH  
Sbjct  60    YKGYDVTKENDKLIFNLMMEYMPDGTLSDEIRKQGGRMNEPLIGYYTKQMVKGLEFLHSG  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             G+ H D+K +N+LL  SG   +ADFGC++ +       P   + G+P++MAPE  R   Q
Sbjct  120   GLAHCDIKGQNILLGKSG-ATIADFGCARWID------PAEPIGGTPMFMAPEVARGEEQ  172

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G   C +DIW LGCT+IEMATG  PW   ++N  S + +IA SE  P  P   S +  DF
Sbjct  173   G---CPADIWGLGCTMIEMATGGSPW-NNVTNAASLLYKIAFSEQSPKIPKFLSLQARDF  228

Query  1079  LEKCLERDPRKRWKAEELLHHPFVNpeseefa---asspasVLDRSIFPetdysdesdee  1249
             L KCL RDP++RW A++LL HPF+   +        SSP S+LD+ I+        S+  
Sbjct  229   LSKCLRRDPKERWTAKQLLKHPFLESNTTTIQDFVTSSPTSILDQDIW-------NSEST  281

Query  1250  detPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGE---HWSTSEEWITVRTS  1408
                 + SP+ +                  V E     GE    W+  E WITVR+S
Sbjct  282   ISQTVSSPLQR------------------VRELGSNLGESNCRWNDDERWITVRSS  319



>emb|CDY18290.1| BnaC05g03130D [Brassica napus]
Length=337

 Score =   212 bits (539),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 166/264 (63%), Gaps = 14/264 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W + KT+G GS  +V+ A  + +G    VKSAE     +FL+ EA++L S++SP+V+   
Sbjct  3     WTREKTIGRGSSATVYAATCQESGETIAVKSAEFHQS-EFLQREAKLLSSMNSPYVIGYR  61

Query  560   GKEMCGG--KKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN-GI  730
             G E+        NL +EY   G++ADV  + GG +DE  +  YTR+ILLGL+Y+H++ GI
Sbjct  62    GCEVTKEPLATYNLLMEYAPYGTMADVAAKNGGCIDEARVVSYTRQILLGLEYVHDSKGI  121

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQGG  904
              H D+K  NVL+  +G+ K+ADFGC+KRV+    P     V G+P +MAPE  R   QG 
Sbjct  122   AHCDVKGSNVLVGVNGEAKIADFGCAKRVE----PELTEPVRGTPAFMAPEVARGERQGK  177

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKIS-NPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
                 SDIW+LGCT+IEM TG+ PW G  S +PVS + R+    + P  PS  +++  DFL
Sbjct  178   ---ESDIWALGCTVIEMVTGSPPWVGGDSTDPVSVLYRVGYMGESPELPSSLTEQAKDFL  234

Query  1082  EKCLERDPRKRWKAEELLHHPFVN  1153
              KCL RD ++RW A +LL+HPFV 
Sbjct  235   GKCLRRDAKERWTATQLLNHPFVT  258



>ref|XP_009361098.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Pyrus x bretschneideri]
Length=465

 Score =   216 bits (549),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 169/261 (65%), Gaps = 13/261 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G TVG GS  +V LA + + G  F VKSAE  S    L+ E   L  L SPH+VK +
Sbjct  4     WTRGPTVGRGSTATVSLATS-SDGERFAVKSAELSSS-ALLQKEQCFLSKLSSPHIVKYL  61

Query  560   GKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGI  730
             G  +    K    NL +EY+ GG+L D  ++ GG+L+E VI+LYT +I+ GL+YLH N +
Sbjct  62    GYNVSIENKKPMYNLCMEYIPGGTLFDAIRRRGGRLEEAVIQLYTHQIVQGLEYLHVNKL  121

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQGGL  907
             VH D+K +N+L++     K+AD GC+K V+          ++G+P++MAPE  R  + G 
Sbjct  122   VHCDIKSQNILVTGE-TAKIADLGCAKLVQGVEAS---TTISGTPVFMAPEVARCEEQGF  177

Query  908   DCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEK  1087
             +  +DIW+LGCTIIEMATG+ PW  +I++PVSA+ RI  S + P  PS  S +G DFL K
Sbjct  178   E--ADIWALGCTIIEMATGSGPWP-EINDPVSALYRIGFSGELPEIPSQLSSKGKDFLSK  234

Query  1088  CLERDPRKRWKAEELLHHPFV  1150
             CL +DPR+RW A++LL HPF+
Sbjct  235   CLMKDPRERWTAKQLLEHPFL  255



>ref|XP_004243483.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum lycopersicum]
Length=329

 Score =   212 bits (539),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 166/264 (63%), Gaps = 17/264 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W++G T+G GS  +V  A +  +G +F VKS E  S  Q L+ E +IL  L SP+VVK
Sbjct  1     MDWIRGHTIGRGSSAAVSAAKSILSGEVFAVKSVEL-SKSQLLQKEQKILSQLSSPYVVK  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++   K     N+ +EYM  G+L+D  ++  G+++E +I  YT++++ GL YLH  
Sbjct  60    YMGYDVTKEKDKLMFNVRMEYMPDGTLSDEIRKQSGRMNERLIGYYTKQMVQGLDYLHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             GI H D+K +N+LL  SG  K+ADFGC++ +       P   + G+P++MAPE  R   Q
Sbjct  120   GIAHCDIKGQNILLGESG-AKIADFGCARWIH------PAEPIGGTPMFMAPEVARGEEQ  172

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G   CA+DIW LGCTIIEMATG  PW   ++N  S + +IA SE  P  P   S +  DF
Sbjct  173   G---CAADIWGLGCTIIEMATGGSPW-NNVTNAASLLYKIAFSEQSPEIPKFLSLQARDF  228

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L KCL RDP++RW A++LL HPF+
Sbjct  229   LSKCLTRDPKERWTAKQLLKHPFL  252



>ref|NP_001043978.1| Os01g0699400 [Oryza sativa Japonica Group]
 dbj|BAF05892.1| Os01g0699400, partial [Oryza sativa Japonica Group]
Length=413

 Score =   214 bits (545),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 159/258 (62%), Gaps = 9/258 (3%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSV-HLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             W + +T+G G+ G+V  LA +  +G LF VKSA + +  + L  E  IL  L SPHV+ C
Sbjct  9     WTRVRTLGRGASGAVVSLAADDRSGALFAVKSAAAAAAAEQLVREGRILSGLRSPHVLPC  68

Query  557   IGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVH  736
             +G     G +  LF+E+  GGSLADV  + GG+LDE  IR Y  ++  GL YLH   +VH
Sbjct  69    LGFRAEAGGECQLFLEFAPGGSLADVVARSGGRLDECAIRAYAADVARGLAYLHGMSLVH  128

Query  737   SDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLDCA  916
              D+K RNV++ + G  K+ADFGC++ V     PI      G+P +MAPE  R +   + A
Sbjct  129   GDVKGRNVVVGADGRAKIADFGCARTVGSD-RPI-----GGTPAFMAPEVARGE-EQEPA  181

Query  917   SDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCLE  1096
             +D+W+LGCT+IEMATG  PW+  + + +SAV RI  ++  P  P   S E  DFL +C  
Sbjct  182   ADVWALGCTVIEMATGRAPWS-DMEDILSAVRRIGYTDAVPEVPEWLSAEAKDFLARCFA  240

Query  1097  RDPRKRWKAEELLHHPFV  1150
             R+PR+RW + +LL HPF+
Sbjct  241   RNPRERWTSSQLLEHPFL  258



>ref|XP_008226949.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Prunus mume]
Length=476

 Score =   216 bits (549),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 116/265 (44%), Positives = 166/265 (63%), Gaps = 13/265 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G T+G GS  +V LA    +G LF VKS E  S   FL+ E   L  L  P++VK +
Sbjct  4     WTRGPTIGRGSTATVSLATAALSGELFAVKSTEL-SCSSFLQKEQCFLSKLSCPNIVKYL  62

Query  560   GKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGI  730
             G  +         NL +EY+ GG+L D  ++ GG+L+E  I+LYT +I+ GL+YLH NG+
Sbjct  63    GCNVSTENNRPMYNLLMEYVPGGTLFDTIRRHGGRLEEPAIQLYTHQIVQGLEYLHVNGL  122

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVKK----HPNPIPLAGVAGSPLWMAPETLR-N  895
             VH D+K +N+L+      K+AD GC+K V++      +      ++G+P++MAPE  R  
Sbjct  123   VHCDIKSQNILVDEEC-AKIADLGCAKSVQRVAGDEDSATSSTIISGTPVFMAPEVARGE  181

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             + G +  +DIW+LGCTIIEMATG+ PW  ++ + VSA+ RI  S D P  P+  S +G D
Sbjct  182   EQGFE--ADIWALGCTIIEMATGDGPWP-ELKDAVSALYRIGFSSDLPEIPTRLSNKGKD  238

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FL KCL RDPR+RW A++LL HPF+
Sbjct  239   FLNKCLRRDPRERWTAKQLLEHPFL  263



>gb|EAZ13219.1| hypothetical protein OsJ_03139 [Oryza sativa Japonica Group]
Length=418

 Score =   214 bits (545),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 159/258 (62%), Gaps = 9/258 (3%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSV-HLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             W + +T+G G+ G+V  LA +  +G LF VKSA + +  + L  E  IL  L SPHV+ C
Sbjct  9     WTRVRTLGRGASGAVVSLAADDRSGALFAVKSAAAAAAAEQLVREGRILSGLRSPHVLPC  68

Query  557   IGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVH  736
             +G     G +  LF+E+  GGSLADV  + GG+LDE  IR Y  ++  GL YLH   +VH
Sbjct  69    LGFRAEAGGECQLFLEFAPGGSLADVVARSGGRLDECAIRAYAADVARGLAYLHGMSLVH  128

Query  737   SDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLDCA  916
              D+K RNV++ + G  K+ADFGC++ V     PI      G+P +MAPE  R +   + A
Sbjct  129   GDVKGRNVVVGADGRAKIADFGCARTVGSD-RPI-----GGTPAFMAPEVARGE-EQEPA  181

Query  917   SDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCLE  1096
             +D+W+LGCT+IEMATG  PW+  + + +SAV RI  ++  P  P   S E  DFL +C  
Sbjct  182   ADVWALGCTVIEMATGRAPWS-DMEDILSAVRRIGYTDAVPEVPEWLSAEAKDFLARCFA  240

Query  1097  RDPRKRWKAEELLHHPFV  1150
             R+PR+RW + +LL HPF+
Sbjct  241   RNPRERWTSSQLLEHPFL  258



>gb|EAY75501.1| hypothetical protein OsI_03400 [Oryza sativa Indica Group]
Length=418

 Score =   214 bits (544),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 159/258 (62%), Gaps = 9/258 (3%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSV-HLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             W + +T+G G+ G+V  LA +  +G LF VKSA + +  + L  E  IL  L SPHV+ C
Sbjct  9     WTRVRTLGRGASGAVVSLAADDRSGALFAVKSAAAAAAAEQLVREGRILSGLRSPHVLPC  68

Query  557   IGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVH  736
             +G     G +  LF+E+  GGSLADV  + GG+LDE  IR Y  ++  GL YLH   +VH
Sbjct  69    LGFRAEAGGECQLFLEFAPGGSLADVVARSGGRLDECAIRAYAADVARGLAYLHGMSLVH  128

Query  737   SDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLDCA  916
              D+K RNV++ + G  K+ADFGC++ V     PI      G+P +MAPE  R +   + A
Sbjct  129   GDVKGRNVVVGADGRAKIADFGCARTVGSD-RPI-----GGTPAFMAPEVARGE-EQEPA  181

Query  917   SDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCLE  1096
             +D+W+LGCT+IEMATG  PW+  + + +SAV RI  ++  P  P   S E  DFL +C  
Sbjct  182   ADVWALGCTVIEMATGRAPWS-DMEDILSAVRRIGYTDAVPEVPEWLSAEAKDFLARCFA  240

Query  1097  RDPRKRWKAEELLHHPFV  1150
             R+PR+RW + +LL HPF+
Sbjct  241   RNPRERWTSSQLLEHPFL  258



>ref|XP_009119207.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Brassica 
rapa]
Length=337

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/266 (44%), Positives = 166/266 (62%), Gaps = 14/266 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W + KT+G GS  +V+ A  + +G    VKSAE     +FL+ EA++L SL+SP+V+ 
Sbjct  1     MNWTREKTIGRGSSATVYAATCQDSGETIAVKSAEFHQS-EFLQREAKLLSSLNSPYVIG  59

Query  554   CIGKEMCGG--KKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN-  724
               G E+        NL +EY   G+LADV  + GG +DE  +  YTR+ILLGL+Y+H + 
Sbjct  60    YRGCEVTKEPLATYNLLMEYAPYGTLADVAAKNGGCIDEARVVSYTRQILLGLEYVHNSK  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             GI H D+K  NVL+  +G+ K+ADFGC+KRV+    P     V G+P +MAPE  R   Q
Sbjct  120   GIAHCDVKASNVLVGENGEAKIADFGCAKRVE----PELTEPVRGTPAFMAPEVARGERQ  175

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWA-GKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             G     SDIW+LGCT+IEM TG+ PW+    ++PVS + R+    + P  PS  +++  D
Sbjct  176   GK---ESDIWALGCTVIEMVTGSHPWSDADYTDPVSVLYRVGYMGESPELPSSLTEQAKD  232

Query  1076  FLEKCLERDPRKRWKAEELLHHPFVN  1153
             FL KCL R+ ++RW A +LL+HPFV 
Sbjct  233   FLGKCLRREAKERWTATQLLNHPFVT  258



>ref|XP_003611720.1| Protein kinase-like protein [Medicago truncatula]
 gb|AES94678.1| MAP3K-like kinase [Medicago truncatula]
Length=353

 Score =   212 bits (539),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 171/268 (64%), Gaps = 15/268 (6%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLF----VVKSAESDSGLQFLESEAEILESL-DSPH  544
             WV+GK +GSG+F +V+LA +    G+F     VK++++  G  FL +E +ILESL  SPH
Sbjct  4     WVRGKMLGSGTFATVNLATHPQNSGIFPSLTAVKTSDT-YGSHFLINEKQILESLGSSPH  62

Query  545   VVKCIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
             ++K  G +     G +  N+F+EY AGG+L+D  +  GGKL E ++R YTR ++ GLK++
Sbjct  63    IIKYFGHDQTFENGEECYNIFLEYAAGGTLSDQLKNHGGKLPENLVRRYTRSVVQGLKHV  122

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSK-RVKKHPNPIPLAGVAGSPLWMAPETLR  892
             HENG VH D+K +N+L+  + +VK++DFG +K +  KH   +      G+PL+M+PE + 
Sbjct  123   HENGFVHCDVKLQNILVFENDEVKISDFGLAKEKGLKHGGKLE---CRGTPLYMSPEAV-  178

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPW-AGKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
             N+   +  +DIW+LGC I+EMATG   W     SN  S ++RI   ++ P  P   SQ G
Sbjct  179   NESVYESPADIWALGCAIVEMATGKHAWNVSSGSNMWSLLIRIGAEDESPLIPDELSQVG  238

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              DFLEKC  +DP KRW AE LL H F++
Sbjct  239   KDFLEKCFIKDPSKRWTAEMLLKHEFIS  266



>ref|XP_010469578.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=363

 Score =   212 bits (540),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 165/265 (62%), Gaps = 14/265 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+T+G GS  +V+ A    +  +  VKS+E     +FL+ EA+IL  LDSP+V+ 
Sbjct  1     MEWTRGRTLGRGSTATVYAATCHNSEEVLAVKSSELHRS-EFLKREAKILSLLDSPYVIG  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G    +E  G    NL +EY   G+L +V  + GG+LDE  +  YTREIL GL+Y+H 
Sbjct  60    YRGSETKRESNGVVTYNLLMEYAPYGTLTEVAAKNGGRLDETRVVKYTREILKGLEYIHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              GI H D+K  NV+L+  G+ K+ADFGC+KRV    +P     V G+P +MAPE  R   
Sbjct  120   EGIAHCDVKGSNVVLAEKGEAKIADFGCAKRV----DPEFELMVMGTPAFMAPEVARGEK  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG     SDIW++GCT+IEM TG+ PW     +P+S + R+  S + P  P   +++  D
Sbjct  176   QGK---ESDIWAVGCTVIEMLTGSPPWTEARDDPLSVLYRVGYSGETPELPCLLAEDAKD  232

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FLEKCL+R+ ++RW A +LL+HPF+
Sbjct  233   FLEKCLKREAKERWTAAQLLNHPFL  257



>gb|EYU27355.1| hypothetical protein MIMGU_mgv1a026298mg [Erythranthe guttata]
Length=417

 Score =   214 bits (544),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 144/361 (40%), Positives = 200/361 (55%), Gaps = 39/361 (11%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKAT--GG--LFVVKSAESDSGLQFLESEAEILESLDSP  541
             +EW +G  +G GS   V LA   A   GG  LF VKSA+  S    LE+E  +L  L SP
Sbjct  1     MEWKRGPILGRGSSAVVSLATTAAAADGGCDLFAVKSADV-SCSALLENEQCLLSQLCSP  59

Query  542   HVVKCIGKEMC----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLK  709
              VVKC G ++      G   NLF+EY+ GG+L+D+ +  GG L+E  I+ Y R++LLGL 
Sbjct  60    FVVKCFGSDVTCERGDGHVYNLFLEYVPGGTLSDLIRNHGGSLEEEAIQFYARQMLLGLD  119

Query  710   YLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETL  889
             YLH  G+ H D+K +NVL+++ G +K+ADFGC+K  +           AG+P +MAPE  
Sbjct  120   YLHLKGMAHCDVKGQNVLIAADGGLKIADFGCAKWAECGGGSA--TKFAGTPAYMAPEVA  177

Query  890   RNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
             R +      +DIW+LGCT+IEMATG+ PW  ++ +P SA+ R+A S D P  P  FS  G
Sbjct  178   RGE-EQSFPADIWALGCTVIEMATGSNPWP-EMKDPASALYRVAYSGDTPEVPDWFSGTG  235

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPF---VNpeseefaasspasVLDRSIFPetdysdes  1240
              DF+ +CL RDPR+RW A ELL HPF   V  ++ EFA  SP SV+D+  +   +     
Sbjct  236   KDFVARCLMRDPRERWTAAELLLHPFFDSVGKKNTEFARKSPTSVMDQGFWDAVE-----  290

Query  1241  deedetPLRSPVPKPTTNRFFP-------FSILCENKFGVSEQHPRFGEHWSTSEEWITV  1399
                    +  P P PT     P          L  ++F  +   P     W+   +W+TV
Sbjct  291   -------VSDPSPNPTDFAMSPENSPAGRIMDLIGDEFSWNLNFP----EWTDEGDWVTV  339

Query  1400  R  1402
             R
Sbjct  340   R  340



>ref|XP_004167046.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis sativus]
Length=372

 Score =   212 bits (540),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 168/266 (63%), Gaps = 24/266 (9%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE---SDSGLQFLESEAEILESLDSPHVV  550
             W +   VG+GS  +V+LA   ++G LF VKSAE   SD    FL+ E  +L SL +P +V
Sbjct  3     WTRRSPVGNGSSATVYLASTASSGQLFAVKSAELLKSD----FLKIEQRVLSSLSNPSIV  58

Query  551   KCIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
                G ++    G    NLF+EY AGG+LAD   + GG++ E     YTREI+ GL+YLH+
Sbjct  59    GYKGFDVTRENGKLMYNLFMEYAAGGTLADEIFRRGGRIKEATAAFYTREIVRGLEYLHK  118

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              G+VH D+K +N+L++  G +K+ADFGCS+ V +       A + G+P++MAPE  R   
Sbjct  119   QGLVHCDIKAKNILIAGDG-LKIADFGCSRWVCESE-----AVIGGTPMFMAPEVARGER  172

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKIS-NPVSAVLRIACSEDRPNFPSHFSQEGL  1072
             QG    +SDIW+LGCT+IEM TG  PW  KI+ +PVS + RI  S + P  PS  S++G 
Sbjct  173   QG---ISSDIWALGCTLIEMVTGAPPW--KITDDPVSVLYRIGYSGESPEIPSFLSEKGK  227

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KCL R+  +RW A +LL HPF+
Sbjct  228   DFLRKCLRREATERWSASQLLEHPFL  253



>ref|XP_002313986.2| hypothetical protein POPTR_0009s07730g, partial [Populus trichocarpa]
 gb|EEE87941.2| hypothetical protein POPTR_0009s07730g, partial [Populus trichocarpa]
Length=393

 Score =   213 bits (541),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 166/268 (62%), Gaps = 20/268 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             V WV+GK VG GSFGSV+LA NK TG +F VK+A   + +Q L++E +IL SL SP +VK
Sbjct  2     VSWVRGKCVGKGSFGSVNLAFNKQTGAVFAVKTASEANQVQALDNEIKILSSLSSPFIVK  61

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADV---TQQFGGKLDEMVIRLYTREILLGLKYL  715
              +G ++         NL +EY+ GG++AD+   TQ+F   ++E  +R +T  I+  LKY+
Sbjct  62    FLGDDVSFENSRACRNLHMEYLPGGTVADLASSTQRF-ADVNEETVRSFTYCIVSALKYI  120

Query  716   HENGIVHSDLKCRNVLLSSSGD-VKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR  892
             H  GIVH D+K RN+LL  S D VKLADFG +         +P     GSPLWMAPE ++
Sbjct  121   HSRGIVHCDVKGRNILLGHSFDSVKLADFGSAIDATSGEPLLP----RGSPLWMAPEVIK  176

Query  893   N--QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQE  1066
                QG     SD+WSLGCTIIEM TG   W     + V ++ RI  S + P  P   S  
Sbjct  177   REYQGP---ESDVWSLGCTIIEMVTGKPAWE---DHGVDSLSRIGFSNELPELPGQLSVL  230

Query  1067  GLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             G DFL+KCLER+P KRW  ++LL HPF+
Sbjct  231   GRDFLKKCLEREPSKRWSCDQLLEHPFL  258



>gb|EPS71117.1| hypothetical protein M569_03641, partial [Genlisea aurea]
Length=346

 Score =   211 bits (537),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 174/283 (61%), Gaps = 11/283 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G  +G GS  +V+LA   A G LF VKS++  S    L  E  ++  L  P VVK
Sbjct  8     MEWKRGPAIGRGSSATVYLATAIAAGELFAVKSSDLRSS-SALRREERLISELRPPLVVK  66

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
             C+G ++    G ++ NLF+EY++GG+L+D+ +  GG LDE  I+ Y  ++ +GL+++H  
Sbjct  67    CLGSDVTDEGGRREFNLFLEYVSGGTLSDLIRNSGGSLDEKTIQFYAHQLAIGLRHIHGK  126

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             GIVH D+K +N+L+   G  K+ DFGC++  +     +    ++G+P +MAPE  R +  
Sbjct  127   GIVHCDVKGKNILIGEEG-TKICDFGCARFAEPGGGSV----ISGTPAYMAPEVARGE-E  180

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
              +  +DIW+LGCT+IEMATG+ PW  ++ +P S + R+A S D P FP   S    DF+ 
Sbjct  181   QEFPADIWALGCTVIEMATGSNPWP-EMKDPASTLYRVAYSGDTPEFPDWLSTAAKDFIG  239

Query  1085  KCLERDPRKRWKAEELLHHPFVNpeseefaasspasVLDRSIF  1213
             KCL ++P +RW A EL+ HPF+    E     SP +V+D++ +
Sbjct  240   KCLIKEPNERWTAAELVRHPFLASGMERPTRESPTTVVDQTFW  282



>ref|XP_008342026.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Malus 
domestica]
Length=267

 Score =   209 bits (531),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 162/261 (62%), Gaps = 12/261 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G GS  +V LA  +++G  F VKSA+  S  +FL+ E +I   L S HVV 
Sbjct  1     MDWTRGSTIGQGSSAAVSLATXRSSGDKFAVKSAQV-SQSEFLQREQKIHSVLSSRHVVS  59

Query  554   CIGKEMCG-GKKL--NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++     KL  NL +EY+ GG++ D  +  GG +DE +IR YTR I+ GL YLH  
Sbjct  60    YMGHDITSENNKLMYNLLMEYVPGGTIIDAIRSRGGLVDESMIRNYTRGIVKGLDYLHSL  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQG  901
             G+VH D+K RN+L    G  K+ADFGC++     P       + G+P++MAPE  R  + 
Sbjct  120   GLVHCDIKGRNILAGEDGP-KIADFGCARWAX--PAVASATTIGGTPMFMAPEVARGEEQ  176

Query  902   GLDCASDIWSLGCTIIEMAT-GNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G  C  DIW+LGCTIIEMAT G+ PW  K + PV+ + +IA S D P  PS  S++   F
Sbjct  177   GFAC--DIWALGCTIIEMATGGSAPWP-KAAXPVTVLYQIAYSNDLPZIPSFLSEQAKHF  233

Query  1079  LEKCLERDPRKRWKAEELLHH  1141
             LEKCL+RDP +RW A +LL H
Sbjct  234   LEKCLQRDPTERWTASQLLKH  254



>ref|XP_010457586.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=339

 Score =   211 bits (537),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 116/272 (43%), Positives = 164/272 (60%), Gaps = 21/272 (8%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +GK +G GS  +V  A  + +G    VKSAE     +FL+ EA+IL SL+SPHV+ 
Sbjct  1     MNWTRGKIIGRGSTATVSAATLQESGETIAVKSAEFHRS-EFLQREAKILSSLNSPHVIG  59

Query  554   CIGKEMCG---------GKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGL  706
               G ++               NL +EY   G+LADV  + GG +DE  +  YTR+ILLGL
Sbjct  60    YRGCQITKESFNNYNGEATTYNLLMEYAPYGTLADVASKNGGSIDETRVVEYTRQILLGL  119

Query  707   KYLHEN-GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPE  883
             +Y+H + GI H D+K  NVL+  +G+ K+ADFGC+KR      P     V G+P +MAPE
Sbjct  120   EYIHNSMGIAHCDIKGSNVLVGDNGEAKIADFGCAKR----DEPERTEPVRGTPAFMAPE  175

Query  884   TLR--NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISN-PVSAVLRIACSEDRPNFPSH  1054
               R   QG     SDIW++GCT+IEM TG+ PW+G  SN PVS + R+    + P  P  
Sbjct  176   VARGERQGK---ESDIWAMGCTVIEMVTGSTPWSGADSNDPVSVLYRVGYLGESPELPCS  232

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              +++  DFL KCL++D ++RW A +LL+HPF+
Sbjct  233   LTEQAKDFLGKCLKKDAKERWTASQLLNHPFL  264



>ref|XP_004144594.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis sativus]
 gb|KGN43511.1| hypothetical protein Csa_7G043040 [Cucumis sativus]
Length=372

 Score =   212 bits (539),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 168/266 (63%), Gaps = 24/266 (9%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE---SDSGLQFLESEAEILESLDSPHVV  550
             W +   VG+GS  +V+LA   ++G LF VKSAE   SD    FL+ E  +L SL +P +V
Sbjct  3     WTRRSPVGNGSSATVYLASTASSGQLFAVKSAELLKSD----FLKIERRVLSSLSNPSIV  58

Query  551   KCIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
                G ++    G    NLF+EY AGG+LAD   + GG++ E     YTREI+ GL+YLH+
Sbjct  59    GYKGFDVTRENGKLMYNLFMEYAAGGTLADEIFRRGGRIKEATAAFYTREIVRGLEYLHK  118

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              G+VH D+K +N+L++  G +K+ADFGCS+ V +       A + G+P++MAPE  R   
Sbjct  119   QGLVHCDIKAKNILIAGDG-LKIADFGCSRWVCESE-----AVIGGTPMFMAPEVARGEK  172

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKIS-NPVSAVLRIACSEDRPNFPSHFSQEGL  1072
             QG    +SDIW+LGCT+IEM TG  PW  KI+ +PVS + RI  S + P  PS  S++G 
Sbjct  173   QG---ISSDIWALGCTLIEMVTGAPPW--KITDDPVSVLYRIGYSGESPEIPSFLSEKGK  227

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KCL R+  +RW A +LL HPF+
Sbjct  228   DFLRKCLRREATERWSASQLLEHPFL  253



>ref|XP_001421079.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99372.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=323

 Score =   210 bits (535),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 115/276 (42%), Positives = 167/276 (61%), Gaps = 16/276 (6%)
 Frame = +2

Query  347   YSKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-------SDSGLQFLE  505
             ++  + ++P  W KG  +G GS+GSV LA+N  TG LF +K           D  ++ LE
Sbjct  3     HTSLAPTKPRRWTKGDNLGEGSYGSVWLALNGDTGELFALKEVRVGSSDKHRDESIEQLE  62

Query  506   SEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYT  685
              E ++L  L  P++V+ IG        L +F+EY+ GGS+A + Q+FG K +E VIR+YT
Sbjct  63    QEVDVLSRLVHPNIVRYIGITR-QETALYIFLEYVPGGSIASLVQRFG-KFEENVIRVYT  120

Query  686   REILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLA-GVAGS  862
             R+IL+GL YLH   +VH D+K  N+L+  SG +KLADFG +K +++    + +     GS
Sbjct  121   RQILIGLAYLHSQRVVHRDIKGANILVEKSGRIKLADFGMAKVLER----VSIGKSFKGS  176

Query  863   PLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPN  1042
               WMAPE +R Q  +   +DIWS+GCT+ EM+TG+ PW+ + S  V  + +IA S + P+
Sbjct  177   ACWMAPEVIRQQ-NIGFEADIWSVGCTVYEMSTGSPPWS-ECSTQVQIIFKIASSNEIPD  234

Query  1043  FPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              P   S EG DFL  CL+RD   R +A  LL  PFV
Sbjct  235   IPEDLSPEGQDFLRLCLQRDAEMRPEAVALLDEPFV  270



>emb|CDP10763.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   213 bits (543),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 140/370 (38%), Positives = 207/370 (56%), Gaps = 35/370 (9%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +G T+G GS  +V  A  + TG  F +KS E  S  +FL++E +IL +LDSP +V 
Sbjct  1     MNWTRGHTLGHGSTATVSAATCRHTGETFALKSTEL-SKSEFLQNEQKILSTLDSPFIVG  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NL +EY+  GS+AD   + GG+L+E +I  YTR+I+ GL+YLH +
Sbjct  60    YKGYDISMENNKLMFNLMLEYLPDGSIADAIHKRGGRLEESMISCYTRQIVEGLEYLHSS  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHP----NPIPLAGVAGSPLWMAPETLR  892
             GIVH D+K RN+LL   G  K+ADFGC+K     P      I    V G+PL+MAPE  R
Sbjct  120   GIVHCDVKGRNILLDEDG-AKIADFGCAKWAAPVPRITSREIKKVAVGGTPLFMAPEVAR  178

Query  893   --NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQE  1066
               +QG     +DIW+LGCTIIEMATG  PW    +N  S +  I  S + P  P   S++
Sbjct  179   GEDQG---LPADIWALGCTIIEMATGGSPWP-NATNAASLMYEIGFSGELPEAPDFLSEQ  234

Query  1067  GLDFLEKCLERDPRKRWKAEELLHHPFV------NpeseefaasspasVLDRSIFPetdy  1228
               DFL KCL RDP++RW A++LL+H F+      + +++E   SSP S+LD+ I+   + 
Sbjct  235   ATDFLSKCLRRDPQERWTAKQLLNHQFLEGANPNSKQNQEHITSSPTSILDQDIW---NS  291

Query  1229  sdesdeedetPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRTS  1408
              +E D   +  ++      T  +   F          +  +P     W++ E WIT+R+S
Sbjct  292   MEEPDNLSDGEIKESSLNSTPAQRLQF-------LASNSGYP----SWNSGETWITIRSS  340

Query  1409  *GKKKKQEVL  1438
                K++ E +
Sbjct  341   KAVKREDEAM  350



>ref|XP_006295854.1| hypothetical protein CARUB_v10024983mg [Capsella rubella]
 gb|EOA28752.1| hypothetical protein CARUB_v10024983mg [Capsella rubella]
Length=363

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 161/265 (61%), Gaps = 14/265 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+T+G GS  +V+      +     VKS++     +FL+ EA+IL S++SP+V+ 
Sbjct  1     MEWTRGRTLGQGSTATVYAVKCHNSEEFLAVKSSDLHRS-EFLKREAKILSSMNSPYVIG  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G    +E  G    NL +EY   G+L D   + GG LDE  +  YTREIL GL+Y+H 
Sbjct  60    YRGSETRRESNGVVTYNLLMEYAPYGTLTDAAAKNGGGLDETRVVKYTREILRGLEYIHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              GI H DLK  NV+L+  G+ K+ADFGC+KRV    +P     V G+P +MAPE  R   
Sbjct  120   KGIAHCDLKGSNVVLAEKGEAKIADFGCAKRV----DPEFELKVMGTPAFMAPEVARGEK  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG     SDIW++GCT+IEM TG+ PW     +PVS + R+  S + P  P    ++  D
Sbjct  176   QGK---ESDIWAVGCTVIEMVTGSPPWTEATDDPVSVLYRVGYSGETPELPCLLEEDAKD  232

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FLEKCL+R+ ++RW A +LL+HPF+
Sbjct  233   FLEKCLKREAKERWTATQLLNHPFL  257



>ref|XP_002503300.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO64558.1| predicted protein, partial [Micromonas sp. RCC299]
Length=267

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 162/270 (60%), Gaps = 14/270 (5%)
 Frame = +2

Query  368   RPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA-----ESDSG---LQFLESEAEIL  523
             +P  W KG  +GSGSFG+V+L +N  TG LF VK         D+G   ++ LE E E+L
Sbjct  2     KPRRWTKGDCLGSGSFGTVYLGLNGETGELFAVKEVAMTRRTGDTGGEAVEQLEQEVELL  61

Query  524   ESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLG  703
               L  P++V+ +G      + L +F+EY+ GGS+A +  +FG   +E VI +YTR+IL+G
Sbjct  62    SRLQHPNIVRYVGISR-ESRALYIFLEYVPGGSIASLLSRFGA-FEESVISVYTRQILIG  119

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPE  883
             L YLH    VH D+K  N+L+  SG +KLADFG +K + +           GS  WMAPE
Sbjct  120   LDYLHSQRCVHRDIKGGNILVEKSGRIKLADFGMAKSLVEQMA--DGGSFKGSAYWMAPE  177

Query  884   TLRNQG-GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
              +R +G G   A+D+WS+GCT+IEMA+G  PW G  S  V A+ +IA +++ P  P   S
Sbjct  178   VIRQKGSGNHPAADVWSVGCTVIEMASGEHPW-GDCSGQVQAIFKIASTKELPRVPEQLS  236

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
                 +F+  CL+RDP  R  +E LL HPFV
Sbjct  237   PAASEFVLMCLQRDPDARPDSEALLLHPFV  266



>ref|XP_009790438.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
kinase kinase A-like [Nicotiana sylvestris]
Length=325

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 164/264 (62%), Gaps = 18/264 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G GS  +V +AM++ +G +F VKS E  S  +FL+ E +IL +L+SP++V 
Sbjct  1     MDWTRGHTIGRGSTAAVSVAMSRCSGEIFAVKSTEL-SRSEFLQKEQKILSTLNSPYIVG  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKL-DEMVIRLYTREILLGLKYLHE  721
               G ++         NL +EYM  G+L +  ++ G +  +E +IR YT++I+ GL YLH 
Sbjct  60    YKGYDVTRENNKDMFNLMMEYMPDGTLTNQIREQGTRTGNEQMIRYYTKQIVQGLDYLHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              GI+H D+K  N+LL  +G  K+ADFGC++ + +      +    G+P++MAPE  R   
Sbjct  120   KGILHRDIKGHNILLCETG-AKIADFGCARSIDQ------VKWNGGTPMFMAPEVARGEE  172

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG    A+DIW+LGCTIIEMATG  PW    +NP S +  IA S  +P  P   S +  D
Sbjct  173   QG---FAADIWALGCTIIEMATGASPWTDS-TNPASLLYHIAFSGQKPEIPGFLSSQARD  228

Query  1076  FLEKCLERDPRKRWKAEELLHHPF  1147
             F+ KCL RDP++RW A++L  HPF
Sbjct  229   FVSKCLRRDPKQRWSAKQLFKHPF  252



>ref|XP_007132528.1| hypothetical protein PHAVU_011G102000g [Phaseolus vulgaris]
 gb|ESW04522.1| hypothetical protein PHAVU_011G102000g [Phaseolus vulgaris]
Length=354

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 160/262 (61%), Gaps = 12/262 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G  +G GS  +V  A   A GG+F VKSAE  S  + L+ E  IL SL SP+VV 
Sbjct  1     MEWQRGHIIGRGSSATVSTATCCAGGGVFAVKSAEL-SQSESLKREQTILSSLSSPYVVA  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NLF+EYM  G++A  T++ GG+L+E  +  YTR+I+ GL+YLH  
Sbjct  60    YKGCDITMDSNKLLFNLFMEYMPFGTVAQATRRHGGRLEEAAMARYTRQIVQGLEYLHSK  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
              +VH D+K  N+L+   G VK+ D G +K V      I      G+P++MAPE  R +  
Sbjct  120   ELVHCDIKGANILIGEDG-VKIGDLGFAKSVVDSAVVI-----GGTPMFMAPEVARGE-E  172

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
               CASDIWSLGCT++EMATG +PW   + +P S +  IA S + P  P   S+E  DFL 
Sbjct  173   QGCASDIWSLGCTVVEMATGGVPWP-SVEDPFSVLYHIAYSSEVPEIPCFLSEEARDFLG  231

Query  1085  KCLERDPRKRWKAEELLHHPFV  1150
             KCL R+P++RWKA ELL HPF+
Sbjct  232   KCLRRNPQERWKASELLKHPFI  253



>ref|XP_010413987.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=363

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 163/265 (62%), Gaps = 14/265 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+T+G GS  +V+ A    +  +  VKS+E     +FL+ EA IL SLDSP+V+ 
Sbjct  1     MEWTRGRTLGRGSTATVYAATFHNSEEVLAVKSSELHRS-EFLKREARILSSLDSPYVIG  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G    +E  G    NL +EY   G+L +   + GG LDE  +  YTREIL GL+Y+H 
Sbjct  60    YRGSETKRESNGVVTYNLLMEYAPYGTLTEAAAKNGGGLDETRVVKYTREILRGLEYIHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              GI H D+K  NV+L+  G+ K+ADFGC+KRV    +P     V G+P +MAPE  R   
Sbjct  120   EGIAHCDVKGSNVVLAEKGEAKIADFGCAKRV----DPEFELMVMGTPAFMAPEVARGEK  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG     SD+W++GCT+IEM TG+ PW     +P+S + R+  S + P  P   +++  D
Sbjct  176   QGK---ESDVWAVGCTVIEMLTGSPPWTEARDDPLSVLYRVGYSGETPELPCLLAEDAKD  232

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FLEKCL+R+ ++RW A +LL+HPF+
Sbjct  233   FLEKCLKREAKERWTATQLLNHPFL  257



>ref|XP_009770794.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana sylvestris]
Length=667

 Score =   218 bits (555),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/271 (42%), Positives = 168/271 (62%), Gaps = 14/271 (5%)
 Frame = +2

Query  368   RPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAE  517
             RP+ W KG+ +G G+FG V++ MN  +G L  VK            ++ S ++ LE E +
Sbjct  66    RPIRWRKGEMIGCGAFGQVYMGMNLDSGELLAVKQVLIAANGASKEKAQSHVKELEEEVK  125

Query  518   ILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREIL  697
             +L++L  PH+V+ +G  +     LN+ +E++ GGS++ +  +FG    E VIR YT+++L
Sbjct  126   LLKNLSHPHIVRYLGT-VREEDTLNILLEFVPGGSISSLLGKFG-SFPEPVIRTYTKQLL  183

Query  698   LGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMA  877
             LGL YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMA
Sbjct  184   LGLDYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATISGAKSMKGTPYWMA  243

Query  878   PETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHF  1057
             PE +R Q G   ++DIWS+GCT+IEM TG  PW+ +    V+A+  I  ++  P  P H 
Sbjct  244   PEVIR-QTGHSFSADIWSVGCTVIEMTTGKPPWSQQYQE-VAALFYIGTTKAHPPIPEHL  301

Query  1058  SQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             S E  DFL KCL+++P  R  A ELL HPFV
Sbjct  302   SVEAKDFLLKCLQKEPELRLSASELLQHPFV  332



>gb|KHN08178.1| Mitogen-activated protein kinase kinase kinase 3 [Glycine soja]
Length=344

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 165/264 (63%), Gaps = 9/264 (3%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLD-SPHVV  550
             + WV+G+++GSGSF ++    +        VKS+   +    L++E EIL+ L  SP+V+
Sbjct  1     MNWVRGESLGSGSFATIPTNTSTQFLSSTAVKSSYVHTS-SMLKNEKEILDRLGASPYVI  59

Query  551   KCIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
              C G +     G +  N+F+EY AGGSLAD  ++ GG+L E  +R  TR ++ GLK++H+
Sbjct  60    NCFGDDHTVENGEEYYNIFLEYAAGGSLADQVKKHGGRLPESYVRRCTRSLVEGLKHIHD  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
             NG VH D+K +N+L+  +GDVK+ADFG +K   + P  +      G+PL+M+PE++ N  
Sbjct  120   NGYVHCDVKLQNILVFQNGDVKIADFGLAKEKGEKPGKLE---CRGTPLFMSPESV-NDN  175

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
               +  +DIW+LGC ++EM TG   W  + SN  S ++RI   E+ P  P   S+EG DFL
Sbjct  176   EYESPADIWALGCAVVEMVTGKPAWDVRGSNIWSLLIRIGAGEELPKIPEELSEEGKDFL  235

Query  1082  EKCLERDPRKRWKAEELLHHPFVN  1153
              KC  +DP KRW AE LL+HPFVN
Sbjct  236   LKCFVKDPMKRWSAEMLLNHPFVN  259



>emb|CDY19144.1| BnaA04g18840D [Brassica napus]
Length=357

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/267 (43%), Positives = 163/267 (61%), Gaps = 19/267 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+ +G GS  +V  AM   +  +  VKS+E     +FL+ EA+IL SL+SP+V+ 
Sbjct  1     MEWTRGRILGRGSTATVCSAMCHNSNEILAVKSSEIHRS-EFLQREAKILSSLNSPYVIG  59

Query  554   CIGKEM----CGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G E      G    NL +EY   G+L D  ++ GG+L+E +I  YTREIL GL+Y+H 
Sbjct  60    YRGSETKIESNGVVTYNLLMEYAPYGTLTDAAKKNGGRLEEAMIVKYTREILRGLEYIHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              GI H D+K  NV+++  G+ KLADFGC+KRV           V G+P +MAPE  R   
Sbjct  120   KGIAHCDVKGSNVVVAEKGEAKLADFGCAKRVGSE-------AVTGTPAFMAPEVARGEK  172

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPW--AGKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
             QG     SDIW++GCT+IEMATG+ PW  A    +PVS + R+  S + P  P   ++E 
Sbjct  173   QGS---ESDIWAVGCTVIEMATGSPPWTEASSREDPVSVLYRVGYSGETPELPCLLTEEA  229

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFV  1150
              DFL+ C +R+ ++RW A +LL+HPF+
Sbjct  230   KDFLKMCFKREAKERWTATQLLNHPFL  256



>gb|ACH99695.1| NPKL2 [Oryza sativa Indica Group]
Length=393

 Score =   212 bits (539),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 159/258 (62%), Gaps = 10/258 (4%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSV-HLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKC  556
             W + +T+G G+ G+V  LA +  +G LF VKSA + +  Q +  E  IL  L SPHV+ C
Sbjct  9     WTRVRTLGRGASGAVVSLAADDRSGALFAVKSAAAAAAEQLVR-EGRILSGLRSPHVLPC  67

Query  557   IGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVH  736
             +G     G +  LF+E+  GGSLADV  + GG+LDE  IR Y  ++  GL YLH   +VH
Sbjct  68    LGFRAEAGGECQLFLEFAPGGSLADVVARSGGRLDECAIRAYAADVARGLAYLHGMSLVH  127

Query  737   SDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGLDCA  916
              D+K RNV++ + G  K+ADFGC++ V     PI      G+P +MAPE  R +   + A
Sbjct  128   GDVKGRNVVVGADGRAKIADFGCARTVGSD-RPI-----GGTPAFMAPEVARGE-EQEPA  180

Query  917   SDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEKCLE  1096
             +D+W+LGCT+IEMATG  PW+  + + +SAV RI  ++  P  P   S E  DFL +C  
Sbjct  181   ADVWALGCTVIEMATGRAPWS-DMEDILSAVRRIGYTDAVPEVPEWLSAEAKDFLARCFA  239

Query  1097  RDPRKRWKAEELLHHPFV  1150
             R+PR+RW + +LL HPF+
Sbjct  240   RNPRERWTSSQLLEHPFL  257



>gb|ABK06427.1| HA-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=304

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/278 (38%), Positives = 168/278 (60%), Gaps = 14/278 (5%)
 Frame = +2

Query  350   SKCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQF  499
             S      P+ W KG+ +G G+FG+V++ MN  +G L  VK            ++ + +Q 
Sbjct  4     STVQIKPPIRWRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLITSNCASKEKTQAHIQE  63

Query  500   LESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRL  679
             LE E ++L++L  P++V+ +G  +   + LN+ +E++ GGS++ + ++FG    E V+R 
Sbjct  64    LEEEVKLLKNLSHPNIVRYLGT-VREDETLNILLEFVPGGSISSLLEKFGA-FPESVVRT  121

Query  680   YTREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAG  859
             YT ++LLGL+YLH + I+H D+K  N+L+ + G +KLADFG SK+V +         + G
Sbjct  122   YTNQLLLGLEYLHNHAIMHRDIKGANILVDNQGCIKLADFGASKQVAELATISGAKSMKG  181

Query  860   SPLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRP  1039
             +P WMAPE +  Q G   ++DIWS+GCT+IEM TG  PW+ +    ++A+  I  ++  P
Sbjct  182   TPYWMAPEVIL-QTGHSFSADIWSVGCTVIEMVTGKAPWSQQYKE-IAAIFHIGTTKSHP  239

Query  1040  NFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
               P + S +  DFL KCL+++P  R  A ELL HPFV 
Sbjct  240   PIPDNISSDANDFLLKCLQQEPNLRPTASELLKHPFVT  277



>ref|XP_002978306.1| hypothetical protein SELMODRAFT_108118 [Selaginella moellendorffii]
 gb|EFJ20963.1| hypothetical protein SELMODRAFT_108118 [Selaginella moellendorffii]
Length=277

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 168/273 (62%), Gaps = 16/273 (6%)
 Frame = +2

Query  353   KCSCSRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKS------------AESDSGLQ  496
             + +  R + W KG+ +G G++G V++ MN  +G L  VK             A+  + ++
Sbjct  4     QSTSPRAIRWRKGELIGVGAYGRVYMGMNLDSGELIAVKQVLIAASNFAKGKAQLSAHIR  63

Query  497   FLESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIR  676
              LE E ++L++L  P++V+ +G      + LN+F+E++ GGS++ +  +FG    E VIR
Sbjct  64    ELEEEVKLLQNLSHPNIVRYLGTAR-EEEALNIFLEFVPGGSISSLLGKFGS-FTEPVIR  121

Query  677   LYTREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVA  856
             +YTR++LLGL+YLH+N I+H D+K  N+L+ + G +K+ADFG SK+V +         + 
Sbjct  122   MYTRQLLLGLEYLHQNKIMHRDIKGANILVDNQGHIKVADFGASKKVLELATISEAKSMK  181

Query  857   GSPLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDR  1036
             G+P WMAPE +R Q G +  +DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  
Sbjct  182   GTPYWMAPEVVR-QTGHNWQADIWSVGCTVIEMATGKPPWSDQFQE-VAALFHIGTTKSH  239

Query  1037  PNFPSHFSQEGLDFLEKCLERDPRKRWKAEELL  1135
             P  P H S +   FL KCL+R+PR R  A ELL
Sbjct  240   PPIPEHLSPDAKSFLLKCLQREPRLRPTAAELL  272



>ref|XP_010035556.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Eucalyptus grandis]
 gb|KCW46981.1| hypothetical protein EUGRSUZ_K00788 [Eucalyptus grandis]
Length=419

 Score =   212 bits (540),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/269 (45%), Positives = 159/269 (59%), Gaps = 12/269 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+ VG G+  +V +A  + +G +F VKSAE     + L  E   L SL SP +V 
Sbjct  1     MDWTRGRAVGRGASATVSVATCRRSGDVFAVKSAELVRS-ELLRREQRTLSSLSSPRIVG  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G E+         N+F++Y+  GSLAD  +  GGKLDE  IR YT +IL GL YLH  
Sbjct  60    YRGCEITSEDSRIMFNIFMDYLPRGSLADQIRSHGGKLDEPAIRAYTSQILEGLDYLHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRV-KKHPNPIPLAGVAGSPLWMAPETLR-NQ  898
             GI H D+K  NVL+   G  K+ADFGC+KRV          AG+ G+P++MAPE  R  +
Sbjct  120   GIAHCDIKSANVLIGDDGAAKIADFGCAKRVGPAGAAATAAAGIGGTPMFMAPEAARGEE  179

Query  899   GGLDCASDIWSLGCTIIEMATGNLPW----AGKISNPVSAVLRIACSEDRPNFPSHFSQE  1066
              GL  A D W++GCT++EMATG  PW    A    +PVS + RIACS + P  P   S E
Sbjct  180   QGL--AGDAWAVGCTVVEMATGKSPWQAGAAAGADDPVSVLYRIACSGESPAIPGCLSAE  237

Query  1067  GLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
               DF+ KCL RDPR+RW   +LL HPF+ 
Sbjct  238   ARDFVSKCLRRDPRERWTVGQLLEHPFLE  266



>ref|XP_007225680.1| hypothetical protein PRUPE_ppa002856mg [Prunus persica]
 gb|EMJ26879.1| hypothetical protein PRUPE_ppa002856mg [Prunus persica]
Length=627

 Score =   217 bits (553),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 171/273 (63%), Gaps = 14/273 (5%)
 Frame = +2

Query  365   SRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEA  514
             ++P+ W KG+ +GSG+FG V++ MN  +G L  VK            ++ + ++ LE E 
Sbjct  66    AQPIRWRKGELIGSGAFGRVYMGMNLDSGELIAVKQVLIAANSASKEKTQAHIRELEEEV  125

Query  515   EILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREI  694
             ++L++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++
Sbjct  126   KLLKNLSHPNIVRYLGTAR-EDDSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQL  183

Query  695   LLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWM  874
             LLGL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WM
Sbjct  184   LLGLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATINGAKSMKGTPYWM  243

Query  875   APETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSH  1054
             APE +  Q G   ++DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  P  P H
Sbjct  244   APEVIL-QTGHSFSADIWSVGCTVIEMATGKPPWSQQYQE-VAALFHIGTTKSHPPIPEH  301

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              S E  DFL KCLE++P  R  A EL+ HPFV 
Sbjct  302   LSAEAKDFLLKCLEKEPNLRCAASELVQHPFVT  334



>ref|XP_008455448.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Cucumis 
melo]
Length=378

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 163/265 (62%), Gaps = 22/265 (8%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE---SDSGLQFLESEAEILESLDSPHVV  550
             W +   VG+GS  +V+LA   ++G LF VKSAE   SD    FL++E  IL SL  P +V
Sbjct  3     WTRRSPVGNGSSATVYLASTASSGELFAVKSAELLKSD----FLKTEQRILSSLSHPSIV  58

Query  551   KCIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
                G ++    G    NLF+EY  GG+L D   + GG++ E     YTREI+ GL+YLH+
Sbjct  59    GYRGFDVTRENGKLMYNLFMEYADGGTLTDEIFRRGGRIKEATAAFYTREIVRGLEYLHK  118

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              G+VH D+K +N+L++  G +K+ADFGCSK V +       A   G+P++MAPE  R   
Sbjct  119   QGLVHCDIKAKNILIAGDG-LKIADFGCSKWVCEAE-----AVKGGTPMFMAPEVARGEK  172

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG    +SDIW+LGCT+IEM TG LPW     +PVS + RI  S + P  PS  S++G D
Sbjct  173   QG---ISSDIWALGCTLIEMVTGALPWK-TTDDPVSVLYRIGYSGESPEVPSFLSEKGND  228

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FL KCL R+  +RW A +LL HPF+
Sbjct  229   FLRKCLRREATERWSASQLLEHPFL  253



>ref|XP_006364161.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum tuberosum]
Length=337

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 133/352 (38%), Positives = 193/352 (55%), Gaps = 25/352 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W++G T+G GS  +V  A +  +G +F VKS E     Q L+ E +IL  L SP++V 
Sbjct  1     MDWIRGHTIGRGSSAAVSAAKSIWSGEVFAVKSVELCQS-QLLQKEQKILSQLSSPYIVS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++   K     NL +EYM  G+L D  ++  G+++E +I  YT++ILLGL+YLH  
Sbjct  60    YKGYDVTKEKDKLMFNLMMEYMPDGTLTDEIRKQSGRINEQLIGYYTKQILLGLEYLHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             GI HSD+K  N+LL  +G  K+ADFGCS+ V           + G+P++MAPE  R   Q
Sbjct  120   GIAHSDIKGDNILLGKTG-AKIADFGCSRWVDPANRDGDANPIGGTPMFMAPEVARWEEQ  178

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G   C +DIW LGCTIIEMATG  PW   ++N  S + +IA S   P  P   S +  DF
Sbjct  179   G---CPADIWGLGCTIIEMATGGSPWTN-VTNSASLLYKIAFSGQSPEIPKFISLQARDF  234

Query  1079  LEKCLERDPRKRWKAEELLHHPFVNpeseefaassp--asVLDRSIFPetdysdesdeed  1252
             L KCL RD ++RW A+ELL HPF+   +    A+     S+LD+ I+        +  E+
Sbjct  235   LSKCLRRDAKERWTAKELLKHPFLKELNLNSTANQNSPTSILDQDIW--------NSVEE  286

Query  1253  etPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRTS  1408
                  S + +  ++   P   + E     SE        W+  E WIT+R+S
Sbjct  287   LETTNSTILRKISSTESPLQRVRELGSNSSE----LKRIWNDDERWITIRSS  334



>ref|XP_009141244.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Brassica rapa]
Length=357

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 162/265 (61%), Gaps = 15/265 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+ +G GS  +V  AM   +  +  VKS+E     +FL+ EA+IL SL+SP+V+ 
Sbjct  1     MEWTRGRILGRGSTATVCSAMCHNSNEILAVKSSEIHRS-EFLQREAKILSSLNSPYVIG  59

Query  554   CIGKEM----CGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G E      G    NL +EY   G+L D  ++ GG+L+E +I  YTREIL GL+Y+H 
Sbjct  60    YRGSETKIESNGVVTYNLLMEYAPYGTLTDAAKKNGGRLEEAMIVKYTREILRGLEYIHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
              GI H D+K  NV+++  G+ KLADFGC+KRV           V G+P +MAPE  R + 
Sbjct  120   KGIAHCDVKGSNVVVAEKGEAKLADFGCAKRVGSE-------AVTGTPAFMAPEVARGE-  171

Query  902   GLDCASDIWSLGCTIIEMATGNLPW--AGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
                  SDIW++GCT+IEMATG+ PW  A    +PVS + R+  S + P  P   ++E  D
Sbjct  172   KQGSESDIWAVGCTVIEMATGSPPWTEASSREDPVSVLYRVGYSGETPELPCLLTEEAKD  231

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FL+ C +R+ ++RW A +LL+HPF+
Sbjct  232   FLKMCFKREAKERWTATQLLNHPFL  256



>ref|XP_010264778.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nelumbo nucifera]
Length=513

 Score =   214 bits (546),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 169/275 (61%), Gaps = 21/275 (8%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQF----LESEAEILESLDSP  541
             + W++G  +G GSFG+V LA  ++ G LF VKS   +S + F    LE+E  IL+SL SP
Sbjct  9     LRWIRGNCIGKGSFGTVSLA--ESDGRLFAVKSVNPNSSIPFQHESLENEIRILKSLSSP  66

Query  542   HVVKCIGK----EMCGGKKLNLFIEYMAGGSLADVTQQFGGK-LDEMVIRLYTREILLGL  706
             +VV+ +G     E       NL +EY+ GG++AD+  QFGGK L+E ++R YT  I+  L
Sbjct  67    YVVEYLGDDITHETATTSYRNLHMEYLPGGTIADLATQFGGKGLEERIVRSYTWCIVFAL  126

Query  707   KYLHENGIVHSDLKCRNVLLSSS-GDVKLADFGCSKRVKKHPNPIPLAGVA---GSPLWM  874
              Y+H  GIVH D+K RNVL+ S+ G  KLADFG +KRV          G+    GSPLWM
Sbjct  127   SYVHSRGIVHCDVKGRNVLVDSALGVAKLADFGSAKRVSIGDANSEDEGLILPRGSPLWM  186

Query  875   APETLRN--QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFP  1048
             APE +R   QG     +D+WSLGCTIIEM TG   W     +  + + RI  S++ P  P
Sbjct  187   APEVIRRERQGP---EADVWSLGCTIIEMITGKPAWT-DCGDAAATMFRICFSDELPEAP  242

Query  1049  SHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             +  S+ G DFL KCL+R+P +RW  E+LL HPFV+
Sbjct  243   AQLSELGRDFLSKCLKREPSERWSCEQLLRHPFVS  277



>ref|XP_002869589.1| hypothetical protein ARALYDRAFT_492112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45848.1| hypothetical protein ARALYDRAFT_492112 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   213 bits (541),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 168/263 (64%), Gaps = 14/263 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +G+ +G GS  +V +A++ ++G +F VKSA+  S   FL+ E   L +L SPH+VK
Sbjct  3     INWKRGQIIGRGSTATVSVAIS-SSGEIFAVKSADLSSS-SFLQKEQSFLSTLSSPHIVK  60

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG  +         N+ +EY++GGSL D+ +  GGKL E  IR +TR+IL GL YLHE 
Sbjct  61    YIGSGLTYENDRLVYNILMEYVSGGSLHDLIKNSGGKLPEPEIRSHTRQILNGLVYLHER  120

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             GIVH DLK +NVL+  +G +K+AD GC+K V K       +G +G+P +MAPE  R +  
Sbjct  121   GIVHCDLKSQNVLVEENGVLKIADMGCAKSVGK-------SGFSGTPAFMAPEVARGEEQ  173

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                 +D+W+LGCT+IEM TG+ PW  ++++ V+A+ +I  S + P  P   S++  DFL 
Sbjct  174   R-FPADVWALGCTVIEMMTGSNPWP-ELNDVVAAMYKIGFSGESPEIPGWISEKAKDFLN  231

Query  1085  KCLERDPRKRWKAEELLHHPFVN  1153
              CL+ DP++RW  EELL H F+N
Sbjct  232   NCLKEDPKQRWTVEELLKHSFLN  254



>gb|KFK40368.1| hypothetical protein AALP_AA3G364600 [Arabis alpina]
Length=336

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 168/265 (63%), Gaps = 13/265 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +GKT+G GS  +V+ A   ++G +  VK+AE     +FL+ EA IL SL+SP+V+K
Sbjct  1     MNWTRGKTIGHGSSATVYAATCHSSGEIIAVKTAEYHRS-EFLQREANILSSLNSPYVIK  59

Query  554   CIGKEMCGG---KKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G E+         NL +EY   G+L DVT + GG LDE  +  YTR+ILLGL+Y+H +
Sbjct  60    YRGCEITETPFEATYNLLMEYAPYGTLTDVTAKNGGLLDEARVVKYTRQILLGLEYIHNS  119

Query  725   -GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQ-  898
              GI H D+K  N+L+  +G+ K+ DFGC+K VK    P     V G+P +MAPE  R + 
Sbjct  120   KGIAHCDIKGSNILVGDNGEAKIGDFGCAKFVK----PEITEPVKGTPAFMAPEVARGER  175

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAG-KISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
              G++  SDIW++GCT+IEM TG+ PW G   ++PVS + R+    + P  P   +++  D
Sbjct  176   QGIE--SDIWAVGCTVIEMVTGSHPWIGLDSTDPVSVLYRVGYLGEAPELPCSLTEQAKD  233

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FL KCL+++ ++RW A +LL+HPF+
Sbjct  234   FLGKCLKKEAKERWTATQLLNHPFL  258



>emb|CDY14295.1| BnaA08g14260D [Brassica napus]
Length=471

 Score =   213 bits (543),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 168/263 (64%), Gaps = 15/263 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +G T+G GS  +V +A +  TG +F VKSA   S   FL+ E  IL +  SPH+VK
Sbjct  3     IAWTRGPTIGRGSTATVSIATSN-TGEIFAVKSANFSSS-AFLQREQSILSTSSSPHIVK  60

Query  554   CIGKEM-CGGKKL--NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG  + C   +L  N+ +EY++GGSL  + +  GGKL E  IR +TR+IL GLKYLHE 
Sbjct  61    YIGSSLTCENDRLVYNILMEYVSGGSLHGLIKNSGGKLPEPAIRSHTRQILKGLKYLHER  120

Query  725   GIVHSDLKCRNVLLSSSGDV-KLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
             GIVH DLK +NVL+  +G V K+AD GC+K       P+  +G +G+P +MAPE  R + 
Sbjct  121   GIVHCDLKSQNVLVGENGVVSKIADLGCAK-------PVFNSGFSGTPAFMAPEVARGEE  173

Query  902   GLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
                  +D+W+LGCT+IEM TG+ PW  ++++ V+ + +I  S + P  P   S++G DF+
Sbjct  174   Q-RFPADVWTLGCTVIEMVTGSSPWP-ELNDAVARMYKIGYSGESPEIPEGTSEKGRDFV  231

Query  1082  EKCLERDPRKRWKAEELLHHPFV  1150
              +CL  DP++RW  EELL HPF+
Sbjct  232   MRCLRVDPKQRWTVEELLKHPFL  254



>ref|XP_004243853.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum lycopersicum]
Length=326

 Score =   209 bits (532),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 164/264 (62%), Gaps = 11/264 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W++G T+G GS  +V  A ++ +G +F VKS E  S  Q L+ E +IL  L SP++V+
Sbjct  1     MDWIRGNTIGHGSTAAVSAAKSRFSGEVFAVKSVEL-SKSQLLQKEQKILSELISPYIVR  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++   K     NL +EYM  G+L++  ++ GG+++E +I  YT++I+ GL+YLH  
Sbjct  60    YKGYDVTKEKDKLMFNLRMEYMPDGTLSNEIRKQGGRMNEPLIGYYTKQIVQGLEYLHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             G+ H D+K +N+LL  +G  KLADFGCS+ +           + G+P++MAPE  R   Q
Sbjct  120   GVAHCDIKGQNILLGETG-AKLADFGCSRWIDPAERDGGANSIGGTPMFMAPEVARGEEQ  178

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G    A+DIW +GCT+IEMATG  PW   ++N  S + +IA SE  P  P   S +  DF
Sbjct  179   G---FAADIWGVGCTMIEMATGGSPW-NNVTNAASLLYKIAFSEQSPEIPKFLSSQARDF  234

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L KCL RD  +RW A++LL HPF+
Sbjct  235   LNKCLRRDCEERWTAKQLLKHPFL  258



>ref|XP_006342282.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum tuberosum]
Length=338

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 165/268 (62%), Gaps = 19/268 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G  +G GS  +V +AM++ TG +F VKS E  S  +FLE E +IL +L+SP+VV 
Sbjct  1     MDWTRGHIIGHGSTAAVSVAMSRCTGEIFAVKSTEL-SRSEFLEKEQKILSTLNSPYVVD  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NL +EYM  G+L D  ++ GG+L+E +IR YT++I+ GL YLH  
Sbjct  60    YKGYDVTRENNKVMFNLMMEYMPDGTLIDEIRKQGGQLNEELIRHYTKQIVQGLDYLHSK  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQG  901
             GIVH D+K  N+LL ++G  K+ DFGCSKRV           + G+P++MAPE +R  + 
Sbjct  120   GIVHCDIKGHNILLCNTG-AKIGDFGCSKRVDG-------VTIGGTPMFMAPEVVRGEEQ  171

Query  902   GLDCASDIWSLGCTIIEMATGNLPWA----GKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
             G    +DIW+LGCTIIEMATG  PW       ++N  S +  IA S   P  P   S + 
Sbjct  172   GF--RADIWALGCTIIEMATGGSPWTSVVNSTVNNSASLLYHIAFSGLTPEIPKFLSSQA  229

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              DFL+KCL RD ++R  A+ELL H F++
Sbjct  230   KDFLKKCLRRDQKQRCSAKELLKHRFLD  257



>emb|CDY53387.1| BnaAnng12350D [Brassica napus]
Length=337

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/266 (44%), Positives = 165/266 (62%), Gaps = 14/266 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W + KT+G GS  +V+ A  + +G    VKSAE     +FL+ EA++L SL+SP+V+ 
Sbjct  1     MNWTREKTIGRGSSATVYAATCQDSGETIAVKSAEFHQS-EFLQREAKLLSSLNSPYVIG  59

Query  554   CIGKEMCGG--KKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENG  727
               G E+        NL +EY   G+LADV  + GG +DE  +  YTR+ILLGL+Y+H + 
Sbjct  60    YRGCEVTKEPLATYNLLMEYAPYGTLADVAAKNGGCIDEARVVSYTRQILLGLEYVHNSK  119

Query  728   -IVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
              I H D+K  NVL+  +G+ K+ADFGC+KRV+    P     V G+P +MAPE  R   Q
Sbjct  120   RIAHCDVKGSNVLVGVNGEAKIADFGCAKRVE----PELTEPVRGTPAFMAPEVARGERQ  175

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAG-KISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             G     SDIW+LGCT+IEM TG+ PW G   ++PVS + R+    + P  PS  S++  D
Sbjct  176   GK---ESDIWALGCTVIEMVTGSHPWTGGDTTDPVSVLYRVGYMGETPELPSSLSEQAKD  232

Query  1076  FLEKCLERDPRKRWKAEELLHHPFVN  1153
             FL KCL R+ ++RW A +LL+HPFV 
Sbjct  233   FLGKCLRREAKERWTARQLLNHPFVT  258



>gb|AGA37215.1| mitogen-activated protein kinase kinase kinase 18.1 [Brassica 
napus]
Length=337

 Score =   209 bits (532),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 164/264 (62%), Gaps = 14/264 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W + KT+G GS  +V+ A  + +G    VKSAE     +FL+ EA++L SL+SP+V+   
Sbjct  4     WTREKTIGRGSSATVYAATCQDSGETIAVKSAEFHQS-EFLQREAKLLSSLNSPYVIGYR  62

Query  560   GKEMCGG--KKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENG-I  730
             G E+        NL +EY   G+LADV  + GG +DE  +  YTR+ILLGL+Y+H +  I
Sbjct  63    GCEVTKEPLATYNLLMEYAPYGTLADVAAKNGGCIDEARVVSYTRQILLGLEYVHNSKRI  122

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQGG  904
              H D+K  NVL+  +G+ K+ADFGC+KRV+    P     V G+P +MAPE  R   QG 
Sbjct  123   AHCDVKGSNVLVGVNGEAKIADFGCAKRVE----PELTEPVRGTPAFMAPEVARGERQGK  178

Query  905   LDCASDIWSLGCTIIEMATGNLPWAG-KISNPVSAVLRIACSEDRPNFPSHFSQEGLDFL  1081
                 SDIW+LGCT+IEM TG+ PW G   ++PVS + R+    + P  PS  S++  DFL
Sbjct  179   ---ESDIWALGCTVIEMVTGSHPWTGGDTTDPVSVLYRVGYMGETPELPSSLSEQAKDFL  235

Query  1082  EKCLERDPRKRWKAEELLHHPFVN  1153
              KCL R+ ++RW A +LL+HPFV 
Sbjct  236   GKCLRREAKERWTARQLLNHPFVT  259



>ref|XP_008222965.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1 
[Prunus mume]
Length=683

 Score =   217 bits (553),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 171/273 (63%), Gaps = 14/273 (5%)
 Frame = +2

Query  365   SRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEA  514
             ++P+ W KG+ +GSG+FG V++ MN  +G L  VK            ++ + ++ LE E 
Sbjct  64    AQPIRWRKGELIGSGAFGRVYMGMNLDSGELIAVKQVLIAANSASREKTQAHIRELEEEV  123

Query  515   EILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREI  694
             ++L++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++
Sbjct  124   KLLKNLSHPNIVRYLGTAR-EDDSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQL  181

Query  695   LLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWM  874
             LLGL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WM
Sbjct  182   LLGLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATINGAKSMKGTPYWM  241

Query  875   APETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSH  1054
             APE +  Q G   ++DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  P  P H
Sbjct  242   APEVIL-QTGHSFSADIWSVGCTVIEMATGKPPWSQQYQE-VAALFHIGTTKSHPPIPEH  299

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              S E  DFL KCLE++P  R  A EL+ HPFV 
Sbjct  300   LSAEAKDFLLKCLEKEPNLRCAASELVQHPFVT  332



>ref|XP_008380362.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=423

 Score =   211 bits (537),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 167/261 (64%), Gaps = 13/261 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G TVG GS  +V LA + + G  F VKSAE  S    L+ E   L  L SPH+VK +
Sbjct  4     WTRGPTVGRGSTATVSLAAS-SDGERFAVKSAELSSS-ALLQKEQCFLSKLGSPHIVKYL  61

Query  560   GKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGI  730
             G  +         NL +EY+ GG+L D  ++ GG+L+E VI+LYT +I+ GL+YLH N +
Sbjct  62    GYNVSIENNKPMYNLCMEYVPGGTLFDAIRRRGGRLEEAVIQLYTHQIVQGLEYLHVNKL  121

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQGGL  907
             VH D+K +N+L++     K+AD GC+K V+          ++G+P++MAPE  R  + G 
Sbjct  122   VHCDIKSQNILVTGE-TAKIADLGCAKLVQGVE---ACTTISGTPVFMAPEVARGEEQGF  177

Query  908   DCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEK  1087
             +  +DIW+LGCTIIEMATG  PW  +I++PVSA+ RI  S + P  PS  S +G DFL K
Sbjct  178   E--ADIWALGCTIIEMATGGGPWP-EINDPVSALYRIGFSGELPEIPSQLSSKGKDFLSK  234

Query  1088  CLERDPRKRWKAEELLHHPFV  1150
             CL +DPR+RW A++LL HPF+
Sbjct  235   CLMKDPRERWTAKQLLDHPFL  255



>ref|XP_010096875.1| Mitogen-activated protein kinase kinase kinase ANP1 [Morus notabilis]
 gb|EXB66329.1| Mitogen-activated protein kinase kinase kinase ANP1 [Morus notabilis]
Length=369

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 169/265 (64%), Gaps = 13/265 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +  T+G GS  +V LA    +G LF  KS E  S  ++L++E  IL  L+SP++VK
Sbjct  1     MEWTREATIGCGSTATVSLATATHSGELFAAKSTEL-SHSKYLQTEQSILSKLNSPYLVK  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG ++         NLF+EY+  G+L D  ++ GG+L+E +IR YTR+IL GL+YLHE+
Sbjct  60    YIGFDITRENSQFYYNLFMEYLPRGTLHDEIRRHGGRLEEAMIRRYTRDILQGLEYLHES  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKK--HPNPIPLAGVAGSPLWMAPETL--R  892
             G+VH D+K  N+L+    + K++D GC+K  +K        +   +G+P++M+PE +  +
Sbjct  120   GVVHCDIKSSNILIGEK-NAKISDLGCAKFFEKVSKIGDSHMVVFSGTPMFMSPEVVVGQ  178

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
             +QG     +DIW+LGCT+IEMATG  PW  ++ +P+SA+ RI  S + P  P   SQ+G 
Sbjct  179   DQG---FEADIWALGCTVIEMATGKNPWP-EVHDPISALYRIGFSGESPEIPRWLSQKGR  234

Query  1073  DFLEKCLERDPRKRWKAEELLHHPF  1147
             DFLE CL R+P  R  A+ELL HPF
Sbjct  235   DFLEICLRRNPNDRMAAKELLKHPF  259



>ref|XP_008348361.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
 ref|XP_008365626.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=423

 Score =   211 bits (537),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 167/261 (64%), Gaps = 13/261 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W +G TVG GS  +V LA + + G  F VKSAE  S    L+ E   L  L SPH+VK +
Sbjct  4     WTRGPTVGRGSTATVSLAAS-SDGERFAVKSAELSSS-ALLQKEQCFLSKLGSPHIVKYL  61

Query  560   GKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGI  730
             G  +         NL +EY+ GG+L D  ++ GG+L+E VI+LYT +I+ GL+YLH N +
Sbjct  62    GYNVSIENNKPMYNLCMEYVPGGTLFDAIRRRGGRLEEAVIQLYTHQIVQGLEYLHVNKL  121

Query  731   VHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQGGL  907
             VH D+K +N+L++     K+AD GC+K V+          ++G+P++MAPE  R  + G 
Sbjct  122   VHCDIKSQNILVTGE-TAKIADLGCAKLVQGVE---ACTTISGTPVFMAPEVARGEEQGF  177

Query  908   DCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEK  1087
             +  +DIW+LGCTIIEMATG  PW  +I++PVSA+ RI  S + P  PS  S +G DFL K
Sbjct  178   E--ADIWALGCTIIEMATGGGPWP-EINDPVSALYRIGFSGELPEIPSQLSSKGKDFLSK  234

Query  1088  CLERDPRKRWKAEELLHHPFV  1150
             CL +DPR+RW A++LL HPF+
Sbjct  235   CLMKDPRERWTAKQLLDHPFL  255



>ref|XP_010475182.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=339

 Score =   209 bits (531),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/272 (42%), Positives = 166/272 (61%), Gaps = 21/272 (8%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +GK +G GS  +V  A  + +G    VKSA+     +FL+ EA+IL SL+SPHV+ 
Sbjct  1     MNWTRGKIIGRGSTATVSAATLQESGETIAVKSADFHRS-EFLQREAKILSSLNSPHVIG  59

Query  554   CIGKEMCG---------GKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGL  706
               G ++               NL +EY   G+LADV  + GG ++E  +  YTR+ILLGL
Sbjct  60    YRGCQITTESFNNYNGEATTYNLLMEYAPYGTLADVASKNGGSIEEARLVKYTRQILLGL  119

Query  707   KYLHEN-GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPE  883
             +Y+H + GI H D+K  NVL+  +G+ K+ADFGC+KRV+    P     V G+P +MAPE
Sbjct  120   EYIHNSMGIAHCDIKGSNVLVGENGEAKIADFGCAKRVE----PEITEPVRGTPAFMAPE  175

Query  884   TLR--NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISN-PVSAVLRIACSEDRPNFPSH  1054
               R   QG     SD+W++GCT+IEM TG+ PW+G  SN PVS + R+    + P  P  
Sbjct  176   VARGERQGK---ESDVWAVGCTVIEMVTGSTPWSGADSNDPVSVLYRVGYLGESPELPCS  232

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              +++  DFL KCL++D ++RW A +LL+HPF+
Sbjct  233   LTEQAKDFLGKCLKKDAKERWTASQLLNHPFL  264



>ref|XP_009353299.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Pyrus x bretschneideri]
Length=424

 Score =   211 bits (537),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 163/264 (62%), Gaps = 12/264 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G T+G GS  +V LA +  +G  F VKSAE     +FL+ E +I   L SPH+V 
Sbjct  1     MEWTRGCTIGQGSSATVSLATSCRSGDKFAVKSAEMFHS-EFLQREQKIFSVLSSPHIVS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++         NL +EYM GG++ D     GG +DE +IR YTR ++ GL YLH  
Sbjct  60    YMGHDITSENNKLVYNLLMEYMPGGTIIDAIHSSGGLVDESIIRNYTRGMVKGLDYLHSL  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQG  901
             G+VH D+K RN+L+  +G  K+ADFGC++    +P    +A + G+P++MAPE  R  + 
Sbjct  120   GLVHCDIKGRNILVGENG-PKIADFGCARWA--NPAGASVATIGGTPMFMAPEVARGEEQ  176

Query  902   GLDCASDIWSLGCTIIEMAT-GNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G  C  D+W+LGCTIIEMAT G+ PW    ++PV+ + +IA S + P  PS  S +   F
Sbjct  177   GFAC--DVWALGCTIIEMATGGSAPWP-NAADPVTVLYQIAYSNELPEIPSFLSDQAKHF  233

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             LEKCL RDP +RW A +LL H F+
Sbjct  234   LEKCLRRDPTERWTASQLLKHSFL  257



>ref|XP_004486314.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cicer arietinum]
Length=435

 Score =   211 bits (537),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 132/352 (38%), Positives = 200/352 (57%), Gaps = 31/352 (9%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W++G+T+G GS  +V++A N+ +G  F VKS E     +FL+ E EIL  L+ P +V 
Sbjct  1     MDWMRGRTIGRGSTATVYIAENRHSGEHFAVKSTELHRS-EFLKREQEILSKLNCPEIVD  59

Query  554   CIGKEMC---GGKKLNLFIEYMAGGSLAD--VTQQFGGKLDEMVIRLYTREILLGLKYLH  718
               G ++    G +  NLF+EY   G+L+D    +  G  ++E +++ + R IL GL YLH
Sbjct  60    YHGCDVTLENGVEFFNLFMEYAPYGTLSDELRNRNGGNGMEEALVKFHARRILFGLHYLH  119

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-N  895
              NGIVH DLK +NVLL+  G  K+ADFGC++RV++    I     +G+P +MAPE  R  
Sbjct  120   SNGIVHCDLKGQNVLLTEHG-AKIADFGCARRVEEEEMLI-----SGTPAYMAPEVARGE  173

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             + G   ++D+W+LGCT++EM T  +PW G +S+P + + RI  S D P  P+  S++G D
Sbjct  174   EQGF--SADVWALGCTVLEMITAKMPWQG-VSDPAAVLYRIGFSGDVPEIPNSVSEQGKD  230

Query  1076  FLEKCLERDPRKRWKAEELLHHPFVNpeseefaassp-asVLDRSIFPetdysdesdeed  1252
             FL KCL+RDP +RW   ELL H FV    E    S    +VL+RSI+           ++
Sbjct  231   FLRKCLKRDPNERWSVIELLGHEFVGEFKELVFDSETPTTVLERSIWD-----CLEKTQE  285

Query  1253  etPLRSPVPKPTTNRFFPFSILCENKFGVSEQHPRFGEHWSTSEEWITVRTS  1408
               P        ++N       LC ++  V E        +   +EWITVR++
Sbjct  286   VGPTFDCCSSDSSNPLDRIQRLCSDE-AVWE--------FDNDDEWITVRSN  328



>ref|XP_009796297.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Nicotiana sylvestris]
Length=412

 Score =   211 bits (536),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/266 (42%), Positives = 165/266 (62%), Gaps = 13/266 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G  +G GS  +V +A ++ +  +F VKS E  S  QFL+ E ++L +L SP++V 
Sbjct  1     MDWTRGHIIGHGSSAAVSVAKSRWSSEIFAVKSVEL-SQSQFLQKEQKVLSALSSPYIVS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NL +EYM+ G++AD  ++ GG+++E VI  YT++ILLGL+YLH  
Sbjct  60    YKGYDVTKENNTVMFNLMMEYMSEGTIADEIRKNGGRINEPVIGYYTKQILLGLEYLHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVK--KHPNPIPLAGVAGSPLWMAPETLR--  892
             G+VH D+K +N+LL  +G  K+ADFGC++ V   +         + G+P++MAPE  R  
Sbjct  120   GVVHCDIKGQNILLGKTG-AKIADFGCARWVDTAERDGGASAQPIGGTPMYMAPEVARGE  178

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              QG    A+DIW LGCTIIEMATG  PW   ++N  S + +IA S   P  P   S +  
Sbjct  179   EQG---FAADIWGLGCTIIEMATGGSPWT-NVTNSASLLYKIAFSGQSPEIPKFLSLQAK  234

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KC  RD ++RW A++LL HPF+
Sbjct  235   DFLSKCFRRDQKERWTAKQLLKHPFL  260



>gb|KDP20719.1| hypothetical protein JCGZ_21190 [Jatropha curcas]
Length=414

 Score =   211 bits (536),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 117/256 (46%), Positives = 163/256 (64%), Gaps = 13/256 (5%)
 Frame = +2

Query  404   SGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLD-SPHVVKCIGKEMC--  574
             S S  +V +A    +   F VKSAE  S  +FL+ E  IL +L   P ++   G E+   
Sbjct  5     SCSTATVSIATVDESDQAFAVKSAEL-SQSEFLQKEQSILFTLRPCPQIIAYKGFEVTEE  63

Query  575   -GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIVHSDLKC  751
              G    N+F+EY   G+L D  +  GG L+E +IR YTREILLGL +LH NGI+HSD+KC
Sbjct  64    YGKLFYNIFLEYAPAGTLTDAIRLRGGCLEEGIIRSYTREILLGLHHLHSNGIIHSDIKC  123

Query  752   RNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQGGLDCASDI  925
              N+L++S G  KLADFGC++RV +  +      +AG+P++MAPE  R  +QG     +D+
Sbjct  124   HNILVTSDGP-KLADFGCARRVDQFCSATARTTIAGTPIYMAPEVARGEHQG---FPADV  179

Query  926   WSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDR-PNFPSHFSQEGLDFLEKCLERD  1102
             W+LGC ++EMATG  PW   IS+PVSA+ +I  S+   P  PS  S++G DF+ KCL+RD
Sbjct  180   WALGCAVVEMATGRAPWTN-ISDPVSAIYQIGFSDKSMPEIPSFMSKQGKDFISKCLKRD  238

Query  1103  PRKRWKAEELLHHPFV  1150
             P +RW A ELL+H F+
Sbjct  239   PVERWSASELLNHSFI  254



>ref|NP_001067464.1| Os11g0207200 [Oryza sativa Japonica Group]
 dbj|BAF27827.1| Os11g0207200, partial [Oryza sativa Japonica Group]
Length=554

 Score =   214 bits (545),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 165/276 (60%), Gaps = 16/276 (6%)
 Frame = +2

Query  350   SKCSCSRPV--EWVKGKTVGSGSFGSVHLAMNKATGGLFVVK-----SAESDSG--LQFL  502
             S CS SR V  +W KGK +GSG+FG V+   N   G +  +K     S +S+S   L+ L
Sbjct  136   SPCSSSRVVSSQWKKGKLLGSGTFGQVYQGFNSEGGQMCAIKEVKVISDDSNSKECLRQL  195

Query  503   ESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLY  682
               E  +L  L  P++V+  G ++   + L++++EY++GGS+  + Q++G    E V+R Y
Sbjct  196   HQEIVLLSQLSHPNIVQYYGSDL-SSETLSVYLEYVSGGSIHKLLQEYGA-FGEAVLRNY  253

Query  683   TREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGS  862
             T +IL GL YLH    VH D+K  N+L+  +GD+KLADFG +K +  H +   +    GS
Sbjct  254   TAQILSGLAYLHGRNTVHRDIKGANILVDPNGDIKLADFGMAKHISAHTS---IKSFKGS  310

Query  863   PLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPN  1042
             P WMAPE + N  G   + DIWSLGCTIIEMAT   PW       V+A+ +I  S+D P+
Sbjct  311   PYWMAPEVIMNTNGYSLSVDIWSLGCTIIEMATARPPWIQYEG--VAAIFKIGNSKDIPD  368

Query  1043  FPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              P H S E  +FL+ CL+RDP  R  A +L+ HPFV
Sbjct  369   IPDHLSFEAKNFLKLCLQRDPAARPTAAQLMEHPFV  404



>gb|ABK06426.1| HA-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=304

 Score =   207 bits (527),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 164/270 (61%), Gaps = 14/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +G G+FG+V++ MN  +G L  VK            ++ + +Q LE E ++
Sbjct  11    PISWRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLIAANFASKEKTQAHIQELEEEVKL  70

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G  +     LN+ +E++ GGS++ + ++FG    E V+R YTR++LL
Sbjct  71    LKNLSHPNIVRYLGT-VREDDTLNILLEFVPGGSISSLLEKFG-PFPESVVRTYTRQLLL  128

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH + I+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  129   GLEYLHNHAIMHRDIKGANILVDNKGCIKLADFGASKQVAELATMTGAKSMKGTPYWMAP  188

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCT+IEM TG  PW+ +    V+A+  I  ++  P  P   S
Sbjct  189   EVIL-QTGHSFSADIWSVGCTVIEMVTGKAPWSQQYKE-VAAIFFIGTTKSHPPIPDTLS  246

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              +  DFL KCL+  P  R  A ELL HPFV
Sbjct  247   SDAKDFLLKCLQEVPNLRPTASELLKHPFV  276



>gb|KDP39158.1| hypothetical protein JCGZ_00915 [Jatropha curcas]
Length=406

 Score =   210 bits (534),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 170/268 (63%), Gaps = 13/268 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGG-LFVVKSAESDSGLQFLESEAEILESLDSPHVV  550
             +EW +G  +G GS  +V LA + A+ G LF +KS+E    +  L+ E   L  L+SP+VV
Sbjct  1     MEWTRGPIIGRGSTATVSLATSTASSGKLFALKSSELSKSM-LLQKEQCFLSKLNSPYVV  59

Query  551   KCIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
             K IG ++         N+ +EY++GG+L +V  + GGKL+E +IRL+TR IL GL+YLH 
Sbjct  60    KYIGCDISRENDKPMYNICMEYVSGGTLHEVILRNGGKLEEAMIRLHTRNILQGLEYLHG  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQ  898
              G+ H D+K  N+L+S  G  K+ADFGC++ +K+  +    +  AG+P +MAPE  R  +
Sbjct  120   IGLAHCDIKSHNILVSKEGLAKIADFGCARFIKEIDS--GKSAFAGTPAFMAPEVARGEE  177

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAG---KISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
              G +  +D+WS+GCTIIEMATG +PW     +  + +S + +I  S D P  P   S++ 
Sbjct  178   QGFE--ADVWSVGCTIIEMATGRIPWMTLDQENDDVISVLYKIGFSSDLPEIPEWLSEKT  235

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              DFL KCL RDP++RW  +ELL HPF++
Sbjct  236   KDFLSKCLRRDPKERWTVKELLDHPFLD  263



>ref|XP_005845602.1| hypothetical protein CHLNCDRAFT_25736, partial [Chlorella variabilis]
 gb|EFN53500.1| hypothetical protein CHLNCDRAFT_25736, partial [Chlorella variabilis]
Length=362

 Score =   209 bits (531),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 168/276 (61%), Gaps = 21/276 (8%)
 Frame = +2

Query  368   RPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSG-----------LQFLESEA  514
             +P+ W +G+ VG G+FGSV +AM+  TG L  VK      G           ++ +E E 
Sbjct  93    KPINWTRGELVGQGAFGSVFVAMDNDTGELIAVKQVHIPRGGGVHAKKVEDNIRSVEEEV  152

Query  515   EILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREI  694
             ++L+  D  ++V+ +G E   G  LN+F+EY+ GGS+A +  +FG    E VIR+YT++I
Sbjct  153   QLLQQFDHDNIVRYLGTEKTDGA-LNIFLEYVPGGSIASLLAKFG-SFKESVIRVYTKQI  210

Query  695   LLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLA----GVAGS  862
             LLGL+YLH  G++H D+K  N+L+ ++G VK+ADFG SK+++   + + +A     V G+
Sbjct  211   LLGLEYLHSKGVMHRDIKGANILVDNTGLVKVADFGASKKLE---DLVTVADGNKSVKGT  267

Query  863   PLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPN  1042
             P WMAPE +  Q G    +D+WS+ CT++EMATG  PW+ +  + V+A+  IA ++  P 
Sbjct  268   PYWMAPEVI-TQTGHGRQADLWSVACTVLEMATGRPPWSTQYPSQVAAMFHIASTKGPPE  326

Query  1043  FPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              P H S E  DFL  C  RD + R  A  LL HPF+
Sbjct  327   IPQHLSPECKDFLYLCFNRDWKARPLASTLLRHPFL  362



>ref|XP_010323839.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Solanum lycopersicum]
Length=370

 Score =   209 bits (532),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 165/264 (63%), Gaps = 11/264 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W++G T+G GS  +V +A ++ +  +F VKS E  S  Q L+ E +IL  L SP+V+ 
Sbjct  1     MDWIRGHTIGHGSSAAVSVAKSRFSDEVFAVKSVEL-SESQLLQKEQKILSELSSPYVLS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++   K     N+ +EYM  G+L+D  ++  G+++E +I  YT++++ GL+YLH  
Sbjct  60    YKGCDVTKEKDKLMFNIRMEYMPDGTLSDEIRKQSGRMNEPLIGYYTKQMVQGLEYLHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--NQ  898
             GI H D+K +N+LL  SG  K+ADFGC+K +           + G+P++MAPE  R   Q
Sbjct  120   GIAHCDIKGQNILLGKSG-AKIADFGCAKWIDPANRDGGANSIGGTPMFMAPEVARGEEQ  178

Query  899   GGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G   CA+DIW LGCT+IEMATG  PW   ++N  S + +IA SE  P  P+  S +  DF
Sbjct  179   G---CAADIWGLGCTMIEMATGGSPW-NNVTNAASLLHKIAFSEQSPEIPTFLSLQAKDF  234

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             L KCL RD ++RW A++LL HPF+
Sbjct  235   LNKCLRRDSKERWTAKQLLKHPFL  258



>ref|XP_006419859.1| hypothetical protein CICLE_v10004485mg [Citrus clementina]
 gb|ESR33099.1| hypothetical protein CICLE_v10004485mg [Citrus clementina]
Length=653

 Score =   216 bits (549),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 168/271 (62%), Gaps = 14/271 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ VG G+FG V++ MN  +G L  VK            ++ + ++ LE E ++
Sbjct  63    PIRWRKGELVGCGAFGRVYMGMNLDSGELLAVKQVLIAANSASKEKTQAHIRELEEEVKL  122

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  123   LKNLTHPNIVRYLGTAR-EDDSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  180

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  181   GLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATINGAKSMKGTPYWMAP  240

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  241   EVIL-QTGHSFSADIWSVGCTVIEMATGKPPWSQQFQE-VAALFHIGTTKSHPPIPEHLS  298

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              E  DFL KCL+++P  R  A ELL HPFV 
Sbjct  299   MEAKDFLLKCLQKEPYLRSTASELLQHPFVT  329



>ref|XP_006410384.1| hypothetical protein EUTSA_v10016838mg [Eutrema salsugineum]
 gb|ESQ51837.1| hypothetical protein EUTSA_v10016838mg [Eutrema salsugineum]
Length=365

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 162/267 (61%), Gaps = 16/267 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+ +G GS  +V+ A    +  +  VKSAE     +FL+ EA I+ SL+SP+V+ 
Sbjct  1     MEWTRGRILGRGSTATVYAATCHNSNEILAVKSAELHRS-EFLQREATIISSLNSPYVIG  59

Query  554   CIGKEM----CGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G E      G    NL +EY   G L D   + GG+LDE  +  YTR+IL GL+Y+H 
Sbjct  60    YRGSETKTESNGVVTHNLLMEYAPYGKLTDAAAKNGGRLDEAQVVKYTRQILRGLEYIHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              GI H D+K  NV+++  G  K+ADFGC+KRV    +P   + V G+P +MAPE  R   
Sbjct  120   KGIAHCDVKGSNVVVADKGVAKIADFGCAKRV----DPEVESPVMGTPAFMAPEVARGEK  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPW--AGKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
             QG     SDIW++GCT+IEMATG+ PW  A    +PVS + R+  S + P  P   ++E 
Sbjct  176   QGK---ESDIWAVGCTVIEMATGSPPWTEANMREDPVSVLYRVGYSGETPELPRLLTKEA  232

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFV  1150
              DFLEKCL+R+  +RW A +LL+HPF+
Sbjct  233   KDFLEKCLKREANERWTATQLLNHPFL  259



>gb|KHN09317.1| Mitogen-activated protein kinase kinase kinase 2 [Glycine soja]
Length=862

 Score =   218 bits (554),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 160/265 (60%), Gaps = 14/265 (5%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVK-------SAESDSGLQFLESEAEILESLD  535
              W KGK +G G+FG V++  NK +G +  +K        A+S    + L  E  +L  L 
Sbjct  382   RWKKGKLLGRGTFGHVYVGFNKESGEMCAMKEVTLFSDDAKSKESAKQLMQEITLLSRLR  441

Query  536   SPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
              P++V+  G E  G  KL +++EY+AGGS+  + Q++G +  E+ IR YT++IL GL YL
Sbjct  442   HPNIVQYYGSETVG-DKLYIYLEYVAGGSIYKLLQEYG-QFGELAIRSYTQQILSGLAYL  499

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRN  895
             H    VH D+K  N+L+ ++G VKLADFG +K +     P+      GSP WMAPE ++N
Sbjct  500   HAKNTVHRDIKGANILVDTNGRVKLADFGMAKHITGQSCPL---SFKGSPYWMAPEVIKN  556

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
               G + A DIWSLGCT++EMAT   PW+      V+A+ +I  S++ P  P H S EG D
Sbjct  557   SNGCNLAVDIWSLGCTVLEMATTKPPWSQYEG--VAAMFKIGNSKELPTIPDHLSSEGKD  614

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             F+ KCL+R+P  R  A ELL HPFV
Sbjct  615   FVRKCLQRNPHNRPSASELLDHPFV  639



>ref|XP_003548172.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=898

 Score =   218 bits (555),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 160/265 (60%), Gaps = 14/265 (5%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVK-------SAESDSGLQFLESEAEILESLD  535
              W KGK +G G+FG V++  NK +G +  +K        A+S    + L  E  +L  L 
Sbjct  409   RWKKGKLLGRGTFGHVYVGFNKESGEMCAMKEVTLFSDDAKSKESAKQLMQEITLLSRLR  468

Query  536   SPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
              P++V+  G E  G  KL +++EY+AGGS+  + Q++G +  E+ IR YT++IL GL YL
Sbjct  469   HPNIVQYYGSETVG-DKLYIYLEYVAGGSIYKLLQEYG-QFGELAIRSYTQQILSGLAYL  526

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRN  895
             H    VH D+K  N+L+ ++G VKLADFG +K +     P+      GSP WMAPE ++N
Sbjct  527   HAKNTVHRDIKGANILVDTNGRVKLADFGMAKHITGQSCPL---SFKGSPYWMAPEVIKN  583

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
               G + A DIWSLGCT++EMAT   PW+      V+A+ +I  S++ P  P H S EG D
Sbjct  584   SNGCNLAVDIWSLGCTVLEMATTKPPWSQYEG--VAAMFKIGNSKELPTIPDHLSSEGKD  641

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             F+ KCL+R+P  R  A ELL HPFV
Sbjct  642   FVRKCLQRNPHNRPSASELLDHPFV  666



>ref|XP_009766368.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1 
[Nicotiana sylvestris]
Length=690

 Score =   216 bits (550),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 166/270 (61%), Gaps = 14/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +G G+FG V++ MN  +G L  +K             + + ++ LE E  +
Sbjct  77    PIRWRKGEMIGCGAFGRVYMGMNVDSGELLAIKEVSIAMNGASRERAQAHVRELEEEVNL  136

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G     G  LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  137   LKNLSHPNIVRYLGTAREAGS-LNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  194

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  195   GLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATMTGAKSMKGTPYWMAP  254

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCTIIEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  255   EVIL-QTGHSFSADIWSVGCTIIEMATGKPPWSQQYQE-VAALFHIGTTKSHPPIPEHLS  312

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              E  DFL KCL+++P  R  A  LL HPFV
Sbjct  313   AEAKDFLLKCLQKEPHLRHSASNLLQHPFV  342



>ref|XP_009593508.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1 
[Nicotiana tomentosiformis]
Length=690

 Score =   216 bits (550),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 166/270 (61%), Gaps = 14/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +G G+FG V++ MN  +G L  +K             + + ++ LE E  +
Sbjct  77    PIRWRKGEMIGCGAFGRVYMGMNVDSGELLAIKEVSIAMNGASRERAQAHVRELEEEVNL  136

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G     G  LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  137   LKNLSHPNIVRYLGTAREAGS-LNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  194

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  195   GLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATMTGAKSMKGTPYWMAP  254

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCTIIEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  255   EVIL-QTGHSFSADIWSVGCTIIEMATGKPPWSQQYQE-VAALFHIGTTKSHPPIPEHLS  312

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              E  DFL KCL+++P  R  A  LL HPFV
Sbjct  313   AEAKDFLLKCLQKEPHLRHSASNLLQHPFV  342



>gb|KDO76248.1| hypothetical protein CISIN_1g013380mg [Citrus sinensis]
 gb|KDO76249.1| hypothetical protein CISIN_1g013380mg [Citrus sinensis]
Length=444

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 156/265 (59%), Gaps = 14/265 (5%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVK-------SAESDSGLQFLESEAEILESLD  535
              W KG+ +G G+FG V+L  N  +G +  +K        A+S    Q L  E  +L  L 
Sbjct  156   RWKKGRLLGRGTFGHVYLGFNSESGEMCAMKEVTLFSDDAKSKESAQQLGQEIALLSRLR  215

Query  536   SPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
              P++V+  G E     KL +++EY++GGS+  + Q +G +L E  IR YT++IL GL+YL
Sbjct  216   HPNIVRYYGSETLD-DKLYIYLEYVSGGSIYKILQDYG-QLGESAIRSYTQQILSGLEYL  273

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRN  895
             H    VH D+K  N+L+  SG VKLADFG +K +     P+    + GSP WMAPE ++N
Sbjct  274   HAKNTVHRDIKGANILVDPSGRVKLADFGMAKHITGQSCPL---SIKGSPYWMAPEVIKN  330

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
               G + A DIWSLGCT+IEMAT   PW+     P  A+ +I  S++ P  P H S EG D
Sbjct  331   SNGCNLAVDIWSLGCTVIEMATTKPPWSQYEGVP--AMFKIGNSKELPAIPDHLSDEGKD  388

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             F+ KCL+R+P  R  A  LL HPFV
Sbjct  389   FVRKCLQRNPLHRPTAAWLLEHPFV  413



>ref|XP_009396715.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Musa acuminata subsp. malaccensis]
Length=539

 Score =   213 bits (542),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/266 (45%), Positives = 164/266 (62%), Gaps = 16/266 (6%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVVK  553
             +W + +T+G GS  +V LAM   +G LF VKS+E S S L  +  E  IL SL  P++V 
Sbjct  5     QWCRLRTIGHGSTATVSLAMTYPSGHLFSVKSSELSLSAL--VRREQAILSSLHHPNIVS  62

Query  554   CIGKEMC-----GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLH  718
             C+G  +      G    +LF+EY  GGSL+D  ++ GG L+E VIR YT +IL GL +LH
Sbjct  63    CLGFNVAAEAPHGRLFYHLFLEYAPGGSLSDCMKKHGGLLEEAVIRSYTHDILHGLAHLH  122

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--  892
                + H D+K +N+L+   G  K+AD GC++      +      + G+P++MAPE  R  
Sbjct  123   AMFVAHCDVKSQNILIWPEGRAKIADLGCARSAAGDDD--ARWPIMGTPMFMAPEVARGE  180

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              QG     +DIWSLGCT+IEMATG  PW   + +PV+A+ R+  S + PN P   S+ G 
Sbjct  181   EQGA---PADIWSLGCTVIEMATGRPPWP-DVVDPVAALHRVGFSSEVPNRPGWLSEAGK  236

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL+KCL RDPR+RW AE+LL HPFV
Sbjct  237   DFLDKCLRRDPRERWTAEQLLEHPFV  262



>ref|XP_004298165.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Fragaria vesca subsp. vesca]
Length=677

 Score =   216 bits (549),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 168/270 (62%), Gaps = 14/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +GSG+FG V++ MN  +G L  VK            ++ + ++ LE E  +
Sbjct  55    PIRWRKGELIGSGAFGRVYMGMNLDSGELIAVKQVSIAASSASKEKTQAHIRELEEEVRL  114

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  115   LKNLSHPNIVRYLGTAR-EADSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  172

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  173   GLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATINGAKSMKGTPYWMAP  232

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  233   EVIL-QTGHSFSADIWSVGCTVIEMATGKPPWSQQYQE-VAALFHIGTTKSHPPIPEHLS  290

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              E  DFL +CLE++P  R  A ELL HPFV
Sbjct  291   AEAKDFLLQCLEKEPDFRSSASELLQHPFV  320



>ref|XP_010451165.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Camelina sativa]
Length=447

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/263 (43%), Positives = 166/263 (63%), Gaps = 13/263 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +G  +G GS  +V +A++  +G +F VKS+E  S   FL+ E  IL +L SPH+VK
Sbjct  3     MNWTRGPIIGRGSTATVSIAISN-SGEIFAVKSSELSSST-FLQKEQSILSTLSSPHIVK  60

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              IG  +   K     N+ +EY++GGSL D+ +  GGKL E  IR YTR+IL GL YLHE 
Sbjct  61    YIGSGLTREKDGLVYNILMEYVSGGSLHDLIKNSGGKLPEPAIRSYTRQILNGLMYLHER  120

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGG  904
             GIVH DLK +NVL+  +G +K+AD GC+K V         +  +G+P +MAPE  R +  
Sbjct  121   GIVHCDLKSQNVLVEENGVLKIADMGCAKTVGGE------SEFSGTPAFMAPEVARGEEQ  174

Query  905   LDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLE  1084
                 +D+W LGCT++EM TG+ PW  ++++ V+A+ +I  S + P  P   S++  DFL 
Sbjct  175   R-FPADVWGLGCTVMEMMTGSSPWP-ELNDVVAAMYKIGFSGESPEIPVCVSEKAKDFLV  232

Query  1085  KCLERDPRKRWKAEELLHHPFVN  1153
              C E+DP++RW  +ELL HPF++
Sbjct  233   SCFEKDPKQRWTVQELLKHPFLD  255



>sp|Q40541.1|NPK1_TOBAC RecName: Full=Mitogen-activated protein kinase kinase kinase 
NPK1; AltName: Full=Nicotiana protein kinase 1 [Nicotiana tabacum]
 dbj|BAA05648.1| protein kinase [Nicotiana tabacum]
Length=690

 Score =   216 bits (549),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 166/270 (61%), Gaps = 14/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +G G+FG V++ MN  +G L  +K             + + ++ LE E  +
Sbjct  77    PIRWRKGEMIGCGAFGRVYMGMNVDSGELLAIKEVSIAMNGASRERAQAHVRELEEEVNL  136

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G     G  LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  137   LKNLSHPNIVRYLGTAREAGS-LNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  194

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  195   GLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATMTGAKSMKGTPYWMAP  254

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCTIIEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  255   EVIL-QTGHSFSADIWSVGCTIIEMATGKPPWSQQYQE-VAALFHIGTTKSHPPIPEHLS  312

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              E  DFL KCL+++P  R  A  LL HPFV
Sbjct  313   AESKDFLLKCLQKEPHLRHSASNLLQHPFV  342



>gb|AHW50674.1| mitogen-activated protein kinase kinase kinase a [Nicotiana tabacum]
Length=399

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 164/266 (62%), Gaps = 13/266 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G  +G GS  +V +A ++ +  +F VKS E  S  QFL+ E ++L +L SP++V 
Sbjct  1     MDWTRGHIIGHGSSAAVSVAKSRWSSEIFAVKSVEL-SQSQFLQKEQKVLSALSSPYIVS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NL +EYM+ G++AD  ++ GG+++E VI  YT++ILLGL+YLH  
Sbjct  60    YKGYDVTKENNTVMFNLMMEYMSEGTIADEIRKNGGRINEPVIGYYTKQILLGLEYLHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVK--KHPNPIPLAGVAGSPLWMAPETLR--  892
             G+VH D+K +N+L   +G  K+ADFGC++ V   +         + G+P++MAPE  R  
Sbjct  120   GVVHCDIKGQNILFGKTG-AKIADFGCARWVDTAERDGGASAQPIGGTPMYMAPEVARGE  178

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              QG    A+DIW LGCTIIEMATG  PW   ++N  S + +IA S   P  P   S +  
Sbjct  179   EQG---FAADIWGLGCTIIEMATGGSPWT-NVTNSASLLYKIAFSGQSPEIPKFLSLQAK  234

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KC  RD ++RW A++LL HPF+
Sbjct  235   DFLSKCFRRDQKERWTAKQLLKHPFL  260



>ref|XP_006419860.1| hypothetical protein CICLE_v10004485mg [Citrus clementina]
 gb|ESR33100.1| hypothetical protein CICLE_v10004485mg [Citrus clementina]
Length=668

 Score =   215 bits (548),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 168/271 (62%), Gaps = 14/271 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ VG G+FG V++ MN  +G L  VK            ++ + ++ LE E ++
Sbjct  63    PIRWRKGELVGCGAFGRVYMGMNLDSGELLAVKQVLIAANSASKEKTQAHIRELEEEVKL  122

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  123   LKNLTHPNIVRYLGTAR-EDDSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  180

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  181   GLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATINGAKSMKGTPYWMAP  240

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  241   EVIL-QTGHSFSADIWSVGCTVIEMATGKPPWSQQFQE-VAALFHIGTTKSHPPIPEHLS  298

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              E  DFL KCL+++P  R  A ELL HPFV 
Sbjct  299   MEAKDFLLKCLQKEPYLRSTASELLQHPFVT  329



>ref|XP_009625848.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana tomentosiformis]
Length=668

 Score =   215 bits (548),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/271 (41%), Positives = 167/271 (62%), Gaps = 14/271 (5%)
 Frame = +2

Query  368   RPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAE  517
             RP+ W KG+ +G G+FG V++ MN  +G L  VK            ++ S ++ LE E +
Sbjct  66    RPIRWRKGEMIGCGAFGQVYMGMNLDSGELLAVKQVLIAANSASKEKAQSHVKELEEEVK  125

Query  518   ILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREIL  697
             +L++L  PH+V+ +G  +     LN+ +E++ GGS++ +  +FG    E VIR YT+++L
Sbjct  126   LLKNLSHPHIVRYLGT-VREEDTLNILLEFVPGGSISSLLGKFG-SFPEPVIRTYTKQLL  183

Query  698   LGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMA  877
             LGL YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMA
Sbjct  184   LGLDYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATISGAKSMKGTPYWMA  243

Query  878   PETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHF  1057
             PE +R Q G   ++DIWS+GCT+IEM TG  PW+ +    V+A+  I  ++  P  P H 
Sbjct  244   PEVIR-QTGHSFSADIWSVGCTVIEMTTGKPPWSQQYQE-VAALFYIGTTKAHPPIPEHL  301

Query  1058  SQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             S E  DFL KCL+++P  R  A ELL H FV
Sbjct  302   SVEAKDFLLKCLQKEPELRLSASELLQHSFV  332



>ref|XP_006418061.1| hypothetical protein EUTSA_v10008116mg [Eutrema salsugineum]
 gb|ESQ36414.1| hypothetical protein EUTSA_v10008116mg [Eutrema salsugineum]
Length=342

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 167/269 (62%), Gaps = 18/269 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +GKT+G GS  +V+ A  K +G  F VKSAE     +FL+ EA+IL SL+SP+V+ 
Sbjct  1     MNWTRGKTIGRGSSATVYAATCKISGETFAVKSAEFHRS-EFLQREAKILSSLNSPYVIG  59

Query  554   CIGKEMC------GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
               G E+       G    NL +EY   G+L DV  + GG ++E  +  YTR++LLGL+Y+
Sbjct  60    YRGCEITKEPFNDGEATYNLLMEYAPHGTLTDVAAKNGGSIEEARVSRYTRQLLLGLEYI  119

Query  716   HEN-GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR  892
             H++ GI H D+K  NVL+  +G+ K+ADFGC+K V+    P     V G+P +MAPE  R
Sbjct  120   HDSKGIAHCDIKGSNVLVGENGEAKIADFGCAKWVE----PELTEPVRGTPAYMAPEVAR  175

Query  893   --NQGGLDCASDIWSLGCTIIEMATGNLPW-AGKISNPVSAVLRIACSEDRPNFPSHFSQ  1063
                QG     SDIW++GCT+IEM TG+ PW     ++PVS + R+    + P  PS  ++
Sbjct  176   GERQGK---ESDIWAVGCTVIEMVTGSPPWICADSTDPVSVLYRVGYLGESPELPSSLTE  232

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             +  DFL KCL+ + ++RW A +LL+HPF+
Sbjct  233   QAKDFLGKCLKIEAKERWTATQLLNHPFL  261



>ref|XP_006590517.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X5 [Glycine max]
Length=667

 Score =   215 bits (548),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 159/265 (60%), Gaps = 14/265 (5%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVK-------SAESDSGLQFLESEAEILESLD  535
              W KG+ +G G+FG V+L  N  +G +  +K        A+S    Q L  E  +L  L 
Sbjct  382   RWKKGQLLGRGTFGHVYLGFNSESGEMCAMKEVTLFSDDAKSRESAQQLGQEIALLSHLR  441

Query  536   SPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
              P++V+  G E     KL +++EY++GGS+  + QQ+G +L E+VIR YTR+ILLGL YL
Sbjct  442   HPNIVQYYGSETVD-DKLYIYLEYVSGGSIYKLLQQYG-QLSEIVIRNYTRQILLGLAYL  499

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRN  895
             H    VH D+K  N+L+  +G VKLADFG +K +     P+      GSP WMAPE ++N
Sbjct  500   HAKNTVHRDIKAANILVDPNGRVKLADFGMAKHISGQSCPL---SFKGSPYWMAPEVIKN  556

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
               G + A DIWSLG T+ EMAT   PW+      V+A+ +I  S+D P  P H S++G D
Sbjct  557   SNGCNLAVDIWSLGSTVFEMATTKPPWSQYEG--VAAMFKIGNSKDLPAMPDHLSEDGKD  614

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             F+ +CL+R+P  R  A +LL HPFV
Sbjct  615   FIRQCLQRNPVHRPSAAQLLLHPFV  639



>ref|XP_009600573.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Nicotiana tomentosiformis]
Length=416

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 165/269 (61%), Gaps = 16/269 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G  +G GS  +V +A ++ +  +F VKS +  S  QFL+ E +IL  L SP++V 
Sbjct  1     MDWTRGHIIGHGSSAAVSVAKSRWSSEIFAVKSVDL-SQSQFLQKEQKILSELSSPYIVS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
               G ++         NL +EYM+ G++ D  ++ GG+++E +I  YT++ILLGL+YLH  
Sbjct  60    YKGYDVTKENDKFLFNLMMEYMSDGTITDEIRKQGGRINEQLIGYYTKQILLGLEYLHSR  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAG-----VAGSPLWMAPETL  889
             G+VH D+K +N+LL  +G  K+ADFGC++ V         A      + G+P++MAPE  
Sbjct  120   GVVHCDIKGQNILLGKTG-AKIADFGCARWVDPAERDGGAAAASAQPIGGTPMYMAPEVA  178

Query  890   R--NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQ  1063
             R   QG    A+DIW+LGCTIIEMATG  PW   ++N  S + +I  S   P  P   S 
Sbjct  179   RGEEQG---FAADIWALGCTIIEMATGGSPWTN-VANSASLLYKIVFSGQSPQIPKFLSL  234

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             +  DFL KCL R+P++RW A+ELL HPF+
Sbjct  235   QAKDFLSKCLRRNPKERWMAKELLKHPFL  263



>ref|NP_200320.1| mitogen-activated protein kinase kinase kinase 15 [Arabidopsis 
thaliana]
 dbj|BAB08578.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96579.1| mitogen-activated protein kinase kinase kinase 15 [Arabidopsis 
thaliana]
Length=448

 Score =   210 bits (535),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 168/262 (64%), Gaps = 14/262 (5%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVKCI  559
             W++G  +G GS  +V L +  + G  F VKSAE  S   FL+ E  IL  L SP++VK I
Sbjct  6     WIRGPIIGRGSTATVSLGITNS-GDFFAVKSAEFSSS-AFLQREQSILSKLSSPYIVKYI  63

Query  560   GKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGI  730
             G  +         NL +EY++GGSL D+ +  GGKL E +IR YTR+IL GL YLH+ GI
Sbjct  64    GSNVTKENDKLMYNLLMEYVSGGSLHDLIKNSGGKLPEPLIRSYTRQILKGLMYLHDQGI  123

Query  731   VHSDLKCRNVLLSSSGDV-KLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQGGL  907
             VH D+K +NV++   G++ K+ D GC+K V+++ N       +G+P +M+PE  R +   
Sbjct  124   VHCDVKSQNVMI--GGEIAKIVDLGCAKTVEENEN----LEFSGTPAFMSPEVARGEEQ-  176

Query  908   DCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEK  1087
                +D+W+LGCT+IEMATG+ PW  ++++ V+A+ +I  + + P  P   S++G DFL K
Sbjct  177   SFPADVWALGCTVIEMATGSSPWP-ELNDVVAAIYKIGFTGESPVIPVWLSEKGQDFLRK  235

Query  1088  CLERDPRKRWKAEELLHHPFVN  1153
             CL +DP++RW  EELL HPF++
Sbjct  236   CLRKDPKQRWTVEELLQHPFLD  257



>gb|KDO74738.1| hypothetical protein CISIN_1g005944mg [Citrus sinensis]
Length=668

 Score =   215 bits (547),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 168/270 (62%), Gaps = 14/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ VG G+FG V++ MN  +G L  VK            ++ + ++ LE E ++
Sbjct  63    PIRWRKGELVGCGAFGRVYMGMNLDSGELLAVKQVLIAANSASKEKTQAHIRELEEEVKL  122

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  123   LKNLTHPNIVRYLGTAR-EDDSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  180

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  181   GLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATINGAKSMKGTPYWMAP  240

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  241   EVIL-QTGHSFSADIWSVGCTVIEMATGKPPWSQQFQE-VAALFHIGTTKSHPPIPEHLS  298

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              E  DFL KCL+++P  R  A ELL HPFV
Sbjct  299   MEAKDFLLKCLQKEPYLRSTASELLQHPFV  328



>emb|CDY12200.1| BnaC04g12300D [Brassica napus]
Length=365

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/265 (42%), Positives = 160/265 (60%), Gaps = 11/265 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+ +G GS  +V+ A    +  +  VKS+E     +FL+ EA+IL SL SP+V+ 
Sbjct  1     MEWTRGRILGRGSTATVYAATRHNSNEILAVKSSELHRS-EFLKREAKILSSLSSPYVIG  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G    +E  G    NL +EY   G+L D   + GG L+E  I  YTR+IL GL+Y+H 
Sbjct  60    YRGSETKRESNGVVTYNLLMEYAPYGTLTDAAAKNGGGLEEATIVKYTRDILRGLEYIHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
              G+ H D+K  NV++   G+ K+ADFGC+KRV      +    V G+P +MAPE  R + 
Sbjct  120   RGVAHCDVKGSNVVVGEKGEAKIADFGCAKRVDPE---VDSEAVMGTPAFMAPEVARGE-  175

Query  902   GLDCASDIWSLGCTIIEMATGNLPW--AGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
                  SDIW++GCT+IEMATG+ PW  A    +PVS + R+  S + P  P   ++E  D
Sbjct  176   KQGRESDIWAVGCTVIEMATGSPPWTEASSGESPVSVLYRVGYSGEAPELPCLLTEEAKD  235

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FLEKC +R+ ++RW A +LL+HPF+
Sbjct  236   FLEKCFKREAKERWTATQLLNHPFL  260



>ref|XP_009347129.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Pyrus x bretschneideri]
Length=424

 Score =   209 bits (533),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 162/264 (61%), Gaps = 12/264 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G T+G GS  +V LA +  +G  F VKSAE     +FL+ E +I   L SPH+V 
Sbjct  1     MEWTRGCTIGQGSSATVSLATSCRSGDKFAVKSAEMFHS-EFLQREQKIFSVLSSPHIVS  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G ++         NL +EYM GG++ D     GG +DE +IR YTR ++ GL YLH  
Sbjct  60    YMGHDITSENNKLVYNLLMEYMPGGTIIDAIHSSGGLVDESIIRNYTRGMVKGLDYLHSL  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-NQG  901
             G+VH D+K RN+L+  +G  K+ADFGC++   +    +  A + G+P++MAPE  R  + 
Sbjct  120   GLVHCDIKGRNILVGENG-PKIADFGCARWANRAGASV--ATIGGTPMFMAPEVARGEEQ  176

Query  902   GLDCASDIWSLGCTIIEMAT-GNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDF  1078
             G  C  D+W+LGCTIIEMAT G+ PW    ++PV+ + +IA S + P  PS  S +   F
Sbjct  177   GFAC--DVWALGCTIIEMATGGSAPWP-NAADPVTVLYQIAYSNELPEIPSFLSDQAKHF  233

Query  1079  LEKCLERDPRKRWKAEELLHHPFV  1150
             LEKCL RDP +RW A +LL H F+
Sbjct  234   LEKCLRRDPTERWTASQLLKHSFL  257



>ref|XP_010928554.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Elaeis guineensis]
Length=678

 Score =   215 bits (547),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 169/272 (62%), Gaps = 14/272 (5%)
 Frame = +2

Query  365   SRPVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKS----------AESDSGLQFLESEA  514
             S P+ W KG+ +G G+FG V++ MN  +G L  VK           A++ + ++ LE E 
Sbjct  88    SPPIRWRKGELIGYGAFGQVYMGMNLDSGELLAVKQVLIGNNGASRAKAQAHIRELEEEV  147

Query  515   EILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREI  694
             ++L+ L  P++V+ +G  +   + LN+ +E+++GGS++ +  +FG    E VIR+YT+++
Sbjct  148   KLLKKLSHPNIVRYLGT-VREEETLNILLEFVSGGSISSLLGKFGS-FPEAVIRMYTKQL  205

Query  695   LLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWM  874
             L GL+YLH NGI+H D+K  N+L+ + G +KLADFG SK+V K         + G+P WM
Sbjct  206   LQGLEYLHRNGIIHRDIKGANILVDNKGCIKLADFGASKQVAKLATITAAKSMKGTPYWM  265

Query  875   APETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSH  1054
             APE +  Q G   ++DIWS+GCTIIEMATG  PW+ +    V+A+  +  ++  P  P H
Sbjct  266   APEVIV-QSGHSFSADIWSVGCTIIEMATGKPPWSQQYQE-VAALFHVGTTKSHPPIPEH  323

Query  1055  FSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              S E  DFL KCL+ +P  R  A +LL HPFV
Sbjct  324   LSLEAKDFLLKCLQEEPNLRPGAFDLLQHPFV  355



>ref|XP_001699564.1| hypothetical protein CHLREDRAFT_121660 [Chlamydomonas reinhardtii]
 gb|EDO98466.1| predicted protein [Chlamydomonas reinhardtii]
Length=278

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/283 (41%), Positives = 162/283 (57%), Gaps = 28/283 (10%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA--------------ESDSGLQFLES  508
             PV W KG+ +GSGSFG V+LA+N  TG L  VK                     +  LE 
Sbjct  1     PVRWRKGEGIGSGSFGQVYLALNCDTGDLLAVKEVPAGLAGGDGGGAGGGGREAVAQLER  60

Query  509   EAEILESLDSPHVVKCIGKEMCGGKK---------LNLFIEYMAGGSLADVTQQFGGKLD  661
             E  +L +L  P++V+ +G +  G            L +F+EY+ GGSL+    +FG  L 
Sbjct  61    EVALLSALRHPNIVRYVGTQRSGAGGGGGGGGGAPLYIFLEYVPGGSLSSQLARFG-PLP  119

Query  662   EMVIRLYTREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIP  841
             E ++ LYTR++LLGL YLH    VH D+K  N+LL  +G +KLADFG +K++ +  +   
Sbjct  120   EPLVALYTRQLLLGLAYLHAQRTVHRDVKGANLLLEKTGVLKLADFGMAKQLMEQVSFT-  178

Query  842   LAGVAGSPLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIA  1021
                  GS  WMAPE ++ Q G    +DIWS+GCT++EMATG  PW+ + ++ V A+ +IA
Sbjct  179   -RSFKGSAYWMAPEVIKQQ-GYGVQADIWSVGCTVLEMATGKPPWS-QCTSQVQAIFKIA  235

Query  1022  CSEDRPNFPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              S D P  P H S +  +F+  CL+RDP  R  AEELL HPFV
Sbjct  236   SSPDLPAIPDHLSPQASEFILLCLQRDPSSRPTAEELLRHPFV  278



>gb|KDO78298.1| hypothetical protein CISIN_1g040569mg, partial [Citrus sinensis]
Length=385

 Score =   208 bits (530),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/266 (43%), Positives = 165/266 (62%), Gaps = 14/266 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G+T+G GS  +V + M+  +  +F VKSAE  S  +FL+ E  IL +L  P +V 
Sbjct  1     MDWTRGQTIGRGSTATVSIGMSNRSSEVFAVKSAEL-SNSEFLQREQRILSALACPQIVA  59

Query  554   ---CIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
                C   E  G    NLF+EY  GG+L D  +  G  L+E  IR +TR +LLGL+YLH N
Sbjct  60    YKGCDISEENGKILYNLFLEYAPGGTLTDAIRS-GTCLEEGRIRSHTRAVLLGLQYLHSN  118

Query  725   GIVHSDLKCRNVLLSSSGD--VKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--  892
             GIVH D+K +N+L+S   +   K+ADFGC++R + + +      + G+P+ MAPE  R  
Sbjct  119   GIVHCDIKGQNILVSKDNEQGAKIADFGCARRARVNEDD-EGKPICGTPICMAPEVARGE  177

Query  893   NQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGL  1072
              QG     +D+W+LGCT++EMATG  PW   +++P+SA+ RI  S D P  P + S++  
Sbjct  178   EQG---FPADVWALGCTVLEMATGRPPWP-DVADPISALHRIGFSSDTPEIPGYMSKQAQ  233

Query  1073  DFLEKCLERDPRKRWKAEELLHHPFV  1150
             DFL KCL R+P +RW A ELL H FV
Sbjct  234   DFLSKCLIRNPGERWSASELLEHGFV  259



>ref|XP_004487421.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cicer arietinum]
Length=404

 Score =   209 bits (531),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/265 (44%), Positives = 164/265 (62%), Gaps = 16/265 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESD-SGLQFLESEAEILESLDSPHVV  550
             +EW +G  +G GS  +V+LA + ++  +  VKSAE+  S  + LE E  IL SL SP++V
Sbjct  3     MEWTRGNIIGHGSSATVYLATSPSSSDVSAVKSAETSLSYSKHLEREQRILSSLYSPYIV  62

Query  551   KCIGKEMCGGKK---LNLFIEYMAGGSLADVTQQF-GGKLDEMVIRLYTREILLGLKYLH  718
                G            NLF+EYM  G+L+  T++  GG+L+E  I  +TR+IL GL+YLH
Sbjct  63    SYKGCNFTNENNKNLFNLFMEYMPLGNLSQATRRNDGGRLNEPAIAHFTRQILQGLEYLH  122

Query  719   ENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR-N  895
               GIVH D+K  N+L+   G VK+ DFGC+K V +    +P   +AG+P++M+PE  R  
Sbjct  123   TKGIVHCDIKGSNILVCEKG-VKIGDFGCAKMVDE---TVP---IAGTPMFMSPEVARGE  175

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             + G  C  D+WSLGCTI+EMATG  PW   + +PV+ + RIA S D P  P   S++  D
Sbjct  176   EQGYPC--DVWSLGCTIVEMATGFSPWT-NVEDPVTVLYRIAYSNDVPEIPCFLSEQAKD  232

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FLEKC  RD ++RW   +LL HPF+
Sbjct  233   FLEKCFRRDSKERWNCSQLLKHPFL  257



>gb|ABG22410.1| mitogen-activated kinase kinase kinase alpha, putative, expressed 
[Oryza sativa Japonica Group]
Length=552

 Score =   212 bits (540),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 165/276 (60%), Gaps = 16/276 (6%)
 Frame = +2

Query  350   SKCSCSRPV--EWVKGKTVGSGSFGSVHLAMNKATGGLFVVK-----SAESDSG--LQFL  502
             S CS SR V  +W KGK +GSG+FG V+   N   G +  +K     S +S+S   L+ L
Sbjct  235   SPCSSSRVVSSQWKKGKLLGSGTFGQVYQGFNSEGGQMCAIKEVKVISDDSNSKECLRQL  294

Query  503   ESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLY  682
               E  +L  L  P++V+  G ++   + L++++EY++GGS+  + Q++G    E V+R Y
Sbjct  295   HQEIVLLSQLSHPNIVQYYGSDLSS-ETLSVYLEYVSGGSIHKLLQEYGA-FGEAVLRNY  352

Query  683   TREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGS  862
             T +IL GL YLH    VH D+K  N+L+  +GD+KLADFG +K +  H +   +    GS
Sbjct  353   TAQILSGLAYLHGRNTVHRDIKGANILVDPNGDIKLADFGMAKHISAHTS---IKSFKGS  409

Query  863   PLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPN  1042
             P WMAPE + N  G   + DIWSLGCTIIEMAT   PW       V+A+ +I  S+D P+
Sbjct  410   PYWMAPEVIMNTNGYSLSVDIWSLGCTIIEMATARPPWIQY--EGVAAIFKIGNSKDIPD  467

Query  1043  FPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              P H S E  +FL+ CL+RDP  R  A +L+ HPFV
Sbjct  468   IPDHLSFEAKNFLKLCLQRDPAARPTAAQLMEHPFV  503



>ref|XP_008351233.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=696

 Score =   215 bits (547),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 169/271 (62%), Gaps = 14/271 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +GSG+FG V++ MN  +G LF VK            ++ + ++ LE E ++
Sbjct  83    PIRWRKGELIGSGAFGRVYMGMNLDSGELFAVKQVLIAANSASKEKTQAHIRELEEEVKL  142

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  143   LKNLSHPNIVRYLGTAR-EEDSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  200

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+N I+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  201   GLEYLHKNEIMHRDIKGANILVDNKGCIKLADFGASKKVVELATINGAKSMKGTPYWMAP  260

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  261   EVIL-QTGHSFSADIWSVGCTVIEMATGKPPWSQQYQE-VAALFHIGTTKSHPPIPEHLS  318

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              E  DFL KCLE++P  R  A EL+ HPFV 
Sbjct  319   AEAKDFLLKCLEKEPYLRSSASELVQHPFVT  349



>ref|XP_006305299.1| hypothetical protein CARUB_v10009674mg [Capsella rubella]
 gb|EOA38197.1| hypothetical protein CARUB_v10009674mg [Capsella rubella]
Length=336

 Score =   206 bits (525),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/275 (43%), Positives = 166/275 (60%), Gaps = 27/275 (10%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             + W +GK VG GS  +V  A  + +G    VKSAE     +FL+ EAEIL SL+SPHV  
Sbjct  1     MNWTRGKIVGRGSTATVSAATCQESGETIAVKSAEFHRS-EFLQREAEILSSLNSPHV--  57

Query  554   CIGKEMCGGKK------------LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREIL  697
              IG   C   K             NL +EY   G+LADV  + GG L+E  +  YTR++L
Sbjct  58    -IGYRGCAITKEPSSNNDGEATTYNLLMEYAPYGTLADVASKNGGFLEEARVVKYTRQLL  116

Query  698   LGLKYLHEN-GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWM  874
             LGL+Y+H + GI H D+K  NVL+  +G+ K+ADFGC+KRV+    P     V G+P +M
Sbjct  117   LGLEYIHNSMGIAHCDVKGSNVLIGENGEAKIADFGCAKRVE----PERTEPVRGTPAFM  172

Query  875   APETLR--NQGGLDCASDIWSLGCTIIEMATGNLPWAGK-ISNPVSAVLRIACSEDRPNF  1045
             APE  R   QG     SDIW++GCT+IEM TG+ PW+G   ++PVS + R+    + P  
Sbjct  173   APEVARGERQGR---ESDIWAVGCTVIEMVTGSTPWSGAGWNDPVSVLYRVGYLGESPEL  229

Query  1046  PSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             P   +++  DFL KCL+++ ++RW A +LL+HPF+
Sbjct  230   PCSLTEQAKDFLGKCLKKEAKERWTASQLLNHPFL  264



>ref|XP_008390850.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Malus domestica]
Length=696

 Score =   215 bits (547),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 169/271 (62%), Gaps = 14/271 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +GSG+FG V++ MN  +G LF VK            ++ + ++ LE E ++
Sbjct  83    PIRWRKGELIGSGAFGRVYMGMNLDSGELFAVKQVLIAANSASKEKTQAHIRELEEEVKL  142

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  143   LKNLSHPNIVRYLGTAR-EEDSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  200

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+N I+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  201   GLEYLHKNEIMHRDIKGANILVDNKGCIKLADFGASKKVVELATINGAKSMKGTPYWMAP  260

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  261   EVIL-QTGHSFSADIWSVGCTVIEMATGKPPWSQQYQE-VAALFHIGTTKSHPPIPEHLS  318

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              E  DFL KCLE++P  R  A EL+ HPFV 
Sbjct  319   AEAKDFLLKCLEKEPYLRSSASELVQHPFVT  349



>ref|XP_004229416.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1 
[Solanum lycopersicum]
Length=688

 Score =   214 bits (546),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 166/270 (61%), Gaps = 14/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +G G+FG V++ MN  +G L  +K             + + ++ LE E  +
Sbjct  76    PIRWRKGEMIGCGAFGRVYMGMNVDSGELLAIKEVSIAMNGASRERAQAHVRELEEEVNL  135

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G     G  LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  136   LKNLSHPNIVRYLGTAREVGS-LNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  193

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  194   GLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATMTGAKSMKGTPYWMAP  253

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCTIIEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  254   EVIL-QTGHSFSADIWSVGCTIIEMATGKPPWSQQYQE-VAALFHIGTTKSHPPIPEHLS  311

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              E  DFL KCL+++P  R  A  LL HPFV
Sbjct  312   AEAKDFLLKCLQKEPHLRTSASNLLQHPFV  341



>gb|EPS63016.1| hypothetical protein M569_11769 [Genlisea aurea]
Length=407

 Score =   208 bits (530),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 165/265 (62%), Gaps = 15/265 (6%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAE-SDSGLQFLESEAEILESLDSPHVV  550
             +EW +G  +G GS  +V+LA   +   +F VKS + S SG   L  E  ++  L SP+VV
Sbjct  1     MEWKRGPAIGRGSSATVYLASEISGVEVFAVKSCDLSSSGS--LRREERLISELCSPYVV  58

Query  551   KCIGKEMCGGK-----KLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
             +C+G  +  G      + NLF+EY+AGG+L+D+ +  GG LDE  I+LY  ++ +GL ++
Sbjct  59    RCLGSGVTEGGAGGIGEFNLFLEYVAGGTLSDLVRNRGGSLDEKTIQLYANQLAIGLDHI  118

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRN  895
             H  GIVH D+K +N+L+     +K+ DFGC K+  +   P     + G+P +M+PE  R 
Sbjct  119   HGKGIVHCDIKGQNILIGKEA-LKICDFGCGKKAGRGGEPP----IVGTPAYMSPEVARG  173

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             +      +DIW+LGCT+IEMATG+ PW  ++++PVSA+ R+A S D P  P   S    D
Sbjct  174   E-EQSFPADIWALGCTVIEMATGSNPWP-EMNHPVSALFRVAHSGDTPAPPDWLSNAAKD  231

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             F+ KCL RDPR+RW A ELL HPF+
Sbjct  232   FIGKCLARDPRQRWTAAELLRHPFL  256



>emb|CDY42094.1| BnaA05g10920D [Brassica napus]
Length=376

 Score =   207 bits (528),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/265 (42%), Positives = 160/265 (60%), Gaps = 11/265 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+ +G GS  +V  A    +  +  VKS+E     +FL+ EAEIL SL SP+V+ 
Sbjct  1     MEWTRGRILGRGSTATVCAATRHNSNEILAVKSSELHRS-EFLQREAEILSSLSSPYVIG  59

Query  554   CIG----KEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G    +E+ G    NL +EY   G+L D   + GG L+E +I  YTRE+L GL+Y+H 
Sbjct  60    YRGSETKRELNGVVTYNLLMEYAPYGTLTDAAAKNGGGLEEAMIVKYTREMLRGLEYIHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRNQG  901
              G+ H D+K  NV++   G+ K+ DFGC+KRV      +    V G+P +MAPE  R + 
Sbjct  120   RGVAHCDVKGSNVVVGEKGEAKIVDFGCAKRVDPE---VDSGAVVGTPAFMAPEVARGE-  175

Query  902   GLDCASDIWSLGCTIIEMATGNLPW--AGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
                  SDIW++GCT+IEMATG+ PW  A    +PVS + R+  S + P  P   ++E  D
Sbjct  176   KQGRESDIWAVGCTVIEMATGSPPWTEASSGESPVSVLYRVGYSGEAPELPCLLTEEAKD  235

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FLEKC +R+ ++RW A +LL+HPF+
Sbjct  236   FLEKCFKREAKERWTATQLLNHPFL  260



>emb|CDY52049.1| BnaCnng21650D [Brassica napus]
Length=355

 Score =   207 bits (526),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/267 (42%), Positives = 162/267 (61%), Gaps = 19/267 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G+ +G GS  +V  AM +++  +  VKS+E     +FL+ EA+IL SL+SP+V++
Sbjct  1     MEWTRGRILGRGSTATVCAAMYRSSNEILAVKSSELHRS-EFLQREAKILSSLNSPYVIR  59

Query  554   CIGKEM----CGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
               G E      G    NL +EY    +L D   + GG+L+E +I  YTREIL GL+Y+H 
Sbjct  60    YRGTETKIESNGVVTYNLLMEYAPYETLTDAAAKNGGRLEEAMIAKYTREILRGLEYIHS  119

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
              GI H D+K  NV+++  G+ KLADFGC+KRV           V G+P +MAPE  R   
Sbjct  120   KGIAHCDVKGSNVVVAEKGEAKLADFGCAKRVGSET-------VTGTPAFMAPEVARGEK  172

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPW--AGKISNPVSAVLRIACSEDRPNFPSHFSQEG  1069
             QG     SDIW++GCT+IEMATG+ PW  A    +PVS + R+  S + P  P   + E 
Sbjct  173   QGS---ESDIWAVGCTVIEMATGSPPWTEASSREDPVSVLYRVGYSGETPELPCLLTDEA  229

Query  1070  LDFLEKCLERDPRKRWKAEELLHHPFV  1150
              DFL+ C +R+ ++R  A +LL+HPF+
Sbjct  230   KDFLKMCFKREAKERRTATQLLNHPFL  256



>ref|XP_006349218.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum tuberosum]
Length=688

 Score =   214 bits (546),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 166/270 (61%), Gaps = 14/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +G G+FG V++ MN  +G L  +K             + + ++ LE E  +
Sbjct  76    PIRWRKGEMIGCGAFGRVYMGMNVDSGELLAIKEVSIAMNGASRERAQAHVRELEEEVNL  135

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G     G  LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  136   LKNLSHPNIVRYLGTAREVGS-LNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  193

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  194   GLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATMTGAKSMKGTPYWMAP  253

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCTIIEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  254   EVIL-QTGHSFSADIWSVGCTIIEMATGKPPWSQQYQE-VAALFHIGTTKSHPPIPEHLS  311

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              E  DFL KCL+++P  R  A  LL HPFV
Sbjct  312   AEAKDFLLKCLQKEPHLRTSASNLLQHPFV  341



>ref|XP_006452414.1| hypothetical protein CICLE_v10010150mg [Citrus clementina]
 gb|ESR65654.1| hypothetical protein CICLE_v10010150mg [Citrus clementina]
Length=454

 Score =   209 bits (533),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/265 (44%), Positives = 164/265 (62%), Gaps = 11/265 (4%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             +EW +G  +G GS  +V+LA   ++G    VKS E    + FL+ E   L  + SP+VV 
Sbjct  1     MEWTRGPIIGRGSTATVYLANLASSGKFIAVKSTELSQSM-FLQREQCFLSKISSPYVVD  59

Query  554   CIGKEMCGGKK---LNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHEN  724
              +G  +         NL++EYM  G+L D  ++ GG+LDE +I+LY  +IL GL +LH N
Sbjct  60    YLGFNVTNENNTPTYNLYMEYMPRGTLYDEIRRHGGRLDEQMIKLYAWQILQGLNHLHMN  119

Query  725   GIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVA--GSPLWMAPETL-RN  895
             GI H D+K  NVL+   G  K+AD GC+K V +  +   LA  A  G+P++MAPE   R 
Sbjct  120   GIAHCDIKSNNVLIGDDG-AKIADLGCAKYVGEIDSNAALATSAFSGTPVFMAPEVARRE  178

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             + GL  A+DIW++GCTI+EMATG  PW  ++++PVSA+ RI  S + P  P   S E  D
Sbjct  179   EQGL--AADIWAVGCTIVEMATGTNPWP-ELNDPVSALYRIGFSGETPEIPRWLSMEAKD  235

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FL KCL +DP++R  A+ELL HPF+
Sbjct  236   FLCKCLTKDPKERLTAKELLEHPFI  260



>dbj|BAJ92652.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   208 bits (530),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/261 (42%), Positives = 160/261 (61%), Gaps = 13/261 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
              EW +G  +G GS  +V +A+++ T G+  VKS  +D   + L  E  IL  L SP+VV+
Sbjct  4     AEWTRGPAIGRGSSATVSIAVDRRTDGVLAVKSVGADRAAE-LRRERAILRGLSSPYVVR  62

Query  554   CIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHENGIV  733
             C+  E   G  L++ +EY  GGSLAD  ++ GG+  E ++R   R+IL GL ++H  G+ 
Sbjct  63    CLDAEA--GTGLDMLMEYAPGGSLADEIRRCGGRCAEGLVRSRVRDILRGLAHVHAAGVA  120

Query  734   HSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRN--QGGL  907
             H D+K RNVL+ + G   +ADFGC+ R+      +P     G+P++MAPE  R   QG  
Sbjct  121   HCDVKARNVLIGADGRALIADFGCA-RIAAGEGRLP---TGGTPMFMAPEAARGEEQG--  174

Query  908   DCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLDFLEK  1087
               A+DIW++GCT+IEMATG  PW  + ++PV+ +  +A S + P  P   S  G DFL +
Sbjct  175   -PAADIWAVGCTVIEMATGAGPWQ-RFASPVATLHHVAFSGEAPELPPCLSDLGRDFLAR  232

Query  1088  CLERDPRKRWKAEELLHHPFV  1150
             CL++DP +RW AE+LL H FV
Sbjct  233   CLQQDPSERWTAEQLLEHEFV  253



>ref|XP_004231271.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum lycopersicum]
Length=668

 Score =   214 bits (544),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 167/270 (62%), Gaps = 14/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +G G+FG V++ MN  +G L  VK            ++ S ++ LE E ++
Sbjct  68    PIRWRKGEMIGCGAFGQVYMGMNLDSGELLAVKQVMIAANSASKEKAQSHVKELEEEVKL  127

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  PH+V+ +G  +     LN+ +E++ GGS++ +  +FG    E VIR YT+++LL
Sbjct  128   LKNLSHPHIVRYLGI-VREEDTLNILLEFVPGGSISSLLGKFGS-FPEPVIRSYTKQLLL  185

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  186   GLDYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVELATISGAKSMKGTPYWMAP  245

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +R Q G   ++DIWS+GCT+IEM TG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  246   EVIR-QTGHSFSADIWSVGCTVIEMTTGKPPWSQQYQE-VAALFYIGTTKAHPPIPEHVS  303

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              E  DFL KCL+++P  R  A ELL HPFV
Sbjct  304   VEAKDFLLKCLQKEPELRPSASELLQHPFV  333



>dbj|BAA21855.1| NPK1-related protein kinase 1S [Arabidopsis thaliana]
Length=376

 Score =   207 bits (527),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 164/270 (61%), Gaps = 14/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +G G+FG+V++ MN  +G L  VK            ++ + +Q LE E ++
Sbjct  66    PISWRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLIAANFASKEKTQAHIQELEEEVKL  125

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G  +     LN+ +E++ GGS++ + ++FG    E V+R YTR++LL
Sbjct  126   LKNLSHPNIVRYLGT-VREDDTLNILLEFVPGGSISSLLEKFG-PFPESVVRTYTRQLLL  183

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH + I+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  184   GLEYLHNHAIMHRDIKGANILVDNKGCIKLADFGASKQVAELATMTGAKSMKGTPYWMAP  243

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCT+IEM TG  PW+ +    V+A+  I  ++  P  P   S
Sbjct  244   EVIL-QTGHSFSADIWSVGCTVIEMVTGKAPWSQQYKE-VAAIFFIGTTKSHPPIPDTLS  301

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              +  DFL KCL+  P  R  A ELL HPFV
Sbjct  302   SDAKDFLLKCLQEVPNLRPTASELLKHPFV  331



>ref|XP_007146783.1| hypothetical protein PHAVU_006G069600g [Phaseolus vulgaris]
 gb|ESW18777.1| hypothetical protein PHAVU_006G069600g [Phaseolus vulgaris]
Length=444

 Score =   209 bits (531),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/269 (44%), Positives = 169/269 (63%), Gaps = 26/269 (10%)
 Frame = +2

Query  380   WVKGKTVGSGSFGSVHLAMNK--ATGGLFVVKSAESDSGL----QFLESEAEILESLDSP  541
             WV+GK +G G+FG++ +A+ K  A   +F VKS +  +GL    + LE+E  IL+ + SP
Sbjct  5     WVRGKCIGKGAFGTISVALRKLEAQTQIFAVKSVDIKTGLPGQLEALENEIRILQRMSSP  64

Query  542   HVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
             HVV  +G++    ++ NL +EYM GG+LAD+       ++E ++R YT  ++  LK++H 
Sbjct  65    HVVTFLGEDTTSERR-NLHMEYMPGGTLADLD----ADVEEYLVRQYTWCLVSALKHVHA  119

Query  722   NGIVHSDLKCRNVLL---SSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR  892
             NG+VH D+K +NVL+   +S    KLADFG +  ++     +P A   GSPLWMAPE +R
Sbjct  120   NGVVHCDVKGKNVLIGDGASGCSCKLADFGSA--MEFDGEGLPAASPRGSPLWMAPEVIR  177

Query  893   NQGGLDC---ASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQ  1063
              +    C   ASD+WSLGCT+IEM TG  PW G   N V A+ RI  S + P FP   S+
Sbjct  178   RE----CQGPASDVWSLGCTVIEMLTGKPPWEG---NAVDALSRIGFSGEVPGFPRRLSE  230

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              G DFLEKCL  +PR+RW  ++LL HPF+
Sbjct  231   LGRDFLEKCLRWEPRRRWSCDQLLEHPFL  259



>ref|XP_003520809.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Glycine max]
 gb|KHN03992.1| Mitogen-activated protein kinase kinase kinase ANP1 [Glycine 
soja]
Length=662

 Score =   214 bits (544),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 166/270 (61%), Gaps = 13/270 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +G G+FG V++ MN  +G L  VK            ++ + ++ LE E ++
Sbjct  66    PIRWRKGELIGCGAFGQVYVGMNLDSGELLAVKQVLIAASNATKEKAQAHIKELEEEVKL  125

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L+ L  P++V+ +G  +     LN+ +E++ GGS++ +  +FG    E VIR YT+++LL
Sbjct  126   LKDLSHPNIVRYLGT-VREEDTLNILLEFVPGGSISSLLGKFGA-FPEAVIRTYTKQLLL  183

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH+NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WMAP
Sbjct  184   GLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKQVVELATISGAKSMKGTPYWMAP  243

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+GCT+IEMATG  PW+ +    V+A+  I  ++  P  P H S
Sbjct  244   EVIL-QTGHSFSADIWSVGCTVIEMATGKPPWSQQYQQEVAALFHIGTTKSHPPIPDHLS  302

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
                 DFL KCL+++P  R  A ELL HPFV
Sbjct  303   AAAKDFLLKCLQKEPILRSSASELLQHPFV  332



>gb|EEC67854.1| hypothetical protein OsI_35471 [Oryza sativa Indica Group]
Length=653

 Score =   213 bits (543),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 165/276 (60%), Gaps = 16/276 (6%)
 Frame = +2

Query  350   SKCSCSRPV--EWVKGKTVGSGSFGSVHLAMNKATGGLFVVK-----SAESDSG--LQFL  502
             S CS SR V  +W KGK +GSG+FG V+   N   G +  +K     S +S+S   L+ L
Sbjct  235   SPCSSSRVVSSQWKKGKLLGSGTFGQVYQGFNSEGGQMCAIKEVKVISDDSNSKECLRQL  294

Query  503   ESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLY  682
               E  +L  L  P++V+  G ++   + L++++EY++GGS+  + Q++G    E V+R Y
Sbjct  295   HQEIVLLSQLSHPNIVQYYGSDLSS-ETLSVYLEYVSGGSIHKLLQEYGA-FGEAVLRNY  352

Query  683   TREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGS  862
             T +IL GL YLH    VH D+K  N+L+  +GD+KLADFG +K +  H +   +    GS
Sbjct  353   TAQILSGLAYLHGRNTVHRDIKGANILVDPNGDIKLADFGMAKHISAHTS---IKSFKGS  409

Query  863   PLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPN  1042
             P WMAPE + N  G   + DIWSLGCTIIEMAT   PW       V+A+ +I  S+D P+
Sbjct  410   PYWMAPEVIMNTNGYSLSVDIWSLGCTIIEMATARPPWIQYEG--VAAIFKIGNSKDIPD  467

Query  1043  FPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              P H S E  +FL+ CL+RDP  R  A +L+ HPFV
Sbjct  468   IPDHLSFEAKNFLKLCLQRDPAARPTAAQLMEHPFV  503



>gb|AAF34436.1|AF172282_25 similar to mitogen-activated protein kinases [Oryza sativa]
 gb|ABA92000.1| mitogen-activated kinase kinase kinase alpha, putative, expressed 
[Oryza sativa Japonica Group]
Length=653

 Score =   213 bits (543),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 165/276 (60%), Gaps = 16/276 (6%)
 Frame = +2

Query  350   SKCSCSRPV--EWVKGKTVGSGSFGSVHLAMNKATGGLFVVK-----SAESDSG--LQFL  502
             S CS SR V  +W KGK +GSG+FG V+   N   G +  +K     S +S+S   L+ L
Sbjct  235   SPCSSSRVVSSQWKKGKLLGSGTFGQVYQGFNSEGGQMCAIKEVKVISDDSNSKECLRQL  294

Query  503   ESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLY  682
               E  +L  L  P++V+  G ++   + L++++EY++GGS+  + Q++G    E V+R Y
Sbjct  295   HQEIVLLSQLSHPNIVQYYGSDLSS-ETLSVYLEYVSGGSIHKLLQEYGA-FGEAVLRNY  352

Query  683   TREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGS  862
             T +IL GL YLH    VH D+K  N+L+  +GD+KLADFG +K +  H +   +    GS
Sbjct  353   TAQILSGLAYLHGRNTVHRDIKGANILVDPNGDIKLADFGMAKHISAHTS---IKSFKGS  409

Query  863   PLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPN  1042
             P WMAPE + N  G   + DIWSLGCTIIEMAT   PW       V+A+ +I  S+D P+
Sbjct  410   PYWMAPEVIMNTNGYSLSVDIWSLGCTIIEMATARPPWIQYEG--VAAIFKIGNSKDIPD  467

Query  1043  FPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              P H S E  +FL+ CL+RDP  R  A +L+ HPFV
Sbjct  468   IPDHLSFEAKNFLKLCLQRDPAARPTAAQLMEHPFV  503



>ref|XP_007143215.1| hypothetical protein PHAVU_007G053700g [Phaseolus vulgaris]
 gb|ESW15209.1| hypothetical protein PHAVU_007G053700g [Phaseolus vulgaris]
Length=624

 Score =   213 bits (542),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 164/271 (61%), Gaps = 13/271 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSA----------ESDSGLQFLESEAEI  520
             P+ W KG+ +GSG+FG V++ MN  +G L  +K             + + ++ LE E ++
Sbjct  47    PIRWRKGELIGSGAFGHVYMGMNLDSGELIAIKQVLIAPGSAYKENTQANIRELEEEVKL  106

Query  521   LESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILL  700
             L++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++LL
Sbjct  107   LKNLKHPNIVRYLGTAR-EENSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLL  164

Query  701   GLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAP  880
             GL+YLH NGI+H D+K  N+L+ + G +KLADFG SK+V +         + G+P WM+P
Sbjct  165   GLEYLHNNGIIHRDIKGANILVDNKGCIKLADFGASKKVVELATINGAKSMKGTPHWMSP  224

Query  881   ETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFS  1060
             E +  Q G   ++DIWS+ CT+IEMATG  PW+ +    VSA+  I  ++  P  P H S
Sbjct  225   EVIL-QTGHTISTDIWSVACTVIEMATGKPPWSQQYPQEVSALFYIGTTKSHPPIPEHLS  283

Query  1061  QEGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
              E  DFL KC  ++P  R  A ELL HPF+ 
Sbjct  284   PEANDFLLKCFHKEPDLRPSASELLQHPFIT  314



>ref|XP_011090760.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Sesamum indicum]
 ref|XP_011090761.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Sesamum indicum]
Length=724

 Score =   214 bits (546),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/269 (41%), Positives = 166/269 (62%), Gaps = 13/269 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVK---------SAESDSGLQFLESEAEIL  523
             P+ W KG+ +G G+FG VH+ MN  +G L  VK         S ++   ++ LE E  +L
Sbjct  115   PIRWRKGELIGCGAFGRVHMGMNLNSGELLAVKEVAIAGNSASKKTQEYIRELEKEVNLL  174

Query  524   ESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLG  703
             ++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++LLG
Sbjct  175   KNLSHPNIVRYLGTAR-EDDSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLLG  232

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPE  883
             L+YLH+N I+H D+K  N+L+ + G +KLADFG SK+V+          + G+P WMAPE
Sbjct  233   LEYLHKNKIMHRDIKGANILVDNKGCIKLADFGASKKVEALATITGAKSMKGTPYWMAPE  292

Query  884   TLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQ  1063
              +  Q G   ++DIWS+GCT+IEMATG  PW+ +    V+A+  +  ++  P  P H S 
Sbjct  293   VIV-QSGHSYSADIWSVGCTVIEMATGKAPWSQQYQE-VAALFYVGTTKSHPPIPDHLSV  350

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             E  DFL KCL+++P  R  A ELL HPFV
Sbjct  351   EAKDFLLKCLQKEPDLRPTASELLKHPFV  379



>ref|XP_003538696.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X1 [Glycine max]
 ref|XP_006590514.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X2 [Glycine max]
 ref|XP_006590515.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X3 [Glycine max]
 ref|XP_006590516.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
isoform X4 [Glycine max]
Length=844

 Score =   215 bits (548),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 159/265 (60%), Gaps = 14/265 (5%)
 Frame = +2

Query  377   EWVKGKTVGSGSFGSVHLAMNKATGGLFVVK-------SAESDSGLQFLESEAEILESLD  535
              W KG+ +G G+FG V+L  N  +G +  +K        A+S    Q L  E  +L  L 
Sbjct  382   RWKKGQLLGRGTFGHVYLGFNSESGEMCAMKEVTLFSDDAKSRESAQQLGQEIALLSHLR  441

Query  536   SPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
              P++V+  G E     KL +++EY++GGS+  + QQ+G +L E+VIR YTR+ILLGL YL
Sbjct  442   HPNIVQYYGSETVD-DKLYIYLEYVSGGSIYKLLQQYG-QLSEIVIRNYTRQILLGLAYL  499

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRN  895
             H    VH D+K  N+L+  +G VKLADFG +K +     P+      GSP WMAPE ++N
Sbjct  500   HAKNTVHRDIKAANILVDPNGRVKLADFGMAKHISGQSCPL---SFKGSPYWMAPEVIKN  556

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
               G + A DIWSLG T+ EMAT   PW+      V+A+ +I  S+D P  P H S++G D
Sbjct  557   SNGCNLAVDIWSLGSTVFEMATTKPPWSQYEG--VAAMFKIGNSKDLPAMPDHLSEDGKD  614

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             F+ +CL+R+P  R  A +LL HPFV
Sbjct  615   FIRQCLQRNPVHRPSAAQLLLHPFV  639



>gb|KEH36902.1| MAP kinase kinase kinase [Medicago truncatula]
Length=335

 Score =   206 bits (523),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 165/265 (62%), Gaps = 19/265 (7%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGG-LFVVKSAESDSGLQFLESEAEILESLDSPHVV  550
             ++W +G+ +G GS  +V++A    +GG +F VKS E     + L+ E +IL  L  P +V
Sbjct  3     MDWSRGRIIGRGSTATVYVADRCHSGGEVFAVKSTELHRS-ELLKKEQQILTKLKCPQIV  61

Query  551   KCIGKEMC---GGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYLHE  721
                G E+    G +  NLF+EY   G+L+D  +  G  ++E ++  Y R+ILLGL YLH 
Sbjct  62    SYQGCEVTFENGVQLFNLFMEYAPKGTLSDAVRN-GNGMEEAMVGFYARQILLGLNYLHL  120

Query  722   NGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLR--N  895
             NGIVH DLK +NVL++  G  K++DFGC++RV++         ++G+P +MAPE  R   
Sbjct  121   NGIVHCDLKGQNVLVTEQG-AKISDFGCARRVEEE------LVISGTPAFMAPEVARGEE  173

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             QG    ASD+W+LGCT++EM TG +PW G  S+P + + RI  S D P  P + S++G D
Sbjct  174   QG---FASDVWALGCTLLEMITGKMPWQG-FSDPAAVLYRIGFSGDVPEIPDYVSEQGKD  229

Query  1076  FLEKCLERDPRKRWKAEELLHHPFV  1150
             FL KCL+RDP +RW   ELL H FV
Sbjct  230   FLRKCLKRDPNERWSVVELLGHEFV  254



>ref|XP_011100411.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1 
[Sesamum indicum]
Length=368

 Score =   206 bits (525),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 159/266 (60%), Gaps = 23/266 (9%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVKSAESDSGLQFLESEAEILESLDSPHVVK  553
             ++W +G T+G G+  +V  A+ +  G  F VKSAE  S  + L SE  IL SL+SPH+  
Sbjct  1     MDWTRGHTIGQGASATVSTAVCRRNGDTFAVKSAEL-SQSKSLRSEQRILSSLNSPHI--  57

Query  554   CIGKEMCG-----GKKL-NLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLGLKYL  715
              IG + CG     GK L NL IEY   G+L D  ++ GG+LDE  I  YT  +L GL+YL
Sbjct  58    -IGYKGCGVSVENGKALFNLMIEYAPDGTLVDEIRRQGGRLDESTIGYYTSRVLKGLEYL  116

Query  716   HENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPETLRN  895
             H  GIVH D+K  N+LLS   DVK+ADFGC+K   +       A + G+P++MAPE  R 
Sbjct  117   HSRGIVHCDVKGSNILLSQE-DVKIADFGCAKAADE-------ASIGGTPMFMAPEVARG  168

Query  896   QGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQEGLD  1075
             +      +DIW+LGCTIIEM+TG  PW     N  S + RIA S + P  P+  S    D
Sbjct  169   EEQ-SFPADIWALGCTIIEMSTGKSPWP----NEPSTLHRIAFSGETPRIPTFLSDIARD  223

Query  1076  FLEKCLERDPRKRWKAEELLHHPFVN  1153
             FL KCL  DPR+RW A++LL H F+ 
Sbjct  224   FLSKCLRVDPRERWTAKQLLGHRFLQ  249



>gb|ABK06428.1| HA-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=304

 Score =   204 bits (520),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 165/270 (61%), Gaps = 14/270 (5%)
 Frame = +2

Query  374   VEWVKGKTVGSGSFGSVHLAMNKATGGLFVVK---------SAESDSG-LQFLESEAEIL  523
             + W KG+ +G G+FG V++ MN  +G L  +K         S E   G ++ LE E ++L
Sbjct  12    IRWRKGELIGCGAFGRVYMGMNLDSGELLAIKQVLIAPSSASKEKTQGHIRELEEEVQLL  71

Query  524   ESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLG  703
             ++L  P++V+ +G  +     LN+ +E++ GGS++ + ++FG    E VI +YT+++LLG
Sbjct  72    KNLSHPNIVRYLGT-VRESDSLNILMEFVPGGSISSLLEKFGS-FPEPVIIMYTKQLLLG  129

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPE  883
             L+YLH NGI+H D+K  N+L+ + G ++LADFG SK+V +         + G+P WMAPE
Sbjct  130   LEYLHNNGIMHRDIKGANILVDNKGCIRLADFGASKKVVELATVNGAKSMKGTPYWMAPE  189

Query  884   TLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQ  1063
              +  Q G   ++DIWS+GCT+IEMATG  PW+ +     +AVL I  ++  P  P   S 
Sbjct  190   VIL-QTGHSFSADIWSVGCTVIEMATGKPPWSEQYQQ-FAAVLHIGRTKAHPPIPEDLSP  247

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFVN  1153
             E  DFL KCL ++P  R  A ELL HPFV 
Sbjct  248   EAKDFLMKCLHKEPSLRLSATELLQHPFVT  277



>gb|EYU45626.1| hypothetical protein MIMGU_mgv1a017805mg [Erythranthe guttata]
Length=736

 Score =   214 bits (546),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/269 (41%), Positives = 166/269 (62%), Gaps = 13/269 (5%)
 Frame = +2

Query  371   PVEWVKGKTVGSGSFGSVHLAMNKATGGLFVVK---------SAESDSGLQFLESEAEIL  523
             P+ W KG+ +G G+FG V++ MN  +G L  VK         S ++   ++ LE E  +L
Sbjct  112   PIRWRKGEMIGCGAFGRVYMGMNLDSGELLAVKQVAIATNNGSKKTQEYIRELEKEVNLL  171

Query  524   ESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLYTREILLG  703
             ++L  P++V+ +G        LN+ +E++ GGS++ +  +FG    E VIR+YT+++LLG
Sbjct  172   KNLSHPNIVRYLGTAR-EQDSLNILLEFVPGGSISSLLGKFGS-FPESVIRMYTKQLLLG  229

Query  704   LKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGSPLWMAPE  883
             L+YLHEN I+H D+K  N+L+ +   +KLADFG SK+V+          + G+P WMAPE
Sbjct  230   LEYLHENKIMHRDIKGANILVDNKACIKLADFGASKKVEALAAATGAKSMKGTPYWMAPE  289

Query  884   TLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPNFPSHFSQ  1063
              +  Q G   ++DIWS+GCTIIEMATG  PW+ +    V+A+  +  ++  P  P H S+
Sbjct  290   VIV-QTGHSYSADIWSVGCTIIEMATGKAPWSQQYQE-VAALFYVGTTKSHPPIPEHLSR  347

Query  1064  EGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
             E  DFL KCL+++P  R  A ELL HPFV
Sbjct  348   EANDFLLKCLQKEPDLRSTASELLKHPFV  376



>gb|EEE51829.1| hypothetical protein OsJ_33308 [Oryza sativa Japonica Group]
Length=667

 Score =   213 bits (543),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 165/276 (60%), Gaps = 16/276 (6%)
 Frame = +2

Query  350   SKCSCSRPV--EWVKGKTVGSGSFGSVHLAMNKATGGLFVVK-----SAESDSG--LQFL  502
             S CS SR V  +W KGK +GSG+FG V+   N   G +  +K     S +S+S   L+ L
Sbjct  249   SPCSSSRVVSSQWKKGKLLGSGTFGQVYQGFNSEGGQMCAIKEVKVISDDSNSKECLRQL  308

Query  503   ESEAEILESLDSPHVVKCIGKEMCGGKKLNLFIEYMAGGSLADVTQQFGGKLDEMVIRLY  682
               E  +L  L  P++V+  G ++   + L++++EY++GGS+  + Q++G    E V+R Y
Sbjct  309   HQEIVLLSQLSHPNIVQYYGSDLSS-ETLSVYLEYVSGGSIHKLLQEYGA-FGEAVLRNY  366

Query  683   TREILLGLKYLHENGIVHSDLKCRNVLLSSSGDVKLADFGCSKRVKKHPNPIPLAGVAGS  862
             T +IL GL YLH    VH D+K  N+L+  +GD+KLADFG +K +  H +   +    GS
Sbjct  367   TAQILSGLAYLHGRNTVHRDIKGANILVDPNGDIKLADFGMAKHISAHTS---IKSFKGS  423

Query  863   PLWMAPETLRNQGGLDCASDIWSLGCTIIEMATGNLPWAGKISNPVSAVLRIACSEDRPN  1042
             P WMAPE + N  G   + DIWSLGCTIIEMAT   PW       V+A+ +I  S+D P+
Sbjct  424   PYWMAPEVIMNTNGYSLSVDIWSLGCTIIEMATARPPWIQY--EGVAAIFKIGNSKDIPD  481

Query  1043  FPSHFSQEGLDFLEKCLERDPRKRWKAEELLHHPFV  1150
              P H S E  +FL+ CL+RDP  R  A +L+ HPFV
Sbjct  482   IPDHLSFEAKNFLKLCLQRDPAARPTAAQLMEHPFV  517



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5097750019822