BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82360_g1_i1 len=659 path=[1:0-658]

Length=659
                                                                      Score     E

ref|XP_009757307.1|  PREDICTED: non-specific lipid-transfer prote...  94.4    4e-30   
ref|XP_004245220.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    4e-28   
ref|XP_009596391.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    2e-26   
gb|ABY21307.1|  pollen allergen Pla o 3                               65.5    6e-20   Platanus orientalis
emb|CAL07989.1|  lipid transfer protein                               65.5    2e-19   Platanus x hispanica [London plane tree]
emb|CDP12680.1|  unnamed protein product                              61.2    3e-19   
gb|AEI70830.1|  non-specific lipid-transfer protein                   64.7    4e-19   
emb|CBW38498.1|  lipid transfer protein                               63.9    9e-19   
gb|AFR43276.1|  lipid transfer protein precursor                      67.0    1e-18   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  62.8    1e-18   Helianthus annuus
gb|AEI70826.1|  non-specific lipid-transfer protein                   63.9    2e-18   
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    2e-18   
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    3e-18   
gb|KDO64078.1|  hypothetical protein CISIN_1g033544mg                 65.1    3e-18   
gb|AGH13363.1|  lipid transfer protein                                65.1    3e-18   
gb|AEI70829.1|  non-specific lipid-transfer protein                   64.7    3e-18   
emb|CBW38501.1|  lipid transfer protein                               64.7    4e-18   
gb|AAX84944.1|  non-specific lipid transfer protein-like antimicr...  66.6    4e-18   Leonurus japonicus [Chinese motherwort]
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    5e-18   
gb|AAY43800.1|  FSLTP2                                                64.7    5e-18   Gossypium hirsutum [American cotton]
ref|XP_007033545.1|  Non-specific lipid-transfer protein isoform 1    69.3    7e-18   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       63.9    9e-18   
gb|AEI70827.1|  non-specific lipid-transfer protein                   64.3    1e-17   
emb|CBW38499.1|  lipid transfer protein                               64.7    1e-17   
ref|XP_004240614.2|  PREDICTED: non-specific lipid-transfer prote...  60.5    2e-17   
gb|ACQ42221.1|  lipid transfer protein                                69.7    2e-17   Chimonanthus praecox [wintersweet]
emb|CBW38502.1|  lipid transfer protein                               64.7    2e-17   
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-17   
ref|XP_007033546.1|  Non-specific lipid-transfer protein 6, putat...  67.4    2e-17   
gb|AFK46170.1|  unknown                                               58.9    2e-17   
emb|CBW38497.1|  lipid transfer protein                               64.7    2e-17   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  59.3    3e-17   Lens culinaris
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            66.2    3e-17   Gossypium hirsutum [American cotton]
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    3e-17   
ref|XP_008370253.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    3e-17   
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-17   
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    5e-17   
ref|XP_002305878.2|  lipid transfer family protein                    61.2    6e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011091601.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    7e-17   
ref|XP_010043178.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    7e-17   
emb|CBW38503.1|  lipid transfer protein                               65.1    7e-17   
emb|CBW38504.1|  lipid transfer protein                               65.1    8e-17   
sp|A0AT28.1|NLTP1_LENCU  RecName: Full=Non-specific lipid-transfe...  59.3    1e-16   Lens culinaris
gb|ABK94706.1|  unknown                                               60.8    1e-16   Populus trichocarpa [western balsam poplar]
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...  60.5    1e-16   Lens culinaris
gb|KEH29195.1|  Lipid transfer protein                                60.5    1e-16   
gb|ABK96515.1|  unknown                                               61.2    1e-16   Populus trichocarpa x Populus deltoides
ref|XP_011091599.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    1e-16   
ref|XP_003605266.1|  Non-specific lipid-transfer protein              58.5    2e-16   
ref|XP_003605309.1|  Non-specific lipid-transfer protein              60.8    2e-16   
gb|AFK44274.1|  unknown                                               58.9    2e-16   
sp|Q43129.1|NLTP2_GOSHI  RecName: Full=Non-specific lipid-transfe...  63.9    2e-16   Gossypium hirsutum [American cotton]
gb|AAL25839.1|  lipid transfer precursor protein                      61.6    2e-16   Hevea brasiliensis [Para rubber tree]
gb|AGH13362.1|  lipid transfer protein                                56.6    2e-16   
gb|ADK60918.1|  lipid transfer protein                                58.5    2e-16   
ref|XP_009346911.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    3e-16   
ref|XP_008244918.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    3e-16   
gb|ADV02773.1|  lipid transfer protein 1b                             67.8    3e-16   
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    3e-16   
gb|ABP01769.1|  lipid transfer protein 2                              64.7    4e-16   Salvia miltiorrhiza [Chinese salvia]
ref|XP_008442324.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    4e-16   
gb|AES87466.2|  Lipid transfer protein                                57.4    5e-16   
ref|XP_006842466.1|  hypothetical protein AMTR_s00077p00068900        60.8    5e-16   
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    6e-16   
gb|ACL01093.1|  lipid transfer protein                                58.9    6e-16   Castanea mollissima
gb|ACN11576.1|  lipid transfer protein 3 precursor                    57.8    7e-16   Prunus dulcis [sweet almond]
gb|EYU41040.1|  hypothetical protein MIMGU_mgv1a016547mg              61.2    7e-16   
ref|XP_007206148.1|  hypothetical protein PRUPE_ppa013428mg           57.8    7e-16   
ref|NP_001235162.1|  uncharacterized protein LOC100499726 precursor   58.2    8e-16   
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    9e-16   
gb|ABF06565.1|  non-specific lipid transfer-like protein              58.2    1e-15   Prosopis juliflora [algorrobo]
ref|XP_011091596.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    1e-15   
gb|AFR31532.1|  lipid transfer protein                                56.6    1e-15   
gb|AFK38461.1|  unknown                                               60.5    1e-15   
gb|AEC04836.1|  lipid transfer protein                                56.2    1e-15   
gb|AFR43285.1|  lipid transfer protein precursor                      57.8    1e-15   
ref|XP_011091597.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    1e-15   
emb|CCK33472.1|  lipid transfer protein precursor                     68.9    1e-15   
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    2e-15   
gb|KHL91133.1|  hypothetical protein QW71_36410                       63.5    2e-15   
dbj|BAC77694.1|  lipid transfer protein                               58.5    2e-15   Atriplex nummularia
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  57.4    2e-15   Lens culinaris
gb|ACM78614.1|  lipid transfer protein 2                              55.8    2e-15   Tamarix hispida
ref|XP_008244911.1|  PREDICTED: non-specific lipid-transfer prote...  54.7    2e-15   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    2e-15   
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  58.9    3e-15   Lens culinaris
ref|XP_011095131.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    3e-15   
emb|CCJ09772.1|  putative non-specific lipid transfer protein         68.2    3e-15   
gb|AAQ74627.1|  lipid transfer protein I                              54.7    3e-15   Vigna radiata [mung bean]
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...  55.8    3e-15   Lens culinaris
gb|AAM22767.2|  lipid transfer protein 2 precursor                    55.8    3e-15   Prunus persica
ref|XP_010922736.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    4e-15   
gb|ABA33849.1|  phospholipid transfer protein 1                       60.8    4e-15   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_007134705.1|  hypothetical protein PHAVU_010G069500g           55.5    4e-15   
ref|XP_006429571.1|  hypothetical protein CICLE_v10013114mg           59.7    4e-15   
gb|ABA33846.1|  phospholipid transfer protein 1                       60.8    4e-15   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CBI18043.3|  unnamed protein product                              63.5    4e-15   
gb|ABA33858.1|  phospholipid transfer protein 1                       60.5    5e-15   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002276372.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    5e-15   Vitis vinifera
gb|ABA33866.1|  phospholipid transfer protein 1                       60.5    5e-15   Zea diploperennis [chapule]
gb|AFR43294.1|  lipid transfer protein precursor                      57.0    5e-15   
gb|ABA33847.1|  phospholipid transfer protein 1                       60.8    5e-15   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105311.1|  non-specific lipid-transfer protein precursor    60.8    5e-15   Zea mays [maize]
gb|ABA33857.1|  phospholipid transfer protein 1                       60.8    6e-15   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33848.1|  phospholipid transfer protein 1                       60.5    6e-15   Zea mays subsp. parviglumis [Balsas teosinte]
gb|EYU42011.1|  hypothetical protein MIMGU_mgv1a016819mg              62.4    6e-15   
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    6e-15   
gb|ABA33850.1|  phospholipid transfer protein 1                       60.8    6e-15   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33862.1|  phospholipid transfer protein 1                       60.5    6e-15   Zea diploperennis [chapule]
ref|XP_002323667.1|  putative lipid transfer family protein           53.9    6e-15   Populus trichocarpa [western balsam poplar]
gb|ABA33853.1|  phospholipid transfer protein 1                       60.8    7e-15   Zea mays subsp. parviglumis [Balsas teosinte]
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  62.8    7e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AFI61838.1|  harmalin                                              55.1    7e-15   
ref|XP_002270970.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    7e-15   Vitis vinifera
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  56.2    7e-15   
gb|AFK37572.1|  unknown                                               57.8    8e-15   
gb|ABY54820.1|  lipid transfer protein                                57.8    8e-15   
ref|XP_003605293.1|  Non-specific lipid-transfer protein              57.8    8e-15   
gb|ABA33860.1|  phospholipid transfer protein 1                       60.5    8e-15   Zea diploperennis [chapule]
gb|AFK36168.1|  unknown                                               58.2    8e-15   
gb|AAA74624.1|  lipid transfer protein precursor                      62.8    9e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001176316.1|  Os11g0115466                                     62.8    1e-14   
gb|ABA33867.1|  phospholipid transfer protein 1                       59.3    1e-14   Zea diploperennis [chapule]
gb|ACU24604.1|  unknown                                               54.7    1e-14   Glycine max [soybeans]
ref|XP_004506487.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    1e-14   
ref|NP_001275802.1|  lipid-transfer protein precursor                 56.6    1e-14   
ref|XP_002442776.1|  hypothetical protein SORBIDRAFT_08g002690        58.5    1e-14   Sorghum bicolor [broomcorn]
ref|NP_001065986.1|  Os12g0115000                                     62.8    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KHN40624.1|  Non-specific lipid-transfer protein 3                 58.2    1e-14   
ref|XP_009770883.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    1e-14   
gb|AHB19226.1|  non specific lipid transfer protein 1B                60.8    1e-14   
gb|AGH32496.1|  non-specific lipid transfer protein                   60.1    1e-14   
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    1e-14   
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    1e-14   
ref|XP_006842467.1|  hypothetical protein AMTR_s00077p00070120        53.9    1e-14   
ref|XP_007134701.1|  hypothetical protein PHAVU_010G069100g           56.6    2e-14   
gb|AFR43291.1|  lipid transfer protein precursor                      54.3    2e-14   
gb|ABQ53932.1|  lipid transfer protein                                59.7    2e-14   Sesamum indicum [beniseed]
emb|CDP14198.1|  unnamed protein product                              55.1    2e-14   
gb|KHG09723.1|  Non-specific lipid-transfer                           53.9    2e-14   
ref|XP_009135090.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    2e-14   
gb|AHG99490.1|  lipid-transfer protein                                56.2    2e-14   
emb|CAN70512.1|  hypothetical protein VITISV_005630                   62.0    2e-14   Vitis vinifera
gb|AAT80649.1|  lipid transfer protein precursor                      60.1    2e-14   Malus domestica [apple tree]
ref|XP_010035997.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    2e-14   
gb|ABA33859.1|  phospholipid transfer protein 1                       58.2    2e-14   Zea diploperennis [chapule]
gb|ABB96481.1|  non-specific lipid transfer protein precursor         60.5    3e-14   Malus domestica [apple tree]
emb|CDP15101.1|  unnamed protein product                              55.5    3e-14   
ref|WP_039311159.1|  hypothetical protein                             63.9    3e-14   
ref|XP_009372010.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    3e-14   
ref|XP_003605345.1|  Non-specific lipid-transfer protein              53.1    3e-14   
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    60.1    3e-14   
gb|AAB70539.1|  lipid transfer protein LPT II                         62.8    3e-14   Oryza sativa Indica Group [Indian rice]
gb|ABX56711.1|  LTP isoallergen 1 precursor                           56.2    3e-14   Arachis hypogaea [goober]
gb|KHG09722.1|  Non-specific lipid-transfer                           54.3    3e-14   
gb|KHN14506.1|  Non-specific lipid-transfer protein 3                 55.1    4e-14   
gb|AAR22488.1|  allergen Mal d 3                                      59.7    4e-14   Malus domestica [apple tree]
ref|XP_002442775.1|  hypothetical protein SORBIDRAFT_08g002680        57.0    5e-14   Sorghum bicolor [broomcorn]
gb|KHG10481.1|  Non-specific lipid-transfer 3                         57.8    5e-14   
ref|XP_010486423.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    5e-14   
emb|CDX73941.1|  BnaA03g31060D                                        52.8    5e-14   
gb|AAY83343.1|  non-specific lipid transfer protein precursor         57.0    5e-14   Fragaria x ananassa
ref|XP_008244970.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-14   
ref|XP_002323072.2|  hypothetical protein POPTR_0016s14290g           53.9    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_004245406.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    5e-14   
gb|AAY83345.1|  non-specific lipid transfer protein precursor         57.0    5e-14   Fragaria x ananassa
ref|XP_003522081.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    5e-14   
gb|ADR66947.1|  non-specific lipid transfer protein                   59.3    5e-14   
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    6e-14   
dbj|BAI94496.1|  lipid transfer protein                               66.2    6e-14   
ref|XP_010253093.1|  PREDICTED: non-specific lipid-transfer prote...  56.6    6e-14   
gb|ACQ42222.1|  lipid transfer protein 1                              64.7    6e-14   Chimonanthus praecox [wintersweet]
ref|XP_008798560.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    6e-14   
ref|XP_009593826.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    6e-14   
gb|KHN43734.1|  Non-specific lipid-transfer protein 3                 52.4    6e-14   
ref|XP_009396870.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    7e-14   
gb|KDO49687.1|  hypothetical protein CISIN_1g033151mg                 55.1    7e-14   
ref|XP_008798559.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    7e-14   
ref|XP_008388344.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    7e-14   
gb|AFR43295.1|  lipid transfer protein precursor                      57.0    7e-14   
sp|Q43194.1|NLTP2_SORBI  RecName: Full=Non-specific lipid-transfe...  57.0    7e-14   Sorghum bicolor [broomcorn]
gb|AAT80652.1|  lipid transfer protein precursor                      57.4    8e-14   Malus domestica [apple tree]
gb|AAT80650.1|  lipid transfer protein precursor                      57.4    9e-14   Malus domestica [apple tree]
ref|XP_010277659.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    9e-14   
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  59.7    9e-14   
gb|KDO49688.1|  hypothetical protein CISIN_1g033151mg                 54.3    9e-14   
gb|ADR66948.1|  non-specific lipid transfer protein                   58.2    1e-13   
emb|CAA80809.1|  lipid transfer protein                               63.2    1e-13   Oryza sativa Indica Group [Indian rice]
gb|AGN56421.1|  non-specific lipid transfer protein 1                 58.5    1e-13   
ref|XP_011002608.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    1e-13   
ref|XP_009396875.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    1e-13   
dbj|BAI94497.1|  lipid transfer protein                               65.5    1e-13   
gb|AGN56422.1|  non-specific lipid transfer protein 2                 58.5    1e-13   
emb|CDX71121.1|  BnaC03g12050D                                        53.5    1e-13   
gb|KCW47519.1|  hypothetical protein EUGRSUZ_K01282                   60.5    1e-13   
emb|CAB96874.1|  mal d 3                                              60.1    1e-13   Malus domestica [apple tree]
ref|XP_004242229.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    1e-13   
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   58.2    1e-13   
sp|Q43748.1|NLTP_BETVU  RecName: Full=Non-specific lipid-transfer...  60.1    2e-13   Beta vulgaris [beet]
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   52.0    2e-13   
gb|KDO49686.1|  hypothetical protein CISIN_1g033151mg                 53.5    2e-13   
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    2e-13   
ref|XP_002323069.1|  Nonspecific lipid-transfer protein 1             56.6    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   58.5    2e-13   
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  58.9    2e-13   
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   55.8    2e-13   
gb|AFK45186.1|  unknown                                               53.1    2e-13   
gb|AAT80665.1|  lipid transfer protein precursor                      55.8    2e-13   Malus domestica [apple tree]
emb|CDY00655.1|  BnaC03g36390D                                        51.6    3e-13   
gb|AHB19225.1|  non specific lipid transfer protein 1C                59.3    3e-13   
gb|AAP92127.1|  lipid transfer protein LPT1                           62.0    3e-13   Oryza sativa Japonica Group [Japonica rice]
sp|P81651.2|NLTP1_PRUAR  RecName: Full=Non-specific lipid-transfe...  58.9    3e-13   Prunus armeniaca
gb|AAA86694.1|  phospholipid transfer protein precursor               53.9    3e-13   Hordeum vulgare [barley]
gb|ACM78613.1|  lipid transfer protein 1                              60.8    3e-13   Tamarix hispida
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           52.4    3e-13   
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  62.4    3e-13   Morus nigra
ref|XP_009132002.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    3e-13   
pdb|1FK0|A  Chain A, Structural Basis Of Non-Specific Lipid Bindi...  60.5    3e-13   
ref|XP_006353709.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    3e-13   
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    3e-13   
ref|XP_004302622.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    4e-13   
ref|XP_010683516.1|  PREDICTED: non-specific lipid-transfer protein   60.1    4e-13   
gb|AAT80663.1|  lipid transfer protein precursor                      57.4    4e-13   Malus domestica [apple tree]
ref|XP_008662435.1|  PREDICTED: non-specific lipid-transfer protein   60.5    4e-13   
ref|NP_001055844.2|  Os05g0477900                                     52.0    4e-13   Oryza sativa Japonica Group [Japonica rice]
gb|ABA33856.1|  phospholipid transfer protein 1                       60.5    4e-13   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CAC86258.1|  lipid transfer protein                               55.5    5e-13   Fragaria x ananassa
gb|ABA33855.1|  phospholipid transfer protein 1                       60.5    5e-13   Zea mays subsp. parviglumis [Balsas teosinte]
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  56.2    5e-13   Pyrus communis
ref|XP_008350568.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    5e-13   
ref|XP_006662672.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    5e-13   
sp|Q43193.1|NLTP1_SORBI  RecName: Full=Non-specific lipid-transfe...  58.2    5e-13   Sorghum bicolor [broomcorn]
gb|AAK28533.1|AF329829_1  lipid transfer protein precursor            60.1    5e-13   Corylus avellana [European hazelnut]
ref|NP_568905.1|  non-specific lipid-transfer protein 3               50.8    6e-13   Arabidopsis thaliana [mouse-ear cress]
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  57.4    6e-13   Prunus domestica
ref|XP_007017081.1|  Non-specific lipid-transfer protein, putative    51.2    6e-13   
gb|AER92599.1|  putative lipid transfer protein                       57.0    6e-13   
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    6e-13   
gb|AAR90329.1|  lipid transfer protein precursor                      63.2    6e-13   Gossypium barbadense [Egyptian cotton]
ref|XP_008778766.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    6e-13   
ref|XP_004249042.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    7e-13   
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            57.0    7e-13   
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  55.8    7e-13   Hordeum vulgare [barley]
gb|ABA33854.1|  phospholipid transfer protein 1                       60.5    7e-13   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AGN56423.1|  non-specific lipid transfer protein 3                 55.8    7e-13   
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  50.8    7e-13   Arabidopsis thaliana [mouse-ear cress]
gb|ACZ06858.1|  lipid transfer protein                                50.8    8e-13   
ref|XP_006429566.1|  hypothetical protein CICLE_v10013119mg           50.8    8e-13   
gb|AET05731.1|  lipid transfer protein isoform b                      56.6    8e-13   
gb|AAY83344.1|  non-specific lipid transfer protein precursor         53.1    9e-13   Fragaria x ananassa
ref|XP_009384323.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    9e-13   
ref|XP_010922734.1|  PREDICTED: non-specific lipid-transfer prote...  55.8    9e-13   
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  56.2    9e-13   Cicer arietinum [garbanzo]
gb|AAL27855.1|  lipid transfer protein precursor                      72.4    1e-12   Davidia involucrata
gb|AET05730.1|  lipid transfer protein isoform a                      56.6    1e-12   
gb|AET05733.1|  lipid transfer protein isoform d                      61.6    1e-12   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           52.4    1e-12   
gb|KCW88358.1|  hypothetical protein EUGRSUZ_A00744                   53.5    1e-12   
ref|XP_010043291.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    1e-12   
emb|CAH69196.1|  type 1 non specific lipid transfer protein precu...  50.1    1e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           52.4    1e-12   
gb|AAF23460.1|AF208834_1  non-specific lipid transfer protein pre...  71.6    1e-12   Capsicum annuum
ref|XP_010043282.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    1e-12   
ref|NP_001067782.1|  Os11g0427800                                     58.2    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008388341.1|  PREDICTED: non-specific lipid-transfer prote...  55.5    1e-12   
ref|XP_008350569.1|  PREDICTED: non-specific lipid-transfer prote...  55.5    1e-12   
ref|XP_002864626.1|  hypothetical protein ARALYDRAFT_496059           51.2    1e-12   
gb|AAB70538.1|  lipid transfer protein                                59.7    2e-12   Oryza sativa [red rice]
gb|AAT01364.1|  unknown protein                                       50.4    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008779709.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    2e-12   
sp|O24418.1|NLTP6_GOSHI  RecName: Full=Non-specific lipid-transfe...  57.4    2e-12   Gossypium hirsutum [American cotton]
ref|XP_006362359.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    2e-12   
dbj|BAP11219.1|  hypothetical protein                                 56.2    2e-12   
ref|NP_001236948.1|  uncharacterized protein LOC100306062 precursor   59.3    2e-12   
dbj|BAP11226.1|  hypothetical protein                                 56.2    2e-12   
gb|ADR66945.1|  non-specific lipid transfer protein                   49.7    2e-12   
dbj|BAP11220.1|  hypothetical protein                                 56.2    2e-12   
dbj|BAB09777.1|  lipid transfer protein-like                          50.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49860.1|  non-specific lipid transfer protein PvLTP-24          50.1    2e-12   Phaseolus vulgaris [French bean]
emb|CAA69949.1|  lipid transfer protein                               57.0    2e-12   
gb|AGH27866.1|  lipid transfer protein precursor                      53.5    2e-12   
gb|ACB05670.1|  putative non-specific lipid transfer protein          70.9    2e-12   
ref|XP_011011316.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    2e-12   
dbj|BAP11218.1|  hypothetical protein                                 56.2    3e-12   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         55.5    3e-12   
dbj|BAP11221.1|  hypothetical protein                                 55.8    3e-12   
gb|AAX08122.1|  lipid transfer protein III                            70.9    3e-12   
gb|AAF14232.1|AF109195_1  lipid transfer protein                      51.6    3e-12   
gb|KEH29225.1|  Lipid transfer protein                                53.1    3e-12   
ref|NP_001065585.1|  Os11g0116000                                     53.5    3e-12   
gb|EAY79716.1|  hypothetical protein OsI_34868                        53.5    3e-12   
ref|XP_002442774.1|  hypothetical protein SORBIDRAFT_08g002670        62.4    3e-12   
ref|XP_003605349.1|  Non-specific lipid-transfer protein              51.6    3e-12   
ref|XP_009372014.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    3e-12   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           53.5    3e-12   
pir||JH0379  phospholipid transfer protein 6B6 - maize (fragment)     58.9    4e-12
sp|E6Y8S8.1|NLTP1_APIGR  RecName: Full=Non-specific lipid-transfe...  62.8    4e-12   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           49.7    4e-12   
ref|XP_010043259.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    4e-12   
gb|AGW21344.1|  lipid transfer protein                                53.1    5e-12   
ref|XP_003562719.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-12   
ref|XP_003623613.1|  Non-specific lipid-transfer protein              53.9    5e-12   
gb|ABG54494.1|  putative allergen Rub i 3                             56.2    5e-12   
ref|NP_001065988.1|  Os12g0115300                                     53.1    5e-12   
dbj|BAH03575.1|  nonspecific lipid transfer protein                   49.3    5e-12   
emb|CAH69207.1|  type 1 non specific lipid transfer protein precu...  51.6    6e-12   
gb|ACJ62320.1|  lipid-transfer protein                                59.3    6e-12   
gb|KDP22770.1|  hypothetical protein JCGZ_00357                       50.8    6e-12   
ref|NP_001065987.1|  Os12g0115100                                     57.0    7e-12   
ref|XP_010553199.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    7e-12   
gb|ACJ62326.1|  lipid-transfer protein                                59.3    7e-12   
gb|AET05732.1|  lipid transfer protein isoform c                      53.5    7e-12   
ref|XP_011091598.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    8e-12   
gb|ACJ62316.1|  lipid-transfer protein                                58.9    8e-12   
ref|XP_006281283.1|  hypothetical protein CARUB_v10027331mg           49.7    8e-12   
emb|CDM80997.1|  unnamed protein product                              50.4    9e-12   
ref|XP_009761744.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    9e-12   
ref|XP_004308147.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    1e-11   
ref|XP_011019013.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    1e-11   
gb|AAV40850.1|  lipid transfer protein 1 precursor                    53.5    1e-11   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            69.3    1e-11   
gb|AAT68263.1|  lipid transfer protein                                69.3    1e-11   
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  50.8    1e-11   
emb|CDP14199.1|  unnamed protein product                              50.1    1e-11   
gb|AAY83346.1|  non-specific lipid transfer protein precursor         61.6    1e-11   
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  53.5    1e-11   
ref|XP_003623596.1|  Non-specific lipid-transfer protein              54.7    1e-11   
ref|NP_187489.1|  lipid-transfer protein 6                            52.8    1e-11   
ref|XP_004229551.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    1e-11   
emb|CDM80963.1|  unnamed protein product                              50.4    1e-11   
ref|XP_006429568.1|  hypothetical protein CICLE_v10012953mg           49.3    1e-11   
gb|ABG27026.1|  phosophlipid protein                                  53.9    1e-11   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       50.4    1e-11   
ref|XP_010443684.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    1e-11   
pir||EPRZ  phospholipid transfer protein homolog - rice               57.0    1e-11
gb|ADB12472.1|  lipid transfer protein                                55.8    1e-11   
sp|Q39794.1|NLTP_GERHY  RecName: Full=Non-specific lipid-transfer...  50.4    1e-11   
emb|CDX72398.1|  BnaC07g44200D                                        49.7    1e-11   
emb|CAB96876.2|  pru p 1                                              53.5    1e-11   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               50.4    1e-11   
gb|AGV40203.1|  nonspecific lipid-transfer protein 2                  56.2    1e-11   
gb|AAT68262.1|  lipid transfer protein                                68.9    1e-11   
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    1e-11   
gb|EYU41036.1|  hypothetical protein MIMGU_mgv1a016508mg              68.9    1e-11   
gb|ACJ62323.1|  lipid-transfer protein                                59.3    1e-11   
gb|ACJ62315.1|  lipid-transfer protein                                59.3    1e-11   
sp|P85105.1|NLTP5_VITSX  RecName: Full=Non-specific lipid-transfe...  62.8    1e-11   
gb|KHN29511.1|  Non-specific lipid-transfer protein                   56.2    1e-11   
sp|P83434.1|NLTP1_VIGRR  RecName: Full=Non-specific lipid-transfe...  62.4    2e-11   
gb|KDP21875.1|  hypothetical protein JCGZ_00662                       48.5    2e-11   
gb|ABO28527.1|  lipid transfer protein                                50.4    2e-11   
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           50.8    2e-11   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  50.4    2e-11   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  50.4    2e-11   
ref|NP_001105392.1|  phospholipid transfer protein precursor          59.3    2e-11   
gb|AAT68264.1|  lipid transfer protein                                68.6    2e-11   
ref|XP_009136622.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    2e-11   
gb|ACJ62339.1|  lipid-transfer protein                                59.3    2e-11   
gb|AGH27863.1|  lipid transfer protein precursor                      53.5    2e-11   
gb|AAV49759.1|  non-specific lipid transfer protein 6                 56.2    2e-11   
gb|ABA34089.1|  phospholipid transfer protein 2                       57.8    2e-11   
gb|ACJ62342.1|  lipid-transfer protein                                59.3    2e-11   
gb|KFK36745.1|  hypothetical protein AALP_AA4G164400                  50.8    2e-11   
gb|ACJ62355.1|  lipid-transfer protein                                58.9    2e-11   
gb|ABA91221.2|  Nonspecific lipid-transfer protein 1 precursor, p...  57.4    2e-11   
ref|XP_008461223.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    2e-11   
gb|ACJ62319.1|  lipid-transfer protein                                58.9    2e-11   
gb|ACJ62318.1|  lipid-transfer protein                                58.9    2e-11   
ref|XP_010454858.1|  PREDICTED: non-specific lipid-transfer prote...  48.9    2e-11   
ref|XP_010454869.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    2e-11   
ref|XP_004977380.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    2e-11   
ref|XP_010454878.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    2e-11   
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
gb|ADR66946.1|  non-specific lipid transfer protein                   54.7    2e-11   
gb|ABB90546.1|  lipid transfer protein                                50.8    2e-11   
ref|XP_010483551.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    2e-11   
ref|XP_004249051.1|  PREDICTED: non-specific lipid-transfer prote...  68.2    2e-11   
gb|AES79831.2|  Lipid transfer protein                                52.0    2e-11   
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      68.2    3e-11   
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  53.5    3e-11   
gb|ACJ62381.1|  lipid-transfer protein                                59.7    3e-11   
ref|NP_001065583.1|  Os11g0115400                                     57.0    3e-11   
dbj|BAK04894.1|  predicted protein                                    51.2    3e-11   
gb|ACE07187.1|  Art v 3 allergen precursor                            52.0    3e-11   
ref|XP_010443685.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    3e-11   
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  50.1    3e-11   
ref|XP_003595853.1|  Non-specific lipid-transfer protein              50.1    3e-11   
gb|AES79814.2|  Lipid transfer protein                                53.9    3e-11   
gb|ACG30522.1|  nonspecific lipid-transfer protein 1 precursor        58.2    3e-11   
gb|AFK47623.1|  unknown                                               50.1    3e-11   
ref|XP_003564507.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    3e-11   
gb|ACJ62387.1|  lipid-transfer protein                                59.3    4e-11   
ref|NP_001234735.1|  non-specific lipid transfer protein precursor    67.4    4e-11   
gb|AEI70828.1|  non-specific lipid-transfer protein                   67.4    4e-11   
gb|ABA96286.1|  Nonspecific lipid-transfer protein 3 precursor, p...  52.0    4e-11   
gb|ACG29829.1|  nonspecific lipid-transfer protein 1 precursor        58.2    4e-11   
emb|CDY68127.1|  BnaC03g71570D                                        50.1    4e-11   
ref|NP_568904.1|  non-specific lipid-transfer protein 4               49.3    4e-11   
gb|ABK96812.1|  lipid transfer protein isoform 1.2                    67.0    4e-11   
gb|ABA34080.1|  phospholipid transfer protein 2                       57.8    4e-11   
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               48.5    4e-11   
ref|XP_010483549.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    4e-11   
gb|ABA34092.1|  phospholipid transfer protein 2                       57.8    4e-11   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 47.8    5e-11   
ref|XP_007140137.1|  hypothetical protein PHAVU_008G087100g           48.1    5e-11   
gb|ABS72013.1|  putative plant lipid transfer protein                 65.9    5e-11   
gb|KFK26696.1|  hypothetical protein AALP_AA8G281300                  50.1    5e-11   
gb|EMS55040.1|  Non-specific lipid-transfer protein 4.1               50.4    5e-11   
ref|XP_006346674.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    5e-11   
ref|XP_004963700.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    5e-11   
pdb|1T12|A  Chain A, Solution Structure Of A New Ltp1                 66.6    6e-11   
ref|XP_009396871.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    6e-11   
ref|XP_002308250.1|  Nonspecific lipid-transfer protein 1             47.8    6e-11   
gb|AGV40202.1|  nonspecific lipid-transfer protein 1                  55.8    6e-11   
ref|XP_006362360.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    6e-11   
gb|ACJ62361.1|  lipid-transfer protein                                59.7    7e-11   
ref|XP_007149145.1|  hypothetical protein PHAVU_005G045100g           48.1    7e-11   
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            67.0    7e-11   
gb|AHB19227.1|  non specific lipid transfer protein 1A                67.0    7e-11   
gb|ABA34083.1|  phospholipid transfer protein 2                       57.0    7e-11   
gb|ABA34096.1|  phospholipid transfer protein 2                       57.8    7e-11   
ref|XP_006296741.1|  hypothetical protein CARUB_v10014964mg           47.8    7e-11   
gb|AFD32274.1|  stigma/style cysteine-rich adhesin                    51.6    8e-11   
gb|AEN70918.1|  lipid transfer protein                                66.6    8e-11   
gb|KHN29530.1|  Non-specific lipid-transfer protein 3                 49.7    8e-11   
gb|AFD32272.1|  stigma/style cysteine-rich adhesin                    50.1    8e-11   
emb|CDY27974.1|  BnaC05g43760D                                        49.7    8e-11   
gb|AAN77147.1|  fiber lipid transfer protein                          66.6    8e-11   
gb|ABA34098.1|  phospholipid transfer protein 2                       57.4    8e-11   
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    8e-11   
gb|ABO42261.1|  lipid transfer protein 4 precursor                    66.6    8e-11   
ref|XP_007140089.1|  hypothetical protein PHAVU_008G083400g           53.1    8e-11   
emb|CAG28937.1|  lipid transfer protein                               51.6    8e-11   
gb|ABA34094.1|  phospholipid transfer protein 2                       57.4    8e-11   
gb|ACG40474.1|  nonspecific lipid-transfer protein 2 precursor        52.0    8e-11   
ref|XP_007134675.1|  hypothetical protein PHAVU_010G066500g           59.3    8e-11   
gb|AAC00499.1|  lipid transfer protein precursor                      66.6    8e-11   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    66.6    9e-11   
emb|CDM80964.1|  unnamed protein product                              50.4    9e-11   
ref|XP_002864627.1|  predicted protein                                49.7    9e-11   
gb|KHG30577.1|  Non-specific lipid-transfer                           66.6    9e-11   
ref|XP_004978531.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    9e-11   
ref|XP_003546844.1|  PREDICTED: LOW QUALITY PROTEIN: non-specific...  47.8    1e-10   
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
gb|AGH32497.1|  non-specific lipid transfer protein                   66.2    1e-10   
ref|NP_195807.1|  pathogenesis-related lipid transfer protein         49.7    1e-10   
ref|XP_004978532.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    1e-10   
emb|CAT99613.1|  lipid transfer protein                               53.5    1e-10   
gb|KHN44829.1|  Non-specific lipid-transfer protein 1                 52.8    1e-10   
gb|AFK35133.1|  unknown                                               50.1    1e-10   
ref|XP_010443683.1|  PREDICTED: non-specific lipid-transfer prote...  46.6    1e-10   
emb|CDY36007.1|  BnaA05g29430D                                        49.7    1e-10   
emb|CAT99614.1|  lipid transfer protein                               53.5    1e-10   
emb|CDY46122.1|  BnaA03g52460D                                        47.0    1e-10   
gb|AGC08428.1|  lipid transfer protein                                66.2    1e-10   
ref|XP_009800887.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    1e-10   
ref|XP_003522128.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    1e-10   
gb|AAT45202.1|  lipid transfer protein 1 precursor                    66.2    1e-10   
gb|AAB32995.1|  basic protein 1A, WBP1A=lipid transfer protein ho...  60.5    1e-10   
ref|XP_009608991.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    1e-10   
gb|KHN21357.1|  Non-specific lipid-transfer protein 8                 47.0    1e-10   
emb|CDX90642.1|  BnaA03g41390D                                        60.8    1e-10   
gb|AAL23748.1|  nonspecific lipid transfer protein                    53.1    1e-10   
ref|NP_001236847.1|  uncharacterized protein LOC100306055             47.0    1e-10   
gb|AEV12221.1|  stigma/stylar cysteine-rich adhesin                   51.2    1e-10   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    2e-10   
ref|XP_009138182.1|  PREDICTED: non-specific lipid-transfer prote...  47.0    2e-10   
ref|XP_006292059.1|  hypothetical protein CARUB_v10018254mg           46.6    2e-10   
ref|XP_006367396.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    2e-10   
ref|XP_002877813.1|  hypothetical protein ARALYDRAFT_485512           57.0    2e-10   
gb|KHG21711.1|  Non-specific lipid-transfer                           65.9    2e-10   
gb|AAF23458.1|AF208832_1  non-specific lipid transfer protein         65.5    2e-10   
gb|AAB70541.1|  lipid transfer protein LPT IV                         54.7    2e-10   
ref|NP_181388.1|  non-specific lipid-transfer protein 1               51.2    2e-10   
emb|CDX88695.1|  BnaA03g09540D                                        46.6    2e-10   
ref|XP_009626829.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    2e-10   
ref|NP_001142300.1|  uncharacterized protein LOC100274469 precursor   52.0    2e-10   
ref|XP_009372012.1|  PREDICTED: non-specific lipid-transfer prote...  47.0    2e-10   
ref|XP_006644921.1|  PREDICTED: non-specific lipid-transfer prote...  46.6    2e-10   
gb|ABE11609.1|  lipid-transfer protein precursor                      65.5    2e-10   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    2e-10   
gb|ADK98521.1|  phospholipid transfer protein 1                       56.2    2e-10   
ref|XP_009143378.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    2e-10   
ref|XP_010536638.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    2e-10   
gb|ABA29446.1|  non-specific lipid transfer protein                   65.5    2e-10   
ref|XP_009136621.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    3e-10   
prf||2115353B  lipid transfer protein                                 46.2    3e-10
ref|XP_007134674.1|  hypothetical protein PHAVU_010G066400g           50.1    3e-10   
ref|NP_001150972.1|  nonspecific lipid-transfer protein 3 precursor   52.0    3e-10   
ref|XP_006281350.1|  hypothetical protein CARUB_v10027406mg           46.2    3e-10   
gb|AAM22768.1|  lipid transfer protein                                51.6    3e-10   
emb|CAT99615.1|  lipid transfer protein                               50.8    3e-10   
ref|XP_002879751.1|  hypothetical protein ARALYDRAFT_482863           50.1    3e-10   
gb|ABK20926.1|  unknown                                               50.4    3e-10   
gb|AFD32273.1|  stigma/style cysteine-rich adhesin                    51.6    3e-10   
ref|XP_006345269.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    3e-10   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-10   
emb|CDY29024.1|  BnaC07g32300D                                        49.3    3e-10   
gb|AEN70933.1|  lipid transfer protein                                65.1    3e-10   
gb|KFK26695.1|  hypothetical protein AALP_AA8G281200                  47.8    3e-10   



>ref|XP_009757307.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score = 94.4 bits (233),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADRRSVCSCLK+AASSVSGINFK AA LPGKCGVKNIPF+ISPK DCSK+K
Sbjct  70   KTAADRRSVCSCLKTAASSVSGINFKNAAALPGKCGVKNIPFKISPKADCSKVK  123


 Score = 64.3 bits (155),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +2

Query  125  PCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            P +EAA++C+TV +SL+PCLSYV  GG KV P CC GIKSLY AAKT
Sbjct  26   PRAEAAITCSTVVNSLIPCLSYVMNGG-KVPPTCCQGIKSLYGAAKT  71



>ref|XP_004245220.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score = 85.5 bits (210),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  AD + VCSCLK AASSVSGI+FK AA LPGKCGVKNIPF+ISPKVDCSK++
Sbjct  69   KTTADHQGVCSCLKMAASSVSGIDFKNAAALPGKCGVKNIPFKISPKVDCSKVR  122


 Score = 67.0 bits (162),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
             +I +++A +P  +AA++C++VF+ L+PCLSYV KGG KV P CC GIKSLY+ AKT
Sbjct  15   FLIYIVIAASPRVDAAITCSSVFNGLIPCLSYVVKGG-KVPPTCCRGIKSLYSIAKT  70



>ref|XP_009596391.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=147

 Score = 92.4 bits (228),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADRRSVCSCLK+A SSVSGINFK AA LPGKCGVKNIPF+ISPK DCSK+K
Sbjct  94   KTTADRRSVCSCLKTATSSVSGINFKNAAALPGKCGVKNIPFKISPKADCSKVK  147


 Score = 54.3 bits (129),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +2

Query  143  VSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C+TV + L+PCLSYV  GG KV P CC GIKSLY A KT
Sbjct  56   ITCSTVVNGLIPCLSYVVNGG-KVPPTCCKGIKSLYGAVKT  95



>gb|ABY21307.1| pollen allergen Pla o 3 [Platanus orientalis]
Length=118

 Score = 65.5 bits (158),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLK+A++S+SGI    AA L GKCGV N+P++ISP +DCSK+K
Sbjct  70   DRQAACGCLKTASTSISGIQLGNAASLAGKCGV-NLPYKISPTIDCSKVK  118


 Score = 59.3 bits (142),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  83   KFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAK  262
            K + L++  +VA AP +EAA++C TV + L PCL+Y+  GG  V PACC+G+K+L   AK
Sbjct  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGG-AVAPACCNGVKALNNDAK  66

Query  263  T  265
            T
Sbjct  67   T  67



>emb|CAL07989.1| lipid transfer protein [Platanus x acerifolia]
Length=118

 Score = 65.5 bits (158),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLK+A++S+SGI    AA L GKCGV N+P++ISP +DCSK+K
Sbjct  70   DRQAACGCLKTASTSISGIQLGNAASLAGKCGV-NLPYKISPTIDCSKVK  118


 Score = 57.8 bits (138),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  83   KFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAK  262
            K + L++  +VA AP +EAA++C TV + L PCL+++  GG  V PACC+G+K+L   AK
Sbjct  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGG-AVAPACCNGVKALNNDAK  66

Query  263  T  265
            T
Sbjct  67   T  67



>emb|CDP12680.1| unnamed protein product [Coffea canephora]
Length=122

 Score = 61.2 bits (147),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 4/65 (6%)
 Frame = +2

Query  80   LKFSTLII---CLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLY  250
            LK  TL+I    L+++ +   +A +SC+TV + L+PCLS+V  GG KV PACCSGIK+L 
Sbjct  8    LKLGTLVIFVSMLIMSFSHGGQAQISCDTVDNDLLPCLSFVLNGG-KVAPACCSGIKTLL  66

Query  251  AAAKT  265
            + AKT
Sbjct  67   SLAKT  71


 Score = 61.2 bits (147),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
             DR+SVCSCLKS A S +    K AAQ+P  CGV N+PFQIS  +DCSK+K
Sbjct  73   TDRQSVCSCLKSVAQSATNGQLKNAAQIPHLCGV-NVPFQISRNIDCSKVK  122



>gb|AEI70830.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 64.7 bits (156),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SGIN   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  68   DRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKVQ  116


 Score = 57.0 bits (136),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++ C++VA AP +EA +SC  V SSL PC+SY+TKGG  V PACCSG+KSL  AAKT
Sbjct  12   VVTCMVVA-APYAEA-LSCGQVSSSLAPCISYLTKGG-AVPPACCSGVKSLNCAAKT  65



>emb|CBW38498.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 63.9 bits (154),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SG+N   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  54   DRQAACGCLKSAYNSISGVNAGNAASLPGKCGV-SIPYKISPSTDCSKVQ  102


 Score = 56.6 bits (135),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 3/54 (6%)
 Frame = +2

Query  104  CLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            C++VA AP +EA +SC  V SSL PC+SY+TKGG  V PACCSG+KSL +AAKT
Sbjct  1    CMVVA-APYTEA-LSCGQVSSSLAPCISYLTKGG-AVPPACCSGVKSLNSAAKT  51



>gb|AFR43276.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43278.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 67.0 bits (162),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++ C C+KSAA+ + GINF  A+ LPGKCGV NIP++ISP  DCS +K
Sbjct  68   QTTPDRQAACKCIKSAAAGIPGINFGLASGLPGKCGV-NIPYKISPSTDCSSVK  120


 Score = 53.5 bits (127),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVT-KGGKKVQPACCSGIKSLYAA  256
            LK + +++  +V  AP ++ AV+C  V SSL PC++Y+   G   + P CCSGIKSL +A
Sbjct  7    LKLACVVVLCMVVGAPLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLNSA  66

Query  257  AKT  265
            A+T
Sbjct  67   AQT  69



>sp|Q39950.1|NLTP_HELAN RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Short=NsLTP; AltName: Full=SDI-9; Flags: Precursor [Helianthus 
annuus]
 emb|CAA63340.1| lipid transfer protein [Helianthus annuus]
Length=116

 Score = 62.8 bits (151),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SG+N   AA  PGKCGV +IP++ISP  DCSK++
Sbjct  68   DRQAACGCLKSAYNSISGVNAGNAASFPGKCGV-SIPYKISPSTDCSKVQ  116


 Score = 57.0 bits (136),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 6/65 (9%)
 Frame = +2

Query  83   KFSTLIICL----LVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLY  250
            K + +++C     +V  AP +EA +SC  V SSL PC+SY+TKGG  V PACCSG+KSL 
Sbjct  3    KMAMMVLCAGVTCMVVGAPYTEA-LSCGQVSSSLAPCISYLTKGG-AVPPACCSGVKSLN  60

Query  251  AAAKT  265
            +AAKT
Sbjct  61   SAAKT  65



>gb|AEI70826.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=118

 Score = 63.9 bits (154),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 3/52 (6%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISP--KVDCSKIK  420
            DR++ C CLKSA SS+SGIN   AA LPGKCGV NIP++ISP  + DCSK++
Sbjct  68   DRQAACGCLKSAYSSISGINSGNAASLPGKCGV-NIPYKISPGTRTDCSKVQ  118


 Score = 55.8 bits (133),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 3/57 (5%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++ C++VA AP +EA +SC  V SSL PC+ Y+TKGG  V PACCSG+KSL +AAKT
Sbjct  12   VVTCMVVA-APYAEA-LSCGQVSSSLAPCIGYLTKGG-VVPPACCSGVKSLNSAAKT  65



>ref|XP_010252074.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=120

 Score = 62.0 bits (149),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ CSC+KSAA+ V  I    AA LPGKCG+  IP++ISP  DCSK+K
Sbjct  72   DRQTTCSCMKSAATQVPTIKVGNAASLPGKCGI-TIPYKISPTTDCSKVK  120


 Score = 57.8 bits (138),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +2

Query  86   FSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            F  L++  +V  AP +EAA++C  V + + PC++Y+  GG  V  ACC+G+K+LY AAKT
Sbjct  11   FGCLVLAFMVVAAPNAEAAITCGMVATQMTPCVNYLQNGG-PVPAACCNGVKTLYGAAKT  69



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 69.3 bits (168),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++VC+C+KSAA ++SG+N   AA LP KCGV NIP++ISP +DC+K++
Sbjct  70   DRQTVCNCMKSAAGAISGVNLNLAAALPNKCGV-NIPYKISPSIDCAKVQ  118


 Score = 49.7 bits (117),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  107  LLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            L+  +A  +EA V+C TV + L PCL YV  GG  +   CC+GI+SL++AA T Q
Sbjct  16   LIAIVASHAEAVVTCGTVATDLSPCLDYVRMGG-AIPAMCCNGIRSLFSAASTTQ  69



>gb|KDO64078.1| hypothetical protein CISIN_1g033544mg [Citrus sinensis]
Length=117

 Score = 65.1 bits (157),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+SVC+CLK+AA S+  +N   A++LP +CGV NIP+QISP VDCS+++
Sbjct  69   DRQSVCNCLKTAAGSIKNLNLNLASRLPRQCGV-NIPYQISPSVDCSRVR  117


 Score = 53.9 bits (128),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 4/68 (6%)
 Frame = +2

Query  68   MTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVT--KGGKKVQPACCSGIK  241
            M  KL  + L++C+++  AP ++AAV+C  V SSL  C+ YVT  +GG  V PACCSGIK
Sbjct  1    MALKLACAVLLMCMVMG-APIAQAAVTCGQVTSSLQACIPYVTGPRGG-AVPPACCSGIK  58

Query  242  SLYAAAKT  265
            SL +AA T
Sbjct  59   SLNSAATT  66



>gb|AGH13363.1| lipid transfer protein, partial [Helianthus annuus]
Length=102

 Score = 65.1 bits (157),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SGIN   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  54   DRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKVQ  102


 Score = 53.9 bits (128),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 3/54 (6%)
 Frame = +2

Query  104  CLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            C++VA       A+SC  V SSL PC+SY+TKGG  V PACCSG+KSL +AAKT
Sbjct  1    CMMVAAN--YAEALSCGQVSSSLAPCISYLTKGG-AVPPACCSGVKSLNSAAKT  51



>gb|AEI70829.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 64.7 bits (156),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SGIN   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  68   DRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPGTDCSKVQ  116


 Score = 54.3 bits (129),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (68%), Gaps = 6/65 (9%)
 Frame = +2

Query  83   KFSTLIICL----LVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLY  250
            K + +++C     +V +AP +EA +SC  V SSL PC+ Y+TKGG  V PACC+G+K L 
Sbjct  3    KMAMMVLCAVVTCMVVVAPYAEA-LSCGQVSSSLAPCIGYLTKGG-AVPPACCNGVKGLN  60

Query  251  AAAKT  265
             AAKT
Sbjct  61   NAAKT  65



>emb|CBW38501.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 64.7 bits (156),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SGIN   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  54   DRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKVQ  102


 Score = 53.9 bits (128),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            A+SC  V SSL PC+SY+TKGG  V PACCSG+KSL +AAKT
Sbjct  11   ALSCGQVSSSLAPCISYLTKGG-AVPPACCSGVKSLNSAAKT  51



>gb|AAX84944.1| non-specific lipid transfer protein-like antimicrobial protein 
[Leonurus japonicus]
Length=115

 Score = 66.6 bits (161),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            DR++VC+CLK+ A S SGIN   AA LPGKCGV +IP+QISP  DCSK+
Sbjct  67   DRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGV-SIPYQISPNTDCSKV  114


 Score = 52.0 bits (123),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 4/63 (6%)
 Frame = +2

Query  77   KLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            KL  + LI+  +VA  P +EAA+ CNTV S + PCL YVT  GK     CC G+K L  A
Sbjct  6    KLMCTMLIVAAVVA--PLAEAAIGCNTVASKMAPCLPYVT--GKGPLGGCCGGVKGLIDA  61

Query  257  AKT  265
            A+T
Sbjct  62   ART  64



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 61.6 bits (148),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+ VC+CLKS A  +SG+N+  AA LP KCGV +IP++ISP  DC  +K
Sbjct  70   DRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGV-SIPYKISPATDCKTVK  118


 Score = 57.0 bits (136),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            LK +  ++  +V  AP +EAA++C  V SSL  C+ Y+ KGG  + PACCSG+KSL +AA
Sbjct  7    LKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGG-ALPPACCSGLKSLNSAA  65

Query  260  KT  265
            KT
Sbjct  66   KT  67



>gb|AAY43800.1| FSLTP2 [Gossypium hirsutum]
Length=120

 Score = 64.7 bits (156),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            Q   DR++ C C+KSAA+ ++GINF  A+ LPGKCGV NIP++ISP  DC++ 
Sbjct  68   QTTPDRQAACRCIKSAAAGITGINFGLASGLPGKCGV-NIPYKISPNTDCNRF  119


 Score = 53.5 bits (127),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVT-KGGKKVQPACCSGIKSLYAA  256
            LK + +++  +V  AP ++ AV+C  V +SL PC++Y+   G   V P CCSGIKSL +A
Sbjct  7    LKLACVVVLGMVVGAPLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNSA  66

Query  257  AKT  265
            A+T
Sbjct  67   AQT  69



>ref|XP_007033545.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
 gb|EOY04471.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
Length=119

 Score = 69.3 bits (168),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++ C+C+KSAA S+SGIN+  A+Q+P KCGV +IP+QISP +DCS + 
Sbjct  67   QTSQDRKAACACIKSAAGSISGINYALASQMPSKCGV-SIPYQISPNIDCSSVN  119


 Score = 48.5 bits (114),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +2

Query  122  APCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            AP ++ A+SC  V   L PC+SY+   G  V  +CCSGIK L +AA+T Q
Sbjct  21   APLAQGAISCGQVTGYLTPCISYLRGSGGAVPSSCCSGIKGLNSAAQTSQ  70



>gb|KDP27368.1| hypothetical protein JCGZ_20192 [Jatropha curcas]
Length=117

 Score = 63.9 bits (154),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            +  ADR+  C CLKSA++S+ GI+   AA LPGKCGV +IP++ISP VDCSK
Sbjct  67   KTTADRQQACKCLKSASNSIPGIDLNLAAGLPGKCGV-SIPYKISPSVDCSK  117


 Score = 53.5 bits (127),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C++V  AP +EAA++C  V SS+  C+ Y+ KG     PACCSG++SL AAAKT
Sbjct  13   LVMCMVVG-APLAEAAITCGQVASSVSACIPYLRKGVAAPPPACCSGVRSLNAAAKT  68



>gb|AEI70827.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 64.3 bits (155),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SG+N   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  68   DRQAACGCLKSAYNSISGVNAGNAASLPGKCGV-SIPYKISPGTDCSKVQ  116


 Score = 52.8 bits (125),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 3/57 (5%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++ C++VA AP +EA ++C  V SSL PC+ Y+TKGG  V PACC+G+K L  AAKT
Sbjct  12   VVTCMVVA-APYAEA-LTCGQVSSSLAPCIGYLTKGG-AVPPACCNGVKGLNNAAKT  65



>emb|CBW38499.1| lipid transfer protein [Helianthus annuus]
 emb|CBW38500.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 64.7 bits (156),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SGIN   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  54   DRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKVQ  102


 Score = 52.0 bits (123),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 3/54 (6%)
 Frame = +2

Query  104  CLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            C++VA AP +EA +SC  V SSL PC+ Y+TKGG  V PACC+G+K L  AAKT
Sbjct  1    CMVVA-APYAEA-LSCGQVSSSLAPCIGYLTKGG-AVPPACCNGVKGLNNAAKT  51



>ref|XP_004240614.2| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=158

 Score = 60.5 bits (145),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR+S+CSCLKS A++ +      AA LPGKCGVK +PF+IS  VDC+K+K
Sbjct  109  ADRQSICSCLKSLATTATDEQVDRAASLPGKCGVK-VPFKISRDVDCTKVK  158


 Score = 56.2 bits (134),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 4/78 (5%)
 Frame = +2

Query  32   LPTP*THSHMNDMTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKK  211
            LP+P T +++  ++ K   S L+ICL+++  P + A ++C+TVF+ L PCL+YV  GG  
Sbjct  34   LPSPKTMANV--LSKKFLLSFLLICLVLS-PPQARAVITCDTVFNDLKPCLNYVLVGG-N  89

Query  212  VQPACCSGIKSLYAAAKT  265
            V   CC+G+KSL   A T
Sbjct  90   VPAECCNGLKSLIVKAIT  107



>gb|ACQ42221.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 69.7 bits (169),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADR++ CSCLKSA SSVSGI    A+ LPGKCGV +IP+QISP  DCSK+K
Sbjct  67   KTTADRQAACSCLKSALSSVSGIQPSLASSLPGKCGV-SIPYQISPSTDCSKVK  119


 Score = 46.6 bits (109),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = +2

Query  62   NDMTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIK  241
              M   L F  ++   L+ + P  EAA++C TV S+L PC++YV  GG  V  +CC G+ 
Sbjct  3    RSMISVLAFVVMVTGALM-VTPYVEAALTCGTVTSALSPCITYVRNGG-SVPASCCQGVA  60

Query  242  SLYAAAKT  265
            +L +AAKT
Sbjct  61   ALNSAAKT  68



>emb|CBW38502.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 64.7 bits (156),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SGIN   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  54   DRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKVQ  102


 Score = 51.6 bits (122),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            A+SC  V  SL PC+SY+TKGG  V PACCSG+KSL +AAKT
Sbjct  11   ALSCGQVSFSLAPCISYLTKGG-AVPPACCSGVKSLNSAAKT  51



>ref|XP_010683515.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 59.3 bits (142),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C CLKSAA+SV GI+   A+ LPGKC V +IP+ IS   DCSK+ 
Sbjct  67   ADRKTACGCLKSAAASVKGIDMSAASGLPGKCDV-SIPYPISTSTDCSKVN  116


 Score = 57.0 bits (136),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +2

Query  77   KLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            KL  +TL+ C+LV +AP +EAAV+C  V SSL+PCL Y+ +GG    PACC GIKSL + 
Sbjct  6    KLACATLM-CMLV-VAPHAEAAVTCGQVTSSLLPCLGYL-QGGASPSPACCGGIKSLNSM  62

Query  257  AKT  265
            A T
Sbjct  63   AST  65



>ref|XP_007033546.1| Non-specific lipid-transfer protein 6, putative isoform 2 [Theobroma 
cacao]
 gb|EOY04472.1| Non-specific lipid-transfer protein 6, putative isoform 2 [Theobroma 
cacao]
Length=137

 Score = 67.4 bits (163),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++ C+C+KSAA S+SGIN+  A+Q+P KCGV +IP+QISP +DC+  +
Sbjct  67   QTSQDRKAACACIKSAAGSISGINYALASQMPSKCGV-SIPYQISPNIDCTSTE  119


 Score = 48.5 bits (114),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            LK + +++  LV  AP ++ A+SC  V   L PC+SY+   G  V  +CCSGIK L +AA
Sbjct  7    LKLACVVVLCLVVGAPLAQGAISCGQVTGYLTPCISYLRGSGGAVPSSCCSGIKGLNSAA  66

Query  260  KTGQ  271
            +T Q
Sbjct  67   QTSQ  70



>gb|AFK46170.1| unknown [Lotus japonicus]
Length=119

 Score = 58.9 bits (141),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +2

Query  68   MTPKLKFSTLI--ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIK  241
            M   +KFS ++  IC+ +  AP +EAA+SC +V  +L PC+ Y+T GG    P CC+G+K
Sbjct  1    MATSVKFSCMVVAICMALVAAPMAEAAISCGSVIGALTPCMPYLT-GGPAPSPQCCAGVK  59

Query  242  SLYAAAKT  265
            +L AAA T
Sbjct  60   NLNAAAST  67


 Score = 57.0 bits (136),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLK+AA S+  +N   AA LPGKCGV NIP++IS   +C+ IK
Sbjct  70   DRKTACGCLKNAAGSMPNLNAGNAAALPGKCGV-NIPYKISTSTNCNTIK  118



>emb|CBW38497.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 64.7 bits (156),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SGIN   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  54   DRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKVQ  102


 Score = 51.2 bits (121),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 3/54 (6%)
 Frame = +2

Query  104  CLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            C++VA AP +EA +SC  V +SL PC+ Y+TKGG  V PACC+G+K L  AAKT
Sbjct  1    CMVVA-APYAEA-LSCGQVSNSLAPCIGYLTKGG-AVPPACCNGVKGLNNAAKT  51



>sp|A0AT29.1|NLTP2_LENCU RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP2; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
7; Short=LTP7; Flags: Precursor [Lens culinaris]
 gb|AAX35807.1| lipid transfer protein 2 precursor [Lens culinaris]
Length=118

 Score = 59.3 bits (142),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKSAA S++ +N   AA LPGKCGV NIP++IS   +C+ +K
Sbjct  69   DRQAACNCLKSAAGSITKLNTNNAAALPGKCGV-NIPYKISTTTNCNTVK  117


 Score = 56.6 bits (135),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +2

Query  77   KLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            KL    L+IC++V +AP +E A+SC  V S L PCL+Y+T GG    P CC G+K L AA
Sbjct  6    KLACVVLVICMVV-IAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA  63

Query  257  AKT  265
            A T
Sbjct  64   ANT  66



>gb|AAF35184.1|AF195863_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26701.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43273.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43274.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43275.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 66.2 bits (160),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++ C C+KSAA+ + GIN+  A+ LPGKCGV NIP++ISP  DCS++K
Sbjct  68   QTTPDRQAACKCIKSAAAGIPGINYGIASGLPGKCGV-NIPYKISPSTDCSRVK  120


 Score = 49.3 bits (116),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQP-ACCSGIKSLYAA  256
            LK + +++  +V  AP ++  V+C  V  SL PC++Y+   G    P  CCSGIKSL +A
Sbjct  7    LKLACVVVLCMVVGAPLAQGTVTCGQVTGSLAPCINYLRGNGAGAVPQGCCSGIKSLNSA  66

Query  257  AKT  265
            A+T
Sbjct  67   AQT  69



>ref|XP_011091590.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 60.1 bits (144),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            DR+SVC+CLKS A S + ++   AA LPG+CGV NIP++ISP  DCS +
Sbjct  70   DRQSVCNCLKSLADSYTDVDLSKAAGLPGQCGV-NIPYKISPSTDCSTV  117


 Score = 55.5 bits (132),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +2

Query  107  LLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            L +A+AP SEAA++C TV S L  CLSY+T  G     +CCSG+K LY AAKT Q
Sbjct  17   LAMAVAPRSEAAITCGTVVSDLDSCLSYLTNKGP--LGSCCSGVKGLYGAAKTTQ  69



>ref|XP_008370253.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
 ref|XP_008363932.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 64.7 bits (156),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = +2

Query  80   LKFSTLIICL--LVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYA  253
            LK + L++ +  +VA AP +EAAV+C  V +SLVPCLSYVT GG  + PACC+G+K+LY 
Sbjct  8    LKLACLVVVMFCMVAGAPKAEAAVTCGQVVNSLVPCLSYVTNGG-ALNPACCNGVKTLYN  66

Query  254  AAKT  265
             A+T
Sbjct  67   LAQT  70


 Score = 50.8 bits (120),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSV--SGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++VC+CLK A + +  +  N   AA LP +CGV NIP++ISP  DC  +K
Sbjct  69   QTTPDRQNVCNCLKQAINGIPYTNTNAGLAAGLPARCGV-NIPYKISPSTDCKSVK  123



>ref|XP_009760676.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=118

 Score = 64.7 bits (156),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++VC+C+KSAA  +SG+N   AA LP KCGV  IP++ISP +DC+K++
Sbjct  70   DRQTVCNCMKSAARVISGVNLNLAAALPSKCGVI-IPYKISPSIDCAKVQ  118


 Score = 50.4 bits (119),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 6/68 (9%)
 Frame = +2

Query  83   KFSTLIICLLVAL-----APCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSL  247
            KF++L +  + A+     A  +EA V+C TV + L PCL YV  GG  +   CC+GI++L
Sbjct  3    KFASLSVMFIAAMVIAIVASHAEAVVTCGTVATDLSPCLDYVRMGG-AIPTMCCNGIRNL  61

Query  248  YAAAKTGQ  271
            ++AA T Q
Sbjct  62   FSAASTTQ  69



>ref|XP_011091591.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091594.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091595.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 gb|ABQ53933.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 62.4 bits (150),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR+SVCSCLKS A S   ++   AA LPG+CGV NIP++ISP  DCSK+ 
Sbjct  66   QTAQDRQSVCSCLKSLAGSYKDVDLNKAAGLPGQCGV-NIPYKISPSTDCSKVN  118


 Score = 52.4 bits (124),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +2

Query  107  LLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            L +A+AP  EAA+ C TV S L PCL YVT  G     +CC G+K LY AA+T Q
Sbjct  17   LAMAVAPRGEAAIGCGTVVSYLNPCLPYVTNKGP--LGSCCGGVKGLYGAAQTAQ  69



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 61.2 bits (147),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR+ VC+CLKS A  +SGIN+  AA LP KCGV +I ++ISP  DC  +K
Sbjct  69   ADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGV-SISYKISPSTDCKSVK  118


 Score = 53.5 bits (127),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +2

Query  62   NDMTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIK  241
            + M  KL ++ LI   +V  AP +EAA+SC  V SSL  C+ Y+ KGG  V  ACCSG+K
Sbjct  3    SSMGLKLTYAMLIA--MVVSAPLAEAAISCGQVSSSLAQCIGYLQKGG-AVPAACCSGLK  59

Query  242  SLYAAAKT  265
             L +AA T
Sbjct  60   GLNSAATT  67



>ref|XP_011091601.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 65.1 bits (157),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q  ADR+SVC CLK  A+S SG+N   AA LP +CG+ NIP++ISP  DCSK++
Sbjct  66   QTTADRQSVCGCLKDLAASTSGVNLGKAAGLPSQCGL-NIPYKISPSTDCSKVQ  118


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +2

Query  71   TPKLKFSTLI-ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSL  247
            T K  F  LI +  ++++ P  EAA+ C TV S L PCL YVT  G      CC GI  L
Sbjct  4    TIKPMFVVLIAVVSIMSVVPEGEAAIGCGTVVSYLNPCLPYVT--GTGALGGCCKGINDL  61

Query  248  YAAAKT  265
            YAAA+T
Sbjct  62   YAAAQT  67



>ref|XP_010043178.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88337.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 61.6 bits (148),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C C++SAA ++ G+N    + LPGKCGV+ IP++ISP  DCS++K
Sbjct  68   DRRTTCRCVQSAAGNIQGLNLGLVSALPGKCGVR-IPYKISPSTDCSRVK  116


 Score = 52.8 bits (125),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++ L+VA+ P +E+A++C  V S + PCL Y+  GG K+  ACCSGI+SL  AA+T
Sbjct  11   LVVGLVVAM-PLTESAITCGQVRSWVAPCLGYLRAGG-KIPSACCSGIRSLNNAART  65



>emb|CBW38503.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 65.1 bits (157),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SGIN   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  54   DRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKVQ  102


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            A+SC  V SSL PC+ Y+TKGG  V PACC+G+K L  AAKT
Sbjct  11   ALSCGQVSSSLAPCIGYLTKGG-AVPPACCNGVKGLNNAAKT  51



>emb|CBW38504.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 65.1 bits (157),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA +S+SGIN   AA LPGKCGV +IP++ISP  DCSK++
Sbjct  54   DRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTDCSKVQ  102


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            A+SC  V SSL PC+ Y+TKGG  V PACC+G+K L  AAKT
Sbjct  11   ALSCGQVSSSLAPCIGYLTKGG-AVPPACCNGVKGLNNAAKT  51



>sp|A0AT28.1|NLTP1_LENCU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Flags: Precursor [Lens culinaris]
 gb|AAX35806.1| lipid transfer protein 1 precursor [Lens culinaris]
Length=118

 Score = 59.3 bits (142),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = +2

Query  80   LKFSTLI--ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYA  253
            L+ S L+  +C++V  AP +EAA+SC TV  +LVPCL+Y+ KGG    P CC G+K L  
Sbjct  4    LRVSCLVALMCMVVISAPMAEAAISCGTVSGALVPCLTYL-KGGPGPSPQCCGGVKRLNG  62

Query  254  AAKT  265
            AA+T
Sbjct  63   AART  66


 Score = 54.3 bits (129),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C+CLKS+A S+SG+     A LPGKCGV+ +P+ IS   +C+ I+
Sbjct  69   DRRAACNCLKSSAGSISGLKPGNVATLPGKCGVR-LPYTISTSTNCNTIR  117



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 60.8 bits (146),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR+ VC+CLKS A  +SGIN+  AA LP KCGV +I ++ISP  DC  +K
Sbjct  69   ADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGV-SISYKISPSTDCKSVK  118


 Score = 52.8 bits (125),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            LK +  ++  +V  AP +EAA+SC  V SSL  C++Y+ KGG  V  ACCSG+K L +AA
Sbjct  7    LKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCITYLQKGG-AVPAACCSGLKGLNSAA  65

Query  260  KT  265
             T
Sbjct  66   TT  67



>sp|A0AT31.1|NLTP5_LENCU RecName: Full=Non-specific lipid-transfer protein 5; Short=LTP5; 
Flags: Precursor [Lens culinaris]
 gb|AAX35809.1| lipid transfer protein 5 precursor [Lens culinaris subsp. culinaris]
Length=116

 Score = 60.5 bits (145),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+C+KSAASS++ +N   AA LPGKCGV NIP++IS   +C+ +K
Sbjct  68   DRQAACNCMKSAASSITKLNTNNAAALPGKCGV-NIPYKISTSTNCNTVK  116


 Score = 53.1 bits (126),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +2

Query  77   KLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            KL    L++C++VA  P +E A+SC  V   L PCL+Y+T GG    P CC G+K L AA
Sbjct  6    KLACVVLVMCMIVA--PMAEGAISCGAVTGDLSPCLTYLT-GGPGPSPQCCGGVKKLLAA  62

Query  257  AKT  265
            A T
Sbjct  63   ANT  65



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 60.5 bits (145),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKSAA ++SG+N   AA LPGKCGV NIP++IS   +C+ I+
Sbjct  124  DRQAACNCLKSAAGAISGLNPNIAAGLPGKCGV-NIPYKISTSTNCATIR  172


 Score = 52.8 bits (125),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 3/57 (5%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C++VA  P +EAA++C TV  SL PC+ Y+ KGG     ACC G+K L +AA T
Sbjct  68   LMMCIIVA--PMAEAAITCGTVTGSLAPCIGYL-KGGSGPSAACCGGVKRLNSAATT  121



>gb|ABK96515.1| unknown [Populus trichocarpa x Populus deltoides]
Length=118

 Score = 61.2 bits (147),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR+ VC+CLKS A  +SGIN+  AA LP KCGV +I ++ISP  DC  +K
Sbjct  69   ADRQGVCNCLKSLAGKISGINYGLAAGLPSKCGV-SISYKISPSTDCKSVK  118


 Score = 52.4 bits (124),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            LK +  ++  +V  AP +EAA+SC  V SSL  C+ Y+ KGG  V  ACCSG+K L +AA
Sbjct  7    LKLACAMLVAMVVSAPLAEAAISCGQVSSSLAQCIGYLQKGG-AVPAACCSGLKGLNSAA  65

Query  260  KT  265
             T
Sbjct  66   TT  67



>ref|XP_011091599.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=118

 Score = 65.5 bits (158),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+SVC+CLK  A+S SG+N   AA LPG+CGV +IP++ISP  DCSK+K
Sbjct  70   DRQSVCNCLKFLAASTSGVNLGKAAALPGQCGV-SIPYKISPSTDCSKVK  118


 Score = 48.1 bits (113),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 2/52 (4%)
 Frame = +2

Query  110  LVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++++ P  EAA+ C TV S L PC+ YVT  GK     CC GIK LY  AK+
Sbjct  18   IMSVVPEGEAAIGCGTVVSKLSPCIPYVT--GKGALGGCCKGIKGLYDLAKS  67



>ref|XP_003605266.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES87463.1| Lipid transfer protein [Medicago truncatula]
Length=116

 Score = 58.5 bits (140),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLK AA ++SG+N   A+ LPGKCGV NIP++IS   +C+ I+
Sbjct  67   DRQAACNCLKQAAGAISGLNTAAASALPGKCGV-NIPYKISTSTNCATIR  115


 Score = 54.7 bits (130),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  77   KLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            K+    L++C++VA  P ++AA+SC TV S+L PC+ Y+ KGG    PACC G+K L  A
Sbjct  5    KIACVVLMMCMIVA--PMADAAISCGTVTSALGPCIGYL-KGGPGPSPACCGGVKRLNGA  61

Query  257  AKT  265
            A T
Sbjct  62   AAT  64



>ref|XP_003605309.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=545

 Score = 60.8 bits (146),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKSAA ++SG+N   AA LPGKCGV NIP++IS   +C+ I+
Sbjct  496  DRQAACNCLKSAAGAISGLNPNIAAGLPGKCGV-NIPYKISTSTNCATIR  544


 Score = 52.0 bits (123),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 3/57 (5%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C++VA  P +EAA++C TV  SL PC+ Y+ KGG     ACC G+K L +AA T
Sbjct  440  LMMCIIVA--PMAEAAITCGTVTGSLAPCIGYL-KGGSGPSAACCGGVKRLNSAATT  493


 Score = 55.5 bits (132),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDC  408
            DR++ C+CLK AA ++SG+N   A+ LPGKCGV NIP++IS   +C
Sbjct  67   DRQAACNCLKQAAGAISGLNTAAASALPGKCGV-NIPYKISTSTNC  111


 Score = 54.3 bits (129),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C++VA  P ++AA+SC TV S+L PC+ Y+ KGG    PACC G+K L  AA T
Sbjct  11   LMMCMIVA--PMADAAISCGTVTSALGPCIGYL-KGGPGPSPACCGGVKRLNGAAAT  64



>gb|AFK44274.1| unknown [Medicago truncatula]
Length=116

 Score = 58.9 bits (141),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLK AA ++SG+N   A+ LPGKCGV NIP++IS   +C+ I+
Sbjct  67   DRQAACNCLKQAAGAISGLNTAAASALPGKCGV-NIPYKISTSTNCATIR  115


 Score = 54.3 bits (129),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  77   KLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            K+    L++C++VA  P ++AA+SC TV S+L PC+ Y+ KGG    PACC G+K L  A
Sbjct  5    KVACVVLMMCMIVA--PMADAAISCGTVTSALGPCIGYL-KGGPGPSPACCGGVKRLNGA  61

Query  257  AKT  265
            A T
Sbjct  62   AAT  64



>sp|Q43129.1|NLTP2_GOSHI RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=GH3; Flags: Precursor [Gossypium hirsutum]
 gb|AAB34774.1| LTP [Gossypium hirsutum]
 gb|AAY43799.1| NSLTP1 [Gossypium hirsutum]
Length=120

 Score = 63.9 bits (154),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +1

Query  274  RRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            R++ C C+KSAA+ ++GINF  A+ LPGKCGV NIP++ISP  DC+ +K
Sbjct  73   RQAACRCIKSAAAGITGINFGLASGLPGKCGV-NIPYKISPSTDCNSVK  120


 Score = 48.9 bits (115),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVT-KGGKKVQPACCSGIKSLYAA  256
            LK + +++  +V  AP ++ AV+   V +SL PC++Y+   G   V P CC+GIKSL +A
Sbjct  7    LKLACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSA  66

Query  257  AKTGQIAGACAR  292
            A+T  +  A  R
Sbjct  67   AQTTPVRQAACR  78



>gb|AAL25839.1| lipid transfer precursor protein [Hevea brasiliensis]
Length=116

 Score = 61.6 bits (148),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADRR+ C CLKSAA SV G+N    A LPGKCGV NIP++IS   +C+ +K
Sbjct  64   KTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV-NIPYKISLSTNCATVK  116


 Score = 51.2 bits (121),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  89   STLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            S L++C+LVA AP +  A++C  V S+LVPCLSY+   G      CC+G++++  AAKT
Sbjct  8    SFLVLCMLVA-APMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKT  65



>gb|AGH13362.1| lipid transfer protein, partial [Helianthus annuus]
Length=99

 Score = 56.6 bits (135),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 3/54 (6%)
 Frame = +2

Query  104  CLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            C++VA AP +EA +SC  V SSL PC+SY+TKGG  V PACCSG+KSL +AAKT
Sbjct  1    CMVVA-APYAEA-LSCGQVSSSLAPCISYLTKGG-AVPPACCSGVKSLNSAAKT  51


 Score = 56.2 bits (134),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVD  405
            DR++ C CLKSA +S+SGIN   AA LPGKCGV +IP++ISP  +
Sbjct  54   DRQAACGCLKSAYNSISGINAGNAASLPGKCGV-SIPYKISPSTE  97



>gb|ADK60918.1| lipid transfer protein [Castanea sativa]
Length=118

 Score = 58.5 bits (140),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADR++ C CLK+AA S+SG++   AA LPGKCGV N+P++IS   +C  +K
Sbjct  66   KTTADRQAACECLKTAAGSISGLSPANAASLPGKCGV-NVPYKISTSTNCKNVK  118


 Score = 53.9 bits (128),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            LK + L +  +V  AP ++AA+SC  V SSLV C+ Y+  GG   Q ACC+G+KSL  AA
Sbjct  7    LKLTCLAVMCMVIGAPVAQAAISCGQVQSSLVACIPYLRSGGSPTQ-ACCNGVKSLNNAA  65

Query  260  KT  265
            KT
Sbjct  66   KT  67



>ref|XP_009346911.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 60.5 bits (145),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = +2

Query  80   LKFSTLIICL--LVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYA  253
            LK   L++ +  +VA AP +EAAV+C  V +SLVPC+SYV  GG  + PACC+G+++LY 
Sbjct  8    LKLGCLVVVMFCMVAGAPKAEAAVTCGQVVNSLVPCISYVGNGG-ALDPACCNGVRTLYN  66

Query  254  AAKT  265
             A+T
Sbjct  67   LAQT  70


 Score = 51.6 bits (122),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSV--SGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++VC+CLK A + +  +  N   AA LP KCGV NIP++ISP  DC  +K
Sbjct  69   QTTPDRQNVCNCLKQAINGIPYTNTNAGLAAGLPAKCGV-NIPYKISPSTDCKSVK  123



>ref|XP_008244918.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X2 [Prunus 
mume]
Length=123

 Score = 57.4 bits (137),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSV--SGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q  ADR+S+C+CLK A + +  +  N   AA LPGKCGV NIP++ISP  DC  IK
Sbjct  69   QTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGV-NIPYKISPSTDCKSIK  123


 Score = 54.7 bits (130),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C +    P + AAVSC  V +SL PCLSYV+  G  + P+CC+G+KSLY+ A+T
Sbjct  16   VMCCMAVGVPKAMAAVSCGQVVNSLTPCLSYVSNNG-PLNPSCCTGVKSLYSMAQT  70



>gb|ADV02773.1| lipid transfer protein 1b, partial [Ipomoea batatas]
Length=93

 Score = 67.8 bits (164),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            ADR++VC+C+K+AASSV+G+N   AA LP KCGV +IP+QISP VDC+ +
Sbjct  44   ADRQTVCNCMKNAASSVTGLNLDLAAGLPQKCGV-SIPYQISPSVDCATV  92


 Score = 44.3 bits (103),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++SC+TV + L PCL YV  GG  V   CC GI+SLY +A T
Sbjct  2    SMSCSTVVTDLYPCLDYVENGG-AVPMDCCEGIRSLYTSAAT  42



>ref|XP_010252072.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 63.5 bits (153),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADR++ C CLKSAA+S+ G+N   A  +PGKCGV N P++ISP  DCS+++
Sbjct  70   KTTADRQATCQCLKSAAASIPGLNLGLANSIPGKCGV-NFPYKISPSTDCSRVR  122


 Score = 48.5 bits (114),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +2

Query  77   KLKFSTLIICLLVALAPCS--EAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLY  250
            KL  +  ++ ++++  P    +AA+SC  + S L PC++Y  KGG  + PACCSG+++L 
Sbjct  8    KLSLTVAVLSMIISSGPYVHVDAAISCGQLASLLSPCVNYFVKGG-PLPPACCSGVRTLN  66

Query  251  AAAKT  265
            +AAKT
Sbjct  67   SAAKT  71



>gb|ABP01769.1| lipid transfer protein 2 [Salvia miltiorrhiza]
Length=114

 Score = 64.7 bits (156),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+SVC+CLK+ ASS  G+N   AA LPG+CGV +IP++ISP  DCSK+K
Sbjct  66   DRQSVCNCLKTLASSYKGVNLGKAAGLPGQCGV-SIPYKISPSTDCSKVK  114


 Score = 47.0 bits (110),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 28/47 (60%), Gaps = 2/47 (4%)
 Frame = +2

Query  125  PCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            P SEAA+ C  V S L PCL YVT   K     CC GIK LY AAKT
Sbjct  19   PPSEAAIGCGAVVSYLNPCLPYVTN--KGPLGGCCGGIKGLYGAAKT  63



>ref|XP_008442324.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cucumis 
melo]
Length=117

 Score = 69.3 bits (168),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLKSAA S+SGIN+K AA LPGKCGV +I + ISP  DCS++ 
Sbjct  68   ADRRTACNCLKSAAKSISGINYKAAAGLPGKCGV-SISYPISPNTDCSRVN  117


 Score = 42.4 bits (98),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = +2

Query  68   MTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSL  247
            M  KLK   ++  +++ +    EAAV+C +V +++ PC+ Y+      V   CCSGI+SL
Sbjct  1    MEMKLKGLMIVGIVMMCMVVLGEAAVTCGSVATAMGPCIPYLRSPSASVPAGCCSGIRSL  60

Query  248  YAAAKT  265
               A T
Sbjct  61   NGQAAT  66



>gb|AES87466.2| Lipid transfer protein [Medicago truncatula]
Length=139

 Score = 57.4 bits (137),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLK AA ++SG+N   A+ LPGKCGV NIP++IS   +C+ ++
Sbjct  67   DRQAACNCLKQAAGAISGLNTAAASALPGKCGV-NIPYKISTSTNCATVR  115


 Score = 53.9 bits (128),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C++VA  P ++AA+SC TV S+L PC+ Y+ KGG    PACC G+K L  AA T
Sbjct  11   LMMCMIVA--PMADAAISCGTVTSALGPCIGYL-KGGPGPSPACCGGVKRLNGAAAT  64



>ref|XP_006842466.1| hypothetical protein AMTR_s00077p00068900 [Amborella trichopoda]
 gb|ERN04141.1| hypothetical protein AMTR_s00077p00068900 [Amborella trichopoda]
Length=114

 Score = 60.8 bits (146),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+VC CLK A + +SGIN+  A  LP  CGV +IP+ +SP  DCSKIK
Sbjct  66   DRRAVCGCLKQAVAGISGINYSLAQGLPKACGV-SIPYTLSPSTDCSKIK  114


 Score = 50.4 bits (119),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +2

Query  134  EAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            + AVSCN+VFS L PC+ Y+ +GG KV  ACC GIKS+   AKT
Sbjct  21   DGAVSCNSVFSYLGPCVPYL-RGGGKVPTACCGGIKSVNGMAKT  63



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 58.9 bits (141),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+ VC+CLKS A  +SG+N+  AA LP KCGV +I ++ISP  DC  +K
Sbjct  70   DRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGV-SISYKISPSTDCKTVK  118


 Score = 52.4 bits (124),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            LK +  ++  +V  AP +EAA++C  V SSL  C+ Y+ KGG  V  ACCSG+KSL +AA
Sbjct  7    LKLACAMLVAMVVSAPLAEAAITCGQVSSSLAQCIGYLQKGG-AVPAACCSGLKSLNSAA  65

Query  260  KT  265
             T
Sbjct  66   AT  67



>gb|ACL01093.1| lipid transfer protein [Castanea mollissima]
Length=118

 Score = 58.9 bits (141),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C CLK+AA S+SG++   AA LPGKCGV N+P++IS   +C  +K
Sbjct  69   ADRQAACECLKTAAGSISGLSPANAASLPGKCGV-NVPYKISTSTNCKNVK  118


 Score = 52.4 bits (124),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            LK + L +  +V   P ++AA+SC  V SSLV C+ Y+  GG   Q ACC+G+KSL  AA
Sbjct  7    LKLTCLAVMCMVIGEPVAQAAISCGQVQSSLVACIPYLRSGGSPTQ-ACCNGVKSLNNAA  65

Query  260  KT  265
            KT
Sbjct  66   KT  67



>gb|ACN11576.1| lipid transfer protein 3 precursor [Prunus dulcis]
Length=123

 Score = 57.8 bits (138),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSV--SGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q  ADR+S+C+CLK A + +  +  N   AA LPGKCGV NIP++ISP  DC  IK
Sbjct  69   QTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGV-NIPYKISPSTDCKTIK  123


 Score = 53.1 bits (126),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C +    P + AAVSC  V ++L PC++YV  GG  + P+CC+G++SLY+ A+T
Sbjct  16   VMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGG-ALNPSCCTGVRSLYSLAQT  70



>gb|EYU41040.1| hypothetical protein MIMGU_mgv1a016547mg [Erythranthe guttata]
Length=117

 Score = 61.2 bits (147),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 4/50 (8%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+SVC+CLKS A    G+N   AA LPG+CGV NIP++ISP  DCSK+K
Sbjct  72   DRQSVCACLKSLAG---GVNLGKAAALPGQCGV-NIPYKISPSTDCSKVK  117


 Score = 49.7 bits (117),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +2

Query  86   FSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            F   ++  +VA+ P  EAA+ C TV S + PCL YVT  G      CC GIK L +AAKT
Sbjct  12   FVAAVLVTMVAVVPRGEAAIGCGTVVSYMKPCLPYVTGSGP--LGGCCGGIKGLNSAAKT  69



>ref|XP_007206148.1| hypothetical protein PRUPE_ppa013428mg [Prunus persica]
 sp|Q43019.1|NLTP3_PRUDU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; Flags: Precursor [Prunus dulcis]
 emb|CAA65477.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80966.1| putative allergen Pru du 3.02 [Prunus dulcis x Prunus persica]
 gb|ACE80967.1| putative allergen Pru p 3.02 [Prunus dulcis x Prunus persica]
 gb|EMJ07347.1| hypothetical protein PRUPE_ppa013428mg [Prunus persica]
Length=123

 Score = 57.8 bits (138),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSV--SGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q  ADR+S+C+CLK A + +  +  N   AA LPGKCGV NIP++ISP  DC  IK
Sbjct  69   QTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGV-NIPYKISPSTDCKSIK  123


 Score = 53.1 bits (126),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C +    P + AAVSC  V ++L PC++YV  GG  + P+CC+G++SLY+ A+T
Sbjct  16   VMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGG-ALNPSCCTGVRSLYSLAQT  70



>ref|NP_001235162.1| uncharacterized protein LOC100499726 precursor [Glycine max]
 gb|ACU13384.1| unknown [Glycine max]
Length=122

 Score = 58.2 bits (139),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = +2

Query  59   MNDMTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGI  238
            M  ++ ++ F   ++CL  AL P ++  ++C  V S+L PC+SYV  GG  V   CC+GI
Sbjct  1    MASLSTRIFFIMSLVCL--ALGPMAQGEMTCGQVVSNLTPCISYVVYGGTNVPEQCCNGI  58

Query  239  KSLYAAAKT  265
            ++LY  A+T
Sbjct  59   RNLYGMAQT  67


 Score = 52.8 bits (125),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 5/58 (9%)
 Frame = +1

Query  259  QDGADRRSVCSCLKS----AASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++VC+C+K+    +  + S  N   AA LP KCGV NIP+QISP  DC++++
Sbjct  66   QTKPDRQAVCNCIKNGVRNSGFNYSDFNLNLAANLPKKCGV-NIPYQISPNTDCTRVQ  122



>ref|XP_008798551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 62.8 bits (151),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C C+K+AA+ +SG++   A+ LPGKCGV +IP++ISP  DCSKI 
Sbjct  70   DRRTACRCIKTAAAGLSGLDIGRASALPGKCGV-SIPYKISPSTDCSKIN  118


 Score = 47.8 bits (112),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L + +++  +P    A++C  V+  L PC+ Y+  GG  V P CCSG++SL AAA+T
Sbjct  12   LQLAMVLLASPRGTKAITCPQVYGDLTPCIQYLRSGG-AVAPQCCSGVRSLLAAART  67



>gb|ABF06565.1| non-specific lipid transfer-like protein [Prosopis juliflora]
Length=117

 Score = 58.2 bits (139),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q  AD+++VC+CLK AA  V G+N +YA  LP  CGV NIP++IS   +C+ IK
Sbjct  64   QTTADKQAVCNCLKGAAGQVPGLNNQYAQSLPSLCGV-NIPYKISTSTNCASIK  116


 Score = 52.4 bits (124),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C+ + +AP +EA V+C  V SSL PC++Y+ KGG    P CC+G+KSL  AA+T
Sbjct  12   VLCVALVVAPMAEA-VTCGQVSSSLAPCIAYLQKGGTPA-PGCCNGVKSLVGAAQT  65



>ref|XP_011091596.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 63.5 bits (153),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR+SVCSCLKS ASS   ++   AA LPG+CGV NIP++ISP  DCSK+ 
Sbjct  66   QTTQDRQSVCSCLKSLASSYKDVDLNKAAGLPGQCGV-NIPYKISPSTDCSKVN  118


 Score = 47.0 bits (110),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
 Frame = +2

Query  125  PCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            P  EAA+ C TV S L PCL YVT  G     +CC G+K LY AA+T Q
Sbjct  23   PRGEAAIGCGTVVSYLNPCLPYVTNKGP--LGSCCGGVKGLYGAAQTTQ  69



>gb|AFR31532.1| lipid transfer protein [Betula platyphylla]
Length=120

 Score = 56.6 bits (135),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++VC CLK AAS++SG+N    A LPGKC V NIP++IS   +C  IK
Sbjct  72   DRQAVCDCLKKAASALSGVNPNIIAGLPGKCNV-NIPYKISASTNCKTIK  120


 Score = 53.5 bits (127),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYV-TKGGKKVQPACCSGIKSLYAA  256
            L+ + +++  ++  AP ++AAVSC  V +SL+PC++YV   G   V P CCSGI S+  A
Sbjct  7    LRLTCVVLMCMMVYAPLADAAVSCGQVQTSLLPCITYVRNNGAGAVPPTCCSGIVSVNNA  66

Query  257  AKT  265
            AKT
Sbjct  67   AKT  69



>gb|AFK38461.1| unknown [Lotus japonicus]
Length=115

 Score = 60.5 bits (145),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLKSAA S S  N   AA LPGKCGV NIP++IS   +C+ IK
Sbjct  66   ADRRAACNCLKSAAGSFSRFNAGNAASLPGKCGV-NIPYKISTSTNCANIK  115


 Score = 49.7 bits (117),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            +KF   ++ L + +AP +EAA++C  + S+L+PC +Y+ +GG    P CC+G++ + +AA
Sbjct  4    VKFVCALVVLSMVVAPMAEAAITCGAIVSALIPCTAYI-QGGAGPSPPCCAGVRRVNSAA  62

Query  260  KT  265
             +
Sbjct  63   SS  64



>gb|AEC04836.1| lipid transfer protein [Dimocarpus longan]
Length=115

 Score = 56.2 bits (134),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+  C CL++AA ++ GIN   AA LPGKCGV NIP++IS   +C+ +K
Sbjct  67   DRQQACRCLQNAAKAIPGINTNLAAGLPGKCGV-NIPYKISTSTNCASVK  115


 Score = 53.9 bits (128),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L+ C+LV ++P ++AA++C  V SS+ PC+ Y+  GG  V P CC+GIKSL  AA+T
Sbjct  10   LVACMLV-VSPVAQAAITCGQVTSSVAPCIQYLRSGG-SVPPPCCNGIKSLNNAART  64



>gb|AFR43285.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43286.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43287.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 57.8 bits (138),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   +R+S CSC+K+ A+S+SGIN+    +LPG CGV + PF+ISP  +C  +K
Sbjct  68   QSTPERQSACSCVKALAASISGINYDLTNKLPGMCGVHS-PFKISPSTNCKSVK  120


 Score = 52.4 bits (124),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  71   TPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPA-CCSGIKSL  247
            T  LK +  ++  LV  AP +E A+SC  V S+L PC+ YV   G    PA CC+GI+SL
Sbjct  4    TMALKLACGVVLCLVVGAPLAEGAISCGQVISALAPCIPYVRNNGAGGVPAPCCNGIRSL  63

Query  248  YAAAKT  265
             AAA++
Sbjct  64   NAAAQS  69



>ref|XP_011091597.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 62.4 bits (150),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR+SVCSCLKS A S   ++   AA LPG+CGV NIP++ISP  DCSK+ 
Sbjct  66   QTAQDRQSVCSCLKSLAGSYKDVDLNKAAGLPGQCGV-NIPYKISPSTDCSKVN  118


 Score = 47.8 bits (112),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
 Frame = +2

Query  125  PCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            P  EAA+ C TV S L PCL YVT   K    +CC G+K LY AA+T Q
Sbjct  23   PRGEAAIGCGTVVSYLNPCLPYVTN--KGPLGSCCGGVKGLYGAAQTAQ  69



>emb|CCK33472.1| lipid transfer protein precursor, partial (chloroplast) [Cannabis 
sativa]
Length=91

 Score = 68.9 bits (167),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C CLKSAASS+ G+NF  A+ LPGKCGV +IP++ISP  DCS +K
Sbjct  42   ADRQAACKCLKSAASSIKGVNFNLASGLPGKCGV-SIPYKISPSTDCSSVK  91


 Score = 41.2 bits (95),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 27/41 (66%), Gaps = 1/41 (2%)
 Frame = +2

Query  143  VSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C  V SSL PCLSY+  GG  V   CC+ IKSL  AAKT
Sbjct  1    ITCGQVASSLAPCLSYLKVGG-AVPDGCCNDIKSLSGAAKT  40



>ref|XP_004516173.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cicer 
arietinum]
Length=118

 Score = 55.1 bits (131),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C++V  AP +EAAVSC ++ S+LVPC+SY+ KGG     +CC G+K + AAA T
Sbjct  12   LMCMVVVSAPMAEAAVSCGSITSALVPCISYL-KGGPGPSSSCCGGVKRVNAAAAT  66


 Score = 54.7 bits (130),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C+CLK+AA S+SG+    AA LP KCGV NIP++ S   +C+ I 
Sbjct  69   DRRAACNCLKNAAGSISGLKAGNAAALPSKCGV-NIPYKFSTSTNCNSIN  117



>gb|KHL91133.1| hypothetical protein QW71_36410 [Paenibacillus sp. IHB B 3415]
Length=115

 Score = 63.5 bits (153),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            +  ADR+  C CL+ A+ S++GIN + AA LPGKCGV N+P++ISP  DCSK+
Sbjct  63   KTSADRKQTCVCLQQASKSITGINPEAAASLPGKCGV-NVPYKISPSTDCSKV  114


 Score = 45.8 bits (107),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C++V +AP +EA V+C  V  +L  CL Y+ KGG    P CC+G++++ +AAKT
Sbjct  11   VLCMVVVVAPYAEA-VTCGQVQGNLAQCLGYLRKGGAVPGP-CCNGVRAMNSAAKT  64



>dbj|BAC77694.1| lipid transfer protein [Atriplex nummularia]
Length=117

 Score = 58.5 bits (140),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C CLKSAA +++ +N   AA LPGKCG+ ++P+ IS   DCSK+ 
Sbjct  68   ADRKAACGCLKSAAGAMTNLNMGNAASLPGKCGI-SLPYPISTSTDCSKVN  117


 Score = 50.4 bits (119),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            + +C+LVA AP +EA ++C  V SS+ PC+SY+T GG    PACC G+KSL + A T
Sbjct  13   VFMCMLVA-APHAEA-LTCGQVTSSMTPCMSYLTGGGSPT-PACCGGVKSLNSMAST  66



>sp|A0AT32.1|NLTP6_LENCU RecName: Full=Non-specific lipid-transfer protein 6; Short=LTP6; 
Flags: Precursor [Lens culinaris]
 gb|AAX35810.1| lipid transfer protein 6 precursor [Lens culinaris subsp. culinaris]
Length=118

 Score = 57.4 bits (137),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKSAA S++ +N   AA LPGKCGV +IP++IS   +C+ +K
Sbjct  69   DRQAACNCLKSAAGSITKLNTNNAAALPGKCGV-DIPYKISTSTNCNTVK  117


 Score = 52.0 bits (123),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query  119  LAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +AP +E A+SC  V S L PCL+Y+T GG    P CC G+K L AAA T
Sbjct  19   IAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAAANT  66



>gb|ACM78614.1| lipid transfer protein 2 [Tamarix hispida]
Length=116

 Score = 55.8 bits (133),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
             K + L+   ++  AP +EAA+SC TV S L PCL ++ +GG    PACCSGI++L + A
Sbjct  8    FKLACLVAAFMIVSAPHAEAAISCGTVVSKLAPCLGFL-RGGGSPPPACCSGIRNLQSMA  66

Query  260  KT  265
            ++
Sbjct  67   RS  68


 Score = 53.5 bits (127),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 4/50 (8%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSA++   G+N + AA LPGKCGV NI + IS  VDCS++K
Sbjct  71   DRQAACGCLKSASA---GVNMRNAAALPGKCGV-NIGYPISRSVDCSRVK  116



>ref|XP_008244911.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X1 [Prunus 
mume]
Length=132

 Score = 54.7 bits (130),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C +    P + AAVSC  V +SL PCLSYV+  G  + P+CC+G+KSLY+ A+T
Sbjct  16   VMCCMAVGVPKAMAAVSCGQVVNSLTPCLSYVSNNG-PLNPSCCTGVKSLYSMAQT  70


 Score = 54.3 bits (129),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSV--SGINFKYAAQLPGKCGVKNIPFQISPKVDC  408
            Q  ADR+S+C+CLK A + +  +  N   AA LPGKCGV NIP++ISP  DC
Sbjct  69   QTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGV-NIPYKISPSTDC  119



>ref|XP_010683514.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 59.3 bits (142),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C CLKSAA+++  +N+  AA LP +CGV +IP+ ISPK DCS++ 
Sbjct  71   DRRTACGCLKSAATAMKNMNYGKAAGLPKQCGV-SIPYAISPKTDCSRVN  119


 Score = 49.7 bits (117),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            L+FS  I   +V  AP +EAA++C  V S++ PCLSY+    K+    CC+GIK L   A
Sbjct  7    LQFSCAIFLCMVVAAPHAEAAMNCGMVASNVAPCLSYLMGSAKQPPSGCCAGIKKLKNMA  66

Query  260  KT  265
             T
Sbjct  67   ST  68



>sp|A0AT33.1|NLTP4_LENCU RecName: Full=Non-specific lipid-transfer protein 4; Short=LTP4; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
8; Short=LTP8; Flags: Precursor, partial [Lens culinaris]
 gb|AAX35811.1| lipid transfer protein 4 precursor, partial [Lens culinaris subsp. 
culinaris]
Length=110

 Score = 58.9 bits (141),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKSAA S++ +N   AA LPGKCGV NIP++IS   +C+ +K
Sbjct  61   DRQAACNCLKSAAGSITKLNTNNAAALPGKCGV-NIPYKISTSTNCNTVK  109


 Score = 50.1 bits (118),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query  119  LAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +AP +E A+SC  V S L PCL+Y+T GG    P CC G+K L AAA T
Sbjct  11   IAPMAEGAISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAAANT  58



>ref|XP_011095131.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=114

 Score = 63.5 bits (153),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            DRR+ C CL++AA S+  IN+  AA LP KCGVK IPFQISP  DCS++
Sbjct  66   DRRTACRCLQAAAKSMRNINYGNAAMLPAKCGVK-IPFQISPNTDCSRV  113


 Score = 45.1 bits (105),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 39/66 (59%), Gaps = 3/66 (5%)
 Frame = +2

Query  68   MTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSL  247
            M  K  F  +++C++   A  +EA VSC  V S L PCL ++   G+ +   CC G++S+
Sbjct  1    MGAKFGF-VMLLCVVALFATHAEAVVSCGQVQSGLSPCLGFLQ--GRALASQCCPGVRSV  57

Query  248  YAAAKT  265
             AAA+T
Sbjct  58   VAAART  63



>emb|CCJ09772.1| putative non-specific lipid transfer protein, partial [Hirudo 
medicinalis]
Length=82

 Score = 68.2 bits (165),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            ADRRS+C CLKS A S  GIN+  AA LPGKCGV NIP++I P  DCSK+
Sbjct  33   ADRRSICYCLKSLAGSFKGINYSKAAGLPGKCGV-NIPYKIDPSTDCSKV  81


 Score = 40.8 bits (94),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 23/32 (72%), Gaps = 1/32 (3%)
 Frame = +2

Query  170  LVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L PCL YV +GG  V P CC GIKSLY +AKT
Sbjct  1    LKPCLGYV-QGGNVVPPPCCGGIKSLYTSAKT  31



>gb|AAQ74627.1| lipid transfer protein I [Vigna radiata]
Length=117

 Score = 54.7 bits (130),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++VC+CLKS A  + G N   AA LPGKCGV +IP++IS   +C+ IK
Sbjct  68   DRQAVCNCLKSEAGRIGGFNANNAAILPGKCGV-SIPYKISTSTNCASIK  116


 Score = 53.9 bits (128),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++CL+VA AP + A ++C  V SSL  C+ ++TKGG  V P+CC+G+KSL AAAKT
Sbjct  12   LLCLVVATAPTAHA-ITCGQVASSLTSCIPFITKGGI-VPPSCCAGVKSLNAAAKT  65



>sp|A0AT30.1|NLTP3_LENCU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP3; 
Flags: Precursor [Lens culinaris]
 gb|AAX35808.1| lipid transfer protein 3 precursor [Lens culinaris]
Length=118

 Score = 55.8 bits (133),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLK+AA +++ +N   AA LPGKC V NIP++IS   +C+ IK
Sbjct  68   ADRQAACNCLKTAAGNINNLNPGNAAALPGKCNV-NIPYKISTTTNCNTIK  117


 Score = 53.1 bits (126),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C++V +AP +EAAVSC TV   L PC+ Y+T GG     +CC+G+K L AAA T
Sbjct  12   LVMCMVV-IAPMAEAAVSCGTVTGDLAPCIPYLT-GGAGPTDSCCAGVKKLLAAAPT  66



>gb|AAM22767.2| lipid transfer protein 2 precursor [Prunus persica]
Length=123

 Score = 55.8 bits (133),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVS--GINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q  ADR+S+C+CLK A + +     N   AA LPGKCGV NIP++ISP  DC  IK
Sbjct  69   QTTADRQSICNCLKQAVNGIPYPNANAGLAAGLPGKCGV-NIPYKISPSTDCKSIK  123


 Score = 52.8 bits (125),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C +    P + AAVSC  V ++L PC++YV  GG  + P+CC+G++SLY+ A+T
Sbjct  16   VMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGG-ALNPSCCTGVRSLYSLAQT  70



>ref|XP_010922736.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=120

 Score = 58.5 bits (140),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C C+K+AA+ +SG++   A  LPGKCGV +IP++IS   DCSKI 
Sbjct  72   DRRTACRCIKTAAAGLSGLDIGRARALPGKCGV-SIPYKISASTDCSKIN  120


 Score = 50.1 bits (118),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  92   TLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +L++ +++  +P    A++C  V+  L PC+ Y+  GG  V P CCSG++SL AAA+T
Sbjct  13   SLVLAMVLLASPRGTKAITCPQVYGDLNPCIQYLRSGG-AVAPQCCSGVRSLLAAART  69



>gb|ABA33849.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=119

 Score = 60.8 bits (146),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  70   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  119


 Score = 47.8 bits (112),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  24   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  68



>ref|XP_007134705.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
 gb|ESW06699.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
Length=125

 Score = 55.5 bits (132),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 7/59 (12%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINF-----KYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR+++CSC+K+A S+ SG N+       AA LP KCGV NIP+QISP  DC+ ++
Sbjct  69   QTKTDRQAICSCIKNAVSN-SGFNYSRSNLNNAANLPKKCGV-NIPYQISPNTDCNSVQ  125


 Score = 52.8 bits (125),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (62%), Gaps = 3/71 (4%)
 Frame = +2

Query  59   MNDMTPKLKFSTLIICLLVA--LAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCS  232
            M  M  ++ F   I+CL++    +P ++A ++C  V ++L PC+SYV  GG  V   CC+
Sbjct  1    MATMVTRVSF-LAIVCLVLGATTSPKAQAQMTCGQVVNNLSPCISYVMYGGVNVPAQCCN  59

Query  233  GIKSLYAAAKT  265
            GIK+LY  A+T
Sbjct  60   GIKNLYGQAQT  70



>ref|XP_006429571.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
 ref|XP_006481184.1| PREDICTED: non-specific lipid-transfer protein 3-like [Citrus 
sinensis]
 gb|ESR42811.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
Length=125

 Score = 59.7 bits (143),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 3/53 (6%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKY--AAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++VC+CLK A S +S   ++   AA LPGKCG+ NIP+QISP  DCS+++
Sbjct  74   ADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGL-NIPYQISPSTDCSRVQ  125


 Score = 48.9 bits (115),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +++CL+ +    ++A V+C TV + L PC+SYV+ GG  V   CC+G+++LY AA++
Sbjct  17   VLVCLMGSAFVSTKAQVTCRTVVNDLSPCISYVSYGG-AVTTNCCNGVRTLYNAARS  72



>gb|ABA33846.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 60.8 bits (146),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  71   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  120


 Score = 47.8 bits (112),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG+KSL  AA+T
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAART  69



>emb|CBI18043.3| unnamed protein product [Vitis vinifera]
Length=139

 Score = 63.5 bits (153),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C CL +A+ S+SG+NF  AA LPGKCGV NIP++ISP  +C ++ 
Sbjct  91   DRRTACKCLINASKSISGVNFGLAAGLPGKCGV-NIPYKISPSTNCDQVN  139


 Score = 44.7 bits (104),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            +++C+LVA +P +   +SC  V + L PC++Y+   G  + PACC+G+K+L  +A T Q
Sbjct  34   VLMCMLVA-SPMAVEGLSCGDVATQLAPCINYLRSAG-PLPPACCNGVKNLKNSAATTQ  90



>gb|ABA33858.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=116

 Score = 60.5 bits (145),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  67   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  116


 Score = 47.4 bits (111),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  21   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  65



>ref|XP_002276372.1| PREDICTED: non-specific lipid-transfer protein 1 [Vitis vinifera]
 emb|CBI15816.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 57.8 bits (138),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            + G DRR+ CSC++  A+ + GI++   A LP +CGV ++P++ISP  DCS+I 
Sbjct  67   KTGEDRRTACSCIQDGAAMIPGIDYNLVASLPSQCGV-SLPYKISPSTDCSRIN  119


 Score = 50.4 bits (119),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +2

Query  62   NDMTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIK  241
            N    KL  + +++CLLV  AP ++A V+C+ V   L PC++Y+  GG  +  +CC+G+K
Sbjct  3    NSTVLKLACTVVLVCLLVT-APQADATVTCSQVTQLLNPCVNYLIYGG-AIPSSCCAGVK  60

Query  242  SLYAAAKTGQ  271
             + AA+KTG+
Sbjct  61   QVKAASKTGE  70



>gb|ABA33866.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=114

 Score = 60.5 bits (145),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  65   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  114


 Score = 47.4 bits (111),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  19   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  63



>gb|AFR43294.1| lipid transfer protein precursor [Gossypium raimondii]
Length=120

 Score = 57.0 bits (136),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C C+KS A+ +S IN+  AA LPG+C V +IP++ISP +DC ++K
Sbjct  72   DRQAACKCIKSLAADISDINYGVAAGLPGQCNV-HIPYKISPSIDCKRVK  120


 Score = 50.8 bits (120),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVT-KGGKKVQPACCSGIKSLYAA  256
            LK S +++  L+  AP ++ A+SC+ V SSL+PC+ YV     +   P CC GI+SL +A
Sbjct  7    LKLSCVVVLCLLVDAPLAQGAISCDQVKSSLLPCVGYVRGNNARPAPPNCCKGIRSLKSA  66

Query  257  AK  262
            A+
Sbjct  67   AR  68



>gb|ABA33847.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 60.8 bits (146),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  71   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  120


 Score = 47.0 bits (110),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  69



>ref|NP_001105311.1| non-specific lipid-transfer protein precursor [Zea mays]
 sp|P19656.1|NLTP_MAIZE RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Allergen=Zea m 14; Flags: Precursor [Zea mays]
 gb|AAA33493.1| phospholipid transfer protein precursor [Zea mays]
 gb|ABA33851.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
 gb|ABA33852.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 60.8 bits (146),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  71   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  120


 Score = 47.0 bits (110),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  69



>gb|ABA33857.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 60.8 bits (146),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  71   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  120


 Score = 47.0 bits (110),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSAPSAGCCSGVRSLNNAART  69



>gb|ABA33848.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=110

 Score = 60.5 bits (145),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  61   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  110


 Score = 47.4 bits (111),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG+KSL  AA+T
Sbjct  15   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAART  59



>gb|EYU42011.1| hypothetical protein MIMGU_mgv1a016819mg [Erythranthe guttata]
Length=105

 Score = 62.4 bits (150),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            DRR+ C CL+SAA +  GINF   A LP KCGV+ +PF+ISP  DCS++
Sbjct  57   DRRTACQCLQSAAKTFKGINFGNVAALPAKCGVR-LPFKISPTTDCSRV  104


 Score = 45.4 bits (106),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 34/48 (71%), Gaps = 2/48 (4%)
 Frame = +2

Query  122  APCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AP +EAA++CN + S L PCL ++   G+ + P CC+G++S+  AA++
Sbjct  9    APQAEAAITCNQLQSGLAPCLGFLQ--GRALVPQCCAGVRSMANAARS  54



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein-like isoform 1 
[Fragaria vesca subsp. vesca]
 ref|XP_004302609.1| PREDICTED: non-specific lipid-transfer protein-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=116

 Score = 62.0 bits (149),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADR+  C+CLKSAA S+ G+N   AA LPGKCGV N+P++IS   +C+ +K
Sbjct  64   KTTADRKQTCNCLKSAAGSIKGLNANLAAGLPGKCGV-NVPYKISTSTNCNNVK  116


 Score = 45.8 bits (107),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +IC++VA+ P ++A ++C  V  ++ PC +YV  GG  V  ACC+GI+SL +AAKT
Sbjct  13   LICIVVAV-PVAQA-ITCGQVTQNVAPCFNYVKSGGA-VPAACCNGIRSLNSAAKT  65



>gb|ABA33850.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 60.8 bits (146),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  71   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  120


 Score = 47.0 bits (110),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  69



>gb|ABA33862.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33863.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=111

 Score = 60.5 bits (145),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  62   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  111


 Score = 47.4 bits (111),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG+KSL  AA+T
Sbjct  16   SEAAISCGQVASAIAPCISYARGQGSAPSAGCCSGVKSLNNAART  60



>ref|XP_002323667.1| putative lipid transfer family protein [Populus trichocarpa]
 gb|ABK95728.1| unknown [Populus trichocarpa]
 gb|EEF05428.1| putative lipid transfer family protein [Populus trichocarpa]
Length=120

 Score = 53.9 bits (128),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            L    L++C++V  A  ++AA+SCN V ++L PC+SYV  G   +   CC+GI+ L +AA
Sbjct  7    LHLVCLVVCIMVMTASTTKAAISCNQVINTLTPCISYVV-GNGALTDNCCNGIRGLNSAA  65

Query  260  KT  265
            +T
Sbjct  66   RT  67


 Score = 53.5 bits (127),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +1

Query  271  DRRSVCSCLKSAAS--SVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+SVC+CLK+ AS  S +  N   AA LPGKCGVK +P++I P  DC  +K
Sbjct  70   DRQSVCTCLKNTASQFSYNSRNVALAAGLPGKCGVK-LPYKIDPSTDCKSVK  120



>gb|ABA33853.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=109

 Score = 60.8 bits (146),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  60   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  109


 Score = 47.0 bits (110),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  14   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  58



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 62.8 bits (151),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+ A S+SG+N   AA +P KCGV  IP+ ISP +DCS + 
Sbjct  68   ADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVS-IPYTISPSIDCSSVN  117


 Score = 44.7 bits (104),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = +2

Query  137  AAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AA+SC  V S++ PCLSY  +GG     ACCSG++SL +AA T
Sbjct  25   AAISCGQVNSAVSPCLSYA-RGGSGPSAACCSGVRSLNSAATT  66



>gb|AFI61838.1| harmalin [Peganum harmala]
Length=115

 Score = 55.1 bits (131),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+  C CL++AA S+ G+N   A  LPGKCGV NIP++IS   +CS +K
Sbjct  67   DRQEACRCLQNAARSMGGLNEANAGSLPGKCGV-NIPYKISTSTNCSTVK  115


 Score = 52.4 bits (124),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L+ C+LVA AP +EAA++C TV S+L PC+ Y+  GG     ACC+G+++L  AA+T
Sbjct  10   LVACMLVA-APLTEAAIACGTVVSALSPCIGYLRAGGSPPL-ACCNGVRALNNAART  64



>ref|XP_002270970.1| PREDICTED: non-specific lipid-transfer protein P5 [Vitis vinifera]
Length=118

 Score = 63.5 bits (153),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C CL +A+ S+SG+NF  AA LPGKCGV NIP++ISP  +C ++ 
Sbjct  70   DRRTACKCLINASKSISGVNFGLAAGLPGKCGV-NIPYKISPSTNCDQVN  118


 Score = 43.9 bits (102),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            +++C+LVA +P +   +SC  V + L PC++Y+   G  + PACC+G+K+L  +A T Q
Sbjct  13   VLMCMLVA-SPMAVEGLSCGDVATQLAPCINYLRSAG-PLPPACCNGVKNLKNSAATTQ  69



>ref|XP_007033544.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
 gb|EOY04470.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
Length=122

 Score = 56.2 bits (134),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAAS--SVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q  ADR++VC C+KSA +  S S  N   AA LPGKCG+ ++P+ ISP  DC+K++
Sbjct  68   QTSADRQNVCKCIKSAVNGFSYSNFNLGLAAGLPGKCGL-HLPYTISPSTDCNKVQ  122


 Score = 51.2 bits (121),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +2

Query  77   KLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            KL    L++C++V+    + AAV+C  V  +L PC+SYV  GG  +   CC+G+K+LY  
Sbjct  8    KLASLMLVVCMVVSATLQARAAVTCGDVVRTLTPCISYVQYGG-PLPDNCCNGVKTLYGE  66

Query  257  AKT  265
            A+T
Sbjct  67   AQT  69



>gb|AFK37572.1| unknown [Medicago truncatula]
 gb|AES87490.2| Lipid transfer protein [Medicago truncatula]
Length=126

 Score = 57.8 bits (138),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 5/57 (9%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAAS----SVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            Q   DRR+VC+C+K+A S    S + +N   AA LP KCGV NIP+QISP  DC+ +
Sbjct  70   QTTNDRRAVCTCIKNAVSQSGFSYTNLNLNLAAGLPRKCGV-NIPYQISPNTDCNSV  125


 Score = 49.7 bits (117),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 6/66 (9%)
 Frame = +2

Query  86   FSTLIICL----LVALAPCSEAAV-SCNTVFSSLVPCLSYVTKGGKKVQPA-CCSGIKSL  247
             +T ++CL    LV   P +EAAV SC  V +SL PC+SY+  GG  V  A CC+GI++L
Sbjct  6    MATRLVCLAIVCLVTFGPKAEAAVTSCGPVVTSLYPCVSYIMNGGNTVPAAQCCNGIRNL  65

Query  248  YAAAKT  265
               A+T
Sbjct  66   NTMAQT  71



>gb|ABY54820.1| lipid transfer protein [Arachis diogoi]
Length=116

 Score = 57.8 bits (138),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +1

Query  247  LRRCQDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            L   +  ADR++ C+CLK+AA SV G+N   AA LPG+CGV +IP++IS   +C+ IK
Sbjct  59   LGAAKTTADRQAACNCLKAAAGSVHGLNQGNAAALPGRCGV-SIPYKISTSTNCATIK  115


 Score = 49.7 bits (117),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +2

Query  80   LKFS-TLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            LKF+  +++C+ +  AP   A +SC  V S+L PC++++TKGG    P CCSG++ L  A
Sbjct  4    LKFAFVMLVCMAMVGAPMVNA-LSCGQVNSALAPCITFLTKGGAP-SPPCCSGVRGLLGA  61

Query  257  AKT  265
            AKT
Sbjct  62   AKT  64



>ref|XP_003605293.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=121

 Score = 57.8 bits (138),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 5/57 (9%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAAS----SVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            Q   DRR+VC+C+K+A S    S + +N   AA LP KCGV NIP+QISP  DC+ +
Sbjct  65   QTTNDRRAVCTCIKNAVSQSGFSYTNLNLNLAAGLPRKCGV-NIPYQISPNTDCNSV  120


 Score = 49.7 bits (117),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 6/66 (9%)
 Frame = +2

Query  86   FSTLIICL----LVALAPCSEAAV-SCNTVFSSLVPCLSYVTKGGKKVQPA-CCSGIKSL  247
             +T ++CL    LV   P +EAAV SC  V +SL PC+SY+  GG  V  A CC+GI++L
Sbjct  1    MATRLVCLAIVCLVTFGPKAEAAVTSCGPVVTSLYPCVSYIMNGGNTVPAAQCCNGIRNL  60

Query  248  YAAAKT  265
               A+T
Sbjct  61   NTMAQT  66



>gb|ABA33860.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=109

 Score = 60.5 bits (145),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  60   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  109


 Score = 47.0 bits (110),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  14   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  58



>gb|AFK36168.1| unknown [Lotus japonicus]
Length=115

 Score = 58.2 bits (139),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLKSAA S    N   AA LPGKCGV NIP++IS   +C+ IK
Sbjct  66   ADRRAACNCLKSAAGSFPRFNAGNAASLPGKCGV-NIPYKISTSTNCANIK  115


 Score = 48.9 bits (115),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            +KF   ++ L + +AP +EAA++C  + S+L+PC +Y+ +GG    P CC+G++ + +AA
Sbjct  4    VKFVCALVVLSMVVAPMAEAAITCGAIASALIPCTAYI-QGGAGPSPPCCAGVRRVNSAA  62

Query  260  KT  265
             +
Sbjct  63   SS  64



>gb|AAA74624.1| lipid transfer protein precursor [Oryza sativa]
Length=118

 Score = 62.8 bits (151),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+ A S+SG+N   AA +P KCGV  IP+ ISP +DCS + 
Sbjct  69   ADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVT-IPYTISPSIDCSSVN  118


 Score = 44.3 bits (103),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = +2

Query  137  AAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AA+SC  V S++ PCLSY  +GG     ACCSG++SL +AA T
Sbjct  26   AAISCGQVNSAVSPCLSYA-RGGSGPSAACCSGVRSLNSAAST  67



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score = 62.8 bits (151),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+ A S+SG+N   AA +P KCGV  IP+ ISP +DCS + 
Sbjct  69   ADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVS-IPYTISPSIDCSSVN  118


 Score = 44.3 bits (103),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = +2

Query  137  AAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AA+SC  V S++ PCLSY  +GG     ACCSG++SL +AA T
Sbjct  26   AAISCGQVNSAVSPCLSYA-RGGSGPSAACCSGVRSLNSAAST  67



>gb|ABA33867.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=118

 Score = 59.3 bits (142),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ CSCLK+AA+ VSG+N   AA +P KC V +IP+ IS   DCS++ 
Sbjct  69   ADRRAACSCLKNAAAGVSGLNAGNAASIPSKCSV-SIPYTISTSTDCSRVN  118


 Score = 47.8 bits (112),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  23   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  67



>gb|ACU24604.1| unknown [Glycine max]
Length=130

 Score = 54.7 bits (130),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 5/58 (9%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAA----SSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++VC+C+K+A      + S  NF  AA LP  CGV NIP+QISP  DC++++
Sbjct  74   QTKPDRQAVCNCIKNAVRNSGFTYSHFNFNLAANLPKNCGV-NIPYQISPDTDCTRVQ  130


 Score = 52.0 bits (123),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  119  LAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            + P ++  VSC  V S+L PC+SYV  GG  V   CC+GI++LY  A+T
Sbjct  27   IIPMAQGEVSCGQVVSNLTPCISYVLYGGATVPAQCCNGIRNLYGMAQT  75



>ref|XP_004506487.1| PREDICTED: non-specific lipid-transfer protein 3-like [Cicer 
arietinum]
Length=124

 Score = 57.4 bits (137),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 5/57 (9%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASS----VSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            Q   DRR+VCSC+K+A SS     S  N   AA LP +CGV NIP+QISP  DC+ +
Sbjct  68   QTTPDRRAVCSCIKNAVSSSGFTYSNTNLNLAASLPRRCGV-NIPYQISPNTDCNSV  123


 Score = 49.7 bits (117),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            I+CL V   P +E AV+C  V ++L  C+SY+  GG  V   CC+G+++L A A+T
Sbjct  15   ILCL-VTFGPKAEGAVTCGQVVNNLTSCVSYIMYGGNTVPAQCCNGVRNLNAMAQT  69



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 56.6 bits (135),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLK AA S+  +N   AA LPG CGV +IP++IS   DCSK++
Sbjct  67   DRQTACNCLKQAAGSIPNLNLNNAAGLPGACGV-SIPYKISTSTDCSKVR  115


 Score = 50.1 bits (118),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = +2

Query  89   STLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            S L++C+LV   P S  A++C  V  SL PC+ ++  GG    P CC+G++SL AAA+T
Sbjct  8    SALVLCMLVT-GPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAART  64



>ref|XP_002442776.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
 gb|EES16614.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
Length=119

 Score = 58.5 bits (140),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA  +SG+N   AA +P KCGV  +P+ IS   DCS++ 
Sbjct  70   ADRRAACNCLKNAARGISGLNAGNAASIPSKCGVS-VPYTISTSTDCSRVN  119


 Score = 48.5 bits (114),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PCLSY    G      CCSG++SL +AA+T
Sbjct  24   SEAAISCGQVSSAIAPCLSYARGQGSAPSAGCCSGVRSLNSAART  68



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 62.8 bits (151),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+ A S+SG+N   AA +P KCGV  IP+ ISP +DCS + 
Sbjct  61   ADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVS-IPYTISPSIDCSSVN  110


 Score = 43.9 bits (102),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = +2

Query  137  AAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AA+SC  V S++ PCLSY  +GG     ACCSG++SL +AA T
Sbjct  18   AAISCGQVNSAVSPCLSYA-RGGSGPSAACCSGVRSLNSAATT  59



>gb|KHN40624.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=408

 Score = 58.2 bits (139),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 3/57 (5%)
 Frame = +2

Query  98   IICLL---VALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            I+CL+   +++ P ++AAV+CN V S+L PC+SYV  GGK V   CC+GIK+L+  A
Sbjct  14   IVCLVLGVISITPKAQAAVTCNQVVSNLTPCISYVLNGGKAVPGPCCNGIKTLFNLA  70


 Score = 48.5 bits (114),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVS--GINFKYAAQLPGKCGVKNIPFQISPKVDCS  411
            DR++VC C+K+A S+      N   AA LP +CGV NIP+QISP  DC+
Sbjct  75   DRQTVCKCIKNAVSAFHYGKSNVDRAAALPKQCGV-NIPYQISPSTDCT  122



>ref|XP_009770883.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=121

 Score = 53.9 bits (128),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 6/71 (8%)
 Frame = +2

Query  68   MTPKLKFSTLIICLLVALAPCS-----EAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCS  232
            M  K  F  L IC++      +     +  V+CNTV+ SL PCL YV  GG  V P CCS
Sbjct  1    MLNKQLFPFLFICIVATATNTAAATAADETVTCNTVYDSLEPCLGYVL-GGASVPPECCS  59

Query  233  GIKSLYAAAKT  265
            G+KSL  AA+T
Sbjct  60   GLKSLLGAART  70


 Score = 53.1 bits (126),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
             DR+S C C+KS ASS +G     AA +PG C  K +PF+IS  VDCSKIK
Sbjct  72   TDRQSACQCVKSVASSATGDQISRAASIPGICKAK-LPFKISANVDCSKIK  121



>gb|AHB19226.1| non specific lipid transfer protein 1B [Punica granatum]
Length=120

 Score = 60.8 bits (146),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLK  A S++GIN+     LPGKCGV +IP++ISP  DCS++K
Sbjct  72   DRQTACNCLKVIARSITGINYGRVGALPGKCGV-SIPYKISPSTDCSRVK  120


 Score = 45.8 bits (107),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 6/73 (8%)
 Frame = +2

Query  47   THSHMNDMTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPAC  226
            +   +N++ P      L +C++VA A   E+AV+C  V SSL PC+ Y          AC
Sbjct  3    SKRFLNNLVP-----ALFLCMVVA-ASVVESAVTCGQVTSSLTPCIPYARGVVAAPSAAC  56

Query  227  CSGIKSLYAAAKT  265
            CSG++SL  AAKT
Sbjct  57   CSGVRSLNNAAKT  69



>gb|AGH32496.1| non-specific lipid transfer protein [Papaver somniferum]
Length=117

 Score = 60.1 bits (144),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q  +DR++VC CLK+AA S++ I    AA LPGKCGV +IP+  S  +DCSK+ 
Sbjct  65   QTTSDRQTVCGCLKNAAKSMTNIKMSNAASLPGKCGV-SIPYTFSTSIDCSKVN  117


 Score = 46.6 bits (109),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +2

Query  68   MTPKLKFSTLIICLLVALAP-CSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKS  244
            M    K + +++  +V + P  +E A+SC TV S L PC+ Y+T G   +   CC+G+KS
Sbjct  1    MATLFKLACVVLACMVVIVPFVAEGAISCGTVVSKLSPCVGYLT-GLGSLPANCCTGVKS  59

Query  245  LYAAAKT  265
            LY AA+T
Sbjct  60   LYQAAQT  66



>ref|XP_006663743.1| PREDICTED: non-specific lipid-transfer protein 2B-like isoform 
X1 [Oryza brachyantha]
Length=117

 Score = 62.4 bits (150),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA S+SG+N   AA +P KCGV +IP+ IS  +DCS++ 
Sbjct  68   ADRRTACNCLKNAAGSISGLNAGNAASIPSKCGV-SIPYTISTSIDCSRVS  117


 Score = 44.3 bits (103),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = +2

Query  137  AAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AA+SC  V S++ PCLSY  +GG     ACCSG++SL +AA T
Sbjct  25   AAISCGQVNSAVGPCLSYA-RGGAGPSSACCSGVRSLSSAAST  66



>ref|XP_006662671.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Oryza 
brachyantha]
Length=117

 Score = 62.4 bits (150),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA S+SG+N   AA +P KCGV +IP+ IS  +DCS++ 
Sbjct  68   ADRRTACNCLKNAAGSISGLNAGNAASIPSKCGV-SIPYTISTSIDCSRVS  117


 Score = 44.3 bits (103),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = +2

Query  137  AAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AA+SC  V S++ PCLSY  +GG     ACCSG++SL +AA T
Sbjct  25   AAISCGQVNSAVGPCLSYA-RGGAGPSSACCSGVRSLSSAAST  66



>ref|XP_006842467.1| hypothetical protein AMTR_s00077p00070120 [Amborella trichopoda]
 gb|ERN04142.1| hypothetical protein AMTR_s00077p00070120 [Amborella trichopoda]
Length=130

 Score = 53.9 bits (128),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++ +LVA+    + AVSC TV SSL+PC++Y+T GG  V P CC+G++S+   A+T
Sbjct  9    LVAVLVAMVFVVDGAVSCGTVDSSLIPCINYLTSGG-TVPPPCCNGVRSVNGMAQT  63


 Score = 52.4 bits (124),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            Q   D+++VC CLK A ++++GIN      LPG CGV +IPF IS   DC+K
Sbjct  62   QTTPDKQAVCGCLKQATTTINGINNNRLQSLPGDCGV-DIPFTISVSTDCTK  112



>ref|XP_007134701.1| hypothetical protein PHAVU_010G069100g [Phaseolus vulgaris]
 gb|ADC80503.1| non-specific lipid transfer protein 1b precursor [Phaseolus vulgaris]
 gb|ESW06695.1| hypothetical protein PHAVU_010G069100g [Phaseolus vulgaris]
Length=118

 Score = 56.6 bits (135),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++VC+CLKSAA ++ G N   A  LPGKCGV +IP++IS   +C+ IK
Sbjct  69   DRQAVCNCLKSAAGAIPGFNANNAGILPGKCGV-SIPYKISTSTNCATIK  117


 Score = 49.7 bits (117),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  122  APCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AP + AA+SC  V SSL  C+ ++TKGG  V  +CCSG++SL AAAKT
Sbjct  20   APTAHAAISCGQVTSSLASCIPFLTKGG-PVPASCCSGVRSLNAAAKT  66



>gb|AFR43291.1| lipid transfer protein precursor [Gossypium raimondii]
Length=120

 Score = 54.3 bits (129),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   +R+S C+C+K+ A+S+SGIN+    +LPG CG  + PF+ISP  +C  +K
Sbjct  68   QSTPERQSACNCVKALAASISGINYDLTNKLPGMCGAYS-PFKISPSTNCKSVK  120


 Score = 52.0 bits (123),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  71   TPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPA-CCSGIKSL  247
            T  LK +  ++  LV  AP +E A+SC  V S+L PC+ YV   G    PA CC+GI+SL
Sbjct  4    TVALKLACGVVLCLVVGAPLAEGAISCGQVISALAPCIPYVRNNGAGGVPAPCCNGIRSL  63

Query  248  YAAAKT  265
             AAA++
Sbjct  64   NAAAQS  69



>gb|ABQ53932.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 59.7 bits (143),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q  ADR+SVC CLK  A+S +G++   AA LP +CG+ NIP++I P  DCSK++
Sbjct  66   QTTADRQSVCDCLKDLAASTTGVDLGKAAGLPSQCGL-NIPYKIIPSTDCSKVQ  118


 Score = 46.6 bits (109),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 3/66 (5%)
 Frame = +2

Query  71   TPKLKFSTLI-ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSL  247
            T K  F  LI +  ++++ P  EAA+ C TV S L  C  YVT  G      CC GIK L
Sbjct  4    TIKPMFVVLIAVVSIMSVVPEGEAAIGCGTVVSYLNSCFPYVT--GTGALGGCCKGIKDL  61

Query  248  YAAAKT  265
            YAAA+T
Sbjct  62   YAAAQT  67



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 55.1 bits (131),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLKSAA  + G+    AA LPGKCGV ++PF IS  V+C+ + 
Sbjct  69   ADRRTACNCLKSAAGRIPGLKPGLAAGLPGKCGV-SVPFPISTSVNCNTVT  118


 Score = 51.2 bits (121),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +2

Query  86   FSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            F+ +I+C+ V + P +EA ++C  V  ++ PC++YV  GG  V P+CC GI+ L  AAKT
Sbjct  10   FALVILCMAVLVVPHAEA-ITCGQVSGAVAPCINYVRSGG-VVPPSCCGGIRGLVGAAKT  67



>gb|KHG09723.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 53.9 bits (128),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   +R+S C+C+K+ A+S+SGIN+    +LP  CGV + PF+ISP  +C  +K
Sbjct  68   QSTPERQSACNCVKALAASISGINYDLTNKLPSMCGVHS-PFKISPSTNCKSVK  120


 Score = 52.4 bits (124),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  71   TPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPA-CCSGIKSL  247
            T  LK +  ++  LV  AP +E A+SC  V S+L PC+ YV   G    PA CC+GI+SL
Sbjct  4    TMALKLACGVVLCLVVGAPLAEGAISCGQVISALAPCIPYVRNNGAGGVPAPCCNGIRSL  63

Query  248  YAAAKT  265
             AAA++
Sbjct  64   NAAAQS  69



>ref|XP_009135090.1| PREDICTED: non-specific lipid-transfer protein 6-like [Brassica 
rapa]
Length=115

 Score = 54.3 bits (129),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSA--ASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            Q  ADR+SVC C+K+A   +S S  N K A  LP KCGV N+PF ISP  +C+ I
Sbjct  61   QTTADRQSVCRCIKNAIGGASYSSSNLKNALSLPAKCGV-NLPFSISPSTNCNSI  114


 Score = 52.0 bits (123),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  134  EAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            EAAV+CN V   L PCLSYV +GG      CCSG+++L + A+T
Sbjct  19   EAAVTCNNVVGDLYPCLSYVMQGGNSPSTNCCSGVRTLNSQAQT  62



>gb|AHG99490.1| lipid-transfer protein [Citrus suavissima]
Length=115

 Score = 56.2 bits (134),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLK AA S+  +N   AA LPG CGV +IP++IS   DCSK++
Sbjct  67   DRQTACNCLKQAARSIPSLNLNNAAGLPGACGV-SIPYKISTSTDCSKVR  115


 Score = 50.1 bits (118),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = +2

Query  89   STLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            S L++C+LV   P S  A++C  V  SL PC+ ++  GG    P CC+G++SL AAA+T
Sbjct  8    SALVLCMLVT-GPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAART  64



>emb|CAN70512.1| hypothetical protein VITISV_005630 [Vitis vinifera]
Length=115

 Score = 62.0 bits (149),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDC  408
            DRR+ C CL +A+ S+SG+NF  AA LPGKCGV NIP++ISP  +C
Sbjct  70   DRRTACKCLINASKSISGVNFGLAAGLPGKCGV-NIPYKISPSTNC  114


 Score = 43.9 bits (102),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            +++C+LVA +P +   +SC  V + L PC++Y+   G  + PACC+G+K+L  +A T Q
Sbjct  13   VLMCMLVA-SPMAVEGLSCGDVATQLAPCINYLRSAG-PLPPACCNGVKNLKNSAATTQ  69



>gb|AAT80649.1| lipid transfer protein precursor [Malus domestica]
 gb|ABB96482.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 60.1 bits (144),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLK+ A S+SG+N   AA LPGKCGV N+P++IS   +C+ +K
Sbjct  66   ADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV-NVPYKISTSTNCATVK  115


 Score = 45.8 bits (107),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C  V SSL PC+ YV  GG  V PACC+GI+++ + A+T
Sbjct  15   LCMAVSVA----HAITCGQVTSSLAPCIGYVRNGG-AVPPACCNGIRTINSLART  64



>ref|XP_010035997.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW47517.1| hypothetical protein EUGRSUZ_K01282 [Eucalyptus grandis]
Length=118

 Score = 63.2 bits (152),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C CL+SAA S+ GI+F  AA LPGKCGV ++P++ISP  DC  +K
Sbjct  69   ADRQAACRCLQSAAGSIQGIDFNLAAGLPGKCGV-SVPYKISPTTDCKSVK  118


 Score = 42.7 bits (99),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +2

Query  59   MNDMTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGI  238
            M D++ K+    LI CL+ A +P + AA++C+ + SS+ PC+ Y+ +G   +  ACCSG+
Sbjct  1    MADLS-KVSCFLLIACLVAASSPAARAAITCSQISSSMGPCIGYL-RGSGPLSSACCSGV  58

Query  239  KSLYAAAKT  265
            KSL  AA+T
Sbjct  59   KSLNTAART  67



>gb|ABA33859.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33861.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33864.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33865.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=118

 Score = 58.2 bits (139),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KC V  IP+ IS   DCS++ 
Sbjct  69   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCSVS-IPYTISTSTDCSRVN  118


 Score = 47.8 bits (112),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  23   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  67



>gb|ABB96481.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 60.5 bits (145),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLK+ A S+SG+N   AA LPGKCGV N+P++IS   +C+ +K
Sbjct  66   ADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV-NVPYKISTSTNCATVK  115


 Score = 45.4 bits (106),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C  V SSL PC+ YV  GG  V PACC+GI+++   A+T
Sbjct  15   LCMAVSVA----HAITCGQVTSSLAPCIGYVRSGG-AVPPACCNGIRTINGLART  64



>emb|CDP15101.1| unnamed protein product [Coffea canephora]
 emb|CDP12375.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 55.5 bits (132),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
             DR+S CSCLKS A S +    K AAQ+P  CGV N+PF+IS  VDCSK
Sbjct  77   TDRQSACSCLKSVAESATDDQLKNAAQIPHSCGV-NLPFKISRDVDCSK  124


 Score = 50.1 bits (118),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            L F   +  L+++     +A +SC+TV + L PC+ ++  GG KV PACCSG+ +L + A
Sbjct  15   LVFVLFVSMLIMSFFRSGQAQISCDTVKNDLSPCIGFIMNGG-KVPPACCSGLNTLLSLA  73

Query  260  KT  265
            KT
Sbjct  74   KT  75



>ref|WP_039311159.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
Length=102

 Score = 63.9 bits (154),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            +  ADR+  C CL+ A+ S++GIN + AA LPGKCGV N+P++ISP  DCSK+
Sbjct  50   KTSADRKQTCVCLQQASKSITGINPEAAASLPGKCGV-NVPYKISPSTDCSKV  101


 Score = 41.6 bits (96),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +2

Query  107  LLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++V +AP +EA V+C  V  +L  CL Y+ KGG    P CC+G++++ +AAKT
Sbjct  1    MVVVVAPYAEA-VTCGQVQGNLAQCLGYLRKGGAVPGP-CCNGVRAMNSAAKT  51



>ref|XP_009372010.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 52.8 bits (125),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = +2

Query  80   LKFSTLIICL--LVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYA  253
            LK + L++ +  +VA  P ++AA++C  V S L PC+SYV  GG  + PACC+G+++L+ 
Sbjct  8    LKLACLVVVMFCMVACVPKADAAMTCGQVVSDLTPCISYVRAGG-ALAPACCNGVRTLFT  66

Query  254  AAKT  265
             A+T
Sbjct  67   LAQT  70


 Score = 52.8 bits (125),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSV--SGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR+SVC+CLK A + +  +  N   AA LP KCGV NIP++ISP  DC  +K
Sbjct  69   QTTPDRQSVCNCLKQAINGIPYTNTNAGLAAGLPAKCGV-NIPYKISPSTDCKSVK  123



>ref|XP_003605345.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES87542.1| Lipid transfer protein [Medicago truncatula]
Length=117

 Score = 53.1 bits (126),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
              G  R++ C+CLKSAA +++ +N   AA LPGKCGVK IP++ S   +C+ I+
Sbjct  64   NTGPARKAACNCLKSAAGTIARLNNNQAAALPGKCGVK-IPYKFSTSTNCNSIR  116


 Score = 52.4 bits (124),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTG  268
            I+C++VA AP +EAA +C  +  SL+PC++Y+ +GG     ACC G+K L AAA TG
Sbjct  12   IMCMVVASAPIAEAA-TCGQLIDSLIPCITYL-QGGPGPSAACCGGVKKLNAAANTG  66



>ref|NP_001281295.1| non-specific lipid-transfer protein precursor [Malus domestica]
 sp|Q9M5X7.1|NLTP_MALDO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Mal d 3; Flags: Precursor [Malus domestica]
 gb|AAF26450.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80633.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80634.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80635.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80636.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80637.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80638.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80639.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80640.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80641.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80642.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80643.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80644.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80645.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80646.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80647.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80648.1| lipid transfer protein precursor [Malus domestica]
 gb|AAV64878.1| major allergen and lipid transfer protein Mal d 3 [Malus domestica]
Length=115

 Score = 60.1 bits (144),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLK+ A S+SG+N   AA LPGKCGV N+P++IS   +C+ +K
Sbjct  66   ADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV-NVPYKISTSTNCATVK  115


 Score = 45.1 bits (105),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C  V SSL PC+ YV  GG  V PACC+GI+++   A+T
Sbjct  15   LCMAVSVA----HAITCGQVTSSLAPCIGYVRSGG-AVPPACCNGIRTINGLART  64



>gb|AAB70539.1| lipid transfer protein LPT II [Oryza sativa Indica Group]
Length=118

 Score = 62.8 bits (151),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+ A S+SG+N   AA +P KCGV  IP+ ISP +DCS + 
Sbjct  69   ADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVS-IPYTISPSIDCSSVN  118


 Score = 42.4 bits (98),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = +2

Query  137  AAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AA+SC  V S++ PCLSY  +GG     ACCSG+++L +AA T
Sbjct  26   AAISCGQVNSAVSPCLSY-PRGGSGPSAACCSGVRNLNSAAST  67



>gb|ABX56711.1| LTP isoallergen 1 precursor [Arachis hypogaea]
Length=116

 Score = 56.2 bits (134),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLK+AA S+ G+N   AA LPG+CGV +IP++IS   +C+ IK
Sbjct  66   ADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGV-SIPYKISTSTNCATIK  115


 Score = 49.3 bits (116),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +2

Query  80   LKFS-TLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            LKF+  +++C+ +  AP   A +SC  V S+L PC+ ++TKGG    PACCSG++ L  A
Sbjct  4    LKFAFVMLVCMAMVGAPMVNA-ISCGQVNSALAPCIPFLTKGGAP-PPACCSGVRGLLGA  61

Query  257  AKT  265
             +T
Sbjct  62   LRT  64



>gb|KHG09722.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 54.3 bits (129),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   +R+S C+C+K+ A+S+SGIN+    +LP  CGV + PF+ISP  +C  +K
Sbjct  68   QSTPERQSACNCVKALAASISGINYDLTNKLPSMCGVHS-PFKISPSTNCKSVK  120


 Score = 51.2 bits (121),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = +2

Query  68   MTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPA-CCSGIKS  244
            M+ KL +  +++CL+V  AP ++ A+SC  V S+L PC+ +V   G    PA CC+GI+S
Sbjct  5    MSVKLAW-VMVLCLIVG-APLAKGAISCGQVISTLTPCIPFVRNNGAVAVPAPCCNGIRS  62

Query  245  LYAAAKT  265
            L AAA++
Sbjct  63   LNAAAQS  69



>gb|KHN14506.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=116

 Score = 55.1 bits (131),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++CL  AL P ++  ++C  V S+L PC+SYV  GG  V   CC+GI++LY  A+T
Sbjct  3    LVCL--ALGPMAQGEMTCGQVVSNLTPCISYVVYGGTNVPEQCCNGIRNLYGMAQT  56


 Score = 50.1 bits (118),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 5/55 (9%)
 Frame = +1

Query  259  QDGADRRSVCSCLKS----AASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCS  411
            Q   DR++VC+C+K+    +  + S  N   AA LP KCGV NIP+QISP  DC+
Sbjct  55   QTKPDRQAVCNCIKNGVRNSGFNYSDFNLNLAANLPKKCGV-NIPYQISPNTDCT  108



>gb|AAR22488.1| allergen Mal d 3 [Malus domestica]
Length=115

 Score = 59.7 bits (143),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLK+ A S+SG+N   AA LPGKCGV N+P++IS   +C+ +K
Sbjct  66   ADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV-NVPYKISTSTNCATVK  115


 Score = 45.1 bits (105),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C  V SSL PC+ YV  GG  V PACC+GI+++   A+T
Sbjct  15   LCMAVSVA----HAITCGQVTSSLAPCIGYVRSGG-AVPPACCNGIRTINGLART  64



>ref|XP_002442775.1| hypothetical protein SORBIDRAFT_08g002680 [Sorghum bicolor]
 gb|EES16613.1| hypothetical protein SORBIDRAFT_08g002680 [Sorghum bicolor]
Length=119

 Score = 57.0 bits (136),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            ADRR+ C+CLK+AA  + G+N   AA +P KCGV +IP+ IS   DCS++
Sbjct  70   ADRRAACNCLKNAARGIRGLNVGKAASIPSKCGV-SIPYTISTSTDCSRV  118


 Score = 47.8 bits (112),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAAV+C  V S++ PCLSY    G      CCSG++SL +AA+T
Sbjct  24   SEAAVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAART  68



>gb|KHG10481.1| Non-specific lipid-transfer 3 [Gossypium arboreum]
Length=140

 Score = 57.8 bits (138),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +2

Query  77   KLKFSTLIICLLVALAP-CSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYA  253
            KL    LI+C+ V  AP  ++AA++C+ V + L+PCLSYV  GG     ACCSG+K+LY 
Sbjct  8    KLVSMILIVCMTVMSAPKAAKAAITCSDVVNHLIPCLSYVQNGGTPAA-ACCSGVKALYG  66

Query  254  AAKT  265
             A+T
Sbjct  67   EAQT  70


 Score = 47.4 bits (111),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 3/54 (6%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSV--SGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            Q   DR++VC C+KSA + +  +  N   AA LP KCG++ +P+ ISP  DC+ 
Sbjct  69   QTSPDRQNVCKCIKSAVNGIPYTSNNLNLAAGLPAKCGLQ-LPYSISPSTDCNN  121



>ref|XP_010486423.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 57.8 bits (138),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            +KF  L +CL++AL  C EAAVSC+T  + L PC+SYV +GG  V  +CC+GIK+L + A
Sbjct  1    MKFLLLAMCLVLALR-CGEAAVSCSTTVAELYPCVSYVVQGG-AVPESCCNGIKALNSQA  58

Query  260  KT  265
            +T
Sbjct  59   QT  60


 Score = 47.0 bits (110),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGI--NFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q  ADR+SVC C+KSA   VS    N   A  LP KCG+ ++P++ SP  +C  I 
Sbjct  59   QTAADRQSVCRCIKSAIGGVSYTSNNLNNALSLPSKCGL-SLPYKFSPSTNCDSIN  113



>emb|CDX73941.1| BnaA03g31060D [Brassica napus]
 emb|CDX73942.1| BnaA03g31050D [Brassica napus]
Length=113

 Score = 52.8 bits (125),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 3/54 (6%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSA--ASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            Q  ADR+SVC C+K+A   +S S  N K A  LP KCGV N+PF ISP  +C++
Sbjct  61   QTTADRQSVCRCIKNAIGGASYSSSNLKNALSLPAKCGV-NLPFSISPSTNCNR  113


 Score = 52.0 bits (123),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  134  EAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            EAAV+CN V   L PCLSYV +GG      CCSG+++L + A+T
Sbjct  19   EAAVTCNNVVGDLYPCLSYVMQGGNSPSTNCCSGVRTLNSQAQT  62



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 57.0 bits (136),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADR++ C+CLK A+ ++ G+N   AA LPGKCGV N+P++IS   +C+ +K
Sbjct  65   KTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGV-NVPYKISTSTNCAAVK  117


 Score = 47.8 bits (112),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 46/63 (73%), Gaps = 4/63 (6%)
 Frame = +2

Query  80   LKFSTL-IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            +K S + ++C++VAL P ++A ++C  V SS+ PC++YV  GG  V  ACC+G++SL +A
Sbjct  7    MKLSLVALLCIVVAL-PIAQA-ITCGQVASSIAPCVNYVKSGG-AVPAACCNGVRSLNSA  63

Query  257  AKT  265
            AKT
Sbjct  64   AKT  66



>ref|XP_008244970.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 58.2 bits (139),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C+CLK  + S+SG+N   AA LPGKCGV NIP++IS   +C+ +K
Sbjct  69   DRRAACNCLKQLSGSISGVNPNNAAGLPGKCGV-NIPYKISASTNCATVK  117


 Score = 46.2 bits (108),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 41/55 (75%), Gaps = 3/55 (5%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C++V++ P ++A ++C  V SSL PC++YV KGG  V PACC+GI+++   A+T
Sbjct  15   LCMVVSV-PIAQA-ITCGQVSSSLAPCINYVRKGG-VVPPACCNGIRAVNGLART  66



>ref|XP_002323072.2| hypothetical protein POPTR_0016s14290g [Populus trichocarpa]
 gb|EEF04833.2| hypothetical protein POPTR_0016s14290g [Populus trichocarpa]
Length=150

 Score = 53.9 bits (128),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +1

Query  271  DRRSVCSCLKSAAS--SVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+SVC+CLK+ AS  S +  N   AA LPGKCGVK +P++I P  DC  +K
Sbjct  100  DRQSVCTCLKNTASQFSYNSRNVALAAGLPGKCGVK-LPYKIDPSTDCKSVK  150


 Score = 50.4 bits (119),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C++V  A  ++AA+SCN V ++L PC+SYV  G   +   CC+ I+ L +AA+T
Sbjct  42   LVVCIMVMTASTTKAAISCNQVINTLTPCISYVV-GNGALTGNCCNAIRGLNSAART  97



>ref|XP_004245406.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score = 60.8 bits (146),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 5/71 (7%)
 Frame = +2

Query  68   MTPKLKFSTLIICLLVALAPCSEAA-----VSCNTVFSSLVPCLSYVTKGGKKVQPACCS  232
            M  K  FS L+IC+ VA  P   A      V+C+TV+S L PCL YV  GG  V   CC+
Sbjct  1    MLNKQLFSLLLICIAVATTPSIAAEDAITVVTCSTVYSRLEPCLGYVLGGGLSVPSECCN  60

Query  233  GIKSLYAAAKT  265
            GIKSL+ AA+T
Sbjct  61   GIKSLHRAART  71


 Score = 43.9 bits (102),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 1/57 (2%)
 Frame = +1

Query  250  RRCQDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            R  +  ADR+  C CLK+  S+ +      A+QL G C V N  F+I P  DCSK+K
Sbjct  67   RAARTTADRQRFCRCLKNVRSNATNTRISRASQLTGICKV-NALFKIRPDFDCSKVK  122



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 57.0 bits (136),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADR++ C+CLK A+ ++ G+N   AA LPGKCGV N+P++IS   +C+ +K
Sbjct  65   KTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGV-NVPYKISTSTNCAAVK  117


 Score = 47.4 bits (111),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 46/63 (73%), Gaps = 4/63 (6%)
 Frame = +2

Query  80   LKFSTL-IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            +K S + ++C++VAL P ++A ++C  V SS+ PC++YV  GG  V  ACC+GI+SL +A
Sbjct  7    MKLSLVALLCIVVAL-PIAQA-ITCGQVASSISPCVNYVKSGG-AVPAACCNGIRSLNSA  63

Query  257  AKT  265
            AKT
Sbjct  64   AKT  66



>ref|XP_003522081.1| PREDICTED: non-specific lipid-transfer protein 3-like [Glycine 
max]
Length=130

 Score = 52.4 bits (124),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  119  LAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            + P ++  VSC  V S+L PC+SYV  GG  V   CC+GI++LY  A+T
Sbjct  27   IIPMAQGEVSCGQVVSNLTPCISYVLYGGATVPAQCCNGIRNLYGMAQT  75


 Score = 52.4 bits (124),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 5/58 (9%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAA----SSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++VC+C+K+A      + S  N   AA LP  CGV NIP+QISP  DC++++
Sbjct  74   QTKPDRQAVCNCIKNAVRNSGFTYSHFNLNLAANLPKNCGV-NIPYQISPDTDCTRVQ  130



>gb|ADR66947.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 59.3 bits (142),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C+CLK  + S+SG+N   AA LPGKCGV NIP++IS   +C+ +K
Sbjct  69   DRRTACNCLKQLSGSISGVNPNNAAALPGKCGV-NIPYKISASTNCATVK  117


 Score = 45.4 bits (106),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C++V++ P ++A ++C  V SSL PC+ YV +GG  V PACC+GI+++   A+T
Sbjct  15   LCMVVSV-PIAQA-ITCGQVSSSLAPCIGYV-RGGGAVPPACCNGIRNVNNLART  66



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 64.3 bits (155),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+VC+CLKS A+ +SGI    AA LP KCGV+ IPF ISP  DCSK+ 
Sbjct  69   ADRRTVCNCLKSTAARISGIKPALAAGLPSKCGVR-IPFTISPSTDCSKVT  118


 Score = 40.0 bits (92),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +2

Query  125  PCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            P +  A++C  V SS+  C+SYV  GG  +  +CCSG++SL  +AKT
Sbjct  22   PHAANAITCGQVASSVSGCISYVRSGG-SIPASCCSGVRSLAGSAKT  67



>dbj|BAI94496.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 66.2 bits (160),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSAA+++SG+N+  A+ LPGKCGV +IP+ ISP  DCSK+ 
Sbjct  71   DRKTACGCLKSAAAAISGLNYGLASGLPGKCGV-SIPYPISPSTDCSKVN  119


 Score = 38.1 bits (87),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +2

Query  83   KFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAK  262
            K +  +I  +V  AP + AA++C  V  +L PC++Y+ KG       CC+GIK L   A+
Sbjct  9    KVACAVILCIVMTAPYATAAMTCGQVSGNLGPCITYL-KGAPGPSALCCAGIKRLNGMAQ  67

Query  263  T  265
            T
Sbjct  68   T  68



>ref|XP_010253093.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=123

 Score = 56.6 bits (135),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +1

Query  250  RRCQDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            R  +  ADR++ C CLKS+A+ V GI    A+ L  KCGV N+P++ISP  DCS++K
Sbjct  68   RAARTTADRQTTCICLKSSAAGVPGIKPALASSLADKCGV-NLPYKISPSTDCSRVK  123


 Score = 47.8 bits (112),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +2

Query  107  LLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +++A AP   AA+SC  V S+L PC+ Y+  GG  + P CCSG+++L  AA+T
Sbjct  21   MVIAAAPNEVAAISCGQVVSNLSPCIVYLRTGG-PLPPKCCSGVRTLSRAART  72



>gb|ACQ42222.1| lipid transfer protein 1 [Chimonanthus praecox]
Length=116

 Score = 64.7 bits (156),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSAASS+SGI +  A  LP KCGV +IP++ SP  DCSK+K
Sbjct  68   DRQTACGCLKSAASSISGIQYGLAGSLPSKCGV-SIPYKTSPSTDCSKVK  116


 Score = 39.7 bits (91),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            A++C  V S+L PC++Y+  GG  +Q  CC+G++SL  AAK+
Sbjct  25   AITCGQVASALSPCITYLRSGG-ALQSNCCAGVRSLNNAAKS  65



>ref|XP_008798560.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 62.0 bits (149),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ CSCLK AA+S+SG+N    A +P KCGV+ IP+ ISP  DCSK+K
Sbjct  70   DRQTACSCLKRAAASISGLNTGLIAGVPAKCGVR-IPYSISPSTDCSKVK  118


 Score = 42.4 bits (98),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L+  +LVA  P    A++C  V S L PC++Y   GG  +   CCSG+K L AAAK+
Sbjct  13   LLAVMLVA-GPRMADAITCGQVVSFLTPCIAYARNGG-PIPAGCCSGVKGLVAAAKS  67



>ref|XP_009593826.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 52.4 bits (124),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+S C C+K+ ASS +G     AA +PG C  K +PF+IS  VDCSKIK
Sbjct  80   DRQSACQCVKTVASSATGDQISRAASIPGICKAK-VPFKISANVDCSKIK  128


 Score = 52.0 bits (123),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 13/78 (17%)
 Frame = +2

Query  68   MTPKLKFSTLIICLLVALAP------------CSEAAVSCNTVFSSLVPCLSYVTKGGKK  211
            M  K  F  L IC++V++A              ++A V+CNTV+ SL PCL YV  GG  
Sbjct  1    MLNKQLFPLLFICIVVSVASITATATNTAAATAADATVTCNTVYDSLEPCLGYVL-GGAS  59

Query  212  VQPACCSGIKSLYAAAKT  265
            V P CCSG+KSL +AA+T
Sbjct  60   VPPECCSGLKSLLSAART  77



>gb|KHN43734.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=155

 Score = 52.4 bits (124),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  119  LAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            + P ++  VSC  V S+L PC+SYV  GG  V   CC+GI++LY  A+T
Sbjct  23   IIPMAQGEVSCGQVVSNLTPCISYVLYGGATVPAQCCNGIRNLYGMAQT  71


 Score = 52.0 bits (123),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 5/58 (9%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAA----SSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++VC+C+K+A      + S  N   AA LP  CGV NIP+QISP  DC+  K
Sbjct  70   QTKPDRQAVCNCIKNAVRNSGFTYSHFNLNLAANLPKNCGV-NIPYQISPDTDCTSFK  126



>ref|XP_009396870.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=119

 Score = 61.6 bits (148),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C C+K+AA+ +SGI++   +QLPG+CG+ ++ ++ISP VDCSKI 
Sbjct  71   DRRTACGCIKTAAAGLSGIDYGRVSQLPGQCGI-SVSYKISPNVDCSKIN  119


 Score = 42.7 bits (99),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 2/49 (4%)
 Frame = +2

Query  125  PCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            P    A++C+ V+  L+ C+ Y+  G  K Q  CCSGIKSL AAA+T Q
Sbjct  24   PRGGEAITCSQVYGDLISCVGYLQGGPIKQQ--CCSGIKSLIAAARTTQ  70



>gb|KDO49687.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=115

 Score = 55.1 bits (131),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLK A  S+ GIN   AA LP +CGV +IP++ISP  DCS+++
Sbjct  67   DRQAACNCLKQAYRSIPGINANVAAGLPRQCGV-SIPYKISPNTDCSRVR  115


 Score = 49.3 bits (116),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C+LV  AP + A ++C  V  SL PC++++  GG+   P CC+G++SL  AA+T
Sbjct  10   LLLCILVT-APVTNA-ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAART  64



>ref|XP_008798559.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=117

 Score = 57.8 bits (138),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            DRR+ C+CLK+AA+ +SG+     A +PGKCGV+ +P+ ISP  DCS+
Sbjct  70   DRRTACTCLKNAAAGISGLKTGLIAGIPGKCGVR-VPYAISPSTDCSR  116


 Score = 46.2 bits (108),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +2

Query  125  PCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            P +  A++C  V S L PC++YV  GG ++  ACCSG++ L AAAKT
Sbjct  22   PHTADAITCGQVVSYLTPCINYVRNGG-QIPGACCSGVRGLAAAAKT  67



>ref|XP_008388344.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 53.9 bits (128),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = +2

Query  80   LKFSTLIICL--LVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYA  253
            LK + L++ +  +VA  P +EAAV+C  + S L PC+SYV  GG  + PACC+G+++L+ 
Sbjct  8    LKLACLVVVMFCMVACVPKAEAAVTCGQMVSDLTPCISYVKXGG-ALAPACCNGVRTLFT  66

Query  254  AAKT  265
             A+T
Sbjct  67   LAQT  70


 Score = 50.1 bits (118),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSV--SGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR+SVC+CLK A + +  +  N   AA LP KC V NIP++ISP  DC  +K
Sbjct  69   QTXPDRQSVCNCLKQAINGIPYTNTNAGLAAGLPAKCSV-NIPYKISPSTDCKSVK  123



>gb|AFR43295.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 57.0 bits (136),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C C+KS A+ +S IN+  AA LPG+C V +IP++ISP +DC ++K
Sbjct  72   DRQAACKCIKSLAADISDINYGVAAGLPGQCNV-HIPYKISPSIDCKRVK  120


 Score = 47.0 bits (110),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVT-KGGKKVQPACCSGIKSLYAA  256
            LK + +++   +  AP ++ A+SC+ V SSL+PC+ YV     +   P CC GI+SL +A
Sbjct  7    LKLACVVVLCSLVDAPLAQGAISCDQVKSSLLPCVGYVRGNNARPAPPNCCKGIRSLKSA  66

Query  257  AK  262
            A+
Sbjct  67   AR  68



>sp|Q43194.1|NLTP2_SORBI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Sorghum bicolor]
 emb|CAA50661.1| lipid transfer protein [Sorghum bicolor]
Length=122

 Score = 57.0 bits (136),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            ADRR+ C+CLK+AA  + G+N   AA +P KCGV +IP+ IS   DCS++
Sbjct  73   ADRRAACNCLKNAARGIRGLNVGKAASIPSKCGV-SIPYTISTSTDCSRV  121


 Score = 47.0 bits (110),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAAV+C  V S++ PCLSY    G      CCSG++SL +AA+T
Sbjct  27   SEAAVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAART  71



>gb|AAT80652.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80660.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80661.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80662.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 57.4 bits (137),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKS A SVSG+N   A  LPGKCGV N+P++IS   +C+ +K
Sbjct  67   DRQAACNCLKSLAGSVSGVNPGNAESLPGKCGV-NVPYKISTSTNCATVK  115


 Score = 46.6 bits (109),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C  V S+LVPC  YV  GG  V PACC+GI+++   AKT
Sbjct  15   LCMAVSVA----HAITCGQVSSNLVPCFDYVRSGG-PVPPACCNGIRTINGLAKT  64



>gb|AAT80650.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80651.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80653.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80654.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80655.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80656.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80657.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80658.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80659.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 57.4 bits (137),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKS A SVSG+N   A  LPGKCGV N+P++IS   +C+ +K
Sbjct  67   DRQAACNCLKSLAGSVSGVNPGNAESLPGKCGV-NVPYKISTSTNCATVK  115


 Score = 46.6 bits (109),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C  V S+LVPC  YV  GG  V PACC+GI+++   AKT
Sbjct  15   LCMAVSVA----HAITCGQVSSNLVPCFDYVRSGG-PVPPACCNGIRTINGLAKT  64



>ref|XP_010277659.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 60.5 bits (145),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++VCSC KSAA+S+ G+N   A  +PG+CGV+   ++ISP  DCS+I+
Sbjct  73   ADRQAVCSCFKSAAASIPGVNLGLANSIPGRCGVQ-FTYKISPSTDCSRIR  122


 Score = 43.1 bits (100),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +2

Query  110  LVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +VA    ++AA++C  V S L PC++Y  KGG  + PACC  ++ L  A+KT
Sbjct  21   MVAAPDHADAAMTCGQVASLLTPCINYFVKGG-ALPPACCGAVRGLITASKT  71



>gb|AGV40204.1| nonspecific lipid-transfer protein 3, partial [Oryza sativa]
Length=126

 Score = 59.7 bits (143),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCS  411
            ADRR+ C+CLK+ A S+SG+N   AA +P KCGV +IP+ ISP ++CS
Sbjct  80   ADRRTACNCLKNVAGSISGLNAGNAASIPSKCGV-SIPYTISPSIECS  126


 Score = 43.9 bits (102),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 1/43 (2%)
 Frame = +2

Query  137  AAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AA+SC  V S++ PCLSY  +GG     ACCSG++SL +AA T
Sbjct  37   AAISCGQVNSAVSPCLSYA-RGGSGPSAACCSGVRSLNSAAST  78



>gb|KDO49688.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=120

 Score = 54.3 bits (129),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            DR++ C+CLK A  S+ GIN   AA LP +CGV +IP++ISP  DCS+I
Sbjct  67   DRQAACNCLKQAYRSIPGINANVAAGLPRQCGV-SIPYKISPNTDCSRI  114


 Score = 49.3 bits (116),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C+LV  AP + A ++C  V  SL PC++++  GG+   P CC+G++SL  AA+T
Sbjct  10   LLLCILVT-APVTNA-ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAART  64



>gb|ADR66948.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 58.2 bits (139),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C+CLK  + S+SG+N   AA LPGKCGV NIP++IS   +C+ +K
Sbjct  69   DRRTACNCLKQLSGSISGVNPNNAAALPGKCGV-NIPYKISISTNCAAVK  117


 Score = 45.4 bits (106),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C++V++ P ++A ++C  V SSL PC+ YV +GG  V PACC+GI+++   A+T
Sbjct  15   LCMVVSV-PIAQA-ITCGQVSSSLAPCIGYV-RGGGAVPPACCNGIRNVNNLART  66



>emb|CAA80809.1| lipid transfer protein [Oryza sativa Indica Group]
Length=117

 Score = 63.2 bits (152),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+ A S+SG+N   AA +P KCGV  IP+ ISP +DCS++ 
Sbjct  68   ADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVS-IPYTISPSIDCSRVN  117


 Score = 40.4 bits (93),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = +2

Query  137  AAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AA+SC  V S++ PCLSY    G +   ACCSG++SL +AA T
Sbjct  26   AAISCGQVNSAVSPCLSYAR--GLRPSAACCSGVRSLNSAAST  66



>gb|AGN56421.1| non-specific lipid transfer protein 1 [Linum usitatissimum]
Length=116

 Score = 58.5 bits (140),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +1

Query  247  LRRCQDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            L   +  ADRR  C+CLK+AA +V G+N   AA LPGKCGVK IP++IS   +C+ 
Sbjct  60   LNMAKTTADRRLACTCLKTAAGNVPGLNPAIAAGLPGKCGVK-IPYKISTSTNCNT  114


 Score = 45.1 bits (105),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +2

Query  68   MTPKLKF-STLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKS  244
            M   LK  S L++C LVA AP + + ++C  V S +  CL+Y+T G   V PACC+G++ 
Sbjct  1    MAAALKLVSILLVCALVA-APITVSGLTCGQVSSGMAACLTYLT-GRAPVTPACCNGMRG  58

Query  245  LYAAAKT  265
            L   AKT
Sbjct  59   LLNMAKT  65



>ref|XP_011002608.1| PREDICTED: non-specific lipid-transfer protein 1 [Populus euphratica]
Length=120

 Score = 53.5 bits (127),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +1

Query  271  DRRSVCSCLKSAAS--SVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+SVC+CLK+ AS  S +  N   AA LPGKCGVK +P++I P  DC  +K
Sbjct  70   DRQSVCTCLKNTASQFSYNSRNVALAAGLPGKCGVK-LPYKIDPSTDCKSVK  120


 Score = 50.1 bits (118),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            L    L++C++V  A  ++AA+SCN V ++L PC+SYV  G   +   CC+ I+ + +AA
Sbjct  7    LNLVCLVVCIMVMTASTTKAAISCNQVINTLTPCISYVV-GNGALTGNCCNAIRGINSAA  65

Query  260  KT  265
            +T
Sbjct  66   RT  67



>ref|XP_009396875.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=119

 Score = 61.2 bits (147),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C C+K+AA+ +SGI++   +QLPG+CG+ ++ ++ISP VDCSKI 
Sbjct  71   DRRTACGCIKTAAAGLSGIDYGRVSQLPGQCGI-SVSYKISPNVDCSKIN  119


 Score = 42.0 bits (97),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 2/47 (4%)
 Frame = +2

Query  125  PCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            P    A++C+ V+  L+ C+ Y+  G  K Q  CCSGIKSL AAA+T
Sbjct  24   PRGGEAITCSQVYGDLISCVGYLQGGPIKQQ--CCSGIKSLIAAART  68



>dbj|BAI94497.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 65.5 bits (158),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            DR++ C CLKSAA+++SGIN+  A  LPGKCGV +IP+ ISP  DCS++
Sbjct  71   DRKTACGCLKSAAAAISGINYGLANALPGKCGV-SIPYPISPNTDCSRV  118


 Score = 37.7 bits (86),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +I+C+ V  AP +  A++C  V  SL  C+SY+ KG      ACC GIK L   A+T
Sbjct  14   MILCI-VMTAPYATEALTCGQVSGSLASCISYL-KGAPGPSGACCGGIKRLNGMAQT  68



>gb|AGN56422.1| non-specific lipid transfer protein 2, partial [Linum usitatissimum]
Length=116

 Score = 58.5 bits (140),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +1

Query  247  LRRCQDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            L   +  ADRR  C+CLK+AA +V G+N   AA LPGKCGVK IP++IS   +C+ 
Sbjct  60   LNMAKTTADRRLACTCLKTAAGNVPGLNPAIAAGLPGKCGVK-IPYKISTSTNCNT  114


 Score = 44.7 bits (104),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +2

Query  86   FSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
             S L++C LVA AP + + ++C  V S +  CL+Y+T G   V PACC+G++ L   AKT
Sbjct  8    VSILLVCALVA-APITVSGLTCGQVSSGMAACLTYLT-GRAPVTPACCNGMRGLLNMAKT  65



>emb|CDX71121.1| BnaC03g12050D [Brassica napus]
Length=115

 Score = 53.5 bits (127),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR+  C CL+SAA +VSG++   AA LPGKCGV +IP+ IS   +C  +K
Sbjct  63   QTTPDRQQACKCLQSAAKTVSGLDPSLAASLPGKCGV-SIPYSISVSTNCDNVK  115


 Score = 50.1 bits (118),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +2

Query  68   MTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSL  247
            M   L+F T ++ L V +    +AAVSC TV SSL PC +Y++KGG  V P CC+G+  L
Sbjct  1    MALALRFFTCLV-LTVCIVASVDAAVSCGTVTSSLAPCANYLSKGG-DVPPPCCAGVTKL  58

Query  248  YAAAKT  265
               A+T
Sbjct  59   NGMAQT  64



>gb|KCW47519.1| hypothetical protein EUGRSUZ_K01282 [Eucalyptus grandis]
Length=116

 Score = 60.5 bits (145),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDC  408
            ADR++ C CL+SAA S+ GI+F  AA LPGKCGV ++P++ISP  DC
Sbjct  69   ADRQAACRCLQSAAGSIQGIDFNLAAGLPGKCGV-SVPYKISPTTDC  114


 Score = 42.7 bits (99),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +2

Query  59   MNDMTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGI  238
            M D++ K+    LI CL+ A +P + AA++C+ + SS+ PC+ Y+ +G   +  ACCSG+
Sbjct  1    MADLS-KVSCFLLIACLVAASSPAARAAITCSQISSSMGPCIGYL-RGSGPLSSACCSGV  58

Query  239  KSLYAAAKT  265
            KSL  AA+T
Sbjct  59   KSLNTAART  67



>emb|CAB96874.1| mal d 3 [Malus domestica]
Length=91

 Score = 60.1 bits (144),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLK+ A S+SG+N   AA LPGKCGV N+P++IS   +C+ +K
Sbjct  42   ADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGV-NVPYKISTSTNCATVK  91


 Score = 43.1 bits (100),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +2

Query  143  VSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C  V SSL PC+ YV  GG  V PACC+GI+++   A+T
Sbjct  1    ITCGQVTSSLAPCIGYVRSGG-AVPPACCNGIRTINGLART  40



>ref|XP_004242229.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=119

 Score = 57.4 bits (137),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            AD +S CSC+KS AS  +      AA +PG+CG   IPF+ISP VDCSK+K
Sbjct  70   ADHQSTCSCIKSLASQATDDELSRAASIPGQCG-ATIPFEISPNVDCSKVK  119


 Score = 45.8 bits (107),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++I  +VA  P ++A ++C+TV+  + PCL+YV  GG  V   CC+G++S+ A+A T
Sbjct  13   ILIIYMVAAPPPAKAVITCDTVYDGVKPCLNYVLFGG-IVSTDCCNGLESVIASATT  68



>ref|XP_009372013.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 58.2 bits (139),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLK+ A S+ G+N   AA LPGKCGV N+P++IS   +C+ +K
Sbjct  66   ADRQAACNCLKNLAGSIRGVNPNNAAALPGKCGV-NVPYKISTSTNCATVK  115


 Score = 45.1 bits (105),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            A++C  V SSL PC++Y  KGG  V PACC+GI+++   A+T
Sbjct  24   AITCGQVTSSLAPCINYA-KGGGVVPPACCNGIRTINGIART  64



>sp|Q43748.1|NLTP_BETVU RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Beta vulgaris]
 emb|CAA63407.1| IWF1' [Beta vulgaris subsp. vulgaris]
Length=117

 Score = 60.1 bits (144),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            ADR++ C+CLKSAA+S+ GIN+  AA LP +CGV ++P+ ISP  +C+ I
Sbjct  68   ADRKTACTCLKSAATSIKGINYGKAASLPRQCGV-SVPYAISPNTNCNAI  116


 Score = 42.7 bits (99),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = +2

Query  80   LKFS-TLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            +KF+  L++C++VA AP +EA ++C  V S L PC+ Y+ +G      ACC GIKSL +A
Sbjct  7    VKFTCALVMCMMVA-APLAEA-ITCGLVASKLAPCIGYL-QGAPGPSAACCGGIKSLNSA  63

Query  257  AKT  265
            A +
Sbjct  64   AAS  66



>ref|NP_001240073.1| uncharacterized protein LOC100815185 precursor [Glycine max]
 gb|ACU20651.1| unknown [Glycine max]
Length=122

 Score = 52.0 bits (123),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVS-GINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR+  CSCLK+ A+++   +N   AA LPGKCGV NIP++IS   +C+ IK
Sbjct  71   ADRQGACSCLKNLANNMGQSLNAGNAASLPGKCGV-NIPYKISTSTNCATIK  121


 Score = 50.8 bits (120),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = +2

Query  122  APCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAK-TGQIAGACA  289
            AP ++AA++C  V   + PC SY+  GGK  Q ACC+G+KSL +AAK T    GAC+
Sbjct  23   APMAQAAITCGQVAGDMSPCFSYLRSGGKPSQ-ACCNGVKSLSSAAKTTADRQGACS  78



>gb|KDO49686.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=126

 Score = 53.5 bits (127),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK*AKLQGMNY  447
            DR++ C+CLK A  S+ GIN   AA LP +CGV +IP++ISP  DCS+     L  + +
Sbjct  67   DRQAACNCLKQAYRSIPGINANVAAGLPRQCGV-SIPYKISPNTDCSRYVKLSLSSVTF  124


 Score = 48.9 bits (115),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C+LV  AP + A ++C  V  SL PC++++  GG+   P CC+G++SL  AA+T
Sbjct  10   LLLCILVT-APVTNA-ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAART  64



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 58.9 bits (141),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKSAA S+S +N   AA LPGKCGV NIP++IS   +C+ I+
Sbjct  67   DRQAACNCLKSAAGSISRLNANNAAALPGKCGV-NIPYKISTSTNCATIR  115


 Score = 43.9 bits (102),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 3/57 (5%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            LI+C+++A  P +E+A++C  V ++L PCL Y+ +GG      CC G+++L +AA T
Sbjct  11   LIMCIVIA--PMAESAITCGRVSAALAPCLGYL-QGGPGPSAQCCGGVRNLNSAAVT  64



>ref|XP_002323069.1| Nonspecific lipid-transfer protein 1 [Populus trichocarpa]
 gb|ABK95798.1| unknown [Populus trichocarpa]
 gb|EEF04830.1| Nonspecific lipid-transfer protein 1 [Populus trichocarpa]
Length=116

 Score = 56.6 bits (135),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR  C+C+K+ A+ + G+N  YAA LPG C V NIP++IS   +C+ IK
Sbjct  68   DRRDACNCIKTTAAQLGGVNSNYAAALPGLCHV-NIPYKISTSTNCASIK  116


 Score = 46.2 bits (108),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKTGQ  271
            L++C++++    +  A+SC+ V S+L  CL+Y+  GG  V PACC G+ +L  AAKT Q
Sbjct  10   LLLCMVLSAPMLNVEALSCSVVASNLAQCLTYLRNGG-AVPPACCKGVGTLNNAAKTTQ  67



>ref|XP_008391369.1| PREDICTED: non-specific lipid-transfer protein [Malus domestica]
Length=113

 Score = 58.5 bits (140),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            DR++VC+CLKS ASSVSG+N   A  LPGKCGV N+P++IS   +C+ 
Sbjct  67   DRQAVCNCLKSLASSVSGVNPGNAESLPGKCGV-NVPYKISTSTNCTT  113


 Score = 43.9 bits (102),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 38/55 (69%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C  V S+L PC+ Y+ +GG  V PACC+GI+++ + A+T
Sbjct  15   LCMAVSVA----HAITCGQVSSNLAPCIGYL-RGGGPVPPACCNGIRTINSLAET  64



>pdb|2MAL|A Chain A, Solution Structure Of Lipid Transfer Protein From Lentil 
Lens Culinaris
Length=93

 Score = 58.9 bits (141),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKSAA S++ +N   AA LPGKCGV NIP++IS   +C+ +K
Sbjct  44   DRQAACNCLKSAAGSITKLNTNNAAALPGKCGV-NIPYKISTTTNCNTVK  92


 Score = 43.5 bits (101),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            A+SC  V S L PCL+Y+T GG    P CC G+K L AAA T
Sbjct  1    AISCGAVTSDLSPCLTYLT-GGPGPSPQCCGGVKKLLAAANT  41



>ref|XP_009346912.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 55.8 bits (133),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKS + S+SG+N   A  LPGKCGV N+P++IS   +C+ +K
Sbjct  67   DRQAACNCLKSLSGSISGVNPGNAESLPGKCGV-NVPYKISTSTNCATVK  115


 Score = 46.6 bits (109),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C  V S+L PC++YV  GG  V PACC+GIK++ A AKT
Sbjct  15   LCMAVSVA----HAITCGQVSSNLAPCINYVRSGG-AVPPACCNGIKTINALAKT  64



>gb|AFK45186.1| unknown [Lotus japonicus]
Length=114

 Score = 53.1 bits (126),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +2

Query  68   MTPKLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSL  247
            M P   FS L+  LL+ L   SEAA+SC+ V   L PC+SY+  G  K   ACCSG K+L
Sbjct  1    MKPSSAFSALV--LLMLLVSASEAAISCSDVIKDLKPCVSYLVSGSGKPPGACCSGAKAL  58

Query  248  YAAAKTGQ  271
             +A  T +
Sbjct  59   ASAVSTSE  66


 Score = 49.3 bits (116),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            D+++ C+C+KS A S+  +N + A  LPG CG+ N+P  +SP  DCSK+
Sbjct  67   DKKAACNCIKSTAKSIK-MNSQLAKALPGNCGI-NVPINVSPDADCSKV  113



>gb|AAT80665.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 55.8 bits (133),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKS A SVSG+N      LPGKCGV N+P++IS   +C+ +K
Sbjct  67   DRQAACNCLKSLAGSVSGVNPGNVESLPGKCGV-NVPYKISTSTNCATVK  115


 Score = 46.6 bits (109),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C  V S+LVPC  YV  GG  V PACC+GI+++   AKT
Sbjct  15   LCMAVSVA----HAITCGQVSSNLVPCFDYVRSGG-PVPPACCNGIRTINGLAKT  64



>emb|CDY00655.1| BnaC03g36390D [Brassica napus]
Length=113

 Score = 51.6 bits (122),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 3/54 (6%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSA--ASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            Q  ADR+SVC C+K+A   +S S  N   A  LP KCGV N+PF ISP  +C++
Sbjct  61   QTTADRQSVCRCIKNAIGGASYSSSNLNNALSLPAKCGV-NLPFSISPSTNCNR  113


 Score = 50.8 bits (120),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  134  EAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            EAAV+CN V   L PCLSYV +GG      CC+G+++L + A+T
Sbjct  19   EAAVTCNNVVGDLYPCLSYVMQGGNAPSTNCCNGVRTLNSQAQT  62



>gb|AHB19225.1| non specific lipid transfer protein 1C [Punica granatum]
Length=120

 Score = 59.3 bits (142),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKS ASS+SGIN+   A  PGKCGV +IP++I+P  +C  +K
Sbjct  72   DRQAACRCLKSLASSISGINYGLVAGAPGKCGV-SIPYKIAPSTNCDNVK  120


 Score = 42.7 bits (99),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQP-ACCSGIKSLYAAAKT  265
            +++C+ VA +  +EA ++C  V SSL  C+ Y    G    P ACC+GI+SL +AAKT
Sbjct  13   VLVCMAVA-STVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKT  69



>gb|AAP92127.1| lipid transfer protein LPT1 [Oryza sativa]
Length=118

 Score = 62.0 bits (149),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            ADRR+ C+CLK+ A S+SG+N   AA +P KCGV +IP+ ISP +DCS+
Sbjct  68   ADRRTACNCLKNVAGSISGLNAGNAASIPSKCGV-SIPYTISPSIDCSR  115


 Score = 40.4 bits (93),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = +2

Query  137  AAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            AA+SC  V S++ PCLSY    G +   ACCSG++SL +AA T
Sbjct  26   AAISCGQVNSAVSPCLSYAR--GLRPSAACCSGVRSLNSAAST  66



>sp|P81651.2|NLTP1_PRUAR RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru ar 3; AltName: Allergen=Pur 
ar 3 [Prunus armeniaca]
Length=91

 Score = 58.9 bits (141),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C+CLK  + S+SG+N   AA LPGKCGV NIP++IS   +C+ +K
Sbjct  43   DRRTACNCLKQLSGSISGVNPNNAAALPGKCGV-NIPYKISASTNCATVK  91


 Score = 43.5 bits (101),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +2

Query  143  VSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C  V SSL PC+ YV +GG  V PACC+GI+++   A+T
Sbjct  1    ITCGQVSSSLAPCIGYV-RGGGAVPPACCNGIRNVNNLART  40



>gb|AAA86694.1| phospholipid transfer protein precursor [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ91366.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 53.9 bits (128),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 4/53 (8%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            Q  AD+++VC C+KSAA   +G+N   AA +P KCGV ++P+ IS  VDCSKI
Sbjct  66   QSTADKQAVCKCIKSAA---AGLNAGKAAGIPSKCGV-SVPYSISTSVDCSKI  114


 Score = 48.5 bits (114),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 4/53 (8%)
 Frame = +2

Query  107  LLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            LLVA    ++AA+SC  V S+L PC+SY +  G  + PACCSG+K L  AA++
Sbjct  19   LLVA----ADAAISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQS  67



>gb|ACM78613.1| lipid transfer protein 1 [Tamarix hispida]
Length=118

 Score = 60.8 bits (146),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C CLKSAA S  GIN   AA LPGKCGV NI + IS  VDCS++K
Sbjct  70   DRKAACGCLKSAAKSFPGINMGNAAALPGKCGV-NIGYPISTSVDCSRVK  118


 Score = 41.2 bits (95),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C++V+L P +EAA++C  V   L PCL+++ +GG      CC  IKSL +  ++
Sbjct  15   MCMVVSL-PYTEAAITCGMVTQKLAPCLTFLQRGGPPAA-GCCGAIKSLNSMVRS  67



>ref|XP_006429565.1| hypothetical protein CICLE_v10013119mg [Citrus clementina]
 ref|XP_006481181.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42805.1| hypothetical protein CICLE_v10013119mg [Citrus clementina]
Length=115

 Score = 52.4 bits (124),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLK A  ++ GI    AA LP +CGV+ IP++ISP  DCS+++
Sbjct  67   DRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVR-IPYKISPSTDCSRVR  115


 Score = 49.7 bits (117),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C+LV  AP + A ++C  V +SL PC+ ++  GG+   P CCSG++SL  AA+T
Sbjct  10   LLLCILVT-APVTNA-ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAART  64



>sp|P85894.1|LTP1_MORNI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Allergen=Mor n 3 [Morus nigra]
Length=91

 Score = 62.4 bits (150),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLKSA +S+ G+N   AA LPGKCGV  +P++ISP  DC  +K
Sbjct  42   ADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS-VPYKISPSTDCKSVK  91


 Score = 40.0 bits (92),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +2

Query  143  VSCNTVFSSLVPCLSYVTKGGKKVQPA-CCSGIKSLYAAAKT  265
            ++C  V SSL PC++Y+  GG  V PA CC+G++SL  AAKT
Sbjct  1    ITCGQVSSSLAPCINYLRAGG--VVPANCCNGVRSLNNAAKT  40



>ref|XP_009132002.1| PREDICTED: non-specific lipid-transfer protein 3 [Brassica rapa]
 emb|CDX88696.1| BnaA03g09530D [Brassica napus]
Length=115

 Score = 52.4 bits (124),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR+  C CL+SAA +VSG++   AA LPGKCGV +IP+ IS   +C  +K
Sbjct  63   QTTPDRQQACKCLQSAAKTVSGLDPSLAAGLPGKCGV-SIPYPISMSTNCDNVK  115


 Score = 50.1 bits (118),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            L+F T ++ L V +    +AAVSC TV SSL PC +Y++KGG  V P CC+G+  L   A
Sbjct  5    LRFFTCLV-LTVCIVASVDAAVSCGTVTSSLAPCANYLSKGG-DVPPPCCAGVTKLNGMA  62

Query  260  KT  265
            +T
Sbjct  63   QT  64



>pdb|1FK0|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Capric Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK1|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Lauric Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK2|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Myristic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK3|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Palmitoleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK4|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Stearic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK5|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Oleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK6|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Alpha-Linolenic Acid 
Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK7|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Ricinoleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1AFH|A Chain A, Lipid Transfer Protein From Maize Seedlings, Nmr, 15 
Structures
 pdb|1MZL|A Chain A, Maize Nonspecific Lipid Transfer Protein
 pdb|1MZM|A Chain A, Maize Nonspecific Lipid Transfer Protein Complexed With 
Palmitate
Length=93

 Score = 60.5 bits (145),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  44   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  93


 Score = 41.6 bits (96),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (62%), Gaps = 0/42 (0%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            A+SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  1    AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  42



>ref|XP_006353709.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=162

 Score = 55.1 bits (131),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            ADR+S CSC+KS AS  +      AA +PG+CG  ++PF+ISP VDCSK
Sbjct  70   ADRQSACSCVKSLASHATDEELSRAASIPGQCG-ASVPFEISPNVDCSK  117


 Score = 47.0 bits (110),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = +2

Query  71   TPKLKFSTLIICLLVALAPC-SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSL  247
            +P+L   + I+ + + +AP  ++A ++C+TV+  + PCL+YV  GG  V   CC+G++SL
Sbjct  4    SPRLMLLSFILIIYMVVAPPPAKAVITCDTVYDGVKPCLNYVLFGG-SVPIDCCNGLESL  62

Query  248  YAAAKT  265
             A+A T
Sbjct  63   IASATT  68



>ref|XP_004302624.1| PREDICTED: non-specific lipid-transfer protein 1-like [Fragaria 
vesca subsp. vesca]
 gb|AAY83341.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 54.3 bits (129),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADR++ C+CLK A+ ++ G+N   AA LPGKCGV ++P++IS   +C+ +K
Sbjct  65   KTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGV-SVPYKISTSTNCAAVK  117


 Score = 47.4 bits (111),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 3/56 (5%)
 Frame = +2

Query  98   IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C++VAL P ++A ++C  V SS+ PC++YV  GG  V  ACC+GI+SL +AAKT
Sbjct  14   LLCIVVAL-PIAQA-ITCGQVASSISPCVNYVKSGG-AVPAACCNGIRSLNSAAKT  66



>ref|XP_004302622.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 57.0 bits (136),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSV--SGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR+SVC+CLK A + +  +G N   AA LPGKCGV NIP++I+P  DC  IK
Sbjct  68   QTTPDRQSVCNCLKQAIAGIPYTGANAGLAAGLPGKCGV-NIPYKINPSTDCKSIK  122


 Score = 45.1 bits (105),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 5/47 (11%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPA--CCSGIKSLYAAAKT  265
            +EAA++C  V + L+PC+SYV  GG    PA  CC GI++LY  A+T
Sbjct  26   AEAALTCGQVVNKLMPCVSYVQNGGT---PAANCCGGIRALYGMAQT  69



>ref|XP_010683516.1| PREDICTED: non-specific lipid-transfer protein [Beta vulgaris 
subsp. vulgaris]
Length=117

 Score = 60.1 bits (144),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            ADR++ C+CLKSAA+S+ GIN+  AA LP +CGV ++P+ ISP  +C+ I
Sbjct  68   ADRKTACTCLKSAATSIKGINYGKAASLPRQCGV-SVPYAISPNTNCNAI  116


 Score = 41.6 bits (96),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = +2

Query  80   LKFS-TLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            +KF+  L++C++VA AP +EA ++C  V S L PC+ Y+ +G       CC GIKSL +A
Sbjct  7    VKFTCALVMCMMVA-APLAEA-ITCGLVASKLAPCIGYL-QGAPGPSAGCCGGIKSLNSA  63

Query  257  AKT  265
            A +
Sbjct  64   AAS  66



>gb|AAT80663.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80664.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 57.4 bits (137),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLKS A SVSG+N   A  LPGKCGV N+P++IS   +C+ +K
Sbjct  67   DRQAACNCLKSLAGSVSGVNPGNAESLPGKCGV-NVPYKISTSTNCATVK  115


 Score = 44.3 bits (103),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C  V S+LVPC  YV   G  V PACC+GI+++   AKT
Sbjct  15   LCMAVSVA----HAITCGQVSSNLVPCFDYVRSDG-PVPPACCNGIRTINGLAKT  64



>ref|XP_008662435.1| PREDICTED: non-specific lipid-transfer protein [Zea mays]
 gb|ACG24030.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
 gb|AFW55967.1| phospholipid transfer protein-like protein [Zea mays]
Length=121

 Score = 60.5 bits (145),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV +IP+ IS   DCS++ 
Sbjct  72   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV-SIPYTISTSTDCSRVN  121


 Score = 41.2 bits (95),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  143  VSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +SC  V S++ PC+SY    G      CCSG+KSL  AA+T
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAART  70



>ref|NP_001055844.2| Os05g0477900 [Oryza sativa Japonica Group]
 dbj|BAF17758.2| Os05g0477900 [Oryza sativa Japonica Group]
Length=129

 Score = 52.0 bits (123),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +1

Query  268  ADRRSVCSCLKS-AASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+ AA +  G     AA LPG+CGV ++PF+ISP V+C+ + 
Sbjct  79   ADRRAACTCLKNVAAGAAGGPYISRAAGLPGRCGV-SVPFKISPNVNCNAVN  129


 Score = 49.3 bits (116),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            + AA+SC+TV+++L+PCL YV  GG  V  ACC GI+S+ AAA+T
Sbjct  34   ARAALSCSTVYNTLLPCLPYVQSGG-AVPAACCGGIRSVVAAART  77



>gb|ABA33856.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=117

 Score = 60.5 bits (145),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  68   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  117


 Score = 41.2 bits (95),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  143  VSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  26   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAART  66



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 55.5 bits (132),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLK AA  + G+N   AA LPGKCGV ++P++IS   +C+ +K
Sbjct  68   ADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGV-SVPYKISTTTNCAAVK  117


 Score = 46.2 bits (108),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = +2

Query  80   LKFSTL-IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            +K S + ++C++VAL P ++A ++C  V S++ PCL+YV  GG  V  ACCSGI++L   
Sbjct  7    MKLSLVALLCIVVAL-PIAQA-ITCGQVASNISPCLTYVKSGG-AVPAACCSGIRNLNGM  63

Query  257  AKT  265
            AKT
Sbjct  64   AKT  66



>gb|ABA33855.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=121

 Score = 60.5 bits (145),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV  IP+ IS   DCS++ 
Sbjct  72   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVS-IPYTISTSTDCSRVN  121


 Score = 40.8 bits (94),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  143  VSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +SC  V S++ PC+SY    G     +CCSG++SL  AA+T
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSASCCSGVRSLNNAART  70



>sp|Q9M5X6.1|NLTP_PYRCO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pyr c 3; Flags: Precursor [Pyrus communis]
 gb|AAF26451.1| lipid transfer protein precursor [Pyrus communis]
Length=115

 Score = 56.2 bits (134),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLK+ A SVSG+N   A  LPGKCGV N+P++IS   +C+ +K
Sbjct  67   DRQAACNCLKNLAGSVSGVNPGNAESLPGKCGV-NVPYKISTSTNCATVK  115


 Score = 45.1 bits (105),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 38/55 (69%), Gaps = 5/55 (9%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C+ V++A     A++C+ V ++L PC++YV  GG  V PACC+GIK++   AKT
Sbjct  15   LCMAVSVA----HAITCSQVSANLAPCINYVRSGG-AVPPACCNGIKTINGLAKT  64



>ref|XP_008350568.1| PREDICTED: non-specific lipid-transfer protein isoform X1 [Malus 
domestica]
Length=124

 Score = 57.0 bits (136),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK*AKLQ  435
            ADR++ C+CLK+ A S+SG+N   AA LP KCGV N+PF+IS   +C+ +    L+
Sbjct  66   ADRQTTCNCLKNLAGSISGVNPNNAAALPVKCGV-NVPFKISTSTNCATLLPTSLE  120


 Score = 44.3 bits (103),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            A++C  V S+L PC++YV +GG  V PACC+GI+++   A+T
Sbjct  24   AMTCGQVTSNLGPCINYVRRGG-AVPPACCNGIRTINGLART  64



>ref|XP_006662672.1| PREDICTED: non-specific lipid-transfer protein 1-like [Oryza 
brachyantha]
Length=117

 Score = 57.0 bits (136),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA  + G+N   AA +P KCGV ++P+ IS  +DCS++ 
Sbjct  68   ADRRTACNCLKNAARGIRGLNAGNAASIPSKCGV-SVPYTISASIDCSRVS  117


 Score = 44.3 bits (103),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +2

Query  125  PCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            P +  A++C  V S++ PCL+Y  +GG     ACC+G+KSL AAA+T
Sbjct  21   PHATVAITCGQVSSAISPCLAYA-RGGAGPSSACCTGVKSLNAAART  66



>sp|Q43193.1|NLTP1_SORBI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Sorghum bicolor]
 emb|CAA50660.1| lipid transfer protein [Sorghum bicolor]
Length=118

 Score = 58.2 bits (139),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA  +SG+N   AA +P KCGV ++P+ IS   DCS++ 
Sbjct  69   ADRRAACNCLKNAARGISGLNAGNAASIPSKCGV-SVPYTISTSTDCSRVS  118


 Score = 42.7 bits (99),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  131  SEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            SEAA+SC  V S++  CLSY    G      CCSG++SL +AA+T
Sbjct  23   SEAAISCGQVSSAIALCLSYARGQGFAPSAGCCSGVRSLNSAART  67



>gb|AAK28533.1|AF329829_1 lipid transfer protein precursor [Corylus avellana]
Length=115

 Score = 60.1 bits (144),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +DR+S C+CLK  A  ++G+N   AA LPGKCGV NIP++ISP  +C+ +K
Sbjct  66   SDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGV-NIPYKISPSTNCNNVK  115


 Score = 41.2 bits (95),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +++C++VA AP + A+++C  +  +L PC+ Y+  GG  + P+CC G++++  A++T
Sbjct  10   VLLCMMVA-APVARASLTCPQIKGNLTPCVLYLKNGG-VLPPSCCKGVRAVNDASRT  64



>ref|NP_568905.1| non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
 sp|Q9LLR7.1|NLTP3_ARATH RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF76929.1| lipid transfer protein 3 [Arabidopsis thaliana]
 gb|AAL38769.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAM19801.1| AT5g59320/mnc17_210 [Arabidopsis thaliana]
 gb|AAM20222.1| putative nonspecific lipid-transfer precursor [Arabidopsis thaliana]
 gb|AAN60256.1| unknown [Arabidopsis thaliana]
 gb|AED97171.1| non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
Length=115

 Score = 50.8 bits (120),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            L+F T ++ L V +    +AA+SC TV  SL PC +Y++KGG  V P+CC+G+K+L + A
Sbjct  5    LRFFTCLV-LTVCIVASVDAAISCGTVAGSLAPCATYLSKGG-LVPPSCCAGVKTLNSMA  62

Query  260  KT  265
            KT
Sbjct  63   KT  64


 Score = 50.4 bits (119),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+  C C++S A S+SG+N   A+ LPGKCGV +IP+ IS   +C+ IK
Sbjct  67   DRQQACRCIQSTAKSISGLNPSLASGLPGKCGV-SIPYPISMSTNCNNIK  115



>sp|P82534.1|NLTP1_PRUDO RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru d 3; AltName: Allergen=Pur 
d 3 [Prunus domestica]
Length=91

 Score = 57.4 bits (137),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK  + S+ G+N   AA LPGKCGV N+P++IS   +C+ +K
Sbjct  42   ADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGV-NVPYKISASTNCATVK  91


 Score = 43.9 bits (102),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +2

Query  143  VSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++C  V S+L PC++YV KGG  V PACC+GI+++   A+T
Sbjct  1    ITCGQVSSNLAPCINYV-KGGGAVPPACCNGIRNVNNLART  40



>ref|XP_007017081.1| Non-specific lipid-transfer protein, putative [Theobroma cacao]
 gb|EOY34700.1| Non-specific lipid-transfer protein, putative [Theobroma cacao]
Length=119

 Score = 51.2 bits (121),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +2

Query  77   KLKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            K+ F  L++ +LVA AP   A +SC  V + L PC++Y   GG  V P CC GIK+L AA
Sbjct  8    KVAFGALLVSMLVA-APYVNATISCEQVTNWLTPCITYGLFGG-TVPPGCCEGIKTLNAA  65

Query  257  AKTGQ  271
            + T +
Sbjct  66   SNTTE  70


 Score = 50.1 bits (118),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DRR+ C+C+K  A+ + G+N+    +LPGKCG    P+++S  +DCSK+ 
Sbjct  71   DRRAQCNCVKEGAAKIPGLNYDRVNELPGKCGT-TCPYKLSYDLDCSKVN  119



>gb|AER92599.1| putative lipid transfer protein [Linum usitatissimum]
Length=119

 Score = 57.0 bits (136),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +1

Query  247  LRRCQDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            L   +  ADRR  C+CLKSAAS + G+N   AA LPGKCGVK IP++IS   +C+ 
Sbjct  65   LVEARTTADRRQACNCLKSAASKLPGLNPALAAGLPGKCGVK-IPYKISISTNCNT  119


 Score = 44.3 bits (103),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 5/62 (8%)
 Frame = +2

Query  89   STLIICLLVALAPCSEAAVS---CNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            S  + C LVA AP   A VS   C+ V   L PC+SY+T G   V P CC+G+K L   A
Sbjct  11   SVFLFCALVA-APMMNAGVSALSCDQVDGGLAPCVSYLT-GRGAVTPGCCNGMKGLLVEA  68

Query  260  KT  265
            +T
Sbjct  69   RT  70



>ref|XP_008244959.1| PREDICTED: non-specific lipid-transfer protein 1-like [Prunus 
mume]
Length=117

 Score = 56.2 bits (134),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            +  ADR++ C+CLK  + S+SG+N   AA LPGKCGV N+P++I+  ++C+ +K
Sbjct  65   KTTADRQAACNCLKQLSGSISGVNPNNAAALPGKCGV-NVPYKINTFINCAAVK  117


 Score = 44.7 bits (104),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +2

Query  101  ICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +C++V++ P ++A ++C  V S+L PC+ YV KGG  V PACC GI+++   AKT
Sbjct  15   LCMVVSV-PIAQA-ITCGQVSSNLAPCIPYV-KGGGAVPPACCKGIRTVSGLAKT  66



>gb|AAR90329.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 63.2 bits (152),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            Q   DR++ C C+KSAA+ +SGIN+  A+  PGKCGV NIP++ISP  DC+ +K
Sbjct  68   QTTPDRQAACKCIKSAAAGISGINYGIASGPPGKCGV-NIPYKISPSTDCNSVK  120


 Score = 37.7 bits (86),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVT-KGGKKVQPACCSGIKSLYAA  256
            LK + + +  +V  AP ++ AV+C  V SSL PC+ Y+T  G   V P CC GIKSL +A
Sbjct  7    LKLACVAVLCMVVGAPLAQGAVTCGQVTSSLAPCIGYLTGNGAGGVPPGCCGGIKSLNSA  66

Query  257  AKT  265
            A+T
Sbjct  67   AQT  69



>ref|XP_008778766.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 60.5 bits (145),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +1

Query  253  RCQDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            R +  ADRR+VC+CLK+A SS+ G+       +PGKCGV+ IP+ ISP  DCSK+ 
Sbjct  64   RAKTTADRRTVCNCLKNAISSIRGLKPGLVNGIPGKCGVR-IPYTISPSTDCSKVN  118


 Score = 40.4 bits (93),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = +2

Query  122  APCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +P +  A++C  V S+L  C+SY   GG  + P CCSG++ L + AKT
Sbjct  21   SPHAANAITCGQVASALAGCISYARNGG-SIPPNCCSGVRGLASRAKT  67



>ref|XP_004249042.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=116

 Score = 58.5 bits (140),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR+  C+CLKSAA+++ GI+   AA LP  CGV NIP++ISP  DC++++
Sbjct  67   ADRKMACNCLKSAATAIKGIDAGKAAGLPSVCGV-NIPYKISPSTDCNRVQ  116


 Score = 42.4 bits (98),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +++C++V L      AV+C  V S + PCL Y+T  G+     CC GIK L  AA+T
Sbjct  11   VVLCMVVTLVAPHAEAVTCGQVTSGVAPCLPYLT--GRGPLGGCCGGIKGLLGAART  65



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 57.0 bits (136),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            DR++ C+CLKSAA S+S +N   AA LPGKCGV NIP++IS   +C+ 
Sbjct  67   DRQAACNCLKSAAGSISRLNANNAAALPGKCGV-NIPYKISTSTNCAT  113


 Score = 43.9 bits (102),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 3/57 (5%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            LI+C+++A  P +E+A++C  V ++L PCL Y+ +GG      CC G+++L +AA T
Sbjct  11   LIMCIVIA--PMAESAITCGRVSAALAPCLGYL-QGGPGPSAQCCGGVRNLNSAAVT  64



>sp|Q43766.1|NLTP3_HORVU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; AltName: Full=CW-19; AltName: Full=CW-20; Short=CW20; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA48623.1| Cw-19 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
Length=118

 Score = 55.8 bits (133),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +1

Query  259  QDGADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKI  417
            Q  AD+++ C CLKS A+S+ GIN    + +PGKCGV ++PF IS   DC+K+
Sbjct  66   QSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGV-SVPFPISMSTDCNKV  117


 Score = 45.1 bits (105),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 4/53 (8%)
 Frame = +2

Query  107  LLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            LLVA    ++AA+SC  V S+L PC+SY    G K   ACCSG+K L  AA++
Sbjct  19   LLVA----TDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQS  67



>gb|ABA33854.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=121

 Score = 60.5 bits (145),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADRR+ C+CLK+AA+ VSG+N   AA +P KCGV +IP+ IS   DCS++ 
Sbjct  72   ADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGV-SIPYTISTSTDCSRVN  121


 Score = 40.4 bits (93),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  143  VSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            +SC  V S++ PC+SY    G      CCSG++SL  AA+T
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLKNAART  70



>gb|AGN56423.1| non-specific lipid transfer protein 3 [Linum usitatissimum]
Length=103

 Score = 55.8 bits (133),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            DR++ C CLKSAAS V GIN+  A  LPGKCGV N+ F IS  V+C+ 
Sbjct  57   DRQAACRCLKSAASGVRGINYGLAGGLPGKCGV-NVGFPISQSVNCAT  103


 Score = 44.7 bits (104),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  110  LVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            ++A +  ++ A++C  V S + PCL Y+ +G   + PACC GIKSL AAA +
Sbjct  4    MLAASQIADGAITCGRVASGIAPCLGYI-RGMAPLTPACCGGIKSLNAAASS  54



>gb|AAM66088.1| nonspecific lipid-transfer protein precursor-like protein [Arabidopsis 
thaliana]
Length=115

 Score = 50.8 bits (120),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = +2

Query  80   LKFSTLIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAA  259
            L+F T ++ L V +    +AA+SC TV  SL PC +Y++KGG  V P+CC+G+K+L + A
Sbjct  5    LRFFTCLV-LTVCIVASVDAAISCGTVAGSLAPCATYLSKGG-LVPPSCCAGVKTLNSMA  62

Query  260  KT  265
            KT
Sbjct  63   KT  64


 Score = 50.1 bits (118),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR+  C C++S A S+SG+N   A+ LPGKCGV +IP+ IS   +C+ IK
Sbjct  67   DRQQACRCIQSTAKSISGLNPSXASGLPGKCGV-SIPYPISMSTNCNNIK  115



>gb|ACZ06858.1| lipid transfer protein [Glycine soja]
Length=122

 Score = 50.8 bits (120),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = +2

Query  122  APCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAK-TGQIAGACA  289
            AP ++AA++C  V   + PC SY+  GGK  Q ACC+G+KSL +AAK T    GAC+
Sbjct  23   APMAQAAITCGQVAGDMSPCFSYLRSGGKPSQ-ACCNGVKSLSSAAKTTADRQGACS  78


 Score = 50.1 bits (118),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVS-GINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR+  CSCLK+ A+++   +N   AA LPGKCGV +IP++IS   +C+ IK
Sbjct  71   ADRQGACSCLKNLANNMGQSLNAGNAASLPGKCGV-SIPYKISTSTNCATIK  121



>ref|XP_006429566.1| hypothetical protein CICLE_v10013119mg [Citrus clementina]
 gb|ESR42806.1| hypothetical protein CICLE_v10013119mg [Citrus clementina]
Length=122

 Score = 50.8 bits (120),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSK  414
            DR++ C+CLK A  ++ GI    AA LP +CGV+ IP++ISP  DCS+
Sbjct  67   DRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVR-IPYKISPSTDCSR  113


 Score = 50.1 bits (118),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  95   LIICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            L++C+LV  AP + A ++C  V +SL PC+ ++  GG+   P CCSG++SL  AA+T
Sbjct  10   LLLCILVT-APVTNA-ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAART  64



>gb|AET05731.1| lipid transfer protein isoform b, partial [Pyrus communis]
Length=94

 Score = 56.6 bits (135),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +1

Query  271  DRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            DR++ C+CLK+ A SVSG+N   A  LPGKCGV N+P++IS   +C+ +K
Sbjct  46   DRQAACNCLKNLAGSVSGVNPGNAESLPGKCGV-NVPYKISTSTNCATVK  94


 Score = 44.3 bits (103),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  140  AVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAAAKT  265
            A++C+ V ++L PC++YV  GG  V PACC+GIK++   AKT
Sbjct  3    AITCSQVSANLAPCINYVRSGG-AVPPACCNGIKTINGLAKT  43



>gb|AAY83344.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 53.1 bits (126),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +1

Query  268  ADRRSVCSCLKSAASSVSGINFKYAAQLPGKCGVKNIPFQISPKVDCSKIK  420
            ADR++ C+CLK A+ ++ G+N   AA LPGK GV N+P++IS   +C+ +K
Sbjct  68   ADRQTTCNCLKQASGAIKGLNPNLAAGLPGKXGV-NVPYKISTSTNCAAVK  117


 Score = 47.0 bits (110),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 45/63 (71%), Gaps = 4/63 (6%)
 Frame = +2

Query  80   LKFSTL-IICLLVALAPCSEAAVSCNTVFSSLVPCLSYVTKGGKKVQPACCSGIKSLYAA  256
            +K S + ++C++VAL P ++A ++C  V SS+ PC++YV  GG  V   CC+GI+SL +A
Sbjct  7    MKLSLVALLCIVVAL-PIAQA-ITCGQVASSIAPCVNYVKSGG-AVPAGCCNGIRSLNSA  63

Query  257  AKT  265
            AKT
Sbjct  64   AKT  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 969971295884