BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82289_g1_i1 len=1399 path=[1377:0-1398]

Length=1399
                                                                      Score     E

ref|XP_009625033.1|  PREDICTED: uncharacterized protein LOC104115986    254   2e-75   
ref|XP_009792811.1|  PREDICTED: uncharacterized protein LOC104239794    166   2e-43   
ref|XP_007132355.1|  hypothetical protein PHAVU_011G087700g             160   2e-40   
ref|XP_007132356.1|  hypothetical protein PHAVU_011G087800g             155   5e-39   
ref|XP_010319948.1|  PREDICTED: uncharacterized protein LOC104647076    152   3e-38   
ref|XP_007147205.1|  hypothetical protein PHAVU_006G104400g             152   7e-38   
ref|XP_004494967.1|  PREDICTED: uncharacterized protein LOC101508328    152   1e-37   
ref|XP_004495587.1|  PREDICTED: uncharacterized protein LOC101488962    149   1e-36   
gb|KEH24577.1|  calcium-dependent lipid-binding (CaLB domain) fam...    149   2e-36   
ref|XP_006577748.1|  PREDICTED: uncharacterized protein LOC102667983    147   5e-36   
ref|XP_003535375.1|  PREDICTED: uncharacterized protein LOC100795448    146   9e-36   
ref|XP_002325345.1|  hypothetical protein POPTR_0019s03780g             145   1e-35   Populus trichocarpa [western balsam poplar]
emb|CDP04278.1|  unnamed protein product                                144   1e-34   
ref|XP_004155136.1|  PREDICTED: uncharacterized protein LOC101227028    143   1e-34   
ref|XP_004152866.1|  PREDICTED: uncharacterized protein LOC101218582    142   2e-34   
ref|XP_002319115.2|  hypothetical protein POPTR_0013s04590g             142   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_003590980.1|  hypothetical protein MTR_1g080360                  142   4e-34   
ref|XP_011036375.1|  PREDICTED: uncharacterized protein LOC105133911    141   7e-34   
ref|XP_002521996.1|  conserved hypothetical protein                     141   8e-34   Ricinus communis
ref|XP_007205372.1|  hypothetical protein PRUPE_ppa007276mg             138   7e-33   
gb|KCW85316.1|  hypothetical protein EUGRSUZ_B02156                     136   2e-32   
ref|XP_010043310.1|  PREDICTED: uncharacterized protein LOC104432551    136   2e-32   
ref|XP_008441789.1|  PREDICTED: uncharacterized protein LOC103485843    136   2e-32   
gb|KHN31488.1|  hypothetical protein glysoja_035595                     133   3e-32   
ref|XP_011077059.1|  PREDICTED: uncharacterized protein LOC105161156    135   6e-32   
gb|KDP23730.1|  hypothetical protein JCGZ_23563                         135   7e-32   
ref|XP_008460692.1|  PREDICTED: uncharacterized protein LOC103499460    137   1e-31   
ref|XP_004173200.1|  PREDICTED: uncharacterized LOC101215059            136   1e-31   
ref|XP_004147189.1|  PREDICTED: uncharacterized protein LOC101215059    136   1e-31   
ref|XP_008218351.1|  PREDICTED: uncharacterized protein LOC103318712    133   7e-31   
ref|XP_009343786.1|  PREDICTED: uncharacterized protein LOC103935702    132   1e-30   
ref|XP_008370760.1|  PREDICTED: uncharacterized protein LOC103434221    132   1e-30   
ref|XP_011038591.1|  PREDICTED: uncharacterized protein LOC105135426    131   2e-30   
ref|XP_009795461.1|  PREDICTED: uncharacterized protein LOC104242159    130   5e-30   
ref|XP_008366882.1|  PREDICTED: uncharacterized protein LOC103430513    130   6e-30   
ref|XP_009379739.1|  PREDICTED: uncharacterized protein LOC103968123    130   7e-30   
ref|XP_008224037.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    130   1e-29   
ref|XP_007226487.1|  hypothetical protein PRUPE_ppa026634mg             130   1e-29   
ref|XP_008340669.1|  PREDICTED: uncharacterized protein LOC103403599    130   2e-29   
ref|XP_009792812.1|  PREDICTED: uncharacterized protein LOC104239795    128   3e-29   
ref|XP_008388740.1|  PREDICTED: uncharacterized protein LOC103451084    127   4e-29   
ref|XP_002314508.1|  C2 domain-containing family protein                128   4e-29   Populus trichocarpa [western balsam poplar]
emb|CDO99320.1|  unnamed protein product                                128   5e-29   
gb|EYU43768.1|  hypothetical protein MIMGU_mgv1a006114mg                127   7e-29   
ref|XP_009625035.1|  PREDICTED: uncharacterized protein LOC104115988    126   1e-28   
ref|XP_009357966.1|  PREDICTED: uncharacterized protein LOC103948651    127   1e-28   
ref|XP_011041447.1|  PREDICTED: uncharacterized protein LOC105137420    125   3e-28   
ref|XP_010667096.1|  PREDICTED: uncharacterized protein LOC104884184    125   3e-28   
gb|EYU39518.1|  hypothetical protein MIMGU_mgv1a007478mg                125   3e-28   
ref|XP_006358324.1|  PREDICTED: uncharacterized protein LOC102592049    123   5e-28   
gb|KDO41882.1|  hypothetical protein CISIN_1g041258mg                   125   6e-28   
ref|XP_006489752.1|  PREDICTED: uncharacterized protein DDB_G0271...    125   6e-28   
gb|KCW57324.1|  hypothetical protein EUGRSUZ_H00123                     124   6e-28   
emb|CDP04279.1|  unnamed protein product                                123   8e-28   
ref|XP_004242771.1|  PREDICTED: formin-J                                123   8e-28   
ref|XP_010025827.1|  PREDICTED: uncharacterized protein LOC104416087    124   8e-28   
ref|XP_010105208.1|  hypothetical protein L484_011265                   125   1e-27   
ref|XP_002311697.2|  C2 domain-containing family protein                124   1e-27   Populus trichocarpa [western balsam poplar]
gb|KDO53064.1|  hypothetical protein CISIN_1g035970mg                   123   1e-27   
ref|XP_006437469.1|  hypothetical protein CICLE_v10033675mg             123   1e-27   
ref|XP_004297932.1|  PREDICTED: uncharacterized protein LOC101311957    124   2e-27   
ref|XP_004304780.1|  PREDICTED: uncharacterized protein LOC101296310    123   2e-27   
ref|XP_006420366.1|  hypothetical protein CICLE_v10006849mg             123   3e-27   
ref|XP_011091348.1|  PREDICTED: uncharacterized protein LOC105171810    124   3e-27   
ref|XP_010674263.1|  PREDICTED: uncharacterized protein LOC104890461    121   3e-27   
ref|XP_011029742.1|  PREDICTED: uncharacterized protein LOC105129399    122   4e-27   
ref|XP_009621969.1|  PREDICTED: uncharacterized protein LOC104113496    123   4e-27   
ref|XP_006345991.1|  PREDICTED: uncharacterized protein LOC102591105    121   4e-27   
ref|XP_010264865.1|  PREDICTED: uncharacterized protein LOC104602763    121   5e-27   
ref|XP_004253020.1|  PREDICTED: uncharacterized protein LOC101244358    122   5e-27   
gb|AFK13837.1|  C2 domain-containing protein SRC2                       120   6e-27   
ref|XP_002282144.1|  PREDICTED: uncharacterized protein LOC100256206    122   7e-27   Vitis vinifera
emb|CAN83108.1|  hypothetical protein VITISV_026570                     122   7e-27   Vitis vinifera
ref|XP_004497792.1|  PREDICTED: uncharacterized protein LOC101505544    121   7e-27   
ref|XP_006356117.1|  PREDICTED: uncharacterized protein LOC102592369    121   1e-26   
ref|XP_009591729.1|  PREDICTED: uncharacterized protein LOC104088710    120   1e-26   
ref|XP_006342681.1|  PREDICTED: uncharacterized protein LOC102596842    121   2e-26   
ref|XP_004234051.1|  PREDICTED: uncharacterized protein LOC101265801    120   2e-26   
ref|XP_004239688.1|  PREDICTED: putative uncharacterized protein ...    120   2e-26   
ref|XP_007035276.1|  Calcium-dependent lipid-binding family prote...    120   2e-26   
ref|XP_007144140.1|  hypothetical protein PHAVU_007G132000g             122   2e-26   
emb|CDY18242.1|  BnaC05g02650D                                          119   2e-26   
ref|XP_002528347.1|  hypothetical protein RCOM_1217340                  119   3e-26   Ricinus communis
gb|KDP33324.1|  hypothetical protein JCGZ_12873                         118   7e-26   
emb|CBI23723.3|  unnamed protein product                                118   9e-26   
ref|XP_009604695.1|  PREDICTED: uncharacterized protein LOC104099416    119   1e-25   
ref|XP_009804994.1|  PREDICTED: uncharacterized protein DDB_G0292...    119   1e-25   
ref|XP_009795412.1|  PREDICTED: uncharacterized protein LOC104242110    119   1e-25   
ref|XP_003555498.1|  PREDICTED: uncharacterized protein LOC100812185    119   1e-25   
ref|XP_003535258.1|  PREDICTED: uncharacterized protein LOC100787698    119   1e-25   
ref|XP_010469493.1|  PREDICTED: uncharacterized protein LOC104749540    119   2e-25   
ref|XP_010509905.1|  PREDICTED: serine/arginine repetitive matrix...    119   2e-25   
ref|XP_010413889.1|  PREDICTED: uncharacterized protein LOC104700118    119   2e-25   
ref|XP_007030351.1|  Calcium-dependent lipid-binding (CaLB domain...    116   2e-25   
ref|XP_006418119.1|  hypothetical protein EUTSA_v10007144mg             118   3e-25   
gb|KFK31057.1|  hypothetical protein AALP_AA6G062700                    115   3e-25   
ref|XP_002884443.1|  hypothetical protein ARALYDRAFT_477695             115   4e-25   
emb|CDX89815.1|  BnaA10g02670D                                          117   4e-25   
ref|XP_003590735.1|  RNA-binding protein 12B                            118   5e-25   
gb|KFK37859.1|  hypothetical protein AALP_AA3G038400                    115   5e-25   
ref|XP_006293875.1|  hypothetical protein CARUB_v10022860mg             117   6e-25   
ref|XP_002889512.1|  hypothetical protein ARALYDRAFT_470434             117   6e-25   
ref|NP_171948.1|  calcium-dependent lipid-binding domain-containi...    117   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003556915.1|  PREDICTED: uncharacterized protein LOC100779058    115   8e-25   
ref|XP_002881275.1|  C2 domain-containing protein                       117   9e-25   
ref|XP_010025828.1|  PREDICTED: uncharacterized protein LOC104416088    109   9e-25   
ref|XP_006410470.1|  hypothetical protein EUTSA_v10016412mg             117   1e-24   
ref|XP_011073723.1|  PREDICTED: uncharacterized protein LOC105158612    115   1e-24   
ref|XP_011077131.1|  PREDICTED: uncharacterized protein LOC105161211    114   1e-24   
emb|CDY23753.1|  BnaC04g43690D                                          117   1e-24   
ref|NP_180890.1|  calcium-dependent lipid-binding domain-containi...    116   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475114.1|  PREDICTED: uncharacterized protein LOC104754591    116   1e-24   
ref|XP_010485810.1|  PREDICTED: putative lysozyme-like protein          114   1e-24   
ref|XP_010457504.1|  PREDICTED: uncharacterized protein LOC104738975    116   1e-24   
ref|XP_009141305.1|  PREDICTED: uncharacterized protein LOC103865261    116   1e-24   
ref|XP_010463915.1|  PREDICTED: uncharacterized protein LOC104744544    114   2e-24   
ref|XP_010483923.1|  PREDICTED: uncharacterized protein LOC104762347    116   2e-24   
gb|AAB80639.1|  Contains similarity to Glycine SRC2 (gb|AB000130)       116   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118638.1|  PREDICTED: uncharacterized protein LOC103843645    116   2e-24   
emb|CDY53195.1|  BnaAnng12200D                                          116   2e-24   
ref|XP_009119477.1|  PREDICTED: uncharacterized protein LOC103844449    115   2e-24   
emb|CDY37732.1|  BnaA04g19360D                                          116   2e-24   
emb|CDY59181.1|  BnaC08g50140D                                          116   2e-24   
ref|XP_006297897.1|  hypothetical protein CARUB_v10013938mg             113   2e-24   
ref|XP_010556931.1|  PREDICTED: uncharacterized protein LOC104826097    115   2e-24   
ref|XP_004495257.1|  PREDICTED: proteoglycan 4-like                     116   3e-24   
ref|XP_009123999.1|  PREDICTED: uncharacterized protein LOC103848923    113   3e-24   
emb|CDY49343.1|  BnaA05g33050D                                          113   3e-24   
ref|XP_007145354.1|  hypothetical protein PHAVU_007G232100g             113   4e-24   
gb|KFK42792.1|  hypothetical protein AALP_AA1G039700                    115   4e-24   
ref|XP_010522448.1|  PREDICTED: uncharacterized protein LOC104801063    115   4e-24   
emb|CDY42921.1|  BnaC05g47300D                                          112   4e-24   
gb|AAM67146.1|  unknown                                                 112   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303752.1|  hypothetical protein CARUB_v10011922mg             114   7e-24   
ref|XP_006408192.1|  hypothetical protein EUTSA_v10020890mg             111   9e-24   
ref|XP_010102203.1|  hypothetical protein L484_024484                   111   1e-23   
ref|XP_009143873.1|  PREDICTED: uncharacterized protein LOC103867544    113   1e-23   
ref|XP_010557577.1|  PREDICTED: uncharacterized protein LOC104826528    112   1e-23   
gb|ABK28543.1|  unknown                                                 108   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb|EPS62035.1|  hypothetical protein M569_12761                         104   7e-23   
ref|XP_011069440.1|  PREDICTED: uncharacterized protein LOC105155266    109   8e-23   
ref|NP_566225.4|  calcium-dependent lipid-binding family protein        108   9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010558947.1|  PREDICTED: uncharacterized protein LOC104827473    108   1e-22   
gb|AAF26778.1|AC016829_2  hypothetical protein                          107   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136211.1|  PREDICTED: uncharacterized protein LOC103860372    108   2e-22   
ref|XP_010467176.1|  PREDICTED: uncharacterized protein LOC104747266    107   2e-22   
gb|KFK39933.1|  hypothetical protein AALP_AA3G308600                    107   2e-22   
ref|XP_010518533.1|  PREDICTED: uncharacterized protein LOC104793798    107   2e-22   
ref|XP_002885870.1|  hypothetical protein ARALYDRAFT_480303             107   2e-22   
ref|XP_010262513.1|  PREDICTED: uncharacterized protein LOC104601031    106   3e-22   
emb|CDX89605.1|  BnaC03g45190D                                          107   3e-22   
ref|NP_178968.1|  C2 domain-containing protein                          107   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488836.1|  PREDICTED: uncharacterized protein LOC104766620    107   3e-22   
gb|KCW57325.1|  hypothetical protein EUGRSUZ_H00124                     102   3e-22   
emb|CDY37206.1|  BnaA09g08270D                                          106   8e-22   
ref|XP_009112245.1|  PREDICTED: uncharacterized protein LOC103837642    106   1e-21   
emb|CDY37207.1|  BnaA09g08280D                                          106   1e-21   
emb|CDX81442.1|  BnaC09g08530D                                          105   1e-21   
ref|XP_006300066.1|  hypothetical protein CARUB_v10016294mg             105   1e-21   
ref|XP_009590587.1|  PREDICTED: ankyrin repeat-containing protein...    107   2e-21   
ref|XP_009767920.1|  PREDICTED: uncharacterized protein LOC104218993    107   2e-21   
ref|XP_010251574.1|  PREDICTED: uncharacterized protein LOC104593437    103   2e-21   
ref|XP_009377282.1|  PREDICTED: BON1-associated protein 2               102   2e-21   
ref|XP_008801291.1|  PREDICTED: uncharacterized protein LOC103715451    103   2e-21   
ref|XP_010920373.1|  PREDICTED: CASP-like protein 4A1                   105   3e-21   
ref|XP_004247791.2|  PREDICTED: uncharacterized protein LOC101245204    106   3e-21   
ref|XP_010026783.1|  PREDICTED: protein bunched, class 2/F/G isof...    105   4e-21   
gb|KCW60206.1|  hypothetical protein EUGRSUZ_H02915                     105   4e-21   
ref|XP_003590193.1|  hypothetical protein MTR_1g045780                  104   5e-21   
emb|CDX92066.1|  BnaC03g33680D                                          103   7e-21   
ref|XP_010533203.1|  PREDICTED: uncharacterized protein LOC104809...    104   7e-21   
ref|XP_009134757.1|  PREDICTED: uncharacterized protein LOC103859027    103   1e-20   
emb|CDX74193.1|  BnaA03g28540D                                          102   1e-20   
ref|XP_006409691.1|  hypothetical protein EUTSA_v10022712mg             103   1e-20   
gb|EYU39778.1|  hypothetical protein MIMGU_mgv1a009123mg                102   1e-20   
ref|XP_002511946.1|  conserved hypothetical protein                     100   2e-20   Ricinus communis
ref|XP_008362824.1|  PREDICTED: uncharacterized protein LOC103426513  99.4    5e-20   
ref|XP_010549648.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   7e-20   
ref|XP_010456220.1|  PREDICTED: BON1-associated protein 2-like        97.8    1e-19   
ref|XP_009385178.1|  PREDICTED: uncharacterized protein LOC103972545  98.2    2e-19   
ref|XP_009401202.1|  PREDICTED: uncharacterized protein LOC103985274  97.8    2e-19   
ref|XP_002276427.1|  PREDICTED: uncharacterized protein LOC100258448  97.4    2e-19   Vitis vinifera
ref|XP_006842901.1|  hypothetical protein AMTR_s00075p00073210        99.0    4e-19   
ref|XP_009420756.1|  PREDICTED: uncharacterized protein LOC104000435  96.7    4e-19   
ref|XP_004308328.1|  PREDICTED: uncharacterized protein LOC101301728  97.1    4e-19   
ref|XP_009111426.1|  PREDICTED: uncharacterized protein LOC103836878  96.3    5e-19   
ref|XP_006396291.1|  hypothetical protein EUTSA_v10028892mg           95.1    1e-18   
ref|XP_010936043.1|  PREDICTED: uncharacterized protein LOC105055767  95.1    2e-18   
ref|XP_002872904.1|  C2 domain-containing protein                     94.7    2e-18   
ref|XP_006289671.1|  hypothetical protein CARUB_v10003230mg           94.4    2e-18   
ref|NP_192029.1|  calcium-dependent lipid-binding domain-containi...  94.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009764572.1|  PREDICTED: uncharacterized protein LOC104216252  94.7    2e-18   
ref|XP_010544424.1|  PREDICTED: uncharacterized protein LOC104817045  94.4    3e-18   
ref|XP_010422779.1|  PREDICTED: BON1-associated protein 2-like        94.0    3e-18   
ref|XP_009350266.1|  PREDICTED: uncharacterized protein LOC103941795  94.0    4e-18   
ref|XP_007218843.1|  hypothetical protein PRUPE_ppa010336mg           93.6    4e-18   
ref|XP_007051663.1|  Calcium-dependent lipid-binding family prote...  93.2    7e-18   
ref|XP_010427687.1|  PREDICTED: BON1-associated protein 2-like        92.4    1e-17   
ref|XP_008233233.1|  PREDICTED: uncharacterized protein LOC103332288  92.8    1e-17   
ref|XP_009591358.1|  PREDICTED: uncharacterized protein LOC104088405  92.4    1e-17   
ref|XP_009347863.1|  PREDICTED: uncharacterized protein LOC103939495  92.4    1e-17   
ref|XP_010092894.1|  hypothetical protein L484_022489                 91.7    2e-17   
gb|EYU32591.1|  hypothetical protein MIMGU_mgv1a006056mg              94.0    3e-17   
ref|XP_009406969.1|  PREDICTED: uncharacterized protein LOC103989745  90.9    6e-17   
emb|CDY07180.1|  BnaCnng01950D                                        94.4    6e-17   
ref|XP_010669605.1|  PREDICTED: uncharacterized protein LOC104886787  90.1    7e-17   
gb|KDP28538.1|  hypothetical protein JCGZ_14309                       90.1    8e-17   
emb|CDY48509.1|  BnaA09g00140D                                        94.0    8e-17   
ref|XP_008796382.1|  PREDICTED: uncharacterized protein LOC103711856  90.1    8e-17   
gb|EYU38921.1|  hypothetical protein MIMGU_mgv1a022778mg              89.7    9e-17   
ref|XP_006842598.1|  hypothetical protein AMTR_s00077p00167680        90.9    1e-16   
ref|XP_006339653.1|  PREDICTED: uncharacterized protein LOC102592387  87.8    4e-16   
ref|XP_011023248.1|  PREDICTED: uncharacterized protein LOC105124808  87.8    5e-16   
ref|XP_004229965.1|  PREDICTED: BON1-associated protein 2             87.4    6e-16   
gb|KDO86360.1|  hypothetical protein CISIN_1g047341mg                 87.4    6e-16   
ref|XP_006444911.1|  hypothetical protein CICLE_v10021815mg           87.0    7e-16   
gb|EPS68074.1|  hypothetical protein M569_06693                       86.7    8e-16   
emb|CDP17419.1|  unnamed protein product                              86.7    1e-15   
emb|CDP08734.1|  unnamed protein product                              86.3    2e-15   
ref|XP_002301388.2|  hypothetical protein POPTR_0002s16800g           84.7    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_011093241.1|  PREDICTED: uncharacterized protein LOC105173247  84.0    8e-15   
ref|XP_010055064.1|  PREDICTED: uncharacterized protein LOC104443389  83.6    1e-14   
ref|XP_003553776.1|  PREDICTED: uncharacterized protein LOC100793541  82.8    2e-14   
emb|CAN79006.1|  hypothetical protein VITISV_040896                   84.0    3e-14   Vitis vinifera
ref|XP_011093070.1|  PREDICTED: uncharacterized protein LOC105173112  82.0    4e-14   
gb|KDP30266.1|  hypothetical protein JCGZ_17048                       80.9    5e-14   
ref|XP_006577334.1|  PREDICTED: BON1-associated protein 2-like        80.5    8e-14   
ref|XP_008679175.1|  PREDICTED: uncharacterized protein LOC103654122  80.5    1e-13   
ref|XP_004133823.1|  PREDICTED: uncharacterized protein LOC101212280  79.7    2e-13   
gb|ABK23345.1|  unknown                                               78.6    3e-13   Picea sitchensis
ref|XP_007031704.1|  Calcium-dependent lipid-binding (CaLB domain...  79.7    4e-13   
gb|AES82742.2|  calcium-dependent lipid-binding (CaLB domain) fam...  79.0    4e-13   
ref|XP_007147256.1|  hypothetical protein PHAVU_006G109100g           78.2    6e-13   
ref|XP_003626524.1|  hypothetical protein MTR_7g116840                79.0    6e-13   
gb|ABK22654.1|  unknown                                               77.0    1e-12   Picea sitchensis
ref|XP_004494776.1|  PREDICTED: uncharacterized protein LOC101496947  77.8    1e-12   
ref|XP_008437926.1|  PREDICTED: uncharacterized protein LOC103483209  77.4    2e-12   
ref|XP_008791481.1|  PREDICTED: uncharacterized protein LOC103708363  77.0    2e-12   
gb|EAY87999.1|  hypothetical protein OsI_09421                        77.0    2e-12   Oryza sativa Indica Group [Indian rice]
gb|AFG52315.1|  hypothetical protein 2_3193_01                        75.1    2e-12   
ref|XP_008798687.1|  PREDICTED: uncharacterized protein LOC103713510  75.9    3e-12   
gb|AFG52320.1|  hypothetical protein 2_3193_01                        74.3    3e-12   
gb|AEW08214.1|  hypothetical protein 2_3193_01                        74.3    4e-12   
ref|XP_010936622.1|  PREDICTED: uncharacterized protein LOC105056210  75.1    4e-12   
ref|XP_003569491.1|  PREDICTED: uncharacterized protein LOC100842238  75.5    1e-11   
ref|XP_002970540.1|  hypothetical protein SELMODRAFT_441151           74.3    1e-11   
emb|CDM83573.1|  unnamed protein product                              73.6    4e-11   
ref|XP_002976843.1|  hypothetical protein SELMODRAFT_443351           73.6    4e-11   
dbj|BAK03653.1|  predicted protein                                    73.2    4e-11   
ref|NP_001170657.1|  hypothetical protein                             72.8    5e-11   Zea mays [maize]
ref|XP_004985379.1|  PREDICTED: uncharacterized protein LOC101774...  73.2    6e-11   
ref|XP_004985378.1|  PREDICTED: uncharacterized protein LOC101774...  73.2    6e-11   
gb|ABK24127.1|  unknown                                               70.9    1e-10   Picea sitchensis
ref|XP_010245272.1|  PREDICTED: uncharacterized protein LOC104588843  70.9    1e-10   
emb|CDY17163.1|  BnaA05g10250D                                        67.8    1e-10   
ref|XP_010914657.1|  PREDICTED: uncharacterized protein LOC105039993  71.2    2e-10   
ref|XP_002453028.1|  hypothetical protein SORBIDRAFT_04g037000        71.2    2e-10   Sorghum bicolor [broomcorn]
ref|XP_002456081.1|  hypothetical protein SORBIDRAFT_03g030080        71.2    2e-10   Sorghum bicolor [broomcorn]
ref|XP_002978619.1|  hypothetical protein SELMODRAFT_443918           72.0    3e-10   
ref|XP_001778275.1|  predicted protein                                69.7    4e-10   
ref|XP_002272904.1|  PREDICTED: cytokinesis protein sepA-like         70.1    5e-10   Vitis vinifera
gb|ACN40336.1|  unknown                                               69.7    8e-10   Picea sitchensis
ref|XP_002989504.1|  hypothetical protein SELMODRAFT_428112           67.4    1e-09   
ref|XP_010914471.1|  PREDICTED: uncharacterized protein LOC105039856  68.2    2e-09   
ref|XP_002964639.1|  hypothetical protein SELMODRAFT_406042           66.6    2e-09   
ref|NP_001043768.1|  Os01g0659800                                     67.8    4e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ABR17336.1|  unknown                                               67.8    4e-09   Picea sitchensis
gb|AFW83462.1|  C2 domain containing protein                          67.0    5e-09   
ref|XP_008365038.1|  PREDICTED: uncharacterized protein LOC103428692  66.6    6e-09   
ref|XP_010275059.1|  PREDICTED: uncharacterized protein LOC104610232  65.1    7e-09   
ref|XP_002968005.1|  hypothetical protein SELMODRAFT_440190           65.5    7e-09   
ref|XP_003572941.1|  PREDICTED: uncharacterized protein LOC100843074  66.2    8e-09   
gb|ABR18223.1|  unknown                                               65.9    2e-08   Picea sitchensis
ref|NP_001152648.1|  C2 domain containing protein                     65.5    2e-08   Zea mays [maize]
ref|XP_006827562.1|  hypothetical protein AMTR_s00009p00222310        64.7    2e-08   
ref|XP_008225460.1|  PREDICTED: uncharacterized protein LOC103325105  63.5    3e-08   
ref|XP_009400560.1|  PREDICTED: uncharacterized protein LOC103984726  64.3    3e-08   
ref|XP_010101600.1|  hypothetical protein L484_001120                 62.8    5e-08   
ref|XP_010096455.1|  hypothetical protein L484_001160                 62.4    1e-07   
ref|XP_001782642.1|  predicted protein                                61.2    4e-07   
ref|XP_002992362.1|  hypothetical protein SELMODRAFT_430579           60.8    5e-07   
ref|XP_002967740.1|  hypothetical protein SELMODRAFT_408999           60.1    7e-07   
ref|XP_007213255.1|  hypothetical protein PRUPE_ppb020632mg           58.9    8e-07   
ref|XP_001772125.1|  predicted protein                                61.6    8e-07   
ref|NP_001048499.1|  Os02g0815100                                     59.7    1e-06   
gb|ABK23901.1|  unknown                                               60.1    2e-06   
ref|XP_010440511.1|  PREDICTED: uncharacterized protein LOC104723800  58.9    2e-06   
ref|XP_009362765.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  59.7    2e-06   
ref|XP_006371351.1|  hypothetical protein POPTR_0019s09350g           58.9    3e-06   
ref|XP_010999508.1|  PREDICTED: formin-G                              58.9    4e-06   
gb|KDP32089.1|  hypothetical protein JCGZ_12550                       59.3    4e-06   
ref|XP_009791711.1|  PREDICTED: uncharacterized protein LOC104238906  58.5    4e-06   
ref|XP_009600682.1|  PREDICTED: uncharacterized protein LOC104096081  58.5    4e-06   
ref|XP_011084443.1|  PREDICTED: uncharacterized protein LOC105166693  58.2    5e-06   
ref|XP_003529574.1|  PREDICTED: toll-interacting protein-like         58.2    5e-06   
ref|XP_002520901.1|  conserved hypothetical protein                   58.5    5e-06   
ref|XP_004955273.1|  PREDICTED: uncharacterized protein LOC101765467  57.8    5e-06   
ref|XP_010934387.1|  PREDICTED: large proline-rich protein bag6-like  58.2    5e-06   
gb|EEE55117.1|  hypothetical protein OsJ_02891                        57.8    6e-06   
ref|XP_008375255.1|  PREDICTED: uncharacterized protein LOC103438493  58.2    6e-06   
ref|XP_010550541.1|  PREDICTED: uncharacterized protein LOC104821382  57.4    7e-06   
ref|XP_008347213.1|  PREDICTED: uncharacterized protein LOC103410258  58.2    7e-06   
ref|XP_006605265.1|  PREDICTED: uncharacterized protein LOC102668124  55.8    8e-06   
ref|XP_007218318.1|  hypothetical protein PRUPE_ppa008392mg           57.8    9e-06   
ref|XP_004307752.1|  PREDICTED: uncharacterized protein LOC101311043  57.8    9e-06   
ref|XP_006358166.1|  PREDICTED: uncharacterized protein LOC102591162  57.8    9e-06   
ref|XP_006342789.1|  PREDICTED: formin-A-like isoform X1              57.4    9e-06   
ref|XP_009627866.1|  PREDICTED: uncharacterized protein LOC104118341  57.0    9e-06   
ref|XP_008234153.1|  PREDICTED: verprolin                             57.4    1e-05   
ref|XP_004235211.1|  PREDICTED: uncharacterized protein LOC101249714  57.4    1e-05   
ref|XP_011076131.1|  PREDICTED: WW domain-containing protein C11B...  57.0    1e-05   
gb|ABU98655.1|  SRC2 protein                                          57.0    2e-05   
gb|KDO67597.1|  hypothetical protein CISIN_1g020960mg                 57.0    2e-05   
ref|XP_006435975.1|  hypothetical protein CICLE_v10033529mg           56.6    2e-05   
ref|XP_001775930.1|  predicted protein                                56.6    2e-05   
ref|XP_009774894.1|  PREDICTED: uncharacterized protein LOC104224872  55.8    2e-05   
gb|KDP46959.1|  hypothetical protein JCGZ_07976                       55.8    2e-05   
ref|XP_002271409.1|  PREDICTED: BAHD acyltransferase DCR              57.0    3e-05   
ref|XP_010670031.1|  PREDICTED: probable inactive serine/threonin...  56.2    3e-05   
emb|CBI22681.3|  unnamed protein product                              57.0    3e-05   
ref|XP_006486118.1|  PREDICTED: probable inactive serine/threonin...  55.8    3e-05   
ref|XP_001761054.1|  predicted protein                                54.7    4e-05   
gb|EYU20141.1|  hypothetical protein MIMGU_mgv1a024429mg              55.1    4e-05   
ref|XP_010922806.1|  PREDICTED: WW domain-binding protein 11          55.5    5e-05   
ref|XP_003634095.1|  PREDICTED: uncharacterized protein LOC100852496  55.1    5e-05   
ref|XP_008439269.1|  PREDICTED: zinc finger matrin-type protein C...  55.1    5e-05   
ref|XP_010109170.1|  hypothetical protein L484_017111                 55.5    5e-05   
ref|XP_010417623.1|  PREDICTED: uncharacterized protein LOC104703311  55.5    5e-05   
ref|XP_004140766.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.9    6e-05   
gb|KDP37957.1|  hypothetical protein JCGZ_04600                       53.5    6e-05   
ref|XP_002275480.1|  PREDICTED: uncharacterized protein LOC100242355  54.7    6e-05   
ref|XP_008376957.1|  PREDICTED: protein transport protein Sec24-l...  55.1    6e-05   
ref|XP_004157192.1|  PREDICTED: uncharacterized protein LOC101224685  54.7    7e-05   
ref|XP_001758594.1|  predicted protein                                53.9    7e-05   
gb|KCW65820.1|  hypothetical protein EUGRSUZ_G031711                  54.3    7e-05   
emb|CAN69351.1|  hypothetical protein VITISV_017753                   54.3    8e-05   
ref|XP_003609663.1|  hypothetical protein MTR_4g119780                53.5    9e-05   
ref|XP_010068940.1|  PREDICTED: uncharacterized protein LOC104455934  54.7    9e-05   
emb|CAN78886.1|  hypothetical protein VITISV_002549                   54.3    9e-05   
ref|XP_007208693.1|  hypothetical protein PRUPE_ppa1027138mg          53.1    1e-04   
gb|AFK33423.1|  unknown                                               53.5    1e-04   
ref|XP_002271267.1|  PREDICTED: uncharacterized protein LOC100249100  54.3    1e-04   
emb|CAN68775.1|  hypothetical protein VITISV_006805                   53.9    1e-04   
gb|ACU18582.1|  unknown                                               53.5    1e-04   
ref|XP_010269468.1|  PREDICTED: abl interactor homolog                53.5    2e-04   
ref|XP_009363765.1|  PREDICTED: wiskott-Aldrich syndrome protein-...  53.5    2e-04   
ref|XP_004135614.1|  PREDICTED: uncharacterized protein LOC101206742  53.1    2e-04   
gb|KDP21615.1|  hypothetical protein JCGZ_03286                       53.5    2e-04   
ref|XP_004229314.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  53.1    2e-04   
ref|XP_008803020.1|  PREDICTED: WAS/WASL-interacting protein fami...  53.1    2e-04   
ref|XP_002971671.1|  hypothetical protein SELMODRAFT_412188           53.5    2e-04   
ref|XP_003602455.1|  hypothetical protein MTR_3g093550                50.4    3e-04   
ref|XP_002266989.1|  PREDICTED: formin-A                              53.1    3e-04   
ref|XP_009352334.1|  PREDICTED: uncharacterized protein LOC103943719  52.0    3e-04   
ref|XP_004289725.1|  PREDICTED: uncharacterized protein LOC101315189  52.8    3e-04   
ref|XP_011076565.1|  PREDICTED: cleavage and polyadenylation spec...  52.8    3e-04   
ref|XP_009779515.1|  PREDICTED: formin-like protein 18                52.8    3e-04   
gb|KHN02132.1|  hypothetical protein glysoja_046458                   52.8    3e-04   
ref|XP_002965668.1|  hypothetical protein SELMODRAFT_407234           53.1    3e-04   
ref|XP_006827556.1|  hypothetical protein AMTR_s00009p00221230        52.4    3e-04   
ref|XP_008367154.1|  PREDICTED: LOW QUALITY PROTEIN: vasodilator-...  52.8    4e-04   
gb|KEH35505.1|  calcium-dependent lipid-binding (CaLB domain) fam...  52.8    4e-04   
ref|XP_009800792.1|  PREDICTED: WW domain-containing protein C11B...  52.4    4e-04   
ref|XP_002881742.1|  proline-rich family protein                      53.1    4e-04   
ref|XP_008353231.1|  PREDICTED: protein diaphanous homolog 1-like     52.4    5e-04   
ref|XP_011030162.1|  PREDICTED: uncharacterized protein LOC105129684  52.0    5e-04   
ref|XP_009592495.1|  PREDICTED: cytokinesis protein sepA              52.4    5e-04   
ref|XP_006855523.1|  hypothetical protein AMTR_s00057p00209740        52.0    5e-04   
emb|CDP21817.1|  unnamed protein product                              51.6    6e-04   
ref|XP_001759306.1|  predicted protein                                52.0    8e-04   
ref|XP_010505837.1|  PREDICTED: U1 small nuclear ribonucleoprotei...  51.6    9e-04   
gb|KFK27692.1|  hypothetical protein AALP_AA8G416000                  51.2    0.001   
ref|XP_010454681.1|  PREDICTED: uncharacterized protein LOC104736407  50.8    0.001   
gb|EYU25119.1|  hypothetical protein MIMGU_mgv1a021760mg              51.2    0.001   



>ref|XP_009625033.1| PREDICTED: uncharacterized protein LOC104115986 [Nicotiana tomentosiformis]
Length=397

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 159/374 (43%), Positives = 211/374 (56%), Gaps = 69/374 (18%)
 Frame = -1

Query  1210  MIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLA  1031
             M  Q P+K+LEINVISA DLPPVSK LRT+ VA++   H+LTT+V+HNG  NPTWNY++ 
Sbjct  1     MFIQPPFKILEINVISAQDLPPVSKMLRTFAVAYIHPDHRLTTRVDHNGKTNPTWNYKMV  60

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRR  851
             F  DD+ L+S+  +V FEIYNVAWLRDLPIGT  L +NSF+PPLS+K P +R   + IRR
Sbjct  61    FRVDDKFLNSESASVTFEIYNVAWLRDLPIGTTHLMINSFFPPLSSKNPTMRSTTLHIRR  120

Query  850   PSTGQVQGTLNVTVQLIHDSPPET-ESGSQL-----------------------SVSTLN  743
             PS G +QG L+V+VQLI  SP E   SGS+L                       S+ST++
Sbjct  121   PS-GHLQGLLHVSVQLIDTSPLEILPSGSELSSSICTTHVSSKDEKSISDEKFESISTIS  179

Query  742   KRGGETSGEddddddkidgDQENPEPE------IKRGKSVRIVSEKDDASPGDMKLKNCP  581
             K G +T  E+D   +     +   E +      ++R +S RI+S        + K++  P
Sbjct  180   K-GHDTLYEEDITKNINYVVETREENKTQKRGILQRLRSKRIMSNNSSDFSPNQKMRRTP  238

Query  580   SFSASYVSGMHPLPSEVAAGLKKGLYYFPGEEEEYGSSIFENWSVPG----ETKSKSSKT  413
               + S+ SG+ P+PS VA  +KKGLY+  GE  EYGSS+FENW+VPG    E +S  SK+
Sbjct  239   --TVSFCSGVQPIPSIVAEDMKKGLYH-TGEGIEYGSSVFENWTVPGDKDEEIQSMRSKS  295

Query  412   VSW-------RMEHKVIPMAG--KDHGGAAGGSYNTKRTRLSKLQRRsssgggcmscfGN  260
             ++W         EH  I      K H    GG ++                      FG 
Sbjct  296   LTWGSDDQIHLQEHVEIKKKSRPKRHDSDGGGLFSC---------------------FGK  334

Query  259   AYGLRFKFICGSNS  218
             AYG  FK ICGS S
Sbjct  335   AYGFEFKLICGSRS  348



>ref|XP_009792811.1| PREDICTED: uncharacterized protein LOC104239794 [Nicotiana sylvestris]
Length=321

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 166/314 (53%), Gaps = 69/314 (22%)
 Frame = -1

Query  1036  LAFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEI  857
             + F  DD+ L+S+  +V FEIYNVAWLRDLPIGT  L +NSF+PPLS+K P +R   + I
Sbjct  1     MVFRVDDKFLNSESASVTFEIYNVAWLRDLPIGTTHLMINSFFPPLSSKNPTMRSTTLHI  60

Query  856   RRPSTGQVQGTLNVTVQLIHDSPPET-ESGSQL-----------------------SVST  749
             RRPS G +QG L V+VQLI  +P E   SGS+L                       S+ST
Sbjct  61    RRPS-GHLQGLLYVSVQLIDTNPLEILPSGSELSSSICTSHVSSKDEKSISDEKFESIST  119

Query  748   LNKRGGETSGEdddddd---kidgDQENPEPE---IKRGKSVRIVSEKDDASPGDMKLKN  587
             ++K G +T  E+D   +    ++  +EN  P+   ++R +S RI+S        + K++ 
Sbjct  120   ISK-GHDTLYEEDITKNINYVVENREENKSPKRGILQRLRSKRIMSNNSSDFSPNQKMRR  178

Query  586   CPSFSASYVSGMHPLPSEVAAGLKKGLYYFPGEEEEYGSSIFENWSVPG----ETKSKSS  419
              P  + S+ SG+ P+PS VA  +KKGLY+  GE  EYGSS+FENW+VPG    E +S  S
Sbjct  179   TP--TVSFCSGVQPIPSIVAEDMKKGLYH-TGEGIEYGSSVFENWTVPGDKDEEIQSMRS  235

Query  418   KTVSW-------RMEHKVIPMAG--KDHGGAAGGSYNTKRTRLSKLQRRsssgggcmscf  266
             K+++W         EH  I      + H    GG ++                      F
Sbjct  236   KSLTWGSDDQIHMQEHVEIKKKSRPRRHDSDGGGLFSC---------------------F  274

Query  265   GNAYGLRFKFICGS  224
             G AYG  FK ICGS
Sbjct  275   GKAYGFEFKLICGS  288



>ref|XP_007132355.1| hypothetical protein PHAVU_011G087700g [Phaseolus vulgaris]
 gb|ESW04349.1| hypothetical protein PHAVU_011G087700g [Phaseolus vulgaris]
Length=385

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 127/376 (34%), Positives = 184/376 (49%), Gaps = 50/376 (13%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +P++LLE+N+ISA DL PVSK+++ Y VAWLD   KLTT+++ +GH NPTWN +  F  D
Sbjct  6     SPFQLLEVNIISAQDLAPVSKSIKAYAVAWLDPERKLTTQIHPDGHNNPTWNEKFVFRID  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L +D+  V  EIY   WLRD+ +GT  + L++  P    +   +R  A+++RRPS G
Sbjct  66    EDFLYADDSVVMIEIYASTWLRDILVGTVGVLLSNLLPRSINRTSKIRFIALQVRRPS-G  124

Query  838   QVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPEI  659
               QG LN+ V L+  +       S+L  ST+     +   +            + P  E 
Sbjct  125   HPQGILNIGVNLVDPTRRSMPMYSELGSSTVGDWDADPKKQ-------KPMPNQTPSNEF  177

Query  658   KRGKS-----VRIVSEKDDASPGDMKLKNCP-------------------------SFSA  569
                K       R  SEK+D++  D   KN P                         + + 
Sbjct  178   NSAKCKLLTLQRSASEKNDSTINDYTYKNYPKGYEDNEDCQGSELGMPTTKKGMIMNLNG  237

Query  568   SYVSGMHPLPSEVAAGLKKGLYYFP-GEEEEYGSSIFENWSVPGETKSK---SSKTVSWR  401
             S  S + P PS VA  + KGLY FP    ++ G+ +FE W  PG+ K     ++K   WR
Sbjct  238   SLCSDVGPSPSVVATAIAKGLYPFPMMAPQKTGNLVFEGW--PGKEKGPEELNTKIDQWR  295

Query  400   -MEHKVIPMAGKDHGGA--AGGSYNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFIC  230
              ME   +  A  DH G     G +N  + +  + QRRS + GG  SCFG A G  F   C
Sbjct  296   SMERGGV--AVYDHLGQNEKTGKHNVPKGK-GQNQRRSGANGGLFSCFGTAMGCEFSITC  352

Query  229   GSNSkeekkkkkEAGR  182
             G  ++  KK+ K  GR
Sbjct  353   GGGNRSRKKRYKGGGR  368



>ref|XP_007132356.1| hypothetical protein PHAVU_011G087800g [Phaseolus vulgaris]
 gb|ESW04350.1| hypothetical protein PHAVU_011G087800g [Phaseolus vulgaris]
Length=385

 Score =   155 bits (393),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 123/371 (33%), Positives = 179/371 (48%), Gaps = 40/371 (11%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +P++LLE+N+ISA DL PVSK+++ Y VAWLD   KLTT+++ +GH NPTWN +  F  D
Sbjct  6     SPFQLLEVNIISAQDLAPVSKSIKAYAVAWLDPERKLTTQIDPDGHNNPTWNEKFVFRID  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L +D+  V  EIY   WLRD+ +GT  + L++  P    +   +R  A+++RRPS G
Sbjct  66    EDFLYADDSVVMIEIYASTWLRDILVGTVGVLLSNLLPRSINRTSKIRFIALQVRRPS-G  124

Query  838   QVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPEI  659
               QG LN+ V L+  +       S+L  ST+     +   +            E      
Sbjct  125   HPQGILNIGVNLVDPTRRSMPMYSELGSSTVGDW--DADPKKQKPMSNQTPSNEFNSANC  182

Query  658   KRGKSVRIVSEKDDASPGDMKLKNCP-------------------------SFSASYVSG  554
             K     R  SEK+D++  D    N P                         + + S  S 
Sbjct  183   KLLTLQRSASEKNDSTINDYTYNNYPKGYEDNEDCQGSELGMPTTKKGMVMNLNGSLCSD  242

Query  553   MHPLPSEVAAGLKKGLYYFPGEE-EEYGSSIFENWSVPGETKSK---SSKTVSWR-MEHK  389
             + P PS VA  + KGLY FP     + G+ +FE W  PG+ K     ++K   WR ME  
Sbjct  243   VGPSPSVVATAIAKGLYPFPMMAPRKTGNLVFEGW--PGKEKGPEELNTKIDRWRSMERG  300

Query  388   VIPMAGKDHGGA--AGGSYNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFICGSNSk  215
              +  A  DH G     G +N  + +  + QRR  + GG  SCFG A G  F   CG  ++
Sbjct  301   GV--AVYDHLGQNEKTGKHNVLKGK-GQNQRRGGANGGLFSCFGTAMGCEFSITCGGGNR  357

Query  214   eekkkkkEAGR  182
               KK+ +  GR
Sbjct  358   SRKKRYEGGGR  368



>ref|XP_010319948.1| PREDICTED: uncharacterized protein LOC104647076 [Solanum lycopersicum]
Length=313

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 109/301 (36%), Positives = 157/301 (52%), Gaps = 56/301 (19%)
 Frame = -1

Query  1036  LAFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEI  857
             + F  DD+ L+S+  +V FEIYNVAWLRDLPIGT  L +NSF+PPLS+  P +R   + I
Sbjct  1     MIFRVDDKFLNSESPSVMFEIYNVAWLRDLPIGTTQLMINSFFPPLSSNNPTMRSTTLHI  60

Query  856   RRPSTGQVQGTLNVTVQLIHDSPPET-ESGSQLSVSTL----------------NKRGGE  728
             RRPS G +QG L+V+VQLI  +PPE   S S+LS S                  +++   
Sbjct  61    RRPS-GHLQGLLHVSVQLIDTTPPEILCSESELSNSICTTDVSSSKDERRNNCYDEKNDN  119

Query  727   TSGEddddddkidgDQENPEPEIKRGKSVRIVSEKDDA--SPGDMKLKNCPSFSASYVSG  554
             TS   D   ++      +    ++R +S R++S  +    SP + K++   S + S+ SG
Sbjct  120   TSIISDTLYEEEITKNTHDRGMLQRLRSKRLMSNSNSGLLSP-NQKMRR-TSTAVSFCSG  177

Query  553   MHPLPSEVAAGLKKGLYYFPGEEEEYGSSIFENWSVPGE----TKSKSSKTVSWRMEHKV  386
             + P+PS VA  +KKGLY   GE  +YGS IFENW++ GE     +S  SK+++W  + +V
Sbjct  178   VQPIPSLVAEDMKKGLYQ-TGEGIDYGSCIFENWTIQGEKDDEIQSMRSKSLTWGSDDQV  236

Query  385   -----IPMAGK---DHGGAAGGSYNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFIC  230
                  + +  K    H    GG ++                      FG AYG  FK IC
Sbjct  237   RVQELVEIKKKPRRRHDSERGGLFSC---------------------FGKAYGFEFKLIC  275

Query  229   G  227
             G
Sbjct  276   G  276



>ref|XP_007147205.1| hypothetical protein PHAVU_006G104400g [Phaseolus vulgaris]
 gb|ESW19199.1| hypothetical protein PHAVU_006G104400g [Phaseolus vulgaris]
Length=371

 Score =   152 bits (384),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 103/287 (36%), Positives = 143/287 (50%), Gaps = 23/287 (8%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             A Y+LLEINV+SA DLP VSK +R Y V WL    KLTT+V+  GH NPTWN +  F  D
Sbjct  5     AGYQLLEINVMSAQDLPRVSKPVRAYAVGWLHPDRKLTTQVDQEGHTNPTWNEKFVFRVD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             D+ LDSD+  +  EIY  AWL  + IGT  + ++   P  + +KP +R  AV+IRRPS G
Sbjct  65    DQFLDSDDAVITIEIYTQAWLSPVLIGTVGILVSDLLP--TNRKPKLRFVAVQIRRPS-G  121

Query  838   QVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPEI  659
             + QG LN+ V L+  +       S LS S         S ++     + D ++ +P    
Sbjct  122   RTQGILNIGVTLLDSTMRSMPLYSDLSSSDGGYYDPTESRKNKHAVTEEDREEHSPSDTT  181

Query  658   KRGKSVRIVSEKDDASPGD------------------MKLKNCPSFSA-SYVSGMHPLPS  536
                   R  SEK+D++  D                  + ++    F+  S +S + P PS
Sbjct  182   SLLTLQRYQSEKNDSTIDDYAYHGNAKRYFYDEQDSEVGVRKGGVFNGDSLISDVGPSPS  241

Query  535   EVAAGLKKGLYYFPGEEEEYGSSIFENWSVPGETKSKSSKTVSWRME  395
              VA+ + KGLY  P       SS  + WS    T+    K   WRME
Sbjct  242   MVASAISKGLYPMP-PPRTADSSTIDGWSENSGTEVMKKKMEKWRME  287



>ref|XP_004494967.1| PREDICTED: uncharacterized protein LOC101508328 [Cicer arietinum]
Length=373

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 172/355 (48%), Gaps = 49/355 (14%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +PY+LLEI++ISA DLPPV+K+++ Y VAWL    KL T+++  GH NPTWN +  F  D
Sbjct  8     SPYQLLEISIISAQDLPPVAKSIKAYAVAWLHPERKLATQIDQVGHTNPTWNEKFVFRVD  67

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP---LSAKKPAVRHAAVEIRRP  848
             D  L+S+   +  +IYN  W+RD+ IGT  + + +  PP      +KP +R  A++IR+P
Sbjct  68    DEFLNSENSVIMIDIYNSTWIRDVLIGTVGVLVGNLLPPGTRTGNRKPKLRFVALQIRKP  127

Query  847   STGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPE  668
             S G+ QG LN+ V ++  +       S+LS S +       S +    +D  + +    +
Sbjct  128   S-GRPQGILNIGVTVLDSTMRSMPLYSELSTSAVGYSDLMDSNKKKISNDNNNDNYSTTD  186

Query  667   PEIKRGKSVRIVSEKDDASPGDMKL----KNCPSFSASYV----------------SGMH  548
              ++   +  R  SEK+D++  D       KN   +  S V                S + 
Sbjct  187   SKLLTLQ--RCQSEKNDSTINDYVYHGAGKNGYVYEESEVSVPLPRKGGNNEESLCSDIG  244

Query  547   PLPSEVAAGLKKGLYYFPGEEEEYGSSIFENWSVPGETKSKSSKTVSWRMEHKVIPMAGK  368
             P PS VAA + KGLY  P       SS  ++WS    ++  ++K   WR  H++ P   K
Sbjct  245   PSPSVVAAAIAKGLYPIPAPPRTMESSTVDDWSESNCSEGMNTKIQRWR--HELTPAYNK  302

Query  367   DH--------GGAAGGSYNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFICG  227
             +         GG   G   +++ +L              SCFG A+G  F   CG
Sbjct  303   EEYDEIEKRVGGKTPGRPVSRKGKL-------------FSCFGTAFGCEFSISCG  344



>ref|XP_004495587.1| PREDICTED: uncharacterized protein LOC101488962 [Cicer arietinum]
Length=363

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 135/259 (52%), Gaps = 32/259 (12%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P+ LLEIN+ISA DL PVSK+++ Y VAWLD   KLTT+++ + H NPTWN +  F  DD
Sbjct  7     PFHLLEINIISAQDLSPVSKSIKAYAVAWLDPQRKLTTQIDPHAHNNPTWNEKFVFRVDD  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S++ A+  EIY+ AWLRD+ IGT  + LN+  P L  +K  +R  A+++RRPS G+
Sbjct  67    DFLQSEDSAIVIEIYSSAWLRDILIGTVAVNLNNLLPRLYNRKSKIRFVALQVRRPS-GR  125

Query  835   VQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPEIK  656
              QG LN+ V L+  +       S+LS S +         +  +     + + EN   + K
Sbjct  126   PQGILNIGVNLVDATMRSMPMYSELSSSAVEYH------DLMNPKKIQNHENENNACDSK  179

Query  655   RGKSVRIVSEKDDASPGDMK-----------LKNCPS--------------FSASYVSGM  551
                  R  SEK+D++  D             ++N  S               + S  S +
Sbjct  180   LMTLQRSQSEKNDSTINDYTYNPNGKNGYGGVENSESEIGVPTGKKGVIMNANGSLCSDV  239

Query  550   HPLPSEVAAGLKKGLYYFP  494
              P PS VAA + KGLY  P
Sbjct  240   GPSPSVVAAAIAKGLYPLP  258



>gb|KEH24577.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=389

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 142/293 (48%), Gaps = 26/293 (9%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +PY+LLEIN+ISA DL  V+K+++ Y VAWL    KL T+++  GH NPTWN +  F  D
Sbjct  8     SPYQLLEINIISAQDLSGVAKSVKAYAVAWLHPERKLATQIDQVGHTNPTWNEKFVFRVD  67

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---KKPAVRHAAVEIRRP  848
             +  L+S+   +  EIYN AWLRD+ IGT  + +N+  P ++    +KP +R   ++IRRP
Sbjct  68    NEFLNSESSVIMIEIYNSAWLRDILIGTVVVLVNNLLPTVTLSGNRKPKLRFVGLQIRRP  127

Query  847   STGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPE  668
             S G+ QG LN+ V L+  +       S+LS S +       S  +    +    D  +  
Sbjct  128   S-GRPQGILNIGVTLLDSTMRSMPLYSELSTSAVGYWDMMDSNSNKRKVNNNYNDNNSIV  186

Query  667   PEIKRGKSV--RIVSEKDDASPGD--------------------MKLKNCPSFSASYVSG  554
              +  +      R  SEK+D++  D                    M L        S  S 
Sbjct  187   TDDSKMMLTLQRCQSEKNDSTINDYTYHGAGKNNYNGYEESEASMPLPRKRGNEESLCSD  246

Query  553   MHPLPSEVAAGLKKGLYYFPGEEEEYGSSIFENWSVPGETKSKSSKTVSWRME  395
             + P PS VAA + KGLY  P    +  SS    WS    T+   +K   WR E
Sbjct  247   VGPSPSVVAAAIAKGLYLMPPPSRKVKSSAVGGWSESNYTEGMDTKIERWRNE  299



>ref|XP_006577748.1| PREDICTED: uncharacterized protein LOC102667983 [Glycine max]
Length=373

 Score =   147 bits (371),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 104/289 (36%), Positives = 145/289 (50%), Gaps = 25/289 (9%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             PY+LLEINVISA DL  VSK++R Y VAWL    KL T+V+  GH NPTWN +  F  DD
Sbjct  7     PYQLLEINVISAQDLAQVSKSVRGYAVAWLHPERKLATQVDQEGHTNPTWNEKFVFRVDD  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L+SD   +  EIY+ AWLR + IGT  + L +  PP   +KP +R  A++IRRPS G+
Sbjct  67    SFLNSDNSVIMIEIYSHAWLRHVLIGTVAVQLTNLLPP--NRKPKLRFVALQIRRPS-GR  123

Query  835   VQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPEIK  656
              QG LN+ V L+  +       S+LS ST+       S +     ++ D +  +    + 
Sbjct  124   PQGILNIGVNLLDSTMRSMPLYSELSSSTVGYWDIMESSKKKKKSEEDDDNTHHHHSPLD  183

Query  655   RGKSV--RIVSEKDDAS------------------PGDMKLKNCPSFS-ASYVSGMHPLP  539
                    R  SEK+D++                    D+ ++    F+  S +S + P P
Sbjct  184   SSLLTLQRCQSEKNDSTVNDYAYHGNAKHYGYDGQDSDVGMRKGAVFNEGSLISDVGPSP  243

Query  538   SEVAAGLKKGLYYF-PGEEEEYGSSIFENWSVPGETKSKSSKTVSWRME  395
             S VAA + KGLY   P       SS  + WS    T+   +K   WR E
Sbjct  244   SVVAAAIAKGLYPMPPPAPRTVESSTMDGWSENSGTEGMKTKIERWRNE  292



>ref|XP_003535375.1| PREDICTED: uncharacterized protein LOC100795448 [Glycine max]
Length=373

 Score =   146 bits (369),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 141/280 (50%), Gaps = 37/280 (13%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +P++LLE+N+ISA DL PVSK+++ Y VAWL+   KLTT+++ NG  NPTWN +  F  D
Sbjct  6     SPFQLLELNIISAQDLAPVSKSIKAYAVAWLNPERKLTTQIDPNGQNNPTWNEKFVFRVD  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYP-PLSAKKPAVRHAAVEIRRPST  842
             D  L SDE  +  EIY  AWLRD+ IGT T+  ++  P  ++ +K  +R  A+++RRPS 
Sbjct  66    DDFLTSDESLIIIEIYASAWLRDILIGTVTVLASNLLPRSINTRKSKIRFVALQVRRPS-  124

Query  841   GQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPE  662
             G+ QG LN+ V L+  +       S+LS S +    G     D         +  N +  
Sbjct  125   GRPQGILNIGVNLVDSTMRSMPMYSELSASAV----GYWDVMDPKKPKLQQNETNNNDSS  180

Query  661   IKRGKSVRIVSEKDDASPGDMKLKNCP----------------------------SFSAS  566
              K     R  SEK+D++  D    NC                             + + S
Sbjct  181   CKLLTLQRSQSEKNDSTINDYAY-NCSKENGYDEGGDDCQGSEVGMPMAKKGVIMNMNGS  239

Query  565   YVSGMHPLPSEVAAGLKKGLYYFP--GEEEEYGSSIFENW  452
               S + P PS VAA + KGLY  P      + G+ +F++W
Sbjct  240   LCSDVGPSPSVVAAAIAKGLYPLPMMTAPRKPGNLVFQDW  279



>ref|XP_002325345.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
 gb|EEE99726.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
Length=364

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 113/344 (33%), Positives = 164/344 (48%), Gaps = 32/344 (9%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEINVIS  DL PVSK++RTY VAW+  G KL+TKV+ NGH+NP WN +  F  DD
Sbjct  7     PFQLLEINVISGQDLAPVSKSMRTYAVAWVHPGRKLSTKVDQNGHINPQWNEKFVFRVDD  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               ++++  ++  EIY  AWLRD+ IG+  + +++ +P  +     +R  A+++RRPS G+
Sbjct  67    TFINAENSSIMIEIYAAAWLRDVQIGSVRVLISNLFPSNNNNNK-MRFVALQVRRPS-GR  124

Query  835   VQGTLNVTVQLIHDSPPETESGSQLSVSTL----------NKRGGETSGEddddddkidg  686
              QG LN+ VQ++  +       ++LS S +          N +  E  G           
Sbjct  125   PQGILNMGVQVLDSTMRSMPLYTELSASAVGFNDLINAKTNGKDLEEKGAKLRRTQSDRT  184

Query  685   DQENPEPEIKRGKSVR------IVSEKDDASPGDMKLKNCPSFSASYVSGMHPLPSEVAA  524
             D    +    +   VR      I S     S  D    N    + S  S + P  S VAA
Sbjct  185   DHTTTDESGLKEGGVRSLGGSLINSSVAKPSVKDNGNGNGSMVNGSLCSDVGPSASVVAA  244

Query  523   GLKKGLYYFPG-----EEEEYGSSIFENWSVPGETKSKSSKTVSWRMEHKVIPMAGKDHG  359
              + KGL   P      + +  GSSI E+W+     +   +K   WR E  + P+   D  
Sbjct  245   AIAKGLIKTPANAGQQDTDGAGSSILEDWTENDSAEGLRTKLERWRTE--LPPVYDNDLR  302

Query  358   GAAGGSYNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFICG  227
                  S N K  R S+  R         SCFGNA+G      CG
Sbjct  303   KMQSRSRNKKHRRRSEGGR-------LFSCFGNAFGCEISITCG  339



>emb|CDP04278.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 113/348 (32%), Positives = 170/348 (49%), Gaps = 29/348 (8%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+NVISA DL PVS+ LRTY VAW++   KL T+V+  G  NPTWN +  F  D+
Sbjct  5     PFQLLELNVISAQDLAPVSQNLRTYAVAWMNPERKLRTRVDQQGKTNPTWNDKFVFRVDE  64

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAK--KPAVRHAAVEIRRPST  842
             + LDS+  +V  E+Y + WLRD P+G+  + +++  P    K      R  A++IRRPS 
Sbjct  65    KFLDSETSSVMIEVYAIGWLRDTPVGSVRVLISNLIPQNVRKTNNSQRRFVALQIRRPS-  123

Query  841   GQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPE  662
             G+ QG LN+ V L+ ++       S+LS S  N  G     E+     +   D    + +
Sbjct  124   GRPQGILNMGVTLLDNNMKSMPLYSELSASAKNGNGNSDQKEEKIKLRRTQSDCTEVKEK  183

Query  661   IKRGK-----SVRIVSEKDDASPGDMKLKNCPSFSASYV----------SGMHPLPSEVA  527
               + K     SV   S  +  + G   L N P+ + S +          S + P PS VA
Sbjct  184   GNKWKGNGEGSVYNSSVVNGPTRGGSSL-NGPNLNGSEIGVAKNGSMCNSDVGPSPSVVA  242

Query  526   AGLKKGLYYFP-GEEEEYGSSIFENWSV-PGETKSKSSKTVSWRMEHKVIPMAGK-DHGG  356
             A + +GLY  P  +  + GSSI  +W+      +   SK   W+ME     + GK D   
Sbjct  243   AAVARGLYPTPLPKPHDPGSSILGDWTADDASVEGLKSKIDRWKME-----LPGKCDKTP  297

Query  355   AAGGSYNTKRTRLSKLQRRsssgggcmscfG--NAYGLRFKFICGSNS  218
              +      ++ R    +RR S+  G         A G  F  +CG+N+
Sbjct  298   NSYQKIPKEKERKQHWRRRKSANEGSGRFSCFGAACGCEFTIVCGANN  345



>ref|XP_004155136.1| PREDICTED: uncharacterized protein LOC101227028 [Cucumis sativus]
Length=360

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 172/348 (49%), Gaps = 35/348 (10%)
 Frame = -1

Query  1210  MIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLA  1031
             M+ Q P+++LE++++SA+DL  VSKT+RT+ VAW++   KLTT+V+  G  NPTWN +  
Sbjct  1     MVRQ-PFQVLELSLLSANDLASVSKTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFV  59

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRR  851
             F  DD +L+     V  EIY+ A LRD+ IGT T  +++  P  S+ K  +R   +++RR
Sbjct  60    FKVDDDLLEDPTSTVTIEIYSSALLRDILIGTVTEVVSNLIPQ-SSSKSNMRFLTLQVRR  118

Query  850   PSTGQVQGTLNVTVQLIHDS----PPETESGS-------QLSVSTLNKRGGETSGEdddd  704
             PS G+ +GT+ V V L+  +    P E++ GS        LS     K+  + +G     
Sbjct  119   PS-GRPKGTVKVGVTLLDSAKRSMPLESDLGSSAVDYDWDLSEIKAQKQNFQKNG---YR  174

Query  703   ddkidgDQENPEPEIKRGKSVRIVSEKDDASPGDMKL---------KNCPSFSASYVSGM  551
                     E  +P+   GK    V   +    G   +         K   + + S  S +
Sbjct  175   IVMKRSHSERYDPDAFNGKPSGSVCNTNSVIGGRESVRSKSELGTTKKIVNANGSLCSDV  234

Query  550   HPLPSEVAAGLKKGLYYFPGEEEEYGSSIFENWSVPGETKSKSSKTVSWRMEHKVIPMAG  371
              P PS VAA + KGLY  P   ++ GSSI E+W+     +   +K   WR E  + PM  
Sbjct  235   GPSPSVVAAAIAKGLYPAP---DDVGSSILEDWTEKDSIEGLKTKIERWRTE--LHPMYE  289

Query  370   KDHGGAAGGSYNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFICG  227
              +       SY  K  +    ++R   G G  SCFG AYG  F   CG
Sbjct  290   SEIKKLPSRSYRKKSVK----KQRRKKGSGLFSCFGTAYGCEFSITCG  333



>ref|XP_004152866.1| PREDICTED: uncharacterized protein LOC101218582 [Cucumis sativus]
 gb|KGN61292.1| hypothetical protein Csa_2G076000 [Cucumis sativus]
Length=360

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 114/348 (33%), Positives = 172/348 (49%), Gaps = 35/348 (10%)
 Frame = -1

Query  1210  MIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLA  1031
             M+ Q P+++LE++++SA+DL  VSKT+RT+ VAW++   KLTT+V+  G  NPTWN +  
Sbjct  1     MVRQ-PFQVLELSLLSANDLASVSKTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFV  59

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRR  851
             F  DD +L+     V  EIY+ A LRD+ +GT T  +++  P  S+ K  +R   +++RR
Sbjct  60    FKVDDDLLEDPTSTVTIEIYSSALLRDILVGTVTEVVSNLIPQ-SSSKSNMRFLTLQVRR  118

Query  850   PSTGQVQGTLNVTVQLIHDS----PPETESGS-------QLSVSTLNKRGGETSGEdddd  704
             PS G+ +GT+ V V L+  +    P E++ GS        LS     K+  + +G     
Sbjct  119   PS-GRPKGTVKVGVTLLDSAKRSMPLESDLGSSAVDYDWDLSEIKAQKQNFQKNG---YR  174

Query  703   ddkidgDQENPEPEIKRGKSVRIVSEKDDASPGDMKL---------KNCPSFSASYVSGM  551
                     E  +P+   GK    V   +    G   +         K   + + S  S +
Sbjct  175   IVMKRSHSERYDPDAFNGKPSGSVCNTNSVIGGRESVRSKSELGTTKKIVNANGSLCSDV  234

Query  550   HPLPSEVAAGLKKGLYYFPGEEEEYGSSIFENWSVPGETKSKSSKTVSWRMEHKVIPMAG  371
              P PS VAA + KGLY  P   ++ GSSI E+W+     +   +K   WR E  + PM  
Sbjct  235   GPSPSVVAAAIAKGLYPAP---DDVGSSILEDWTEKDSIEGLKTKIERWRTE--LHPMYE  289

Query  370   KDHGGAAGGSYNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFICG  227
              +       SY  K  +    ++R   G G  SCFG AYG  F   CG
Sbjct  290   SEIKKLPSRSYRKKSVK----KQRRKKGSGLFSCFGTAYGCEFSITCG  333



>ref|XP_002319115.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
 gb|EEE95038.2| hypothetical protein POPTR_0013s04590g, partial [Populus trichocarpa]
Length=383

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 144/278 (52%), Gaps = 28/278 (10%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEINVIS  DL PVSK++RTY + W+  G KL+TKV+ NGH NP WN +  F  DD
Sbjct  7     PFQLLEINVISGQDLAPVSKSMRTYAIVWVHPGRKLSTKVDQNGHTNPQWNEKFVFRVDD  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               ++++  ++  E+Y  AWLRD+ IG+  + +++ +P  +     +R  A+++RRPS G+
Sbjct  67    TFINAENSSIMIEVYAAAWLRDVQIGSVNVLISNLFPSHNNNN-KMRFVALQVRRPS-GR  124

Query  835   VQGTLNVTVQLIHDSPPETESGSQLSVSTL---NKRGGETSGEddddddkidgDQENPEP  665
              QG LN+ VQL+  +       ++LSVS +   +    +T G+                 
Sbjct  125   PQGILNLGVQLLDTTMRSMPLYTELSVSAVGFDDLIDAKTIGQSL---------------  169

Query  664   EIKRGKSVRIVSEKDDASPGD---MKLKNCPSFSASYVSGMHPLPSEVAAGLKKGLYYFP  494
             E K  K  R  S++ D +  D   +K       + S  S + P  S VAA + KGL   P
Sbjct  170   EEKSAKLRRTQSDQTDQTISDKSGIKESGVSMINGSLCSDVGPSASVVAAAIAKGLIKTP  229

Query  493   GEEEEYG-----SSIFENWSVPGETKSKSSKTVSWRME  395
                 ++      SS+ E+W+     +   +K   WR E
Sbjct  230   ANAVQHDTDGARSSVVEDWTENDSIEGLRTKLERWRTE  267



>ref|XP_003590980.1| hypothetical protein MTR_1g080360 [Medicago truncatula]
 gb|AES61231.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=375

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 98/274 (36%), Positives = 140/274 (51%), Gaps = 35/274 (13%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEINVISA DL PVSK+++ Y VAWL+   KLTT+ + +GH NPTWN +  F  DD
Sbjct  7     PFQLLEINVISAQDLAPVSKSIKAYAVAWLNPERKLTTQADPHGHNNPTWNEKFVFRVDD  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+E  +  EIY  AWLRD+ IGT  + LN+  P    +K  +R  A+++RRPS G+
Sbjct  67    DFLLSEESVIMIEIYASAWLRDVLIGTVAVHLNNLLP--RNRKSKIRFVALQVRRPS-GR  123

Query  835   VQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPEIK  656
              QG LN+ V ++  +       S+LS S +         +    + +      N   + K
Sbjct  124   PQGILNIGVNVVDATMRSMPMYSELSSSAVEYY------DITKPNKQNQNYDNNSNCDAK  177

Query  655   RGKSV-RIVSEKDDASPGDMKL----KN-----CPS--------------FSASYVSGMH  548
                ++ R  SEK+D++  D       KN     C S               + S  S + 
Sbjct  178   HMMTLQRSQSEKNDSTINDYVYNPNGKNGYGGECESEISVPTGKKGVIVNANGSLCSDVG  237

Query  547   PLPSEVAAGLKKGLYYFPGE--EEEYGSSIFENW  452
             P PS VAA + KGLY  P     +   +S+FE W
Sbjct  238   PSPSVVAAAIAKGLYPLPLHVPRKTVNNSMFEKW  271



>ref|XP_011036375.1| PREDICTED: uncharacterized protein LOC105133911 [Populus euphratica]
Length=382

 Score =   141 bits (355),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 115/346 (33%), Positives = 163/346 (47%), Gaps = 34/346 (10%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             A   LLEINVIS  DL PVSK++RTY VAW+  G KL+TKV+ NGH+NP WN +  F  D
Sbjct  24    ARLPLLEINVISGQDLAPVSKSMRTYAVAWVHPGRKLSTKVDQNGHINPQWNEKFVFRVD  83

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             D  ++++  ++  EIY  AWLRD+ IG+  + +++ +P  +     +R  A+++RRPS G
Sbjct  84    DTFINAENSSIMIEIYAAAWLRDVQIGSVRVLISNLFPSNNNNNK-MRFVALQVRRPS-G  141

Query  838   QVQGTLNVTVQLIHDSPPETESGSQLSVSTLN-------KRGG----ETSGEddddddki  692
             + QG LN+ VQ++  +       ++LS S +        K  G    E   +        
Sbjct  142   RPQGILNMGVQVLDSTMRSMPLYTELSASAVGFNDLINAKTNGKDLEEKGAKLRRTQSDR  201

Query  691   dgDQENPEPEIKRGKSVR------IVSEKDDASPGDMKLKNCPSFSASYVSGMHPLPSEV  530
                    E  +K G  VR      I S     S  D    N    + S  S + P  S V
Sbjct  202   TDLTTTDESGLKEG-GVRSLGGSLINSSVAKPSVKDNGNGNGSMVNGSLCSDVGPSASVV  260

Query  529   AAGLKKGLYYFPGEEEEY-----GSSIFENWSVPGETKSKSSKTVSWRMEHKVIPMAGKD  365
             AA + KGL   P    ++     GSSI E+W+     +   +K   WR E  + P+   D
Sbjct  261   AAAIAKGLIKTPANAGQHDTDGAGSSILEDWTENDSAEGLRTKLERWRTE--LPPVYDND  318

Query  364   HGGAAGGSYNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFICG  227
                    S N K  R S+  R         SCFGNA+G      CG
Sbjct  319   LRKMQSRSRNKKHRRRSEGGR-------LFSCFGNAFGCEISITCG  357



>ref|XP_002521996.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40400.1| conserved hypothetical protein [Ricinus communis]
Length=380

 Score =   141 bits (355),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 98/150 (65%), Gaps = 1/150 (1%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEINVISA DL PVSK++RTY V W+    KLTT+V+ NGH NP WN +  F  DD
Sbjct  7     PFQLLEINVISAQDLAPVSKSMRTYAVVWVHPERKLTTRVDQNGHTNPQWNEKFVFRVDD  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L+S+  ++  EIY  AWLRD+ IG+  + +++ +P  +     +R  A++IRRPS G+
Sbjct  67    TFLNSETSSIMIEIYAAAWLRDVQIGSVRVLISNLFPSPTNNNSKMRFVALQIRRPS-GR  125

Query  835   VQGTLNVTVQLIHDSPPETESGSQLSVSTL  746
              QG LN+ VQL+ ++       ++LS S +
Sbjct  126   PQGILNMGVQLLDNTMRSMPLYTELSASAV  155



>ref|XP_007205372.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
 gb|EMJ06571.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
Length=375

 Score =   138 bits (348),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 93/285 (33%), Positives = 142/285 (50%), Gaps = 34/285 (12%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLEIN+ISA DL P SK++RT+ VAW++   KLTT+V+ NGH NPTWN +  F  DD 
Sbjct  10    FQLLEINLISAQDLYPASKSMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDDE  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQV  833
              L  D   +  EIY  AWLRD+ IGTA + +N+        K  +R  A+++RRPS G+ 
Sbjct  70    FLKDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL-----QNKSKMRFMAIQLRRPS-GRP  123

Query  832   QGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPEIK-  656
             QG LN+ + L+ ++       S+LS S +            D  +    +Q+N +P  K 
Sbjct  124   QGILNIGLGLLDNTMRSMPLYSELSSSAVG---------YWDLMEGKGANQKNHDPNYKD  174

Query  655   RGKSVRIVSEKDDASPGDM-KLKNCPSFSA--------SYVSGMHPLPSEVAAGLKKGLY  503
             + K +     + D +  D   + N    S+        S  S + P PS VAA + KG+Y
Sbjct  175   QDKFIIFQRSQSDRTGSDYGSIVNGSELSSAQKGGKGGSICSDVGPSPSVVAAAIAKGIY  234

Query  502   YFP---------GEEEEYGSSIFENWSVPGETKSKSSKTVSWRME  395
                           + +  +S+ + W+     +   +K   WR E
Sbjct  235   PLGHVGGNVVRHAAQGDARNSLLDEWTDQDSVEGLKTKIERWRTE  279



>gb|KCW85316.1| hypothetical protein EUGRSUZ_B02156 [Eucalyptus grandis]
Length=352

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 119/341 (35%), Positives = 167/341 (49%), Gaps = 23/341 (7%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRI  1010
             +LLE+N+ISA DL PVSK++RTY VAW+    KLTT+V+  GH NP WN +  F  +D  
Sbjct  9     RLLELNLISAQDLAPVSKSMRTYAVAWVHPDRKLTTRVDEKGHANPNWNEKFVFRVNDVS  68

Query  1009  LDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS---AKKPAVRHAAVEIRRPSTG  839
             L++D   +  EIY + WLR + +GT    L+S  PP +    K   +R   +++ RPS G
Sbjct  69    LETDTCVITIEIYALTWLRVVLVGTVRALLSSLIPPSTRTRTKNTPMRFMTLQVLRPS-G  127

Query  838   QVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPEI  659
             + QG +N  V LI+ S       S+LS S L    GE + + D+  +  +   +N + + 
Sbjct  128   RPQGAINFGVSLINSSMRSMPLNSELSAS-LAFDSGEEADQKDNKKEPGNDGNKNSQKDA  186

Query  658   KRGKSVRIVSEKDDA---SPGD---------MKLKNCPSFSASYVSGMHPLPSEVAAGLK  515
              + +  R  SE+ +    +PG           K     S   S VS + P  S VAA + 
Sbjct  187   TKIRLWRSQSERTNDYSYNPGSTVCNDSMVGFKQTKGGSLLGSMVSDVGPSASIVAAAIA  246

Query  514   KGLYYFPGEEEEYGSS--IFENWSVPGETKSKSSKTVSWRMEHKVIPMAGKDHGGAAGGS  341
             KGL        E G S  + +NW+    ++   +K   WR E   I   G +    A   
Sbjct  247   KGLLPPNKNYREEGESSILLDNWTENDSSEGLRTKIERWRTELPPIHNRGGNGKKNAKTG  306

Query  340   YNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFICGSNS  218
              N  R R     RR S GGG  SCFGNAYG  F   CG  S
Sbjct  307   ANQGRDR----PRRHSDGGGLFSCFGNAYGCEFSISCGGGS  343



>ref|XP_010043310.1| PREDICTED: uncharacterized protein LOC104432551 [Eucalyptus grandis]
Length=355

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 119/341 (35%), Positives = 167/341 (49%), Gaps = 23/341 (7%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRI  1010
             +LLE+N+ISA DL PVSK++RTY VAW+    KLTT+V+  GH NP WN +  F  +D  
Sbjct  9     RLLELNLISAQDLAPVSKSMRTYAVAWVHPDRKLTTRVDEKGHANPNWNEKFVFRVNDVS  68

Query  1009  LDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS---AKKPAVRHAAVEIRRPSTG  839
             L++D   +  EIY + WLR + +GT    L+S  PP +    K   +R   +++ RPS G
Sbjct  69    LETDTCVITIEIYALTWLRVVLVGTVRALLSSLIPPSTRTRTKNTPMRFMTLQVLRPS-G  127

Query  838   QVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPEI  659
             + QG +N  V LI+ S       S+LS S L    GE + + D+  +  +   +N + + 
Sbjct  128   RPQGAINFGVSLINSSMRSMPLNSELSAS-LAFDSGEEADQKDNKKEPGNDGNKNSQKDA  186

Query  658   KRGKSVRIVSEKDDA---SPGD---------MKLKNCPSFSASYVSGMHPLPSEVAAGLK  515
              + +  R  SE+ +    +PG           K     S   S VS + P  S VAA + 
Sbjct  187   TKIRLWRSQSERTNDYSYNPGSTVCNDSMVGFKQTKGGSLLGSMVSDVGPSASIVAAAIA  246

Query  514   KGLYYFPGEEEEYGSS--IFENWSVPGETKSKSSKTVSWRMEHKVIPMAGKDHGGAAGGS  341
             KGL        E G S  + +NW+    ++   +K   WR E   I   G +    A   
Sbjct  247   KGLLPPNKNYREEGESSILLDNWTENDSSEGLRTKIERWRTELPPIHNRGGNGKKNAKTG  306

Query  340   YNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFICGSNS  218
              N  R R     RR S GGG  SCFGNAYG  F   CG  S
Sbjct  307   ANQGRDR----PRRHSDGGGLFSCFGNAYGCEFSISCGGGS  343



>ref|XP_008441789.1| PREDICTED: uncharacterized protein LOC103485843 [Cucumis melo]
Length=361

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 111/340 (33%), Positives = 169/340 (50%), Gaps = 27/340 (8%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P+++LE++++SA+DL  VSKT+RT+ VAW++   KLTT+V+  G  NPTWN +  F  DD
Sbjct  5     PFQVLELSLLSANDLASVSKTMRTFAVAWINPDRKLTTRVDQVGLTNPTWNEKFVFKVDD  64

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
              +L+     V  EIY+ A LRD+ +GT T  +++  P  S+ K  +R   +++RRPS G+
Sbjct  65    DLLEDPTSTVTIEIYSSALLRDILVGTVTEVVSNLIPQ-SSPKSNMRFLTLQVRRPS-GR  122

Query  835   VQGTLNVTVQLIHDS----PPETESGS-------QLSVSTLNKRGGETSGEddddddkid  689
              +GT+ V V L+  +    P E++ GS        L      K+  + +G          
Sbjct  123   PKGTVKVGVTLLDSAKRSMPLESDLGSSAVDYDWDLREIKAQKQNFQKNGYTIVMKRSHS  182

Query  688   gDQENPEPEIKRGKSV----RIVSEKDDA-SPGDM-KLKNCPSFSASYVSGMHPLPSEVA  527
                +      K G SV     ++  +D   S  ++   K   + + S  S + P PS VA
Sbjct  183   ARYDPDALNGKPGGSVCNASSVMGGRDSVRSRSELGTTKKIVNANGSLCSDVGPSPSVVA  242

Query  526   AGLKKGLYYFPGEEEEYGSSIFENWSVPGETKSKSSKTVSWRMEHKVIPMAGKDHGGAAG  347
             A + KGLY  P   ++ GSSI E+W+     +   +K   WR E   I M   +      
Sbjct  243   AAIAKGLYPAP---DDVGSSILEDWTEKDSIEGLKTKIERWRTELHPI-MYDNEIKKLPS  298

Query  346   GSYNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFICG  227
              SY  K  +    ++R   G G  SCFG AYG  F   CG
Sbjct  299   RSYRKKSVK----KQRRKKGSGLFSCFGTAYGCEFSITCG  334



>gb|KHN31488.1| hypothetical protein glysoja_035595, partial [Glycine soja]
Length=241

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 92/147 (63%), Gaps = 3/147 (2%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRIL  1007
             LLEINVISA DL  VSK++R Y VAWL    KL T+V+  GH NPTWN +  F  DD  L
Sbjct  1     LLEINVISAQDLAQVSKSVRGYAVAWLHPERKLATQVDQEGHTNPTWNEKFVFRVDDSFL  60

Query  1006  DSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQVQG  827
             +SD   +  EIY+ AWLR + IGT  + L +  PP   +KP +R  A++IRRPS G+ QG
Sbjct  61    NSDNSVIMIEIYSHAWLRHVLIGTVAVQLTNLLPP--NRKPKLRFVALQIRRPS-GRPQG  117

Query  826   TLNVTVQLIHDSPPETESGSQLSVSTL  746
              LN+ V L+  +       S+LS ST+
Sbjct  118   ILNIGVNLLDSTMRSMPLYSELSSSTV  144



>ref|XP_011077059.1| PREDICTED: uncharacterized protein LOC105161156 [Sesamum indicum]
Length=397

 Score =   135 bits (341),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 117/382 (31%), Positives = 176/382 (46%), Gaps = 61/382 (16%)
 Frame = -1

Query  1207  IPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAF  1028
             + + PY+LLE+ +ISA DL  VS+ LRTY   W++   KL T+V++ G  NPTWN +  F
Sbjct  1     MSRVPYQLLELAIISAQDLASVSRNLRTYATTWINPNRKLKTRVDNQGLNNPTWNDKFIF  60

Query  1027  PFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-LSAKKPAVRHAAVEIRR  851
               DD+ L+S   +V  EIY   WLRD P+G+ ++ +++  PP +  +  + R  A++IRR
Sbjct  61    RVDDKFLNSATSSVMIEIYAQGWLRDTPVGSVSVLISNLIPPSVRQEGSSRRFVALQIRR  120

Query  850   PSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTL-------------NKR---------  737
             PS G+ QG LN+ V L+ ++       + L+ S +             NKR         
Sbjct  121   PS-GRPQGILNMGVSLLDNTMKSMPLYADLNASAVGVRDLMDEKLCKNNKRNKENDNQRK  179

Query  736   ------GGETSGEddddddkidgDQENPEPEI-----KRGKSVRIVSEKDDA------SP  608
                   G E+SGE      +   DQ +   +      +RG SV  V   +          
Sbjct  180   VHRQDGGKESSGEKKIQLLRTLSDQTDLTRKQGGGRKRRGSSVCNVPYYNQGFMLNIGGS  239

Query  607   GDMKLKNCPSFSASYVSG------MHPLPSEVAAGLKKGLYYFP-GEEEEYGSSIFENWS  449
               +   +      SYV+G      + P PS VAA +  GLY    G   + GSS+ E+W+
Sbjct  240   SVVGGGSVVHAGGSYVNGSQCNSDLGPSPSVVAAAVACGLYPTQLGPPPKPGSSVLEDWT  299

Query  448   V-PGETKSKSSKTVSWRMEHKVIPMAGKDHGGAAGGSYNTKRTRLSKLQRRsssgggcms  272
             V     +   SK   WRME   +P   +     A    N +R +    +RR ++ G    
Sbjct  300   VEEASMEGLKSKIERWRME---LPQNQRYQRLEAS---NKRREKKPGHRRRKTANGADDD  353

Query  271   cf------GNAYGLRFKFICGS  224
                     GNAYG  F  +CGS
Sbjct  354   EAGRFSCFGNAYGCEFTIVCGS  375



>gb|KDP23730.1| hypothetical protein JCGZ_23563 [Jatropha curcas]
Length=375

 Score =   135 bits (340),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 96/149 (64%), Gaps = 2/149 (1%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLEINVISA DL  VSK++RTY V W+    KLTT+++ NGH NP WN +  F  DD 
Sbjct  8     FQLLEINVISAQDLATVSKSMRTYAVVWVHPERKLTTRIDQNGHTNPQWNEKFVFRVDDA  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQV  833
              LDS+  A+  EIY  AWLRD+ IG+  + +++ +P  +     +R  A++IRRPS G+ 
Sbjct  68    FLDSETSAIMIEIYAAAWLRDVQIGSVRVLVSNLFPS-NNNNSKMRFVALQIRRPS-GRP  125

Query  832   QGTLNVTVQLIHDSPPETESGSQLSVSTL  746
             QG LN+ VQL+ ++       ++LS S +
Sbjct  126   QGILNMGVQLLDNTMRSMPLYTELSASAV  154



>ref|XP_008460692.1| PREDICTED: uncharacterized protein LOC103499460 [Cucumis melo]
Length=561

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 128/242 (53%), Gaps = 19/242 (8%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+NVISA DL PVS+++RTY VAW+    KL+T+V+ +GH NPTWN +  F  DD
Sbjct  6     PFQLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDD  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-----LSAKKPAV--RHAAVEI  857
               L SD  AV  EIY + W +D+ +GT  + + +  P        +++P V  R  A+++
Sbjct  66    EFLHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVGMRFVALQV  125

Query  856   RRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRG--GETSGEddddddkidgD  683
             RRPS G+ QG LN+ V L+H S       SQLS S +  R   GE            +  
Sbjct  126   RRPS-GRPQGILNIGVALLHSSMRSMPLYSQLSTSAIGYRNLMGEEDPFATHHSTNNNQS  184

Query  682   QENP----EPEIKRGKSVRIVSEKDDASPGDMKLKNCPSFSASYVSGMHPLPSEVAAGLK  515
                P     PE++R KS        +    +M  K   S ++S V+G     SEV+   K
Sbjct  185   HGTPTVLTRPEMRRSKSDTSSMIGSELRGSEMMGKGLKSKASSMVNG-----SEVSKQKK  239

Query  514   KG  509
             KG
Sbjct  240   KG  241



>ref|XP_004173200.1| PREDICTED: uncharacterized LOC101215059 [Cucumis sativus]
Length=533

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 130/242 (54%), Gaps = 19/242 (8%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+NVISA DL PVS+++RTY VAW+    KL+T+V+ +GH NPTWN +  F  DD
Sbjct  6     PFQLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDD  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-----LSAKKPAV--RHAAVEI  857
               L SD  AV  EIY + W +D+ +GT  + + +  P        +++P V  R  A+++
Sbjct  66    EFLHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVGMRFVALQV  125

Query  856   RRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRG--GETSGEddddddkidgD  683
             RRPS G+ QG LN+ V L+H S       SQLS S +  R   GE     +   +  +  
Sbjct  126   RRPS-GRPQGILNIGVALLHSSMRSMPLYSQLSTSAIGYRNLMGEEDPFANHHSNTNNQS  184

Query  682   QENP----EPEIKRGKSVRIVSEKDDASPGDMKLKNCPSFSASYVSGMHPLPSEVAAGLK  515
                P     PE++R KS        +    +M  K   S ++S V+G     SEV+   K
Sbjct  185   HGTPTVLTRPEMRRSKSDTSSMIGSELRGSEMMGKGMKSKASSMVNG-----SEVSKQKK  239

Query  514   KG  509
             KG
Sbjct  240   KG  241



>ref|XP_004147189.1| PREDICTED: uncharacterized protein LOC101215059 [Cucumis sativus]
 gb|KGN61560.1| hypothetical protein Csa_2G171820 [Cucumis sativus]
Length=561

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 130/242 (54%), Gaps = 19/242 (8%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+NVISA DL PVS+++RTY VAW+    KL+T+V+ +GH NPTWN +  F  DD
Sbjct  6     PFQLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVDD  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-----LSAKKPAV--RHAAVEI  857
               L SD  AV  EIY + W +D+ +GT  + + +  P        +++P V  R  A+++
Sbjct  66    EFLHSDTSAVMIEIYALHWFKDIHVGTVRILVGNLIPTPPRLHQFSQQPQVGMRFVALQV  125

Query  856   RRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRG--GETSGEddddddkidgD  683
             RRPS G+ QG LN+ V L+H S       SQLS S +  R   GE     +   +  +  
Sbjct  126   RRPS-GRPQGILNIGVALLHSSMRSMPLYSQLSTSAIGYRNLMGEEDPFANHHSNTNNQS  184

Query  682   QENP----EPEIKRGKSVRIVSEKDDASPGDMKLKNCPSFSASYVSGMHPLPSEVAAGLK  515
                P     PE++R KS        +    +M  K   S ++S V+G     SEV+   K
Sbjct  185   HGTPTVLTRPEMRRSKSDTSSMIGSELRGSEMMGKGMKSKASSMVNG-----SEVSKQKK  239

Query  514   KG  509
             KG
Sbjct  240   KG  241



>ref|XP_008218351.1| PREDICTED: uncharacterized protein LOC103318712 [Prunus mume]
Length=417

 Score =   133 bits (334),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 94/149 (63%), Gaps = 6/149 (4%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLEIN+ISA DL P SK++RT+ VAW++   KLTT+V+ NGH NPTWN +  F  DD 
Sbjct  10    FQLLEINLISAQDLYPASKSMRTFAVAWVNPKRKLTTRVDQNGHTNPTWNEKFVFRVDDE  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQV  833
              L  D   +  EIY  AWLRD+ IGTA + +N+        K  +R  A+++RRPS G+ 
Sbjct  70    FLKDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL-----QNKSKMRFMAIQLRRPS-GRP  123

Query  832   QGTLNVTVQLIHDSPPETESGSQLSVSTL  746
             QG LN+ + L+ ++       S+LS S +
Sbjct  124   QGILNIGLGLLDNTMRSMPLYSELSSSAV  152



>ref|XP_009343786.1| PREDICTED: uncharacterized protein LOC103935702 [Pyrus x bretschneideri]
Length=402

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 96/315 (30%), Positives = 139/315 (44%), Gaps = 56/315 (18%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLEIN+ISA DL P SK +RT+ VAW++   KLTT+ +  GH NPTWN +  F  DD 
Sbjct  9     FQLLEINLISAQDLTPASKAMRTFAVAWVNPKRKLTTRFDQTGHTNPTWNEKFVFRVDDD  68

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQV  833
              L  D   +  EIY  AWLRD+ IGTA + +N+        K  +R  A+++RRPS G+ 
Sbjct  69    FLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNLQ-----NKSKMRFMAIQLRRPS-GRP  122

Query  832   QGTLNVTVQLIHDSPPETESGSQLSVSTL-------NKRGGETS----------------  722
             QG LN+ + L+  +       S+LS S +        K G + S                
Sbjct  123   QGILNIGLGLLDSTMRSMPLYSELSSSAVGYWDLMEGKAGNQKSSGLNSKDQDKFVIFQR  182

Query  721   GEddddddkidgDQENPEPEIKRGKSVRIVSEKDDASPGDMKLKNCPSFSASYV------  560
              + D         +  P   I  G + +I       +    K K   SF  S +      
Sbjct  183   SQSDRTGSDSGFSKSRPASSICDGVT-KIRPSNSTCNAAAYKPKTQASFCNSSIVNGSEL  241

Query  559   --------------SGMHPLPSEVAAGLKKGLYYFP------GEEEEYGSSIFENWSVPG  440
                           S + P PS VAA + KG+Y  P         ++ GSS+ + W+   
Sbjct  242   STEQKKGNVNGSLCSDVGPSPSVVAAAIAKGIYPLPYTGARAPSPDDAGSSLLDEWADQD  301

Query  439   ETKSKSSKTVSWRME  395
               +   +K   WR E
Sbjct  302   SVEGLKTKIERWRTE  316



>ref|XP_008370760.1| PREDICTED: uncharacterized protein LOC103434221 [Malus domestica]
 ref|XP_008370902.1| PREDICTED: uncharacterized protein LOC103434347 [Malus domestica]
Length=402

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 96/315 (30%), Positives = 139/315 (44%), Gaps = 56/315 (18%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLEIN+ISA DL P SK +RT+ VAW++   KLTT+ +  GH NPTWN +  F  DD 
Sbjct  9     FQLLEINLISAQDLTPASKAMRTFAVAWVNPKRKLTTRFDQTGHTNPTWNEKFVFRVDDD  68

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQV  833
              L  D   +  EIY  AWLRD+ IGTA + +N+        K  +R  A+++RRPS G+ 
Sbjct  69    FLRHDTSKIMIEIYASAWLRDVLIGTAAVVVNNLQ-----NKSKMRFMAIQLRRPS-GRP  122

Query  832   QGTLNVTVQLIHDSPPETESGSQLSVSTL-------NKRGGETS----------------  722
             QG LN+ + L+  +       S+LS S +        K G + S                
Sbjct  123   QGILNIGLGLLDSTMRSMPLYSELSSSAVGYWDLMEGKTGNQKSSGLNSKDQDKFVIFQR  182

Query  721   GEddddddkidgDQENPEPEIKRGKSVRIVSEKDDASPGDMKLKNCPSFSASYV------  560
              + D         +  P   I  G + +I       +    K K   SF  S +      
Sbjct  183   SQSDRTGSDSGFSKSRPASSICDGVT-KIRPSNSTCNAAAYKPKTQASFCNSSIVNGSEL  241

Query  559   --------------SGMHPLPSEVAAGLKKGLYYFP------GEEEEYGSSIFENWSVPG  440
                           S + P PS VAA + KG+Y  P         ++ GSS+ + W+   
Sbjct  242   STGQKKGNVNGSLCSDVGPSPSVVAAAIAKGIYPLPYTGARAPSPDDAGSSLLDEWADQD  301

Query  439   ETKSKSSKTVSWRME  395
               +   +K   WR E
Sbjct  302   SVEGLKTKIERWRTE  316



>ref|XP_011038591.1| PREDICTED: uncharacterized protein LOC105135426 [Populus euphratica]
Length=367

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 96/148 (65%), Gaps = 2/148 (1%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEINVIS  DL PVSK++RTY + W+  G KL+TKV+ NGH NP WN +  F  D+
Sbjct  7     PFQLLEINVISGQDLAPVSKSMRTYAIVWVHPGRKLSTKVDQNGHTNPQWNEKFVFRVDE  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               ++++  ++  E+Y  AWLRD+ IG+  + +++ +P  +     +   A+++RRPS G+
Sbjct  67    IFINAENSSIMIEVYAAAWLRDVQIGSVNVLISNLFPSHNNNNK-MHFVALQVRRPS-GR  124

Query  835   VQGTLNVTVQLIHDSPPETESGSQLSVS  752
              QG LN+ VQL+  +       ++LSVS
Sbjct  125   PQGILNLGVQLLDTTMRSMPLYTELSVS  152



>ref|XP_009795461.1| PREDICTED: uncharacterized protein LOC104242159 [Nicotiana sylvestris]
Length=395

 Score =   130 bits (326),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 86/132 (65%), Gaps = 1/132 (1%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRIL  1007
             +LEI++ISA DL PVSK+LRTY +AW++   K +T++++ GH NPTWN + +F  +D  L
Sbjct  37    ILEISLISAQDLAPVSKSLRTYALAWINPNKKRSTRIDNEGHNNPTWNDKFSFKVNDEFL  96

Query  1006  DSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQVQG  827
              S+  AV  EIY V+W RD+ +GT  + LN+   P        R  A++IRRPS G  QG
Sbjct  97    YSETSAVHVEIYTVSWFRDVLVGTVHVLLNNLINPFINNSNGKRFVALQIRRPS-GNPQG  155

Query  826   TLNVTVQLIHDS  791
              LN+ V LIH S
Sbjct  156   ILNMGVSLIHSS  167



>ref|XP_008366882.1| PREDICTED: uncharacterized protein LOC103430513 [Malus domestica]
Length=395

 Score =   130 bits (326),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLEIN+ISA DL P SK +RT+ VAW++   KLTT+V+ NGH NPTWN +  F  D+ 
Sbjct  9     FQLLEINLISAQDLTPASKAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDED  68

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQV  833
              L  D   +  EIY  AWLRD+ IGTA + +N+        K  +R  A+++RRPS G+ 
Sbjct  69    FLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL-----QNKSKMRFMAIQLRRPS-GRP  122

Query  832   QGTLNVTVQLIHDSPPETESGSQLSVSTL  746
             QG LN+ + L+  +       S+LS S +
Sbjct  123   QGILNIGLGLLDSTMRSMPLYSELSSSAV  151



>ref|XP_009379739.1| PREDICTED: uncharacterized protein LOC103968123 [Pyrus x bretschneideri]
Length=395

 Score =   130 bits (326),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLEIN+ISA +L P SK +RT+ VAW++   KLTT+V+ NGH NPTWN +  F  DD 
Sbjct  9     FQLLEINLISAQELTPASKAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDDD  68

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQV  833
              L  D   +  EIY  AWLRD+ IGTA + +N+        K  +R  A+++RRPS G+ 
Sbjct  69    FLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL-----QNKSKMRFMAIQLRRPS-GRP  122

Query  832   QGTLNVTVQLIHDSPPETESGSQLSVSTL  746
             QG LN+ + L+  +       S+LS S +
Sbjct  123   QGILNIGLGLLDSTMRSMPLYSELSSSAV  151



>ref|XP_008224037.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103323799 
[Prunus mume]
Length=516

 Score =   130 bits (328),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 108/195 (55%), Gaps = 13/195 (7%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+NVISA DL P+S+++RTY +AW+    KL+T+V+  GH NPTWN +  F  D
Sbjct  7     APFQLLELNVISAQDLAPISRSMRTYAIAWVHPDRKLSTRVDTQGHSNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP-------AVRHAAVE  860
             +  L  D  AV  EIY + W +D+ +GT  + + +  P  +  KP        +R  A++
Sbjct  67    EDFLHEDTSAVMIEIYALHWFKDVHVGTVRVLVGNLIP--TPAKPHHHNPQLGMRFVALQ  124

Query  859   IRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR---GGETSGEddddddkid  689
             +RRPS G+ QG LN+ V L+H S       SQLS S +  +   G E       +     
Sbjct  125   VRRPS-GRPQGILNIGVALLHSSMRSMPLYSQLSTSAVGYKTLMGEEDPHRSSQNHHAGS  183

Query  688   gDQENPEPEIKRGKS  644
                   +PE++R KS
Sbjct  184   QMTTYSKPELRRSKS  198



>ref|XP_007226487.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
 gb|EMJ27686.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
Length=492

 Score =   130 bits (327),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 107/195 (55%), Gaps = 13/195 (7%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+NVISA DL P+S+++RTY +AW+    KL+T+V+  GH NPTWN +  F  D
Sbjct  7     APFQLLELNVISAQDLAPISRSMRTYAIAWVHPDRKLSTRVDTQGHNNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP-------AVRHAAVE  860
             +  L  D  AV  EIY + W +D+ +GT  + + +  P  +  KP        +R  A++
Sbjct  67    EDFLHEDTSAVMIEIYALHWFKDVHVGTVRVLVGNLIP--TPAKPHHHNPHLGMRFVALQ  124

Query  859   IRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR---GGETSGEddddddkid  689
             +RRPS G+ QG LN+ V L+H S       SQLS S +  +   G E             
Sbjct  125   VRRPS-GRPQGILNIGVALLHSSMRSMPLYSQLSTSAVGYKTLMGEEDPHRSSQTHHAGS  183

Query  688   gDQENPEPEIKRGKS  644
                   +PE++R KS
Sbjct  184   QATTYSKPELRRSKS  198



>ref|XP_008340669.1| PREDICTED: uncharacterized protein LOC103403599 [Malus domestica]
Length=533

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 107/193 (55%), Gaps = 9/193 (5%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+NVISA DL P+S+++RTY +AW+    KL+T+V+ +GH NPTWN +  F  D
Sbjct  7     APFQLLELNVISAQDLAPISRSMRTYAIAWVHPDRKLSTRVDTSGHNNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGT-----ATLTLNSFYPPLSAKKPAVRHAAVEIR  854
             +  L  D  AV  EIY + W +D+ +GT       L   S  P     +  +R  A+++R
Sbjct  67    EDFLHDDTSAVMIEIYVLHWFKDVHVGTVRVLVGNLIQTSTRPYHHHPQVGMRFVALQVR  126

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR---GGETSGEddddddkidgD  683
             RPS G+ QG LN+ V L+H S       SQLS S +  +   G + +             
Sbjct  127   RPS-GRPQGILNIGVALLHSSMRSMPLYSQLSTSAVGYKTLMGEDDATRSTKTHHTRSQM  185

Query  682   QENPEPEIKRGKS  644
               N +P+++R KS
Sbjct  186   TTNSKPQLRRTKS  198



>ref|XP_009792812.1| PREDICTED: uncharacterized protein LOC104239795 [Nicotiana sylvestris]
Length=404

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 98/172 (57%), Gaps = 10/172 (6%)
 Frame = -1

Query  1234  SGHLFSDKMIPQAPYK------LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVN  1073
             S  LF   + P  P        +LEI +ISA DL PV K+LRTY + W++   K TT+V+
Sbjct  19    SSSLFPQPLSPHPPSASNNTNHILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRVD  78

Query  1072  HNGHVNPTWNYRLAFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA  893
             + GH NPTWN + +F  DD  L+S+  AV  EIY V+W RD+ +GT  + LN+   P   
Sbjct  79    NQGHSNPTWNDKFSFRVDDEFLNSESSAVHVEIYTVSWFRDILVGTVKVLLNNLINPFDR  138

Query  892   KKPAVRHAAVEIRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
              K   +  A++IRRPS G  QG LN+ V LI  S       +Q++  +L+ R
Sbjct  139   SK---KFVALQIRRPS-GNPQGILNLGVALIDKSKRSMPLFNQITPLSLDHR  186



>ref|XP_008388740.1| PREDICTED: uncharacterized protein LOC103451084 [Malus domestica]
Length=395

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 91/149 (61%), Gaps = 6/149 (4%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLEIN+ISA DL P SK +RT+ VAW++   KLTT+V+ NGH NPTWN +  F  D+ 
Sbjct  9     FQLLEINLISAQDLTPASKAMRTFAVAWVNPQRKLTTRVDQNGHTNPTWNEKFVFRVDED  68

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQV  833
              L  D   +  EIY  AWLRD+ IGTA + +N+        K  +R  A+++RRPS G+ 
Sbjct  69    FLRDDTSKIMIEIYASAWLRDVLIGTAAVVVNNL-----QNKSKMRFMAIQLRRPS-GRP  122

Query  832   QGTLNVTVQLIHDSPPETESGSQLSVSTL  746
              G LN+ + L+  +       S+LS S +
Sbjct  123   XGILNIGLGLLDSTMRSMPLYSELSSSAV  151



>ref|XP_002314508.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF00679.1| C2 domain-containing family protein [Populus trichocarpa]
Length=460

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 114/201 (57%), Gaps = 17/201 (8%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +P++LLE+NVISA DL  VS+ ++TY VAW+    +L+T+V+  G  NPTWN +  F  D
Sbjct  7     SPFQLLELNVISAQDLVKVSRKMKTYAVAWVHPDRRLSTRVDSEGCNNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-----LSAKKPAVRHAAVEIR  854
             DR L  D  AV  EIY + W RD+ IGT  + + +  PP      +  +  +R  A+++R
Sbjct  67    DRFLHGDTSAVMIEIYALHWFRDIHIGTVRVIVGNLIPPPRPHHHNQFQLGMRFVALQVR  126

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRG----GETSGEddddddkidg  686
             RPS G+ QG LN+ V L+  S       SQ+SVS +  R     GE +   DD DDK  G
Sbjct  127   RPS-GRPQGILNIGVALLDSSMRSMPLYSQISVSAVGYRQLMGEGELNHHKDDSDDKSSG  185

Query  685   DQEN-------PEPEIKRGKS  644
                N       P+PE++R KS
Sbjct  186   IHSNSFLLPWLPKPELRRTKS  206



>emb|CDO99320.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   128 bits (322),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 95/156 (61%), Gaps = 5/156 (3%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLEINVISA DL PVS+ ++TY  AW++S  KL+++V+  GHVNPTWN +  F  D+ 
Sbjct  8     FQLLEINVISAQDLEPVSRKMKTYATAWVNSSRKLSSRVDSGGHVNPTWNDKFVFRVDED  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKK----PAVRHAAVEIRRPS  845
              L  D  AV+ EI+ V W +D  +GT  + + +  PPL   +      +R  A+++RRPS
Sbjct  68    FLRQDTSAVQIEIHAVHWFKDTLVGTVRVLVGNLIPPLLRSRHHNHIGMRFVALQVRRPS  127

Query  844   TGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
              G+ QG LN+ V L+  S       +QLS S +  R
Sbjct  128   -GRPQGILNIGVTLLDSSMRSMPLYTQLSASAVGYR  162



>gb|EYU43768.1| hypothetical protein MIMGU_mgv1a006114mg [Erythranthe guttata]
Length=456

 Score =   127 bits (319),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 91/165 (55%), Gaps = 8/165 (5%)
 Frame = -1

Query  1210  MIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLA  1031
             M P  P++LLEIN+ISA DL PVS+ +RTY  AW+    KL++ V++ G  NPTWN +  
Sbjct  1     MAPSKPFQLLEINIISAQDLEPVSRKMRTYATAWMHQSRKLSSCVDNEGKTNPTWNDKFV  60

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRH-------  872
             F  DD  L  D  A+  EIY   W RD+ +GT  + + +  PP +       H       
Sbjct  61    FRVDDEFLRQDTSAIMIEIYATHWFRDVLVGTVRVLVGNLIPPPTRTHQQTNHYTGGMRF  120

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
              A+++RRPS G+ QG LN+ V L+  S        QLS+S +  R
Sbjct  121   VALQVRRPS-GRPQGILNIGVALLDSSMRSMPLYRQLSMSAVGFR  164



>ref|XP_009625035.1| PREDICTED: uncharacterized protein LOC104115988 [Nicotiana tomentosiformis]
Length=406

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 84/132 (64%), Gaps = 4/132 (3%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRIL  1007
             +LEI +ISA DL PV K+LRTY + W++   K TT+V++ GH NPTWN + +F  DD  L
Sbjct  43    ILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRVDNQGHSNPTWNDKFSFRVDDEFL  102

Query  1006  DSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQVQG  827
             +S+  AV  EIY V+W RD+ +GT  + LN+   P    K   +  A++IRRPS G  QG
Sbjct  103   NSESSAVHVEIYTVSWFRDILVGTVKVLLNNLINPYDRSK---KFVALQIRRPS-GNPQG  158

Query  826   TLNVTVQLIHDS  791
              LN+ V LI  S
Sbjct  159   ILNLGVALIDKS  170



>ref|XP_009357966.1| PREDICTED: uncharacterized protein LOC103948651 [Pyrus x bretschneideri]
Length=533

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 107/193 (55%), Gaps = 9/193 (5%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+NVISA DL P+S+++RTY VAW+    KL+T+V+  GH NPTWN +  F  D
Sbjct  7     APFQLLELNVISAQDLAPISRSMRTYAVAWVHPDRKLSTRVDTLGHNNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTA-TLTLNSFYPPLSAK----KPAVRHAAVEIR  854
             +  L  D  AV  EIY + W +D+ +GT   L  N    P+       +  +R  A+++R
Sbjct  67    EDFLHDDTSAVMIEIYVLHWFKDVHVGTVRVLVGNLIQTPMRPHHHHPQVGMRFVALQVR  126

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR---GGETSGEddddddkidgD  683
             RPS G+ QG LN+ V L+H S       SQLS S +  +   G + +             
Sbjct  127   RPS-GRPQGILNIGVALLHSSMRSMPLYSQLSTSAVGYKTLMGEDDAPRSTKTHHTGSQM  185

Query  682   QENPEPEIKRGKS  644
               N +P+++R KS
Sbjct  186   TTNSKPQLRRTKS  198



>ref|XP_011041447.1| PREDICTED: uncharacterized protein LOC105137420 [Populus euphratica]
Length=459

 Score =   125 bits (315),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 94/159 (59%), Gaps = 6/159 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +P++LLE+NVISA DL  VS+ ++TY VAW+    +L+T+V   G  NPTWN +  F  D
Sbjct  7     SPFQLLELNVISAQDLVKVSRKMKTYAVAWVHPDRRLSTRVTSEGCNNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-----LSAKKPAVRHAAVEIR  854
             DR L  D  AV  EIY + W RD+ IGT  + + +  PP      +  +  +R  A+++R
Sbjct  67    DRFLHGDTSAVMIEIYALHWFRDIHIGTVRVIVGNLIPPPRPHHHNQFQLGMRFVALQVR  126

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             RPS G+ QG LN+ V L+  S       SQ+SVS +  R
Sbjct  127   RPS-GRPQGILNIGVALLDSSMRSMPLYSQISVSAVGYR  164



>ref|XP_010667096.1| PREDICTED: uncharacterized protein LOC104884184 [Beta vulgaris 
subsp. vulgaris]
Length=464

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 92/154 (60%), Gaps = 5/154 (3%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEIN+IS  D+  VS++++TY VAW+    KLTT+V+ NG  NPTWN +  F  D+
Sbjct  3     PFQLLEINIISGQDIHKVSRSMKTYAVAWVHPDRKLTTRVDSNGGTNPTWNDKFVFRVDN  62

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP----LSAKKPAVRHAAVEIRRP  848
             R L SD  A+  EIY + W RD+ +GT  + + +  PP     +     +R  A+++RRP
Sbjct  63    RFLQSDTSAIMIEIYALHWFRDVHVGTVRVLVGNLIPPQTRSFNQNHIGMRFVALQVRRP  122

Query  847   STGQVQGTLNVTVQLIHDSPPETESGSQLSVSTL  746
             S G+ QG LNV V ++  +        QLS S +
Sbjct  123   S-GRPQGILNVGVTVLDSTMRSMPLYRQLSTSAV  155



>gb|EYU39518.1| hypothetical protein MIMGU_mgv1a007478mg [Erythranthe guttata]
Length=406

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 90/143 (63%), Gaps = 6/143 (4%)
 Frame = -1

Query  1204  PQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFP  1025
             P  P  LLEI++ISA DL P++K++RTY +AW++   KLTT+ + +G+ +PTWN +L F 
Sbjct  25    PHTPLHLLEISLISAQDLTPITKSMRTYAIAWVNPNRKLTTRTDQHGNTHPTWNDKLTFR  84

Query  1024  FDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYP-----PLSAKKPAVRHAAVE  860
              D + L SD+ A+  EIY V+W RD+ +GT  + ++         PL +    +R  A++
Sbjct  85    VDSQFLASDDAAITVEIYTVSWFRDVLVGTVRVLISDLMSPPSGVPLQSLPKNMRFVALQ  144

Query  859   IRRPSTGQVQGTLNVTVQLIHDS  791
             +RRPS G  QG LN+ V L+  S
Sbjct  145   VRRPS-GAPQGILNMGVSLLDTS  166



>ref|XP_006358324.1| PREDICTED: uncharacterized protein LOC102592049 [Solanum tuberosum]
Length=353

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 85/134 (63%), Gaps = 3/134 (2%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRIL  1007
             +LEI +ISA DL PV K+LRTY + W++   K TT+V+++GH NP WN + +F  DD  L
Sbjct  37    ILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRVDNHGHNNPNWNDKFSFRVDDEFL  96

Query  1006  DSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPL--SAKKPAVRHAAVEIRRPSTGQV  833
              SD  A+  EIY V+W RD+ +GT  + LN+   P   ++   + +  A++IRRPS G  
Sbjct  97    SSDSSAIHVEIYTVSWFRDILVGTVKVILNNLVNPFENTSSNQSKKFVALQIRRPS-GNP  155

Query  832   QGTLNVTVQLIHDS  791
             QG LN+ V +I  S
Sbjct  156   QGILNMGVAVIDKS  169



>gb|KDO41882.1| hypothetical protein CISIN_1g041258mg [Citrus sinensis]
Length=510

 Score =   125 bits (314),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 90/142 (63%), Gaps = 7/142 (5%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+N+ISA DL PVS+++RTY VAW+    KL+T+V+ +G  NPTWN +  F  D
Sbjct  7     APFQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------LSAKKPAVRHAAVEI  857
             +  L +D  AV  EI+ + W RD+ +GT  + + +  PP       S +   +R  A+++
Sbjct  67    EDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQV  126

Query  856   RRPSTGQVQGTLNVTVQLIHDS  791
             RRPS G+ QG LN+ V L+  S
Sbjct  127   RRPS-GRPQGILNIGVALLDSS  147



>ref|XP_006489752.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
Length=510

 Score =   125 bits (314),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 90/142 (63%), Gaps = 7/142 (5%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+N+ISA DL PVS+++RTY VAW+    KL+T+V+ +G  NPTWN +  F  D
Sbjct  7     APFQLLELNIISAQDLAPVSRSMRTYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------LSAKKPAVRHAAVEI  857
             +  L +D  AV  EI+ + W RD+ +GT  + + +  PP       S +   +R  A+++
Sbjct  67    EDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQV  126

Query  856   RRPSTGQVQGTLNVTVQLIHDS  791
             RRPS G+ QG LN+ V L+  S
Sbjct  127   RRPS-GRPQGILNIGVALLDSS  147



>gb|KCW57324.1| hypothetical protein EUGRSUZ_H00123 [Eucalyptus grandis]
Length=462

 Score =   124 bits (312),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 92/155 (59%), Gaps = 6/155 (4%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+N+ISA DL  VS+++R+Y V W+    KL+T+V+  G  NPTWN +  F  D+
Sbjct  8     PFQLLEVNIISAQDLRSVSRSMRSYAVVWVHPDRKLSTRVDTRGRRNPTWNDKFVFRVDE  67

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS-----AKKPAVRHAAVEIRR  851
               L  D  AV  EIY V W RD+ +GT  L +++  PP S      +   +R  A+++RR
Sbjct  68    EFLRCDTSAVMIEIYAVHWFRDVLVGTIRLLVSNLLPPPSRPFRHQRHIGMRFVALQVRR  127

Query  850   PSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTL  746
             PS G+ QG LNV V L+  S       +QLS S +
Sbjct  128   PS-GRPQGILNVGVALLDSSMRSMPLYTQLSASAV  161



>emb|CDP04279.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 101/335 (30%), Positives = 157/335 (47%), Gaps = 51/335 (15%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             + +L I++ISA DL P+SK++RTY V W+    KLTT V+   H NP WN R AF  D  
Sbjct  26    FYVLNISLISAQDLAPISKSMRTYAVTWIHPSRKLTTSVDQQRHTNPLWNERFAFRVDSE  85

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQV  833
              L SD+ A+  EIY V+W RDL +GT  + ++    P +  +   R+ A++IRRPS G  
Sbjct  86    FLSSDQAAITVEIYTVSWFRDLLVGTVRVLISDLITPCA--RNHTRYLALQIRRPS-GNP  142

Query  832   QGTLNVTVQLIHDSPPETESGSQLSVST------LNKRGGETSGEddddddkidgDQENP  671
             QG LN+ V L+  +        +++ S       L K+    S +  D +   + + +  
Sbjct  143   QGMLNMGVALMDAANRSMPLRREMNPSVRDYQDALVKKLNSMSAQQKDGEIVTEENNDQM  202

Query  670   EPEIKRGKSVRIVSEKDDASPGDMKLKN-CPSFSASYVSGMHPLPSEVAAGL-KKGLYYF  497
               +I   +S  + SE ++  P  +K  + C    +   S + P  S VAA + +K L   
Sbjct  203   NEKIHLWRSYSLGSEFNEEFP--LKAGSICNGNGSELCSDVGPSASIVAAEIARKSLP--  258

Query  496   PGEEEEYGSSIFENWSVPGETKSKSSKTVSWRMEHKVIPMAGKDHGG--AAGGSYNTKRT  323
             P  E + G+SI E  +V   T              K +   G+ HG   + GG ++    
Sbjct  259   PMAERKIGNSIVEEMTVEEATA-------------KGLNSDGRRHGRRHSDGGLFSC---  302

Query  322   RLSKLQRRsssgggcmscfGNAYGLRFKFICGSNS  218
                               FGNAYG  F  +CG+++
Sbjct  303   ------------------FGNAYGFEFTIVCGASN  319



>ref|XP_004242771.1| PREDICTED: formin-J [Solanum lycopersicum]
Length=370

 Score =   123 bits (309),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 84/133 (63%), Gaps = 2/133 (2%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRIL  1007
             +LEI +ISA DL PV K+LRTY + W++   K TT+++++GH NP WN + +F  DD  L
Sbjct  35    ILEITLISAQDLSPVCKSLRTYALTWVNPNRKRTTRIDNHGHNNPNWNDKFSFRVDDEFL  94

Query  1006  DSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPL-SAKKPAVRHAAVEIRRPSTGQVQ  830
              SD  A+  EIY V+W RD+ +GT  + LN+   P  +    + +  A++IRRPS G  Q
Sbjct  95    ISDSSAIHVEIYTVSWFRDILVGTVKVILNNLVNPFENTSNSSKKFVALQIRRPS-GNPQ  153

Query  829   GTLNVTVQLIHDS  791
             G LN+ V LI  S
Sbjct  154   GILNMGVSLIDKS  166



>ref|XP_010025827.1| PREDICTED: uncharacterized protein LOC104416087 [Eucalyptus grandis]
Length=481

 Score =   124 bits (312),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 92/155 (59%), Gaps = 6/155 (4%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+N+ISA DL  VS+++R+Y V W+    KL+T+V+  G  NPTWN +  F  D+
Sbjct  8     PFQLLEVNIISAQDLRSVSRSMRSYAVVWVHPDRKLSTRVDTRGRRNPTWNDKFVFRVDE  67

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS-----AKKPAVRHAAVEIRR  851
               L  D  AV  EIY V W RD+ +GT  L +++  PP S      +   +R  A+++RR
Sbjct  68    EFLRCDTSAVMIEIYAVHWFRDVLVGTIRLLVSNLLPPPSRPFRHQRHIGMRFVALQVRR  127

Query  850   PSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTL  746
             PS G+ QG LNV V L+  S       +QLS S +
Sbjct  128   PS-GRPQGILNVGVALLDSSMRSMPLYTQLSASAV  161



>ref|XP_010105208.1| hypothetical protein L484_011265 [Morus notabilis]
 gb|EXC04073.1| hypothetical protein L484_011265 [Morus notabilis]
Length=589

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 96/166 (58%), Gaps = 14/166 (8%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+NVISA DL PVS+++RTY VAW+    KL+T+V+  GH NPTWN +  F  D+
Sbjct  6     PFQLLELNVISAQDLAPVSRSMRTYAVAWVHPDRKLSTRVDTYGHTNPTWNDKFVFRVDE  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA-------------KKPAVR  875
               L +D  A+  EIY + W +D+ +GT  + + +  PP  A              +  +R
Sbjct  66    DFLHTDTSAIMIEIYALHWFKDVHVGTVRILVGNLIPPPRAGSSFGHGHSHNNYNQLGMR  125

Query  874   HAAVEIRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
               A+++RRPS G+ QG LN+ V ++H +       S LS S +  R
Sbjct  126   FVALQVRRPS-GRPQGILNIGVAILHSAMRSMPLYSHLSNSAVGYR  170



>ref|XP_002311697.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE89064.2| C2 domain-containing family protein [Populus trichocarpa]
Length=492

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 91/152 (60%), Gaps = 6/152 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +P++LLE+NVISA DL  VS+ ++TY VAW+    KL+T+++  G  NPTWN +  F  D
Sbjct  7     SPFQLLELNVISAQDLAKVSRKMKTYAVAWIHPDRKLSTRIDSEGRNNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-----LSAKKPAVRHAAVEIR  854
             DR L  D  AV  EIY + W RD+ +GT  + + +  PP      +  +  +R  A+++R
Sbjct  67    DRFLHGDTSAVMIEIYALHWFRDIHVGTVRVIVGNLIPPPDPHHHNQFQIGMRFVALQVR  126

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLS  758
             RPS G+ QG LN+ V L+  S       SQLS
Sbjct  127   RPS-GRPQGILNIGVALLDSSMRSMPLYSQLS  157



>gb|KDO53064.1| hypothetical protein CISIN_1g035970mg, partial [Citrus sinensis]
Length=377

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 92/141 (65%), Gaps = 4/141 (3%)
 Frame = -1

Query  1210  MIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLA  1031
             M+P  P ++LEI+++S HDL  VSK+++TY VAW+D   KLTT+V+ NG  NP+WN +  
Sbjct  1     MVP--PPRVLEISIVSGHDLALVSKSMKTYSVAWVDPERKLTTRVDQNGLNNPSWNEKFV  58

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS-AKKPAVRHAAVEIR  854
             F  DDR L  +  A+  EIY  AWL+D  IG+  + ++  +  L+     + R+ A+++R
Sbjct  59    FRVDDRFLTDETSAIMIEIYAAAWLKDALIGSVRVLISHLFGTLTHNSSSSTRYVALQVR  118

Query  853   RPSTGQVQGTLNVTVQLIHDS  791
             RPS G+ QG LN+ + L+ ++
Sbjct  119   RPS-GRPQGILNLGITLLDNT  138



>ref|XP_006437469.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
 ref|XP_006484674.1| PREDICTED: haze protective factor 1-like [Citrus sinensis]
 gb|ESR50709.1| hypothetical protein CICLE_v10033675mg [Citrus clementina]
Length=393

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 92/141 (65%), Gaps = 4/141 (3%)
 Frame = -1

Query  1210  MIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLA  1031
             M+P  P ++LEI+++S HDL  VSK+++TY VAW+D   KLTT+V+ NG  NP+WN +  
Sbjct  1     MVP--PPRVLEISIVSGHDLALVSKSMKTYSVAWVDPERKLTTRVDQNGLNNPSWNEKFV  58

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS-AKKPAVRHAAVEIR  854
             F  DDR L  +  A+  EIY  AWL+D  IG+  + ++  +  L+     + R+ A+++R
Sbjct  59    FRVDDRFLTDETSAIMIEIYAAAWLKDALIGSVRVLISHLFGTLTHNSSSSTRYVALQVR  118

Query  853   RPSTGQVQGTLNVTVQLIHDS  791
             RPS G+ QG LN+ + L+ ++
Sbjct  119   RPS-GRPQGILNLGITLLDNT  138



>ref|XP_004297932.1| PREDICTED: uncharacterized protein LOC101311957 [Fragaria vesca 
subsp. vesca]
Length=519

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 95/156 (61%), Gaps = 6/156 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+NVISA DL PVS+++RTY +AW+    KL+T+V+ +GH NPTWN +  F  D
Sbjct  5     APFQLLELNVISAQDLAPVSRSMRTYAIAWVHPDRKLSTRVDTHGHNNPTWNDKFVFRVD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFY-----PPLSAKKPAVRHAAVEIR  854
             +  L  D  AV  EIY + W +D+ +GT  + + +       P     +  +R  A+++R
Sbjct  65    EDFLHEDTSAVMIEIYALHWFKDVHVGTIRVLVGNLIQTPAKPHHHHPQLGMRFVALQVR  124

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTL  746
             RPS G+ QG LN+ V L+H S       SQL+ S +
Sbjct  125   RPS-GRPQGILNIGVALLHSSMRSMPLYSQLNSSAV  159



>ref|XP_004304780.1| PREDICTED: uncharacterized protein LOC101296310 [Fragaria vesca 
subsp. vesca]
Length=457

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 96/161 (60%), Gaps = 10/161 (6%)
 Frame = -1

Query  1207  IPQAP----YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNY  1040
             +P+ P    ++LLEIN+ISA DL   SK++RT+ VAW++   KLTT+V+ NGH NPTWN 
Sbjct  30    MPKPPHMSSFQLLEINLISAQDLTAASKSMRTFAVAWVNPKRKLTTRVDQNGHTNPTWNE  89

Query  1039  RLAFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVE  860
             +  F   +  L  D   +  EIY  AWLRD+ +GTA + +++           +R  A++
Sbjct  90    KFVFRVGEDFLKDDTSKIMIEIYASAWLRDVLVGTAAIVVSNLQ-----NNSKMRFVAIQ  144

Query  859   IRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             +RRPS G+ QG LNV + L+ ++       S+LS S +  R
Sbjct  145   LRRPS-GRPQGILNVGLGLLDNTMRSMPLYSELSTSAVGYR  184



>ref|XP_006420366.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
 gb|ESR33606.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
Length=497

 Score =   123 bits (309),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 89/142 (63%), Gaps = 7/142 (5%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+N+ISA DL PVS+++R Y VAW+    KL+T+V+ +G  NPTWN +  F  D
Sbjct  7     APFQLLELNIISAQDLAPVSRSMRAYAVAWVHPNRKLSTRVDAHGRNNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------LSAKKPAVRHAAVEI  857
             +  L +D  AV  EI+ + W RD+ +GT  + + +  PP       S +   +R  A+++
Sbjct  67    EDFLHNDTSAVMIEIFALHWFRDMHVGTVRVLVGNLIPPPTRSLHHSHRSFGMRFVALQV  126

Query  856   RRPSTGQVQGTLNVTVQLIHDS  791
             RRPS G+ QG LN+ V L+  S
Sbjct  127   RRPS-GRPQGILNIGVALLDSS  147



>ref|XP_011091348.1| PREDICTED: uncharacterized protein LOC105171810 [Sesamum indicum]
Length=545

 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 92/163 (56%), Gaps = 5/163 (3%)
 Frame = -1

Query  1213  KMIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             KM P+ P++LLEIN+ISA DL PVSK +RTY  AWL    KL++ V+  G+ +PTWN + 
Sbjct  34    KMAPEKPFQLLEINIISAQDLEPVSKKMRTYATAWLHPNRKLSSCVDAEGNNSPTWNDKF  93

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP----LSAKKPAVRHAA  866
              F  ++  L  D  AV  EIY   WLRD  +GT  + + +  P     L      +R  A
Sbjct  94    VFKVEEEFLRRDTSAVMIEIYAKQWLRDTLVGTVRVLVGNLIPSSTRTLGHHHFGMRFVA  153

Query  865   VEIRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             +++RRPS G+ QG LN+ V L+  S        QLS S +  R
Sbjct  154   LQVRRPS-GRPQGILNIGVALLDSSMRSMPLYRQLSASAVGYR  195



>ref|XP_010674263.1| PREDICTED: uncharacterized protein LOC104890461 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 84/135 (62%), Gaps = 1/135 (1%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LL IN+ISA DL PVSK++ TYVV W++   KLTT+V+H G+  P WN +  F    
Sbjct  4     PFQLLHINIISARDLAPVSKSMNTYVVGWVNPNRKLTTRVDHKGNNCPEWNDKFVFRVTP  63

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
             + L+SD   V  EIY+ AWLRD  IG+  +++ +  P         R  A++IRRPS G+
Sbjct  64    KFLNSDSSIVDIEIYSQAWLRDALIGSVRVSIANLIPTGYQNGSTRRSVALQIRRPS-GR  122

Query  835   VQGTLNVTVQLIHDS  791
              QG LNV V ++  S
Sbjct  123   PQGILNVVVSVLDGS  137



>ref|XP_011029742.1| PREDICTED: uncharacterized protein LOC105129399 [Populus euphratica]
Length=492

 Score =   122 bits (307),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 91/152 (60%), Gaps = 6/152 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +P++LLE+NVISA DL  VS+ ++TY VAW+    KL+T+++  G  NPTWN +  F  D
Sbjct  7     SPFQLLELNVISAQDLAKVSRKMKTYAVAWIHPDRKLSTRIDSEGRNNPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-----LSAKKPAVRHAAVEIR  854
             DR L  D  AV  EIY + W RD+ +GT  + + +  PP      +  +  +R  A+++R
Sbjct  67    DRFLHGDTSAVMIEIYALHWFRDIHVGTVRVIVGNLIPPPDPHHHNQFQIGMRFVALQVR  126

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLS  758
             RPS G+ +G LN+ V L+  S       SQLS
Sbjct  127   RPS-GRPKGILNIGVALLDSSMRSMPLYSQLS  157



>ref|XP_009621969.1| PREDICTED: uncharacterized protein LOC104113496 [Nicotiana tomentosiformis]
Length=523

 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 91/164 (55%), Gaps = 6/164 (4%)
 Frame = -1

Query  1213  KMIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             KM    P++LLEIN+IS  DL P SK ++TYV AW+    KLTT V+  G  NPTWN + 
Sbjct  6     KMGMLKPFQLLEINIISVQDLEPTSKKMKTYVTAWIHPTQKLTTGVDVEGGNNPTWNDKF  65

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA-----KKPAVRHA  869
              F  D+  L  D  AV  EI++V W RD  IGT  + + +  PP+ A         +R  
Sbjct  66    VFRVDEEFLRQDTSAVHIEIFSVHWFRDSLIGTVRVLVGNLIPPIRAYGHHNHHLGMRFV  125

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             A++IRRPS G+ QG LN+ V L+  S        Q+S S +  R
Sbjct  126   ALQIRRPS-GRPQGILNIGVALLDGSMRSMPLYRQMSTSAVGYR  168



>ref|XP_006345991.1| PREDICTED: uncharacterized protein LOC102591105, partial [Solanum 
tuberosum]
Length=373

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 87/135 (64%), Gaps = 4/135 (3%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRIL  1007
             +LEI +ISA DL PVSK+LRTY + W++   K +TKV+++GH NPTWN + +F  ++  L
Sbjct  32    ILEITLISAQDLAPVSKSLRTYALTWINPNRKRSTKVDNDGHNNPTWNDKFSFKVNEEFL  91

Query  1006  DSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAV---RHAAVEIRRPSTGQ  836
              S+  AV  EIY V+W RD+ +GT  + LN+   P    + ++   R  A++IRRPS G 
Sbjct  92    YSENSAVHVEIYTVSWFRDVLVGTINVQLNNLINPCVNFQNSLNGKRFVALQIRRPS-GN  150

Query  835   VQGTLNVTVQLIHDS  791
              QG LN+ V +I  S
Sbjct  151   PQGILNMGVAIIESS  165



>ref|XP_010264865.1| PREDICTED: uncharacterized protein LOC104602763 [Nelumbo nucifera]
Length=418

 Score =   121 bits (304),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 95/157 (61%), Gaps = 4/157 (3%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
              P++LLEINVISA DL PV++++ TY VAW+D   KL+T V+ +GHV+PTWN +  F  D
Sbjct  7     VPFQLLEINVISAQDLAPVTRSMHTYAVAWVDPERKLSTCVDTHGHVDPTWNDKFVFRVD  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAK---KPAVRHAAVEIRRP  848
             D  L SD  AV  +I+ +   RD+ +GT  + + + +P  S +   +  +R  A+++RRP
Sbjct  67    DEFLHSDTSAVMIKIFALRPFRDVHVGTVRVLVGNLFPLSSLRSHQRSGMRFVALQVRRP  126

Query  847   STGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             S G+ QG LN+   L+  S       SQ + S L  R
Sbjct  127   S-GRPQGILNIGAALLDKSMRSMPLYSQPNSSALGYR  162



>ref|XP_004253020.1| PREDICTED: uncharacterized protein LOC101244358 [Solanum lycopersicum]
Length=534

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 97/164 (59%), Gaps = 6/164 (4%)
 Frame = -1

Query  1213  KMIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             KM    P++LLE+N+ISA DL P+SK ++TY  AW+    KLTT V+++G  NPTWN + 
Sbjct  4     KMGALKPFQLLEVNIISAQDLEPISKKMKTYASAWVHPTRKLTTGVDNDGGNNPTWNDKF  63

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP-----AVRHA  869
              F  DD  L  D  AV+ +I++V W RD  +G+  + + +  PP +  +       +R  
Sbjct  64    VFRVDDEFLQQDTSAVQIDIFSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQQHHIGMRFV  123

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             A++IRRPS G+ QG LN+ V L+  +    +   QLS+S +  R
Sbjct  124   ALQIRRPS-GRPQGILNIGVTLLGGTMRSMQLYRQLSMSAVGYR  166



>gb|AFK13837.1| C2 domain-containing protein SRC2 [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 86/140 (61%), Gaps = 1/140 (1%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LL IN+ISA DL PVSK++ TYVV W++   KLTT+V+H G+  P WN +  F    
Sbjct  4     PFQLLHINIISARDLAPVSKSMNTYVVGWVNPYRKLTTRVDHKGNNCPEWNDKFVFRVTP  63

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
             + L+SD   V  EIY+ AWLRD  IG+  +++ +  P         R  A++IRRPS G+
Sbjct  64    KFLNSDSSIVDIEIYSQAWLRDALIGSVRVSIANLIPTGYQNGSTRRSVALQIRRPS-GR  122

Query  835   VQGTLNVTVQLIHDSPPETE  776
              QG LNV V ++  +  + E
Sbjct  123   PQGILNVVVSVLDGTTIDQE  142



>ref|XP_002282144.1| PREDICTED: uncharacterized protein LOC100256206 [Vitis vinifera]
Length=494

 Score =   122 bits (305),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 93/156 (60%), Gaps = 9/156 (6%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P +LLEIN+ISA DL PV +++RTY +AW+    KL+T+++  GH +PTWN +  F  DD
Sbjct  6     PLQLLEINLISAQDLAPVGRSMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKFVFRVDD  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP------AVRHAAVEIR  854
               L +D  AV  +IY+  W RD  +GT  + + +  PP  + +P       +R  A+++R
Sbjct  66    EFLRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPP--SVRPGHRTQMGMRFMALQVR  123

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTL  746
             R S+G+ QG LN+ V L+  S       SQLS S +
Sbjct  124   R-SSGRPQGLLNIGVALLDSSMRSMPLYSQLSASAV  158



>emb|CAN83108.1| hypothetical protein VITISV_026570 [Vitis vinifera]
Length=494

 Score =   122 bits (305),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 93/156 (60%), Gaps = 9/156 (6%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P +LLEIN+ISA DL PV +++RTY +AW+    KL+T+++  GH +PTWN +  F  DD
Sbjct  6     PLQLLEINLISAQDLAPVGRSMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKFVFRVDD  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP------AVRHAAVEIR  854
               L +D  AV  +IY+  W RD  +GT  + + +  PP  + +P       +R  A+++R
Sbjct  66    EFLRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPP--SVRPGHRTQMGMRFMALQVR  123

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTL  746
             R S+G+ QG LN+ V L+  S       SQLS S +
Sbjct  124   R-SSGRPQGLLNIGVALLDSSMRSMPLYSQLSASAV  158



>ref|XP_004497792.1| PREDICTED: uncharacterized protein LOC101505544 [Cicer arietinum]
Length=451

 Score =   121 bits (304),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 88/142 (62%), Gaps = 7/142 (5%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             A Y+LLE+NVISA DL PV +++RTY VAW+D   KL+T+V+ +G +NP WN +  F  D
Sbjct  6     ACYQLLELNVISAQDLAPVGRSMRTYAVAWVDPDRKLSTRVDSHGGINPAWNDKFVFRVD  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------LSAKKPAVRHAAVEI  857
             D  L+ +   +  +IY + W +D+ +GTA +  +   PP       + K P +R   +++
Sbjct  66    DDFLNDENSIITIDIYALHWFKDIHVGTALVLADDIIPPSRPSHNKNYKPPGMRFVGLQV  125

Query  856   RRPSTGQVQGTLNVTVQLIHDS  791
             RRPS G+ +G LNV V +I  S
Sbjct  126   RRPS-GRPKGILNVGVVVIDSS  146



>ref|XP_006356117.1| PREDICTED: uncharacterized protein LOC102592369 [Solanum tuberosum]
Length=482

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 88/157 (56%), Gaps = 5/157 (3%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEIN+ISA DL P+SK ++TY  AW+    KL T V+  G  NPTWN +  F  DD
Sbjct  14    PFQLLEINIISAQDLEPMSKKMKTYAAAWVHPTRKLATGVDVEGGHNPTWNDKFVFRVDD  73

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP----LSAKKPAVRHAAVEIRRP  848
               L  D  AV  EIY+V W RD  +GT  + + +  PP    L      +R  A+++RRP
Sbjct  74    EFLRHDNSAVHIEIYSVHWFRDTLVGTVRVLVGNLIPPIRTHLRTHHHGMRFIALQVRRP  133

Query  847   STGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             S G+ QG LN+ V L+  S        Q+S S +  R
Sbjct  134   S-GRPQGILNIGVSLLDSSMRSMPLYRQMSTSAVAYR  169



>ref|XP_009591729.1| PREDICTED: uncharacterized protein LOC104088710 [Nicotiana tomentosiformis]
Length=399

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 85/132 (64%), Gaps = 2/132 (2%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRIL  1007
             ++EI++ISA DL PVSK+LRTY + W++   K +T++++ GH NP+WN + +F  +D  L
Sbjct  39    IIEISLISAQDLAPVSKSLRTYALTWINPNKKRSTRIDNEGHNNPSWNDKFSFKVNDEFL  98

Query  1006  DSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQVQG  827
              S+  AV  EIY V+W RD+ +GT  + LN+   P        R  A++IRRPS G  QG
Sbjct  99    YSETSAVHVEIYTVSWFRDVLVGTVHVLLNNLINPF-VNSNGKRFVALQIRRPS-GNPQG  156

Query  826   TLNVTVQLIHDS  791
              LN+ V LI+ S
Sbjct  157   ILNMGVSLINSS  168



>ref|XP_006342681.1| PREDICTED: uncharacterized protein LOC102596842 [Solanum tuberosum]
Length=528

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 95/164 (58%), Gaps = 6/164 (4%)
 Frame = -1

Query  1213  KMIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             KM    P++LLE+N+ISA DL P+SK ++TY  AW+    KLTT V+  G  NPTWN + 
Sbjct  4     KMGALKPFQLLEVNIISAQDLEPISKKMKTYASAWVHPTRKLTTGVDTEGGNNPTWNDKF  63

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKK-----PAVRHA  869
              F  DD  L  D  A++ +I++V W RD  +G+  + + +  PP +  +       +R  
Sbjct  64    VFRVDDEFLQQDTSAIQIDIFSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQQHHIGMRFV  123

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             A++IRRPS G+ QG LN+ V L+  +    +   QLS+S +  R
Sbjct  124   ALQIRRPS-GRPQGILNIGVTLLGGTMRSMQLYRQLSMSAVGYR  166



>ref|XP_004234051.1| PREDICTED: uncharacterized protein LOC101265801 [Solanum lycopersicum]
Length=485

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 89/157 (57%), Gaps = 5/157 (3%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEIN+ISA DL P+SK L+TY  AW+    KL T V+ NG  NPTWN +  F  D+
Sbjct  14    PFQLLEINIISAQDLEPMSKKLKTYAAAWVHPTRKLATGVDVNGGHNPTWNDKFVFRVDE  73

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP----LSAKKPAVRHAAVEIRRP  848
               L  +  AV  EIY+V W RD  +GT  + + +  PP    L      +R  A++IRRP
Sbjct  74    EFLRHENSAVHIEIYSVHWFRDSLVGTVRVLVGNLIPPIRTHLRTHHHGMRFVALQIRRP  133

Query  847   STGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             S G+ QG LN+ V L+  S        Q+S S +  R
Sbjct  134   S-GRPQGILNIGVSLLDSSMRSMPLYRQMSTSAVAYR  169



>ref|XP_004239688.1| PREDICTED: putative uncharacterized protein DDB_G0267840 [Solanum 
lycopersicum]
Length=415

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 83/135 (61%), Gaps = 4/135 (3%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRIL  1007
             +LEI +ISA DL P+SK+LRTY + W++   K +TK+++ GH NPTWN + +F  ++  L
Sbjct  33    ILEITLISAQDLAPISKSLRTYALTWINPNRKRSTKIDNEGHNNPTWNDKFSFKVNEEFL  92

Query  1006  DSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP---LSAKKPAVRHAAVEIRRPSTGQ  836
              S+  AV  EIY V+W RD+ +GT  + LN+   P           R  A++IRRPS G 
Sbjct  93    YSENSAVHVEIYTVSWFRDVLVGTINVQLNNLINPYVNFQNSSNGKRFVALQIRRPS-GN  151

Query  835   VQGTLNVTVQLIHDS  791
              QG LN+ V +I  S
Sbjct  152   PQGILNMGVAIIESS  166



>ref|XP_007035276.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOY06202.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=480

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 89/144 (62%), Gaps = 9/144 (6%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSK-TLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPF  1022
             AP++LLE+NVISA DL PVS+  +RTY VAW+    KL+T++++ GH NPTWN +  F  
Sbjct  8     APFQLLELNVISAQDLEPVSRRKMRTYAVAWVHPQRKLSTRIDNLGHTNPTWNDKFVFRV  67

Query  1021  DDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAK-------KPAVRHAAV  863
             DD  L  D  AV  E+Y V W RD+ +GT  + + +   P +++       +  +R  A+
Sbjct  68    DDEFLHGDTSAVMIELYAVHWFRDIHVGTVRVIVGNLISPPTSRPRHRHEVQIGMRFVAL  127

Query  862   EIRRPSTGQVQGTLNVTVQLIHDS  791
             ++ RPS G+ QG LN+ V L+  S
Sbjct  128   QVWRPS-GRPQGILNIGVALLDSS  150



>ref|XP_007144140.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
 gb|ESW16134.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
Length=736

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 104/194 (54%), Gaps = 11/194 (6%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+NVISA DL PVS+ +RTY V+W+    KL+T+V+  GH +PTWN +  F  DD
Sbjct  7     PFQLLELNVISAQDLAPVSRNMRTYAVSWVHPDRKLSTRVDTQGHTHPTWNDKFVFRVDD  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA-----KKP-AVRHAAVEIR  854
               L SD  ++  EIY + W +D+ +GT  + + +  PP S      + P   R AAV++R
Sbjct  67    EFLCSDTSSIMIEIYALHWFKDIHVGTVRVLIGNLAPPPSRPFHSNRTPLGTRFAAVQVR  126

Query  853   RPSTGQVQGTLNVTVQLI----HDSPPETESGSQLSVSTLNKRGGETSGEddddddkidg  686
             RPS G+ QG LN+   ++    H  P  T + S +    L          +      +  
Sbjct  127   RPS-GRPQGILNIGFTVLDGSMHSMPLYTHNASAVGYRHLMGEKDAYDSHNHLSPHVLAA  185

Query  685   DQENPEPEIKRGKS  644
                 P+ E++R KS
Sbjct  186   ASGTPKAELRRAKS  199



>emb|CDY18242.1| BnaC05g02650D [Brassica napus]
Length=410

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 86/134 (64%), Gaps = 5/134 (4%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++N   NPTWN +  F  D+ 
Sbjct  8     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQV  833
              L +D  AV  EIY + W RD+ +GT  + +++  PP       +R  A+++RR S G+ 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPP----SRRMRFVALQVRRAS-GRP  122

Query  832   QGTLNVTVQLIHDS  791
             QG LN+ V ++  S
Sbjct  123   QGILNIGVGVLDGS  136



>ref|XP_002528347.1| hypothetical protein RCOM_1217340 [Ricinus communis]
 gb|EEF34019.1| hypothetical protein RCOM_1217340 [Ricinus communis]
Length=472

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 90/161 (56%), Gaps = 9/161 (6%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+NVIS  DL  VS+ +RTY VAW+    KL+T+V+  GH NPTWN +  F  DD
Sbjct  9     PFQLLELNVISGQDLAQVSRKMRTYAVAWVHPDRKLSTRVDAQGHNNPTWNDKFVFRVDD  68

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP--------AVRHAAVE  860
               L  +  A+  EIY + W RD+ +GT  + + +  PP    +          +R  A++
Sbjct  69    EFLYGETSAIMIEIYALHWFRDVHVGTVRVIVGNLIPPAQLYRQHQQHHVQLGMRFVALQ  128

Query  859   IRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             +RR S G+ QG LN+ V L+  S       SQ+S S +  R
Sbjct  129   VRRHS-GRPQGILNIGVALLDTSMRSMPLYSQISASAVGYR  168



>gb|KDP33324.1| hypothetical protein JCGZ_12873 [Jatropha curcas]
Length=446

 Score =   118 bits (296),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 88/148 (59%), Gaps = 9/148 (6%)
 Frame = -1

Query  1213  KMIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             ++IPQ P++LLE+NVIS  DL  VS+ +RTY VAW+    KL+T+++   H NPTWN + 
Sbjct  3     RVIPQ-PFQLLELNVISGQDLAQVSRKMRTYAVAWVHPERKLSTRLDIYSHNNPTWNDKF  61

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP-------AVR  875
              F  DD  L  +  A+  EIY V+W RD+ +GT  + + +  PP   KK         +R
Sbjct  62    VFRVDDEFLYRETSAIMVEIYAVSWFRDIHVGTVRVIVGNLIPPAEHKKHQKHGVQLGMR  121

Query  874   HAAVEIRRPSTGQVQGTLNVTVQLIHDS  791
               A+++RR S G+ QG LN+ V  +  S
Sbjct  122   FVALQVRRRS-GRPQGILNIGVAFLDAS  148



>emb|CBI23723.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   118 bits (295),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 87/141 (62%), Gaps = 9/141 (6%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P +LLEIN+ISA DL PV +++RTY +AW+    KL+T+++  GH +PTWN +  F  DD
Sbjct  6     PLQLLEINLISAQDLAPVGRSMRTYAIAWVHPDRKLSTRIDSTGHNSPTWNDKFVFRVDD  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP------AVRHAAVEIR  854
               L +D  AV  +IY+  W RD  +GT  + + +  PP  + +P       +R  A+++R
Sbjct  66    EFLRADTSAVMIDIYSQHWFRDYHVGTVRILVGNLIPP--SVRPGHRTQMGMRFMALQVR  123

Query  853   RPSTGQVQGTLNVTVQLIHDS  791
             R S+G+ QG LN+ V L+  S
Sbjct  124   R-SSGRPQGLLNIGVALLDSS  143



>ref|XP_009604695.1| PREDICTED: uncharacterized protein LOC104099416 [Nicotiana tomentosiformis]
Length=545

 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+N+ISA DL PVSK ++TY  AW+    KLTT V+  G  NPTWN +  F  D+
Sbjct  10    PFQLLEVNIISAQDLEPVSKKMKTYATAWVHPTRKLTTGVDTEGGNNPTWNDKFVFRVDE  69

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKK----PAVRHAAVEIRRP  848
               L  D  AV+ +IY+V W RD  +G+  + + +  PP +  +      +R  A++IRRP
Sbjct  70    EFLRQDTSAVQIDIYSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQHHIGMRFVALQIRRP  129

Query  847   STGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             S G+ QG LN+ V L+  +        QLS+S +  R
Sbjct  130   S-GRPQGILNIGVTLLGGTMRSMPLYRQLSMSAVGYR  165



>ref|XP_009804994.1| PREDICTED: uncharacterized protein DDB_G0292186-like [Nicotiana 
sylvestris]
Length=526

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 88/157 (56%), Gaps = 6/157 (4%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLEIN+ISA DL P SK ++TY  AW+    KLTT V+  G  NPTWN +  F  D+ 
Sbjct  13    FQLLEINIISAQDLEPTSKKMKTYATAWVHPTRKLTTGVDVEGGNNPTWNDKFVFRVDEE  72

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA-----KKPAVRHAAVEIRRP  848
              L  D  AV  EI++V W RD  +GT  + + +  PP+ A         +R  A++IRRP
Sbjct  73    FLRQDTSAVHIEIFSVHWFRDSLVGTVRVLVRNLIPPIRAHGHHNHHLGMRFVALQIRRP  132

Query  847   STGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             S G+ QG LN+ V L+  S        Q+S S +  R
Sbjct  133   S-GRPQGILNIGVALLDGSMRSMPLYRQMSTSAVGYR  168



>ref|XP_009795412.1| PREDICTED: uncharacterized protein LOC104242110 [Nicotiana sylvestris]
Length=545

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+N+ISA DL PVSK ++TY  AW+    KLTT V+  G  NPTWN +  F  D+
Sbjct  10    PFQLLEVNIISAQDLEPVSKRMKTYATAWVHPTRKLTTGVDTEGGNNPTWNDKFVFRVDE  69

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKK----PAVRHAAVEIRRP  848
               L  D  AV+ +IY+V W RD  +G+  + + +  PP +  +      +R  A++IRRP
Sbjct  70    EFLRQDTSAVQIDIYSVHWFRDSLVGSVRVLVGNLIPPPTRLQHQHHIGMRFVALQIRRP  129

Query  847   STGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             S G+ QG LN+ V L+  +        QLS+S +  R
Sbjct  130   S-GRPQGILNIGVTLLGGTMRSMPLYRQLSMSAVGYR  165



>ref|XP_003555498.1| PREDICTED: uncharacterized protein LOC100812185 [Glycine max]
Length=642

 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 88/144 (61%), Gaps = 11/144 (8%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+NVISA DL P+ + +RTY V+W+    KL+T+V+  GH NPTWN +  F  D
Sbjct  6     APFQLLELNVISAQDLAPLGRNMRTYAVSWVHPDRKLSTRVDSEGHTNPTWNDKFVFRVD  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP--------AVRHAAV  863
             +  L SD  A+  EIY + W +D+ +GT  + + +  PP S  KP         +R  A+
Sbjct  66    EEFLYSDTSAIMIEIYALHWFKDIHVGTVRVLVGNLAPPPS--KPFHNNRTPLGMRFIAL  123

Query  862   EIRRPSTGQVQGTLNVTVQLIHDS  791
             ++RRPS G+ QG LN+   ++  S
Sbjct  124   QVRRPS-GRPQGILNIGFTVLDSS  146



>ref|XP_003535258.1| PREDICTED: uncharacterized protein LOC100787698 [Glycine max]
Length=657

 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 89/144 (62%), Gaps = 11/144 (8%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+NVISA DL PVS+ +RTY V+W+    KL+T+V+  GH +PTWN +  F  D
Sbjct  6     APFQLLELNVISAQDLAPVSRNMRTYAVSWVHPERKLSTRVDTEGHTHPTWNDKFVFRVD  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP--------AVRHAAV  863
             +  L SD  A+  EIY + W +D+ +GT  + + +  PP S  KP         +R  A+
Sbjct  66    EEFLYSDTSAIMIEIYALHWFKDIHVGTVRVLVGNLAPPPS--KPFHNNRTPLGMRFVAL  123

Query  862   EIRRPSTGQVQGTLNVTVQLIHDS  791
             ++RRPS G+ QG LN+   ++  S
Sbjct  124   QMRRPS-GRPQGILNIGFTVLDSS  146



>ref|XP_010469493.1| PREDICTED: uncharacterized protein LOC104749540 [Camelina sativa]
Length=596

 Score =   119 bits (298),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 89/146 (61%), Gaps = 13/146 (9%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL P+S+ ++TY VAW+ S  KLTT+V++ G VNPTWN +  F  ++ 
Sbjct  7     FQLLELNIISAQDLAPLSRKMKTYAVAWVHSERKLTTRVDYTGGVNPTWNDKFVFRVNED  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVRHA  869
              L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R  
Sbjct  67    FLYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDS  791
             A+++RRPS G+ QG LN+ V ++  S
Sbjct  127   ALQVRRPS-GRPQGILNIGVGILDGS  151



>ref|XP_010509905.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Camelina 
sativa]
Length=596

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 89/146 (61%), Gaps = 13/146 (9%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL P+S+ ++TY VAW+ S  KLTT+V++ G VNPTWN +  F  ++ 
Sbjct  7     FQLLELNIISAQDLAPLSRKMKTYAVAWVHSERKLTTRVDYTGGVNPTWNDKFVFRVNED  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVRHA  869
              L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R  
Sbjct  67    FLYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDS  791
             A+++RRPS G+ QG LN+ V ++  S
Sbjct  127   ALQVRRPS-GRPQGILNIGVGILDGS  151



>ref|XP_010413889.1| PREDICTED: uncharacterized protein LOC104700118 [Camelina sativa]
Length=596

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 90/146 (62%), Gaps = 13/146 (9%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL P+S+ ++TY VAW+ S  KLTT+V+++G VNPTWN +  F  ++ 
Sbjct  7     FQLLELNIISAQDLAPLSRKMKTYAVAWVHSERKLTTRVDYSGGVNPTWNDKFVFRVNED  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVRHA  869
              L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R  
Sbjct  67    FLYADTSAVVVEIYGLHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDS  791
             A+++RRPS G+ QG LN+ V ++  S
Sbjct  127   ALQVRRPS-GRPQGILNIGVGILDGS  151



>ref|XP_007030351.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY10853.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=370

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 86/140 (61%), Gaps = 6/140 (4%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRI  1010
             ++LEIN+ISA DL PVSK ++TY VAW+   HKL T ++  G  +P+WN +  F  DD+ 
Sbjct  9     RILEINLISAEDLAPVSKNMKTYAVAWVQPDHKLATGIDQTGRTDPSWNEKFMFRLDDKF  68

Query  1009  LDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAA-----VEIRRPS  845
             L+S++ A+  EIY  AW++D+ IG   + +   +   S     + ++A     ++IRRPS
Sbjct  69    LNSEDAAIVVEIYAAAWVKDVLIGYVNVLIKDIFHLRSIADAKINYSATRTVTLQIRRPS  128

Query  844   TGQVQGTLNVTVQLIHDSPP  785
              G+ QG LN+ V L+  + P
Sbjct  129   -GRPQGILNMEVILLDSTTP  147



>ref|XP_006418119.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
 gb|ESQ36472.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
Length=595

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 89/147 (61%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  8     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR ++G+ QG LN+ V L+  S
Sbjct  128   VALQVRR-TSGRPQGILNIGVGLLDGS  153



>gb|KFK31057.1| hypothetical protein AALP_AA6G062700 [Arabis alpina]
Length=367

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 88/146 (60%), Gaps = 13/146 (9%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V+++G  NPTWN +  F   + 
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYSGGANPTWNDKFVFRVSED  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVRHA  869
              L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R  
Sbjct  67    FLYADTSAVVIEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRTNDEYRHTPPPGMRFV  126

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDS  791
             A+++RRPS G+ QG LN+ V ++  S
Sbjct  127   ALQVRRPS-GRPQGILNIGVGMLDGS  151



>ref|XP_002884443.1| hypothetical protein ARALYDRAFT_477695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60702.1| hypothetical protein ARALYDRAFT_477695 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 95/172 (55%), Gaps = 18/172 (10%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL PVS+ ++TY VAW+++    KLTT+V+ +   NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             ILD D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI---HDSPP---ETESGSQLSVSTLNKRGGETS  722
             IRRPS G++QG L + V L+     S P   E   GS+   +  NKR  E S
Sbjct  130   IRRPS-GRLQGFLRLGVALLDGGQRSMPLSIEVFDGSRRGETNSNKRDQEAS  180



>emb|CDX89815.1| BnaA10g02670D [Brassica napus]
Length=498

 Score =   117 bits (292),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 87/139 (63%), Gaps = 7/139 (5%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++N   NPTWN +  F  D+ 
Sbjct  8     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRR-PSTGQ  836
              L +D  AV  EIY + W RD+ +GT  + +++  PP  +++P  R +  E RR P  G 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPP--SRRPGYRTSNNEYRRTPPQGM  125

Query  835   ----VQGTLNVTVQLIHDS  791
                 +QG LN+ V ++  S
Sbjct  126   RFVALQGILNIGVGVLDGS  144



>ref|XP_003590735.1| RNA-binding protein 12B [Medicago truncatula]
 gb|AES60986.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=682

 Score =   118 bits (295),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 88/142 (62%), Gaps = 7/142 (5%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+NVISA DL  + + +RTY VAW+    KL+T+V+  GH NPTWN +  F  D
Sbjct  6     APFQLLELNVISAQDLASLGRNMRTYAVAWVHPDRKLSTRVDTQGHTNPTWNDKFVFRVD  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA-----KKP-AVRHAAVEI  857
             +  L SD  A+  E+Y + W +D+ +GT  + + +  PP +      + P  +R  A+++
Sbjct  66    EEFLYSDTSAIMVEVYALHWFKDIHVGTVRVLVGNLIPPPTRPFHNDRAPMGMRFVALQV  125

Query  856   RRPSTGQVQGTLNVTVQLIHDS  791
             RRPS G+ QG LN+ V ++  S
Sbjct  126   RRPS-GRPQGILNIGVTVLDSS  146



>gb|KFK37859.1| hypothetical protein AALP_AA3G038400 [Arabis alpina]
Length=387

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 95/172 (55%), Gaps = 18/172 (10%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL P+S+ ++TY VAW+++    KLTT+V+ N   NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLAPISRNMKTYSVAWINTDPMRKLTTRVDQNNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS---------AKKPAVRHAAVE  860
             ILD D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDVGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI---HDSPP---ETESGSQLSVSTLNKRGGETS  722
             IRRPS G++QG L + V L+     S P   E   GS+    T +KR  E S
Sbjct  130   IRRPS-GRLQGFLRLGVALLDGGQRSMPLSVEVFDGSRRDGRTNSKRDNEAS  180



>ref|XP_006293875.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
 gb|EOA26773.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
Length=597

 Score =   117 bits (294),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 87/146 (60%), Gaps = 13/146 (9%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++ G  NPTWN +  F   + 
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSED  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVRHA  869
              L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R  
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDS  791
             A+++RRPS G+ QG LN+ V ++  S
Sbjct  127   ALQVRRPS-GRPQGILNIGVGILDGS  151



>ref|XP_002889512.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65771.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PV++  +TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR ++G+ QG LN+ V LI  S
Sbjct  128   VALQVRR-TSGRPQGILNIGVGLIDGS  153



>ref|NP_171948.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE27711.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=601

 Score =   117 bits (293),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PV++  +TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR ++G+ QG LN+ V LI  S
Sbjct  128   VALQVRR-TSGRPQGILNIGVGLIDGS  153



>ref|XP_003556915.1| PREDICTED: uncharacterized protein LOC100779058 [Glycine max]
Length=449

 Score =   115 bits (288),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 85/142 (60%), Gaps = 7/142 (5%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             A Y+LLE+NVISA DL PV +++RTY +AW+D   KL+T+V+  G  NPTWN +  F  D
Sbjct  6     ACYQLLELNVISAQDLAPVGRSMRTYAIAWIDPDRKLSTRVDSQGGTNPTWNDKFVFRVD  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA------KKPAVRHAAVEI  857
             +  L  +E  +  +IY + W RD+ +G+A +     +PP +       K   ++   +++
Sbjct  66    EDFLYDEESVITIDIYALHWFRDIHVGSAQVLSGDLFPPPTQPQKNTYKSTGMQFMGLQV  125

Query  856   RRPSTGQVQGTLNVTVQLIHDS  791
             +RPS G+ +G LN+   +I  S
Sbjct  126   QRPS-GRPKGILNIGAAIIDSS  146



>ref|XP_002881275.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57534.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=595

 Score =   117 bits (292),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 87/146 (60%), Gaps = 13/146 (9%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++ G  NPTWN +  F   + 
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSED  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVRHA  869
              L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R  
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDS  791
             A+++RRPS G+ QG LN+ V ++  S
Sbjct  127   ALQVRRPS-GRPQGILNIGVGILDGS  151



>ref|XP_010025828.1| PREDICTED: uncharacterized protein LOC104416088 [Eucalyptus grandis]
 gb|KCW57326.1| hypothetical protein EUGRSUZ_H00125 [Eucalyptus grandis]
Length=155

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 82/140 (59%), Gaps = 6/140 (4%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P  LL+I++ISA DL  VS ++RTY VAW+    K +T+V+  G  NPTWN +  F  D 
Sbjct  8     PSPLLKIDIISAQDLASVSHSMRTYAVAWVHPDRKFSTRVDTRGQCNPTWNDKFVFCVDQ  67

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS-----AKKPAVRHAAVEIRR  851
               L  +  AV  EIY V W RD+ IGT  + +++F PP S      +   +R  A+++RR
Sbjct  68    EFLRRETSAVMVEIYAVHWFRDVLIGTVRVLVSNFAPPSSWPFRRKQLIGMRVVALQVRR  127

Query  850   PSTGQVQGTLNVTVQLIHDS  791
             PS G+ QG LNV   L+  S
Sbjct  128   PS-GRPQGILNVGGTLLDSS  146



>ref|XP_006410470.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
 gb|ESQ51923.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
Length=597

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 87/146 (60%), Gaps = 13/146 (9%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++ G  NPTWN +  F   + 
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVSED  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVRHA  869
              L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R  
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTIRVLISNLIPPNRRPGYRSNDEYRRTPPPGMRFV  126

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDS  791
             A+++RRPS G+ QG LN+ V ++  S
Sbjct  127   ALQVRRPS-GRPQGILNIGVGILDGS  151



>ref|XP_011073723.1| PREDICTED: uncharacterized protein LOC105158612 [Sesamum indicum]
Length=505

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 91/159 (57%), Gaps = 7/159 (4%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEIN+IS  DL PV++ +RTY  AW+    KL++ V+  G+ NPTWN +  F  ++
Sbjct  7     PFQLLEINIISGQDLEPVARKMRTYAKAWVHPNRKLSSCVDKEGNNNPTWNDKFVFRVEE  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------LSAKKPAVRHAAVEIR  854
               L  D  AV  EIY+  WLRD+ +GT  + + +  PP       ++    +R  A+++R
Sbjct  67    EFLREDSSAVMIEIYSAHWLRDVLVGTVRVLVGNLIPPPVRTHQNNSHYMGMRFVALQVR  126

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             RPS G+ QG LN+ V L+  S        QLS S +  R
Sbjct  127   RPS-GRPQGILNIGVALLDGSLRSMPLYRQLSSSAVGYR  164



>ref|XP_011077131.1| PREDICTED: uncharacterized protein LOC105161211 [Sesamum indicum]
Length=377

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 98/338 (29%), Positives = 153/338 (45%), Gaps = 41/338 (12%)
 Frame = -1

Query  1180  EINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRILDS  1001
             ++++ISA DL PV K++RTY VAW++   KLTT+ +  GH +PTWN + +F  D + L S
Sbjct  35    DVSLISAQDLSPVCKSMRTYAVAWINPNRKLTTRTDQQGHTHPTWNEKFSFRVDTKSLIS  94

Query  1000  DEGAVKFEIYNVAWLRDLPIGTATLTLNSFYP-----PLSAKKPAVRHAAVEIRRPSTGQ  836
             +  A+  EIY V+W RD+ +GT  + ++         PL     + R  A+++RRPS G 
Sbjct  95    ENSAMTVEIYTVSWFRDVLVGTVRVLISDLLAPPSGIPLQNLPRSTRFIALQVRRPS-GA  153

Query  835   VQGTLNVTVQLIHD---SPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEP  665
              QG LN+ V L+     S P            + K+ G  S + +      DG+ E  E 
Sbjct  154   PQGILNMGVSLLDTTMRSMPLNPIADNFH-DEIQKKAGAVSLQQELPQYDEDGEDEKKEL  212

Query  664   E--IKRGKSVRIVSEKDDASPGDMKLKNCPSFSASYVSGMHPLPSEVAAGLKKGLYYFPG  491
             E  I+  +S+ + SE    +  D  LK       S ++G  P P  V    +  L     
Sbjct  213   ERKIQLWRSLSVGSE---MNTDDFALKPGSVIDGSIINGSLPPPLPVKPATQIRLEI---  266

Query  490   EEEEYGSSIFENWSVPGETKSKSSKTVS----WRME----HKVIPMAGKDHGGAAGGSYN  335
               ++  SSI E  ++  E K+K  +T +    WR E    H  +     D          
Sbjct  267   -NDDTSSSILEELTIE-EAKAKGYRTRTSRERWRREVSDGHTDLESCDDD----------  314

Query  334   TKRTRLSKLQRRsssgggcmscfGNAYGLRFKFICGSN  221
                + LS  +R S             YG+ F  +CG++
Sbjct  315   ---SELSTNKRHSRRNSDGGLFSCLVYGIEFTIVCGAS  349



>emb|CDY23753.1| BnaC04g43690D [Brassica napus]
Length=610

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 88/148 (59%), Gaps = 13/148 (9%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             A ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++ G  NPTWN +  F   
Sbjct  5     ASFQLLELNLISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGEANPTWNDKFVFRVS  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVR  875
             +  L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R
Sbjct  65    EDFLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMR  124

Query  874   HAAVEIRRPSTGQVQGTLNVTVQLIHDS  791
               A+++RRPS G+ QG LN+ V ++  S
Sbjct  125   FIALQVRRPS-GRPQGILNIGVGILDGS  151



>ref|NP_180890.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAB80650.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08815.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=602

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 87/146 (60%), Gaps = 13/146 (9%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++ G  NPTWN +  F   + 
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGGNPTWNDKFVFRVSED  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVRHA  869
              L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R  
Sbjct  67    FLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNEEYRRTPPPGMRFV  126

Query  868   AVEIRRPSTGQVQGTLNVTVQLIHDS  791
             A+++RRPS G+ QG LN+ V ++  S
Sbjct  127   ALQVRRPS-GRPQGILNIGVGILDGS  151



>ref|XP_010475114.1| PREDICTED: uncharacterized protein LOC104754591 [Camelina sativa]
Length=600

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PV++  +TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNNNEYRRTPPPGMRF  127

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR ++G+ QG LN+ V L+  S
Sbjct  128   VALQVRR-TSGRPQGILNIGVGLLDGS  153



>ref|XP_010485810.1| PREDICTED: putative lysozyme-like protein [Camelina sativa]
Length=391

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL PVS+ ++TY VAW+++    KLTT+V+ +   NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             ILD+D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILDADASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + V L+
Sbjct  130   IRRPS-GRLQGFLRLGVALL  148



>ref|XP_010457504.1| PREDICTED: uncharacterized protein LOC104738975 [Camelina sativa]
Length=600

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PV++  +TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR ++G+ QG LN+ V L+  S
Sbjct  128   VALQVRR-TSGRPQGILNIGVGLLDGS  153



>ref|XP_009141305.1| PREDICTED: uncharacterized protein LOC103865261 [Brassica rapa]
Length=611

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 88/148 (59%), Gaps = 13/148 (9%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             A ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++ G  NPTWN +  F   
Sbjct  5     ASFQLLELNLISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVS  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVR  875
             +  L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R
Sbjct  65    EDFLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMR  124

Query  874   HAAVEIRRPSTGQVQGTLNVTVQLIHDS  791
               A+++RRPS G+ QG LN+ V ++  S
Sbjct  125   FVALQVRRPS-GRPQGILNIGVGILDGS  151



>ref|XP_010463915.1| PREDICTED: uncharacterized protein LOC104744544 [Camelina sativa]
Length=392

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL PVS+ ++TY VAW+++    KLTT+V+ +   NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             ILD+D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILDADASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + V L+
Sbjct  130   IRRPS-GRLQGFLRLGVALL  148



>ref|XP_010483923.1| PREDICTED: uncharacterized protein LOC104762347 [Camelina sativa]
Length=601

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PV++  +TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMRF  127

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR ++G+ QG LN+ V L+  S
Sbjct  128   VALQVRR-TSGRPQGILNIGVGLLDGS  153



>gb|AAB80639.1| Contains similarity to Glycine SRC2 (gb|AB000130) [Arabidopsis 
thaliana]
Length=578

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PV++  +TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  5     FQLLELNIISAQDLAPVARKTKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE  64

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  65    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  124

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR ++G+ QG LN+ V LI  S
Sbjct  125   VALQVRR-TSGRPQGILNIGVGLIDGS  150



>ref|XP_009118638.1| PREDICTED: uncharacterized protein LOC103843645 [Brassica rapa]
Length=593

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 89/147 (61%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PV++ ++TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  8     FQLLELNIISAQDLAPVARKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMRF  127

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR ++G+ QG LN+ V ++  S
Sbjct  128   VALQVRR-TSGRPQGILNIGVGVLDGS  153



>emb|CDY53195.1| BnaAnng12200D [Brassica napus]
Length=593

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 89/147 (61%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PV++ ++TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  8     FQLLELNIISAQDLAPVARKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTSNNEYRRTPPPGMRF  127

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR ++G+ QG LN+ V ++  S
Sbjct  128   VALQVRR-TSGRPQGILNIGVGVLDGS  153



>ref|XP_009119477.1| PREDICTED: uncharacterized protein LOC103844449 [Brassica rapa]
Length=561

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 90/149 (60%), Gaps = 18/149 (12%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++N   NPTWN +  F  D+ 
Sbjct  8     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNAGTNPTWNDKFVFRVDEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP---------------AV  878
              L +D  AV  EIY + W RD+ +GT  + +++  PP  +++P                +
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPP--SRRPGYRTSNNEYHRTPPQGM  125

Query  877   RHAAVEIRRPSTGQVQGTLNVTVQLIHDS  791
             R  A+++RR S G+ QG LN+ V ++  S
Sbjct  126   RFVALQVRRAS-GRPQGILNIGVGVLDGS  153



>emb|CDY37732.1| BnaA04g19360D [Brassica napus]
Length=611

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 88/148 (59%), Gaps = 13/148 (9%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             A ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++ G  NPTWN +  F   
Sbjct  5     ASFQLLELNLISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYTGGANPTWNDKFVFRVS  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------------LSAKKPAVR  875
             +  L +D  AV  EIY + W RD+ +GT  + +++  PP                 P +R
Sbjct  65    EDFLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTNDEYRHTPPPGMR  124

Query  874   HAAVEIRRPSTGQVQGTLNVTVQLIHDS  791
               A+++RRPS G+ QG LN+ V ++  S
Sbjct  125   FVALQVRRPS-GRPQGILNIGVGILDGS  151



>emb|CDY59181.1| BnaC08g50140D [Brassica napus]
Length=593

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 89/147 (61%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PV++ ++TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  8     FQLLELNIISAQDLAPVARKMKTYAVAWVHSERKLTTRVDYNGGANPTWNDKFVFRVNEE  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR ++G+ QG LN+ V ++  S
Sbjct  128   VALQVRR-TSGRPQGILNIGVGVLDGS  153



>ref|XP_006297897.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
 gb|EOA30795.1| hypothetical protein CARUB_v10013938mg [Capsella rubella]
Length=382

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL PVS+ ++TY VAW+++    KLTT+V+ +   NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS---------AKKPAVRHAAVE  860
             ILD D  A+  EIY  AW +D  +GT  + L+  + P S          +   +R   ++
Sbjct  70    ILDFDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDCGGRNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + V L+
Sbjct  130   IRRPS-GRLQGFLRLGVALL  148



>ref|XP_010556931.1| PREDICTED: uncharacterized protein LOC104826097 [Tarenaya hassleriana]
Length=585

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 90/148 (61%), Gaps = 15/148 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY +AW++S  +L T+V+++G  NPTWN +  F  ++ 
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAIAWVNSERRLATRVDYSGGSNPTWNDKFVFRVNEE  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP--------------LSAKKPAVR  875
              L +D  AV  EIY + W RD+ +GT  + +++  PP               S   P +R
Sbjct  67    FLYADTSAVMIEIYALHWFRDVHVGTVRVLISNLIPPSRRPGYRTGNNEYRRSTPPPGMR  126

Query  874   HAAVEIRRPSTGQVQGTLNVTVQLIHDS  791
               A+++RR ++G+ QG LN+ V L+  S
Sbjct  127   FVALQVRR-TSGRPQGILNIGVGLLDGS  153



>ref|XP_004495257.1| PREDICTED: proteoglycan 4-like [Cicer arietinum]
Length=713

 Score =   116 bits (290),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 86/144 (60%), Gaps = 11/144 (8%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP++LLE+NVISA DL  V + +RTY VAW+    KL+T+V+  GH NPTWN +  F  D
Sbjct  6     APFQLLELNVISAQDLASVGRNMRTYAVAWVHPDRKLSTRVDTQGHTNPTWNDKFVFRVD  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP--------AVRHAAV  863
             D  L +D  A   EIY + W +D+ +GT  + + +   P S  +P         +R  A+
Sbjct  66    DEFLYNDTSAFMIEIYALHWFKDIHVGTVRVLVGNLITPPS--RPFHKDNAPIGMRFVAL  123

Query  862   EIRRPSTGQVQGTLNVTVQLIHDS  791
             ++RRPS G+ QG LN+ V ++  S
Sbjct  124   QVRRPS-GRPQGILNIGVTVLDSS  146



>ref|XP_009123999.1| PREDICTED: uncharacterized protein LOC103848923 [Brassica rapa]
Length=384

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 82/140 (59%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL P+SK ++TY VAW+++    KLTT+V+     NP WN +  F  DD+
Sbjct  10    VLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             ILD D  ++  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + V L+
Sbjct  130   IRRPS-GRLQGFLRLGVALL  148



>emb|CDY49343.1| BnaA05g33050D [Brassica napus]
Length=384

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 81/140 (58%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWL--DSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL P+SK ++TY VAW+  D   KLTT+V+     NP WN +  F  DD+
Sbjct  10    VLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRANPIWNEKFVFRVDDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             ILD D  ++  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + V L+
Sbjct  130   IRRPS-GRLQGFLRLGVALL  148



>ref|XP_007145354.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
 gb|ESW17348.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
Length=438

 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 83/143 (58%), Gaps = 8/143 (6%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             A ++LLE++VISA DL P  +++RTY VAW+D   KL+T+V+ +G  NPTWN +  F  D
Sbjct  6     ARFQLLELHVISAQDLAPAGRSMRTYAVAWIDPDRKLSTRVDSHGGTNPTWNDKFVFRMD  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA-------KKPAVRHAAVE  860
                L  D   +  +IY + W RD+ +GTA +     +PP S        K   +R   ++
Sbjct  66    QDFLYDDSSVITIDIYALHWFRDIHVGTAEVLSTDLFPPSSQPQQPNAYKSTGMRFLGLQ  125

Query  859   IRRPSTGQVQGTLNVTVQLIHDS  791
             ++RPS G+ +G LNV   +I  S
Sbjct  126   VQRPS-GRPKGILNVGAAIIDSS  147



>gb|KFK42792.1| hypothetical protein AALP_AA1G039700 [Arabis alpina]
Length=572

 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 91/149 (61%), Gaps = 18/149 (12%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PVS+ ++TY VAW+ S  KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  7     FQLLELNIISAQDLAPVSRKMKTYAVAWVHSERKLTTRVDYNGGPNPTWNDKFVFRVNEE  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP---------------AV  878
              L +D  AV  EIY + W RD+ +GT  + +++  PP   ++P                +
Sbjct  67    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPP--DRRPGYRTSNNEYRRTPPQGM  124

Query  877   RHAAVEIRRPSTGQVQGTLNVTVQLIHDS  791
             R  A+++RR ++G+ QG LN+ V L+  S
Sbjct  125   RFVALQVRR-TSGRPQGILNIGVGLLDGS  152



>ref|XP_010522448.1| PREDICTED: uncharacterized protein LOC104801063 [Tarenaya hassleriana]
Length=580

 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 89/148 (60%), Gaps = 15/148 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL  VS+ ++TY +AW+ S  KLTT+V+++G  NPTWN +  F  +D 
Sbjct  7     FQLLELNIISAQDLAHVSRKMKTYAIAWVHSERKLTTRVDYSGGSNPTWNDKFVFRVNDE  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP--------------LSAKKPAVR  875
              L +D  AV  EIY + W RD+ +GT  + +++  PP               S   P +R
Sbjct  67    FLYADTSAVMIEIYALHWFRDVHVGTVRVLISNLIPPSHRPGFRTGNNEYRRSTLPPGMR  126

Query  874   HAAVEIRRPSTGQVQGTLNVTVQLIHDS  791
               A+++RR ++G+ QG LN+ V L+  S
Sbjct  127   FVALQVRR-TSGRPQGILNIGVGLLDGS  153



>emb|CDY42921.1| BnaC05g47300D [Brassica napus]
Length=377

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 82/140 (59%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL P+SK ++TY VAW+++    KLTT+V+     NP WN +  F  DD+
Sbjct  10    VLEINLISAQDLAPISKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVDDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             ILD D  ++  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILDVDASSIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + V L+
Sbjct  130   IRRPS-GRLQGFLRLGVALL  148



>gb|AAM67146.1| unknown [Arabidopsis thaliana]
Length=391

 Score =   112 bits (281),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 83/140 (59%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL PVS+ ++TY VAW+++    KLTT+V+ +   NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             ILD D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILDVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + + L+
Sbjct  130   IRRPS-GRLQGFLRLGIALL  148



>ref|XP_006303752.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
 gb|EOA36650.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
Length=600

 Score =   114 bits (286),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 87/147 (59%), Gaps = 14/147 (10%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA DL PV++  +TY VAW+    KLTT+V++NG  NPTWN +  F  ++ 
Sbjct  8     FQLLELNIISAQDLAPVARKTKTYAVAWVHPERKLTTRVDYNGGTNPTWNDKFVFRVNED  67

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------------LSAKKPAVRH  872
              L +D  AV  EIY + W RD+ +GT  + +++  PP                  P +R 
Sbjct  68    FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF  127

Query  871   AAVEIRRPSTGQVQGTLNVTVQLIHDS  791
              A+++RR S+G+ QG LN+ V L+  S
Sbjct  128   VALQVRR-SSGRPQGILNIGVGLLDGS  153



>ref|XP_006408192.1| hypothetical protein EUTSA_v10020890mg [Eutrema salsugineum]
 gb|ESQ49645.1| hypothetical protein EUTSA_v10020890mg [Eutrema salsugineum]
Length=392

 Score =   111 bits (278),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 83/140 (59%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL P+S+ ++TY VAW+++    KLTT+V+ +   NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLAPISRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             ILD D  A+  E+Y  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILDVDASAIVIEVYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + V L+
Sbjct  130   IRRPS-GRLQGFLRLGVALL  148



>ref|XP_010102203.1| hypothetical protein L484_024484 [Morus notabilis]
 gb|EXB93146.1| hypothetical protein L484_024484 [Morus notabilis]
Length=377

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 104/346 (30%), Positives = 160/346 (46%), Gaps = 30/346 (9%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRI  1010
             +LLE+N++SA DL  VSK+++T+ VAW+D   KL T+ +  G  NP WN + AF  DD  
Sbjct  10    RLLELNLLSARDLATVSKSMKTFAVAWIDQDRKLETRNDQTGQNNPAWNEKFAFRVDDDF  69

Query  1009  LDSDEGAVKFEIYNVAWLRDLP-IGTATLTLNSFYPPLSA---KK--PAVRHAAVEIRRP  848
             L S+   +  EI  +    ++  +GT ++ + S +P  S    K+    +R   ++IRRP
Sbjct  70    LVSESSTITIEIRALTRRGNVVLVGTVSVLVASLFPRSSTSFQKRSFSKMRFLTLQIRRP  129

Query  847   STGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPE  668
               G+ QG L+V V L+  +       S +S S     G  T+   D   DK    +  P 
Sbjct  130   -CGRPQGVLDVGVALLDGTRRSMPLSSDVSAS-----GYGTTDMMDTRSDKERKRKSLPN  183

Query  667   P-EIKRGKSVRIVSEKDDASPGDMKLKNCPSFSA---SYVSGMHPLPSEVAAGLKKGLYY  500
               +++R KS R +SE     P +  L +C        S  S + P PS VAA +  G Y 
Sbjct  184   MIKLRRSKSDRSISESCLLKPTNGSLISCSDLGKGKESLCSDVGPSPSVVAAAIAMGRY-  242

Query  499   FPGEEEEYG--------SSIFENWSVPGET-KSKSSKTVSWRME-HKVIPMAGKDHGGAA  350
              P + ++ G        SSI E W+   ++ +   +K   WR E H +     K +    
Sbjct  243   -PAKAKDSGGAANEMAESSILEEWTEEDDSAEGLKTKIERWRSEIHPLYQSQYKKNMSYH  301

Query  349   GGSYNTKRTRLSKLQRRsssgggcmscfG--NAYGLRFKFICGSNS  218
               +YN    R ++  ++    GG        NAYG  F   CG  S
Sbjct  302   RENYNRSTHRRNEPAKKELRRGGSGLFSCFGNAYGCEFSITCGGGS  347



>ref|XP_009143873.1| PREDICTED: uncharacterized protein LOC103867544 [Brassica rapa]
Length=561

 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 89/148 (60%), Gaps = 17/148 (11%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             ++LLE+N+ISA +L PVS+ ++TY VAW+ S  KLTT+V++ G  NPTWN +  F   + 
Sbjct  7     FQLLELNIISAQELAPVSRKMKTYAVAWVHSQRKLTTRVDYTGAANPTWNDKFVFRVSED  66

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP--------------AVR  875
              L +D  AV  EIY + W RD+ +GT  + +++  PP   ++P               +R
Sbjct  67    FLYADTSAVVVEIYTLHWFRDVHVGTIRVLISNLIPP--NRRPGYRSNEEYRHTPPLGMR  124

Query  874   HAAVEIRRPSTGQVQGTLNVTVQLIHDS  791
               A+++RRPS G+ QG LN+ V ++  S
Sbjct  125   FVALQVRRPS-GRPQGILNIGVGILDGS  151



>ref|XP_010557577.1| PREDICTED: uncharacterized protein LOC104826528 [Tarenaya hassleriana]
Length=446

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P ++LE+N+ISA DL PV++ ++TY VAWLD  HKLTT+V++ G  NPTWN +  F  D 
Sbjct  8     PSQILELNIISAQDLAPVARYMKTYAVAWLDPQHKLTTRVDNTGGTNPTWNDKFVFRLDK  67

Query  1015  RILDSDEGAVK-FEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
               L     ++   EIY + W +D+ IGT    +     P S   PA+R   +E+ R S G
Sbjct  68    EALYYGTSSIMVIEIYALHWFKDIHIGTVQALITDLLSPTSL--PAMRFVTLEVLRAS-G  124

Query  838   QVQGTLNVTVQLIHDSPP  785
             +  G LN+ V LI  S P
Sbjct  125   RPHGLLNIAVGLIDSSRP  142



>gb|ABK28543.1| unknown [Arabidopsis thaliana]
Length=354

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWL--DSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL PVS+ ++TY VAW+  D   KLTT+V+ +   NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             IL  D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + V L+
Sbjct  130   IRRPS-GRLQGFLRLGVALL  148



>gb|EPS62035.1| hypothetical protein M569_12761, partial [Genlisea aurea]
Length=167

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 89/159 (56%), Gaps = 7/159 (4%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P+ LLEINVISA +L PV K ++TY  AW+    KL+T V+++G+ +PTWN +  F  D+
Sbjct  7     PFHLLEINVISAQELEPVRKKMQTYATAWVHPQRKLSTSVDNDGNTSPTWNDKFVFKVDE  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP------LSAKKPAVRHAAVEIR  854
               L +D  AV  EI    W  D+ +G+  + + +  PP          +  ++  A+++R
Sbjct  67    DFLRNDTSAVSIEILAEHWFTDIVVGSVRIIIGNLIPPHVWTDRRHHHRIGMQFIALQVR  126

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             RPS G+ QG LN+ V +++ +       +QLS S    R
Sbjct  127   RPS-GRPQGILNIGVAVLNGTMRSMPLYTQLSASAFGYR  164



>ref|XP_011069440.1| PREDICTED: uncharacterized protein LOC105155266 [Sesamum indicum]
Length=404

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 101/362 (28%), Positives = 162/362 (45%), Gaps = 54/362 (15%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             + LLEI++ISA DL P+SK+++TY +AW++   K TT+ +  G+ NP WN +  F   + 
Sbjct  32    FYLLEISLISAQDLAPISKSMQTYAMAWINPNKKHTTRTDQQGNKNPMWNDKFVFRLTNE  91

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP----LSAKKPAVRHAAVEIRRPS  845
             +L S+   V  EIY V+W RD+ +G   + ++    P    L       R  A+++RRPS
Sbjct  92    LLHSETATVTVEIYTVSWFRDVLVGMVRVLISDLITPLIRTLQTNTKNTRFVALQVRRPS  151

Query  844   TGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEP  665
              G  QG LN+ + L+ DS   +      +     K   + S E + + D     ++    
Sbjct  152   -GTPQGILNMGISLL-DSTMRSMPLKNYAARKHAKNNVQDSDEKNTNPDDDTLQKDEQLS  209

Query  664   EIKRGKSVRIV--------SEKDDASP--------GDMKLKNCPSFSASY----VSGMHP  545
             + KR  + +I         SE ++  P        G M   +  + S  Y     S + P
Sbjct  210   DEKRELNAKIQLWRSLSAGSEVNEDFPVKAGSIYNGSMVNGSLCNGSIEYGSELCSDIGP  269

Query  544   LPSEVAAGLKKGLYYFP----------------GEEEEYGSSIFENWSVPGETKSKSSKT  413
               S VAA + K L   P                G+ +E GSSI E  ++      + +K 
Sbjct  270   SASIVAAEVAKKLQPPPDLTYPAASNPKEAKLQGDHQETGSSILEELTI------EEAKA  323

Query  412   VSWRMEHKVIPMAGKDHGGAAGGSYNTKRTRLSKLQRRsssgggcmscfGNAYGLRFKFI  233
               +R+  K      +D   +      + R+      RR+ +  G  SCFGNAYG+ F  +
Sbjct  324   KGYRVASKERSRRDRDGNESEMSIVTSGRS------RRNPADAGLFSCFGNAYGIEFTIV  377

Query  232   CG  227
             CG
Sbjct  378   CG  379



>ref|NP_566225.4| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
 gb|AEE74070.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
Length=391

 Score =   108 bits (271),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL PVS+ ++TY VAW+++    KLTT+V+ +   NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             IL  D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + V L+
Sbjct  130   IRRPS-GRLQGFLRLGVALL  148



>ref|XP_010558947.1| PREDICTED: uncharacterized protein LOC104827473 [Tarenaya hassleriana]
Length=396

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 83/144 (58%), Gaps = 10/144 (7%)
 Frame = -1

Query  1204  PQAPYKLLEINVISAHDLPPVSKTLRTYVVAWL--DSGHKLTTKVNHNGHVNPTWNYRLA  1031
             P+    +LEIN+ISA DL  VS+ ++TY VAW+  D   KLTT+V+     NP WN +L 
Sbjct  4     PRILLPVLEINMISAQDLASVSRNMKTYAVAWINTDPMRKLTTRVDQTNRANPIWNEKLV  63

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS-------AKKPAVRH  872
             F  +D+IL+ D  A+  EIY  AW +D  +G+  + L+  + P S            +R 
Sbjct  64    FRVNDKILNVDASAIVIEIYAAAWAKDALVGSINVLLSDLFAPWSGFNHGGGNGNNNMRL  123

Query  871   AAVEIRRPSTGQVQGTLNVTVQLI  800
               ++IRRPS G++QG L + + L+
Sbjct  124   VTLQIRRPS-GRLQGLLRLGIALL  146



>gb|AAF26778.1|AC016829_2 hypothetical protein [Arabidopsis thaliana]
Length=353

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 12/140 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWL--DSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL PVS+ ++TY VAW+  D   KLTT+V+ +   NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
             IL  D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    ILYVDASAIVIEIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLI  800
             IRRPS G++QG L + V L+
Sbjct  130   IRRPS-GRLQGFLRLGVALL  148



>ref|XP_009136211.1| PREDICTED: uncharacterized protein LOC103860372 [Brassica rapa]
 emb|CDX93113.1| BnaA03g38350D [Brassica napus]
Length=404

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+NVISA +L PV++ ++TY +AW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILELNVISAQELAPVARCMKTYAIAWIDPECKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S    A+R   +E+ R S G
Sbjct  65    EEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVDPSS----AMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>ref|XP_010467176.1| PREDICTED: uncharacterized protein LOC104747266 [Camelina sativa]
Length=404

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY +AW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S    A+R   +E+ R S G
Sbjct  65    EEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS----AMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>gb|KFK39933.1| hypothetical protein AALP_AA3G308600 [Arabis alpina]
Length=401

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 82/136 (60%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY +AW+D   KLTT+V++ G  +PTWN +  F  +
Sbjct  5     APCQILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLE  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L  +   V  EIY + W +D+ +GT    ++    P S    A+R   +E+ R S G
Sbjct  65    EEALYDERSIVVIEIYALHWFKDIHVGTVQALISDLVTPSS----AMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>ref|XP_010518533.1| PREDICTED: uncharacterized protein LOC104793798 [Camelina sativa]
Length=404

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY +AW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S    A+R   +E+ R S G
Sbjct  65    EEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS----AMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>ref|XP_002885870.1| hypothetical protein ARALYDRAFT_480303 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62129.1| hypothetical protein ARALYDRAFT_480303 [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY +AW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S    A+R   +E+ R S G
Sbjct  65    EEALYDATSIVVIEIYALHWFKDIHVGTVQTLISDLVSPSS----AMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>ref|XP_010262513.1| PREDICTED: uncharacterized protein LOC104601031 [Nelumbo nucifera]
Length=318

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 129/266 (48%), Gaps = 20/266 (8%)
 Frame = -1

Query  1204  PQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKL--TTKVNHNGHVNPTWNYRLA  1031
             P  P   LEINVISA DL PV+  +RTY VA LD   K   +T++   GH NPTWN +  
Sbjct  9     PLVPSLHLEINVISALDLAPVTSAMRTYAVACLDRERKCKQSTRIALIGHTNPTWNAKFI  68

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWL-RDLPIGTATLTLNSFYPPLSAKKPAVRH----AA  866
             FP D+  L S   +V  EIY + +L R++ +GT  + +++F  P S+ +P  R       
Sbjct  69    FPVDEDFLKSYTSSVIIEIYALRYLFRNVLVGTVHVLVSNFIHP-SSLQPHDRDYGQLVC  127

Query  865   VEIRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidg  686
             +++RRPS  + QG LN++V L+ +S       +Q S +T+     +  G+          
Sbjct  128   LQVRRPS-DRPQGLLNISVALLDNSVRIMPLCNQPSTTTVGY--SDLMGKKMHTPHHRSY  184

Query  685   DQENPEPEIKRGKSVRIVSEKDDAS---PGDMKLKNCPSFSASYVSGMHPLPSEVAAGLK  515
               +  +P   + K   + S+KDD S    G   + N     +          S  AA  +
Sbjct  185   TPKKVQPRSSKSKR-SVESDKDDLSSGWSGSTTITNSSHLKSDTGRTYSTFTSTEAAITE  243

Query  514   KGLYYFPGEEEEYGSSIFENWSVPGE  437
                 YF   EEE GSS+ E WSV  E
Sbjct  244   D---YF--AEEEIGSSVLERWSVDEE  264



>emb|CDX89605.1| BnaC03g45190D [Brassica napus]
Length=406

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+NVISA +L PV++ ++TY +AW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILELNVISAQELAPVARCMKTYAIAWIDPECKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S    A+R   +E+ R S G
Sbjct  65    EEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVDPSS----AMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>ref|NP_178968.1| C2 domain-containing protein [Arabidopsis thaliana]
 gb|AAD28670.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM15260.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAC43170.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63412.1| At2g13350 [Arabidopsis thaliana]
 gb|AEC06226.1| C2 domain-containing protein [Arabidopsis thaliana]
Length=401

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY +AW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S    A+R   +E+ R S G
Sbjct  65    EEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS----AMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>ref|XP_010488836.1| PREDICTED: uncharacterized protein LOC104766620 [Camelina sativa]
Length=403

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY +AW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILELNIISAQELAPVARCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S    A+R   +E+ R S G
Sbjct  65    EEALYDATSIVVIEIYALHWFKDIHVGTVQALISDLVSPSS----AMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>gb|KCW57325.1| hypothetical protein EUGRSUZ_H00124 [Eucalyptus grandis]
Length=153

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 85/140 (61%), Gaps = 7/140 (5%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             + LLE+++ISA DL PVS+ +RTY V W+    KL T+V+  G  +PTWN R  F  ++ 
Sbjct  9     FHLLEVDIISAQDLAPVSRYMRTYAVVWVHPDGKLPTRVDACGRCDPTWNDRFVFRVNEE  68

Query  1012  ILDSDEGAVKFEIYNVAWL-RDLPIGTATLTLNSFYP----PLSAKKPAVRHA-AVEIRR  851
              L  D  AV  EIY V  L +D+ +GT  + +++F+P        ++ + RH  A+++RR
Sbjct  69    FLRRDTSAVMIEIYAVRRLFKDVRVGTVRVLVSNFFPRPSRSFRREQHSGRHVMALQVRR  128

Query  850   PSTGQVQGTLNVTVQLIHDS  791
             PS G+ QG LNV V L+  S
Sbjct  129   PS-GRPQGILNVGVALLDSS  147



>emb|CDY37206.1| BnaA09g08270D [Brassica napus]
Length=407

 Score =   106 bits (264),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 80/136 (59%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY VAW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S     +R   +E+ R S G
Sbjct  65    EEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS----GMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>ref|XP_009112245.1| PREDICTED: uncharacterized protein LOC103837642 [Brassica rapa]
Length=407

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 80/136 (59%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY VAW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S     +R   +E+ R S G
Sbjct  65    EEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS----GMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>emb|CDY37207.1| BnaA09g08280D [Brassica napus]
Length=407

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 80/136 (59%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY VAW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S     +R   +E+ R S G
Sbjct  65    EEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS----GMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>emb|CDX81442.1| BnaC09g08530D [Brassica napus]
Length=408

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 80/136 (59%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY VAW+D   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     APCQILEMNIISAQELAPVARCMKTYAVAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S     +R   +E+ R S G
Sbjct  65    EEALYDGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS----GMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>ref|XP_006300066.1| hypothetical protein CARUB_v10016294mg [Capsella rubella]
 gb|EOA32964.1| hypothetical protein CARUB_v10016294mg [Capsella rubella]
Length=404

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 79/136 (58%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY +AW+D   KL T+V++ G   PTWN +  F  D
Sbjct  5     APCQILELNIISAQELAPVARCMKTYAIAWIDPERKLMTRVDNTGGTTPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +     D   V  EIY + W +D+ +GT    ++    P S    A+R   +E+ R S G
Sbjct  65    EETTYDDTTIVVIEIYALHWFKDIHVGTVQALISDLVSPSS----AMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI +S
Sbjct  120   RPHGLLNIAVGLIDNS  135



>ref|XP_009590587.1| PREDICTED: ankyrin repeat-containing protein kinase A-like [Nicotiana 
tomentosiformis]
Length=535

 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 80/138 (58%), Gaps = 7/138 (5%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEIN+ISA DL P+SK ++TY   W+    KLTT V+  G  NPTWN +  F  D+
Sbjct  6     PFQLLEINIISAQDLQPISKKMKTYATVWVHPTRKLTTAVDVEGGNNPTWNDKFVFRVDE  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP------AVRHAAVEIR  854
               L  D  AV+ EI+ V W +D  +G+  + + +  PP             +R  A+++R
Sbjct  66    EFLRQDTSAVQIEIHCVHWFKDSVVGSVRVLVGNLIPPPPRPHHNHHHHFGMRFVALQVR  125

Query  853   RPSTGQVQGTLNVTVQLI  800
             RPS G+ QG LN+ V L+
Sbjct  126   RPS-GRPQGILNIGVALL  142



>ref|XP_009767920.1| PREDICTED: uncharacterized protein LOC104218993 [Nicotiana sylvestris]
Length=520

 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 80/138 (58%), Gaps = 7/138 (5%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEIN+ISA DL P+SK ++TY   W+    KLTT V+  G  NPTWN +  F  D+
Sbjct  6     PFQLLEINIISAQDLQPISKKMKTYATVWVHPTRKLTTAVDVEGGNNPTWNDKFVFRVDE  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKP------AVRHAAVEIR  854
               L  D  AV+ EI+ V W +D  +G+  + + +  PP             +R  A+++R
Sbjct  66    EFLRQDTSAVQIEIHCVHWFKDSLVGSVRVLVGNLIPPPPRPHHNHHHHFGMRFVALQVR  125

Query  853   RPSTGQVQGTLNVTVQLI  800
             RPS G+ QG LN+ V L+
Sbjct  126   RPS-GRPQGILNIGVALL  142



>ref|XP_010251574.1| PREDICTED: uncharacterized protein LOC104593437 [Nelumbo nucifera]
Length=269

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             LLEIN+ISA  L P S  LR   TY VAW+DS  KL T+V+  G  NPTWN +  F    
Sbjct  7     LLEINLISAQGLKPPSANLRRMQTYAVAWIDSAIKLRTRVDRVGCENPTWNDKFIFRVSS  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L +D  AV  EIY V +L+D  IGT    + +    LS+  P    +A++IRRPS+G+
Sbjct  67    AFLSTDTSAVSVEIYVVGYLKDTLIGTVRFLIGN---CLSSSAPT--FSALQIRRPSSGR  121

Query  835   VQGTLNVTVQLIHD  794
               G LN+   +I +
Sbjct  122   FHGVLNIGAMVIKN  135



>ref|XP_009377282.1| PREDICTED: BON1-associated protein 2 [Pyrus x bretschneideri]
Length=223

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 79/135 (59%), Gaps = 7/135 (5%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN+ISA DL P S  LR   TY +AW+DS HK+ ++V+  G  NPTWN R  F    
Sbjct  14    VLEINLISAQDLKPPSAALRRMQTYALAWVDSAHKIRSRVDKIGGENPTWNDRFLFKVPS  73

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  +IY V    D  +GT  L +N+F   +++K P+    A++IRRPS G+
Sbjct  74    AFLSSETSQVSIQIYAVGCFSDHLVGTVRLLINNFL-DVASKVPSF--TAIQIRRPS-GR  129

Query  835   VQGTLNVTVQLIHDS  791
              QG LNV   +I  S
Sbjct  130   FQGVLNVAAMVIDGS  144



>ref|XP_008801291.1| PREDICTED: uncharacterized protein LOC103715451 [Phoenix dactylifera]
Length=337

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 77/134 (57%), Gaps = 11/134 (8%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRIL  1007
             LLE+ V+SA DL   S+++RTY VAW++  HKL T+++  GH  PTWN +  F  DD +L
Sbjct  23    LLEVTVVSAQDLFANSRSMRTYAVAWIEPAHKLRTRLDAAGHTEPTWNDKFVFRVDDAVL  82

Query  1006  DSDEGAVKFEIYNVAWLRDLP-----IGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPST  842
              SD  AV   IY  A  R LP     IGTA   L++  P       A R  AV +RRP +
Sbjct  83    RSDTAAVTVNIY-AARPRFLPASDILIGTARALLSALRP-----STATRFVAVLVRRPQS  136

Query  841   GQVQGTLNVTVQLI  800
              + QG LN+ V L+
Sbjct  137   LRPQGILNIGVSLL  150



>ref|XP_010920373.1| PREDICTED: CASP-like protein 4A1 [Elaeis guineensis]
Length=458

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 78/134 (58%), Gaps = 11/134 (8%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRIL  1007
             LLE+ V+SA DL   S+++RTY VAW+D  HKL T+++  GH  PTWN +  F  DD IL
Sbjct  23    LLEVTVVSAQDLFANSRSMRTYAVAWIDPAHKLRTRLDAAGHTEPTWNDKFVFRLDDAIL  82

Query  1006  DSDEGAVKFEIYNVAWLRDLP-----IGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPST  842
              SD  AV   I+  A  R LP     IGTA   L++  P  +      R  AV++RRP +
Sbjct  83    RSDTAAVTVNIF-AARPRFLPGSDNLIGTARALLSTLRPSTT-----TRFVAVQVRRPQS  136

Query  841   GQVQGTLNVTVQLI  800
              + QG LN+ V L+
Sbjct  137   LRPQGILNLGVSLL  150



>ref|XP_004247791.2| PREDICTED: uncharacterized protein LOC101245204 [Solanum lycopersicum]
Length=521

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 8/139 (6%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEIN+ISA DL PVSK ++TY   W+    KLTT V+  G  NPTWN +  F  D+
Sbjct  6     PFQLLEINIISAQDLEPVSKKMKTYATVWVHPTRKLTTAVDIEGGNNPTWNDKFVFRVDE  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAK-------KPAVRHAAVEI  857
               L  D  AV+ EI+   W +D  +G+  + + +  P  S            +R  A+++
Sbjct  66    EFLRQDTSAVQIEIHCGHWFKDSLVGSVRVLVGNLIPSPSRTHHNHHPHNLGMRFVALQV  125

Query  856   RRPSTGQVQGTLNVTVQLI  800
             RRPS G+ QG LN+ V L+
Sbjct  126   RRPS-GRPQGILNIGVALL  143



>ref|XP_010026783.1| PREDICTED: protein bunched, class 2/F/G isoform-like [Eucalyptus 
grandis]
Length=456

 Score =   105 bits (261),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 88/159 (55%), Gaps = 7/159 (4%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+N+ISA DL  V++T+RTY VAW+    KL+T+V+ NG  +PTWN +  F  D+
Sbjct  8     PFQLLELNIISAQDLAMVARTMRTYAVAWVHPDRKLSTRVDSNGRNSPTWNDKFVFRVDE  67

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPL------SAKKPAVRHAAVEIR  854
               L SD   V  EIY V W +D+ +G   + +     P             +R  A+++R
Sbjct  68    EFLRSDTSGVMIEIYAVHWFKDVLVGRVRVLVGHLVTPQPHPFRHQQHHVGMRFVALQVR  127

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             RPS G+ QG LN+ V ++  S        QL+ S +  R
Sbjct  128   RPS-GRPQGILNIGVAVLDSSMRSMPLYMQLNASAVGYR  165



>gb|KCW60206.1| hypothetical protein EUGRSUZ_H02915 [Eucalyptus grandis]
Length=452

 Score =   105 bits (261),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 88/159 (55%), Gaps = 7/159 (4%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLE+N+ISA DL  V++T+RTY VAW+    KL+T+V+ NG  +PTWN +  F  D+
Sbjct  8     PFQLLELNIISAQDLAMVARTMRTYAVAWVHPDRKLSTRVDSNGRNSPTWNDKFVFRVDE  67

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPL------SAKKPAVRHAAVEIR  854
               L SD   V  EIY V W +D+ +G   + +     P             +R  A+++R
Sbjct  68    EFLRSDTSGVMIEIYAVHWFKDVLVGRVRVLVGHLVTPQPHPFRHQQHHVGMRFVALQVR  127

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             RPS G+ QG LN+ V ++  S        QL+ S +  R
Sbjct  128   RPS-GRPQGILNIGVAVLDSSMRSMPLYMQLNASAVGYR  165



>ref|XP_003590193.1| hypothetical protein MTR_1g045780 [Medicago truncatula]
 gb|AES60444.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=459

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 81/142 (57%), Gaps = 7/142 (5%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             A Y+LLE+NVISA DL  V +++RTY VAW+D   KL+T+V+     NP WN +  F  D
Sbjct  6     ACYQLLELNVISAQDLAEVGRSMRTYAVAWVDPDRKLSTRVDSQSGTNPAWNDKFVFRVD  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPL------SAKKPAVRHAAVEI  857
             +  L  +   +  +IY + W +D+ +GTA +  +   PP       + K   ++   +++
Sbjct  66    EDFLYDENSTITIDIYAIHWFKDIHVGTAHVLADDIIPPSRPSHSNNYKPQGMQFVGLQV  125

Query  856   RRPSTGQVQGTLNVTVQLIHDS  791
              RPS G+ +G LNV V +I  S
Sbjct  126   HRPS-GRPKGILNVGVAVIDSS  146



>emb|CDX92066.1| BnaC03g33680D [Brassica napus]
Length=383

 Score =   103 bits (257),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 80/141 (57%), Gaps = 12/141 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL  VSK ++TY VAW+++    KLTT+V+     NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLSLVSKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
              L +D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    TLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLIH  797
             IRRPS G++QG L + V L+ 
Sbjct  130   IRRPS-GRLQGFLRLGVALLD  149



>ref|XP_010533203.1| PREDICTED: uncharacterized protein LOC104809022 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010533204.1| PREDICTED: uncharacterized protein LOC104809022 isoform X2 [Tarenaya 
hassleriana]
Length=431

 Score =   104 bits (259),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 80/136 (59%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
              P ++LE+N+ISA DL PV++ ++TY +AWLD   KLTT+V++ G  +PTWN +  F  D
Sbjct  5     GPSQILELNIISAQDLAPVARYMKTYAIAWLDPERKLTTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L  +   V  EIY + W +D+ +GT    ++     +S    A+R   +E+ R S G
Sbjct  65    EESLYDETSLVVIEIYALHWFKDIHVGTVQALVSDLVNHVS----AMRFVTLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V LI  S
Sbjct  120   RPHGLLNIAVGLIDSS  135



>ref|XP_009134757.1| PREDICTED: uncharacterized protein LOC103859027 [Brassica rapa]
Length=397

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 79/141 (56%), Gaps = 12/141 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWL--DSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL  VSK ++TY VAW+  D   KLTT+V+     NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLSLVSKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---------KKPAVRHAAVE  860
              L +D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    TLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLIH  797
             IRRPS G++QG L + V L+ 
Sbjct  130   IRRPS-GRLQGFLRLGVALLD  149



>emb|CDX74193.1| BnaA03g28540D [Brassica napus]
Length=387

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 80/141 (57%), Gaps = 12/141 (9%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWLDSG--HKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA DL  VSK ++TY VAW+++    KLTT+V+     NP WN +  F  +D+
Sbjct  10    VLEINLISAQDLSLVSKNMKTYSVAWINTDPMRKLTTRVDQANRSNPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS---------AKKPAVRHAAVE  860
              L +D  A+  EIY  AW +D  +GT  + L+  + P S              +R   ++
Sbjct  70    TLQADVSAIVIEIYAAAWSKDALVGTVNVLLSDLFAPWSGFGDGDEGGGGNNNMRLVTLQ  129

Query  859   IRRPSTGQVQGTLNVTVQLIH  797
             IRRPS G++QG L + V L+ 
Sbjct  130   IRRPS-GRLQGFLRLGVALLD  149



>ref|XP_006409691.1| hypothetical protein EUTSA_v10022712mg [Eutrema salsugineum]
 gb|ESQ51144.1| hypothetical protein EUTSA_v10022712mg [Eutrema salsugineum]
Length=400

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 80/136 (59%), Gaps = 5/136 (4%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             AP ++LE+N+ISA +L PV++ ++TY +AW+D   KL T+V++ G  +PTWN +  F  D
Sbjct  5     APSQILELNIISAQELAPVARCMKTYAIAWIDPERKLMTRVDNTGGTSPTWNDKFVFRLD  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
             +  L      V  EIY + W +D+ +GT    ++    P S    A+R   +E+ R S G
Sbjct  65    EEALYHGTSIVVIEIYALHWFKDIHVGTVQTLISDLVNPSS----AMRFITLEVLRAS-G  119

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+ V +I +S
Sbjct  120   RPHGLLNIAVGVIDNS  135



>gb|EYU39778.1| hypothetical protein MIMGU_mgv1a009123mg [Erythranthe guttata]
Length=352

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 104/331 (31%), Positives = 156/331 (47%), Gaps = 36/331 (11%)
 Frame = -1

Query  1198  APYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             A  +LLEI++ISA DL PVSK++ TY V W+    K TT+ +++G  NP WN +  F  D
Sbjct  24    AASQLLEISLISAQDLAPVSKSMHTYGVVWIRPNKKHTTRTDNHGQRNPKWNDKCVFSLD  83

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLS-AKKPAVRHAAVEIRRPST  842
             +   ++D   V  EIY V+W RD+ +G   + +     PL+  +    R  A++IRRPS 
Sbjct  84    NPPENND-ATVTVEIYTVSWFRDVIVGMVRVRVADLITPLTRTRNKNTRFVALQIRRPS-  141

Query  841   GQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKRGGETSGEddddddkidgDQENPEPE  662
             G  QG LN+ V L      +T +   + +S+ N+             D+   + +  +  
Sbjct  142   GSPQGILNMGVAL-----SDTAAMRSMPLSSKNR------------FDEHKQNDDVTDLN  184

Query  661   IKRGKSVRIVSEK-DDAS----PGDMKLKNCPSFSASYVSGMHPLPSEVAAGLKKGLYYF  497
             I   +S+     K DD S    PG +   +     +   S + P  S VAA +       
Sbjct  185   IVLWRSLSAGDGKADDLSFPDKPGSICNGSTVDNGSDLCSDVGPSASVVAAEINT-----  239

Query  496   PGEEEEYGSSIFENWSVPGETKSKSSKTVSWRMEHKVIPMAGKDHGGAAGGSYNTKRTRL  317
                ++E GSSI E  +   E K+K  K+V+   E     M     GG  G      R   
Sbjct  240   TAADQETGSSILEELTAE-EAKAKGYKSVATSKEMWRRAMV---EGG--GDESELLRNGG  293

Query  316   SKLQRRsssgggcmscfGNAYGLRFKFICGS  224
              + + R SS  G  SCFGNAYG+ F  +CG+
Sbjct  294   GRRRSRRSSDEGRFSCFGNAYGIEFTIVCGA  324



>ref|XP_002511946.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50615.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 81/146 (55%), Gaps = 7/146 (5%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             K+LEIN+ISA DL P S +LR   TY V WLDS  KL T+++  G  NPTWN +  F   
Sbjct  5     KILEINLISAQDLKPPSASLRQMQTYAVVWLDSTAKLRTRIDRVGGENPTWNDKFLFKVT  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAV--RHAAVEIRRPS  845
               IL  +   V FEIY V   RD  IGT    +++   P S  KP       A++I+RPS
Sbjct  65    PEILSRETSGVSFEIYAVGCFRDPLIGTVRFLISTIPLP-SPIKPTRTPSCIALQIQRPS  123

Query  844   TGQVQGTLNVTVQLIHDSPPETESGS  767
              G+ QG LN+   +I  S   T +G+
Sbjct  124   -GRFQGVLNIGAMVIDGSDFATLNGA  148



>ref|XP_008362824.1| PREDICTED: uncharacterized protein LOC103426513 [Malus domestica]
 ref|XP_008362377.1| PREDICTED: uncharacterized protein LOC103426067 [Malus domestica]
Length=270

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 78/135 (58%), Gaps = 7/135 (5%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN+ISA  L P S  LR   TY +AW+DS HK+ ++V+  G  NPTWN R  F    
Sbjct  14    VLEINLISAQGLKPPSAALRRMQTYALAWVDSAHKIRSRVDKIGGENPTWNDRFLFKVPS  73

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  +IY V    D  +GT  L +N+F   +++K P+    A++IRRPS G+
Sbjct  74    AFLSSETSQVSIQIYAVGCFSDHLVGTVRLLINNFL-DVASKVPSF--TAIQIRRPS-GR  129

Query  835   VQGTLNVTVQLIHDS  791
              QG LNV   +I  S
Sbjct  130   FQGVLNVAAMVIDGS  144



>ref|XP_010549648.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104820763 
[Tarenaya hassleriana]
Length=397

 Score =   100 bits (250),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 7/135 (5%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLRTYVVAWL--DSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEINVISA DL  VS+ ++TY VAW+  D   KLTT V+     NP WN +  F  +D+
Sbjct  10    VLEINVISAQDLASVSRNMKTYAVAWINTDPMRKLTTPVDQTNRANPIWNEKFVFRVNDK  69

Query  1012  ILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA----KKPAVRHAAVEIRRPS  845
             IL  D  A+  EIY  AW +D  +G+  + L+  + P S           +  + IRRPS
Sbjct  70    ILKVDASAIVIEIYAAAWAKDALVGSVNVLLSDLFAPWSGFADGDGGGNNNXPLHIRRPS  129

Query  844   TGQVQGTLNVTVQLI  800
              G++QG L + V L+
Sbjct  130   -GRLQGFLRLGVALL  143



>ref|XP_010456220.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=252

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 6/140 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLP-PVSK--TLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN+ISA DL  P  K   L+TY   W+DS +KL T+++  G  NP WN +  F    
Sbjct  7     VLEINLISAQDLKEPTGKLRQLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVSP  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  EIY V +LRD  IGT    +++F P  + K P++   A++IRRPS G+
Sbjct  67    EFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSL--VALQIRRPS-GK  123

Query  835   VQGTLNVTVQLIHDSPPETE  776
               G LN+   ++  S   T+
Sbjct  124   FHGVLNIAAMVMDASELPTD  143



>ref|XP_009385178.1| PREDICTED: uncharacterized protein LOC103972545 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 81/135 (60%), Gaps = 9/135 (7%)
 Frame = -1

Query  1183  LEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRILD  1004
             LE+ VISA DL P ++++RTY VA+    H+  T+++ +GH +PTWN +  F  DD +L 
Sbjct  41    LEVTVISAQDLYPAARSMRTYAVAYFRPDHRARTRIDASGHTDPTWNDKFVFRVDDAVLH  100

Query  1003  SDEGAVKFEIY----NVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
             SD  A+  ++Y     +    D+ +GTA   L++  P       A+ +AA++IRRP++ +
Sbjct  101   SDTSAITIDVYADRPGLLPGPDILLGTARALLSTLRP-----SSAIHYAALQIRRPASLR  155

Query  835   VQGTLNVTVQLIHDS  791
              QG LN+ V L+  S
Sbjct  156   PQGILNLGVALVDPS  170



>ref|XP_009401202.1| PREDICTED: uncharacterized protein LOC103985274 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 79/136 (58%), Gaps = 8/136 (6%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P+ LLEI +ISA +L P ++ L+TY  AW+D  HKL T+V+  GH +PTWN +L F  DD
Sbjct  26    PFHLLEITIISAQELYPAARCLKTYASAWVDPEHKLYTRVDRAGHADPTWNDKLVFRVDD  85

Query  1015  RILDSDEGAVKFEIY----NVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRP  848
               L SD  AV   ++      + L D  +GT  + L++  P    +    R  A+++RRP
Sbjct  86    SFLRSDMAAVTVHLHATRGRFSPLPDHLLGTVRVVLSALGPAAGPR----RCVALQVRRP  141

Query  847   STGQVQGTLNVTVQLI  800
             S+ +  G +N+ V ++
Sbjct  142   SSLRPHGIINLGVAIL  157



>ref|XP_002276427.1| PREDICTED: uncharacterized protein LOC100258448 [Vitis vinifera]
Length=265

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 83/150 (55%), Gaps = 13/150 (9%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +LLEI +ISA  L P S  LR   TY +AW+DS +KL T+V+  G  NPTWN +  F   
Sbjct  4     QLLEIILISAQGLKPPSGNLRRMQTYAIAWIDSANKLRTQVDRVGAENPTWNDKFIFRVS  63

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------LSAKKPAVRHAAVE  860
                L  D  AV  EIY V  +RD  IGT  + +++  P         +A+ P++   AV+
Sbjct  64    SDFLACDTSAVAVEIYAVGVIRDHLIGTVRILISNCLPAADLRSRNFAARSPSL--TAVQ  121

Query  859   IRRPSTGQVQGTLNVTVQLIHDSPPETESG  770
             IRRPS G+  G LNV   +++ S   + +G
Sbjct  122   IRRPS-GRFHGVLNVAAAVVNASDFASLTG  150



>ref|XP_006842901.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
 gb|ERN04576.1| hypothetical protein AMTR_s00075p00073210 [Amborella trichopoda]
Length=404

 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 77/134 (57%), Gaps = 9/134 (7%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPV---SKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPF  1022
             Y+LLE+N+ISA DL P+   +KT+ TY VAW+D   KL T+V+  G  NPTWN +  F  
Sbjct  16    YQLLEVNLISAQDLKPIIHSNKTIHTYAVAWVDPRKKLRTRVDTLGRENPTWNDKFIFTV  75

Query  1021  DDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPST  842
             D   L  +  A+  EI+ V +LRD+  GT    +         K   +  AA+++RRPS 
Sbjct  76    DQSFLSGESSAISIEIFYVRYLRDVLAGTVRALVADLM-----KGGGLSFAALQVRRPS-  129

Query  841   GQVQGTLNVTVQLI  800
             G+  G LN+ + ++
Sbjct  130   GRFHGVLNLGLIVL  143



>ref|XP_009420756.1| PREDICTED: uncharacterized protein LOC104000435 [Musa acuminata 
subsp. malaccensis]
Length=266

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 78/137 (57%), Gaps = 10/137 (7%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P+ LLEI +ISA  L P ++++ TY  AW+D  HKL T+V+  GH +PTWN +  F  DD
Sbjct  20    PFHLLEITIISAQGLYPATRSINTYASAWVDPKHKLCTRVDRAGHADPTWNDKFIFRVDD  79

Query  1015  RILDSDEGAVKFEIY----NVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRH-AAVEIRR  851
               L SD   V   ++     ++ L D  +GT  + L+S  P      P VR   A+ +RR
Sbjct  80    AFLRSDTACVDVHLHAARSRLSPLPDHLLGTVRVVLSSLSP-----APGVRRFVALLVRR  134

Query  850   PSTGQVQGTLNVTVQLI  800
             PS+ +  G LN++V ++
Sbjct  135   PSSLRPHGILNLSVAIL  151



>ref|XP_004308328.1| PREDICTED: uncharacterized protein LOC101301728 [Fragaria vesca 
subsp. vesca]
Length=293

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 77/136 (57%), Gaps = 7/136 (5%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEIN+IS   L P S TLR   TY VAW++S HK+ T+V+  G  NPTWN R  F   
Sbjct  11    QVLEINLISGQGLKPPSGTLRRMKTYAVAWVESSHKIRTRVDKVGAENPTWNDRFLFKVS  70

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
                L  +   +  EIY V   RD  +GT  L L++F   L +K P+    A++IRR S G
Sbjct  71    SEFLARETSGITIEIYAVGSFRDHLVGTVRLILSNFL-DLDSKIPS--FTALQIRRRS-G  126

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LNV   + H+S
Sbjct  127   RFHGVLNVAALVNHES  142



>ref|XP_009111426.1| PREDICTED: uncharacterized protein LOC103836878 [Brassica rapa]
Length=256

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLP-PVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN+ISA  L  P  K   L+TY   W+DS  KL T+++  G  NP WN +  F    
Sbjct  7     VLEINLISAQGLKEPTGKLRRLQTYASVWVDSSTKLRTRIDRIGAENPIWNDKFVFQVSS  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  EIY V +LRD  IGT    +++F P  + K P++   A++IRRPS G+
Sbjct  67    EFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEKVPSL--VALQIRRPS-GK  123

Query  835   VQGTLNVTVQLIHDS  791
              +G LN+   +I  S
Sbjct  124   FRGVLNIAAMVIDAS  138



>ref|XP_006396291.1| hypothetical protein EUTSA_v10028892mg [Eutrema salsugineum]
 gb|ESQ37744.1| hypothetical protein EUTSA_v10028892mg [Eutrema salsugineum]
Length=260

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLP-PVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LE+N+ISA  L  P  K   L+TY   W+DS +KL T+++  G  NP WN +  F    
Sbjct  13    VLELNLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVSS  72

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  EIY V +LRD  IGT    +++F P  + K P++   A++IRRPS G+
Sbjct  73    DFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSL--VALQIRRPS-GK  129

Query  835   VQGTLNVTVQLIHDS  791
               G LN+   +I  S
Sbjct  130   FHGVLNIAAMVIDAS  144



>ref|XP_010936043.1| PREDICTED: uncharacterized protein LOC105055767 [Elaeis guineensis]
Length=280

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 79/140 (56%), Gaps = 10/140 (7%)
 Frame = -1

Query  1195  PYKLLEINVISAHDL-PPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             P  LLE+ VISA DL P  ++ +R Y  AW+    KL+T+ +  GH  PTWN +L F  D
Sbjct  19    PCHLLELTVISAQDLFPATARAMRAYATAWVHPDKKLSTRTDRAGHTEPTWNDKLVFRVD  78

Query  1018  DRILDSDEGAVKFEIYNVA-----WLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIR  854
             D  L S   A+  +I+ V       L+D  +GT  + L++  P   A+    R AA+++R
Sbjct  79    DAFLLSVTSAITVDIFAVRHRLSPRLQDPHLGTVRVLLSALRPDPGAR----RFAALQVR  134

Query  853   RPSTGQVQGTLNVTVQLIHD  794
             RP++ + QG LNV V L+ D
Sbjct  135   RPNSLRPQGILNVGVALLDD  154



>ref|XP_002872904.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49163.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLP-PVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN+ISA  L  P  K   L+TY   W+DS +KL T+++  G  NP WN +  F    
Sbjct  6     VLEINLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGSENPIWNDKFVFQVSP  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  EIY V +LRD  IGT    +++F P  + K P++   A++IRRPS G+
Sbjct  66    EFLSSETSGVSIEIYAVGYLRDHQIGTVRFLVSNFLPTAAVKVPSL--VALQIRRPS-GK  122

Query  835   VQGTLNVTVQLIHDS  791
               G LN+   ++  S
Sbjct  123   FHGVLNIAAMVMDAS  137



>ref|XP_006289671.1| hypothetical protein CARUB_v10003230mg [Capsella rubella]
 gb|EOA22569.1| hypothetical protein CARUB_v10003230mg [Capsella rubella]
Length=244

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 77/136 (57%), Gaps = 6/136 (4%)
 Frame = -1

Query  1189  KLLEINVISAHDLP-PVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEIN+ISA  +  P  K   L+TY   W+DS +KL T+++  G  NP WN +  F   
Sbjct  5     QVLEINLISAQGIKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVS  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
                L S+   V  EIY V +LRD  IGT    +++F P  + K P++   A++IRRPS G
Sbjct  65    PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSL--VALQIRRPS-G  121

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+   ++  S
Sbjct  122   KFHGVLNIAAMVMDAS  137



>ref|NP_192029.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 emb|CAB80929.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL87353.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45098.1| unknown protein [Arabidopsis thaliana]
 gb|AEE81993.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=250

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 76/136 (56%), Gaps = 6/136 (4%)
 Frame = -1

Query  1189  KLLEINVISAHDLP-PVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEIN+ISA  L  P  K   L+TY   W+DS  KL T+++  G  NP WN +  F   
Sbjct  5     QVLEINLISAQGLKEPTGKLRRLQTYASVWVDSSSKLRTRIDRIGSENPIWNDKFVFQVS  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
                L S+   V  EIY V +LRD  IGT    +++F P  + K P++   A++IRRPS G
Sbjct  65    PEFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSL--VALQIRRPS-G  121

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LN+   ++  S
Sbjct  122   KFHGVLNIAAMVMDAS  137



>ref|XP_009764572.1| PREDICTED: uncharacterized protein LOC104216252 [Nicotiana sylvestris]
Length=263

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 78/129 (60%), Gaps = 7/129 (5%)
 Frame = -1

Query  1189  KLLEINVISAHDLP-PVS--KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEIN+ISA  L  P++  + ++TY + W++S +KL TK++H G  NPTWN +  F   
Sbjct  7     QILEINLISAQSLKTPITNLRRMQTYALLWVNSSNKLRTKIDHFGGENPTWNDKFLFRVS  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNS-FYPPLSAKKPAVRHAAVEIRRPST  842
              + +  D   V  EIY V  L+D  +GT  L L+S F   ++   PA    AV+IRRPS 
Sbjct  67    PKFISGDTSGVSVEIYAVGVLKDFLVGTVRLLLSSCFKGMVNTATPA--FTAVQIRRPS-  123

Query  841   GQVQGTLNV  815
             G+ QG LN+
Sbjct  124   GRFQGVLNI  132



>ref|XP_010544424.1| PREDICTED: uncharacterized protein LOC104817045 [Tarenaya hassleriana]
Length=260

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 74/135 (55%), Gaps = 6/135 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +L+IN+ISA  L   S  LR   TY V W+D   KL T+++  G  NP WN +  F    
Sbjct  11    VLQINLISAQGLKEPSGKLRRMQTYAVVWVDPSCKLRTRIDRIGAENPIWNDKFLFQVSA  70

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L  +   V  EIY + +LRD  IGT    +++F P +S K P++   A++IRRPS G+
Sbjct  71    DFLSRETSGVSIEIYTIGYLRDHLIGTVRFLVSNFLPTVSLKAPSL--LALQIRRPS-GK  127

Query  835   VQGTLNVTVQLIHDS  791
               G LN+   +I  S
Sbjct  128   FHGVLNIGAMVIDSS  142



>ref|XP_010422779.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=252

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLP-PVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN+ISA  L  P  K   L+TY   W+DS +KL T+++  G  NP WN +  F    
Sbjct  7     VLEINLISAQGLKEPTGKLRRLQTYASVWVDSSNKLRTRIDRIGAENPIWNDKFVFQVSP  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  EIY V +LRD  IGT    +++F P  + K P++   A++IRRPS G+
Sbjct  67    DFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSL--VALQIRRPS-GK  123

Query  835   VQGTLNVTVQLIHDS  791
               G LN+   ++  S
Sbjct  124   FHGVLNIAAMVMDAS  138



>ref|XP_009350266.1| PREDICTED: uncharacterized protein LOC103941795 [Pyrus x bretschneideri]
 ref|XP_009350267.1| PREDICTED: uncharacterized protein LOC103941796 [Pyrus x bretschneideri]
Length=271

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 77/135 (57%), Gaps = 7/135 (5%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN++SA  L   S TLR   TY +AW+DS HK+ ++V+  G  NPTWN R  F    
Sbjct  14    VLEINLVSAQGLKAPSVTLRRMQTYALAWVDSAHKIRSRVDKVGGENPTWNDRCLFKVPS  73

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  +IY V   RD  +GT    +N+F   +S+  P+    A++IRRPS G+
Sbjct  74    GFLSSETSQVSVQIYAVGCFRDHLVGTVRFLINNFL-DVSSAIPS--FTAIQIRRPS-GR  129

Query  835   VQGTLNVTVQLIHDS  791
              +G LNV   +I  S
Sbjct  130   FRGVLNVAALVIDGS  144



>ref|XP_007218843.1| hypothetical protein PRUPE_ppa010336mg [Prunus persica]
 gb|EMJ20042.1| hypothetical protein PRUPE_ppa010336mg [Prunus persica]
Length=253

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 79/140 (56%), Gaps = 7/140 (5%)
 Frame = -1

Query  1201  QAPYKLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLA  1031
             +   ++LEI++ISA  L   + TLR   TY +AW+DS HKL ++V+  G  NPTWN R  
Sbjct  9     EGTMRVLEIHLISAQGLKAPTGTLRRMQTYALAWVDSAHKLRSRVDKIGASNPTWNDRFL  68

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRR  851
             F      L S+  AV  +IY V   RD  +G+    +N+F   + +K P+    AV+IRR
Sbjct  69    FKVPPGFLSSETSAVSVQIYTVGTFRDHLVGSVRFLINNFL-DVHSKMPSF--TAVQIRR  125

Query  850   PSTGQVQGTLNVTVQLIHDS  791
             PS G+  G LNV   +I  S
Sbjct  126   PS-GRFYGVLNVGAMVIDGS  144



>ref|XP_007051663.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOX95820.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=266

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 6/134 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEI +ISA  L   S  LR   TY +AW+DS  KL T V+  G  NPTWN +  F    
Sbjct  6     VLEITLISAQGLKEPSGKLRRMQTYALAWIDSSVKLRTCVDRVGGENPTWNDKFLFKVSS  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHA--AVEIRRPST  842
               L S+   +  EI+ V  LRD  +GT    +++F P  SA   A  H+  AV+IRRPS 
Sbjct  66    EFLSSETSGISVEIFAVGVLRDSLVGTVRFLVSNFLPSGSAFNAAKTHSFNAVQIRRPS-  124

Query  841   GQVQGTLNVTVQLI  800
             G+ QG LN+   ++
Sbjct  125   GRFQGVLNIGATVL  138



>ref|XP_010427687.1| PREDICTED: BON1-associated protein 2-like [Camelina sativa]
Length=256

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLP-PVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN+ISA  L  P  K   L+TY   W++S +KL T+++  G  NP WN +  F    
Sbjct  7     VLEINLISAQRLKEPTGKLRRLQTYASVWVESSNKLRTRIDRIGAENPIWNDKFVFQVSP  66

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  EIY V +LRD  IGT    +++F P  + K P++   A++IRRPS G+
Sbjct  67    EFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAVKVPSL--VALQIRRPS-GK  123

Query  835   VQGTLNVTVQLIHDS  791
               G LN+   ++  S
Sbjct  124   FHGVLNIAAMVMDAS  138



>ref|XP_008233233.1| PREDICTED: uncharacterized protein LOC103332288 [Prunus mume]
Length=273

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 78/136 (57%), Gaps = 7/136 (5%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEI++ISA  L   + TLR   TY +AW+DS HKL ++V+  G  NPTWN R  F   
Sbjct  14    RVLEIHLISAQGLKAPAGTLRRMQTYALAWVDSAHKLRSRVDKIGASNPTWNDRFLFKVP  73

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
                L S+  AV  +IY V   RD  +G+    +N+F   + +K P+    AV+IRRPS G
Sbjct  74    PGFLSSETSAVSVQIYAVGTFRDHLVGSVRFLINNFL-DVHSKMPSF--TAVQIRRPS-G  129

Query  838   QVQGTLNVTVQLIHDS  791
             +  G LNV   +I  S
Sbjct  130   RFYGVLNVGAMVIDGS  145



>ref|XP_009591358.1| PREDICTED: uncharacterized protein LOC104088405 [Nicotiana tomentosiformis]
Length=267

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 77/133 (58%), Gaps = 11/133 (8%)
 Frame = -1

Query  1189  KLLEINVISAHDLP-PVS--KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEIN+ISA  L  P++  + L+TY + ++DS +KL TK++H G  NPTWN +  F   
Sbjct  7     QILEINLISAQSLKTPIANFRRLQTYALIFVDSSNKLRTKIDHFGGENPTWNDKFLFRVS  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPL-----SAKKPAVRHAAVEIR  854
              + +  D   V  EIY V  L+D  +GT  L L+S +  +     S   P     AV+IR
Sbjct  67    PKFISGDTSGVSVEIYAVGVLKDFLVGTVRLLLSSCFKGMVNSGISTATPV--FTAVQIR  124

Query  853   RPSTGQVQGTLNV  815
             RPS G+ QG LN+
Sbjct  125   RPS-GRFQGVLNI  136



>ref|XP_009347863.1| PREDICTED: uncharacterized protein LOC103939495 [Pyrus x bretschneideri]
Length=271

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 77/135 (57%), Gaps = 7/135 (5%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN++SA  L   S TLR   TY +AW+DS HK+ ++++  G  NPTWN R  F    
Sbjct  14    VLEINLVSAQGLKAPSVTLRRMQTYALAWVDSAHKIRSRLDKVGGENPTWNDRCLFKVPS  73

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  +IY V   RD  +GT    +N+F   +S+  P+    A++IRRPS G+
Sbjct  74    GFLSSETSQVSVQIYAVGCFRDHLVGTVRFLINNFL-DVSSTIPS--FTAIQIRRPS-GR  129

Query  835   VQGTLNVTVQLIHDS  791
              +G LNV   +I  S
Sbjct  130   FRGVLNVAALVIDGS  144



>ref|XP_010092894.1| hypothetical protein L484_022489 [Morus notabilis]
 gb|EXB52712.1| hypothetical protein L484_022489 [Morus notabilis]
Length=266

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 80/152 (53%), Gaps = 15/152 (10%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN+ISA  L P S + R   TY + W+DS  KL T V+  G  NPTWN R  F    
Sbjct  12    VLEINLISAQGLKPSSGSSRPVHTYALIWIDSTTKLRTGVDKVGGENPTWNDRFLFRVTP  71

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L  D   +  EIY V  +RD  IGT  L + +F   + AK P+    A++IRRPS G+
Sbjct  72    EFLSGDTSGIYVEIYTVGRIRDSLIGTVRLLIGNFL-DVRAKTPS--FTALQIRRPS-GR  127

Query  835   VQGTLNVTVQLIHDSPPETESGSQLSVSTLNK  740
               G LNV   +I        SG+  +++  N+
Sbjct  128   FHGVLNVGATVI--------SGADFAIALSNR  151



>gb|EYU32591.1| hypothetical protein MIMGU_mgv1a006056mg [Erythranthe guttata]
Length=459

 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 79/159 (50%), Gaps = 26/159 (16%)
 Frame = -1

Query  1195  PYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             P++LLEIN+IS  DL PV K +RTY  AW++ G KL++                    DD
Sbjct  8     PFQLLEINIISGQDLQPVLKKMRTYARAWVNPGRKLSS-------------------VDD  48

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTA-TLTLNSFYPPLSAKKP-----AVRHAAVEIR  854
               L  D  AV  EIY   W RD+ +GT   L  N   PPL  ++       +R  A+++R
Sbjct  49    DFLGEDTSAVMIEIYAAHWFRDVIVGTVRVLVGNLIPPPLMTRRNGGGPIGMRFVALQVR  108

Query  853   RPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVSTLNKR  737
             RPS G+ QG LN+ V L+  S        QLS S +  R
Sbjct  109   RPS-GRPQGILNIGVALLDGSMRSMPLYRQLSASAVGYR  146



>ref|XP_009406969.1| PREDICTED: uncharacterized protein LOC103989745 [Musa acuminata 
subsp. malaccensis]
Length=283

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 77/138 (56%), Gaps = 9/138 (7%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             + LLEI +IS   L P S++L+ Y  AW+D  HKL T+V+  G  +PTWN +  F  DD 
Sbjct  28    FHLLEITIISGQGLFPASRSLQAYASAWVDPKHKLYTRVDRAGVTDPTWNDKFVFRVDDA  87

Query  1012  ILDSDEGAVKFEIY----NVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPS  845
              L S+  AV   ++     ++ LRD  +GT  + L++    L     A R  A+++RRPS
Sbjct  88    FLRSETSAVNVHLHAARGRLSPLRDHLLGTVRVVLSA----LRLAPGAGRCVALQVRRPS  143

Query  844   TGQVQGTLNVTVQLIHDS  791
             T    G LN+ V L HDS
Sbjct  144   TLCPHGILNLGVAL-HDS  160



>emb|CDY07180.1| BnaCnng01950D [Brassica napus]
Length=1640

 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLP-PVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN+ISA  L  P  K   L+TY   W+DS  KL T+++  G  NP WN +  F    
Sbjct  1016  VLEINLISAQGLKEPTGKLRRLQTYASVWVDSSDKLRTRIDRIGAENPIWNDKFVFQVSS  1075

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  EIY V +LRD  IGT    +++F P  + K P++   A++IRRPS G+
Sbjct  1076  EFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEKVPSL--VALQIRRPS-GK  1132

Query  835   VQGTLNVTVQLIHDS  791
              +G LN+   +I  S
Sbjct  1133  FRGVLNIAAMVIDAS  1147



>ref|XP_010669605.1| PREDICTED: uncharacterized protein LOC104886787 [Beta vulgaris 
subsp. vulgaris]
Length=271

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 75/135 (56%), Gaps = 6/135 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             LLEIN+ISA +L P S  LR   TY VA+++   KL T+V+  G  NPTWN +  F   D
Sbjct  20    LLEINLISAQNLKPPSTNLRRLQTYAVAYINPSRKLRTRVDRLGAENPTWNDKFIFRISD  79

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S   +   +I++V  L+D  +G+    L++     S   P+    AV+IRRPS G+
Sbjct  80    AFLSSQTSSFTVDIFSVGVLKDAILGSVRFILSNCVTRNSIGLPSC--VAVQIRRPS-GR  136

Query  835   VQGTLNVTVQLIHDS  791
               G LNV V +I  S
Sbjct  137   FHGVLNVGVMVIDAS  151



>gb|KDP28538.1| hypothetical protein JCGZ_14309 [Jatropha curcas]
Length=259

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             K+LEIN+ISA  L P S  +R   TY V W+DS  KL T+V+  G  +P WN +  F   
Sbjct  5     KILEINLISAQGLKPPSANIRRMQTYAVVWIDSSTKLRTRVDRVGSGDPIWNDKFLFKVS  64

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNS---FYPPLSAKKPAVRHAAVEIRRP  848
                L  +   V  EIY V +LRD  +GT  L +++   F P    + P+    A++IRRP
Sbjct  65    PEFLAGETSGVCVEIYAVGYLRDALLGTVRLLISNIPLFLPNERMRTPS--FIALQIRRP  122

Query  847   STGQVQGTLNV  815
             S G+ QG LN+
Sbjct  123   S-GRFQGLLNI  132



>emb|CDY48509.1| BnaA09g00140D [Brassica napus]
Length=1733

 Score = 94.0 bits (232),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLP-PVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LEIN+ISA  L  P  K   L+TY   W+DS  KL T+++  G  NP WN +  F    
Sbjct  1012  VLEINLISAQGLKEPTGKLRRLQTYASVWVDSSTKLRTRIDRIGAENPIWNDKFVFQVSS  1071

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
               L S+   V  EIY V +LRD  IGT    +++F P  + K P++   A++IRRPS G+
Sbjct  1072  EFLSSETSGVSIEIYAVGYLRDHLIGTVRFLVSNFLPTAAEKVPSL--VALQIRRPS-GK  1128

Query  835   VQGTLNVTVQLIHDS  791
              +G LN+   +I  S
Sbjct  1129  FRGVLNIAAMVIDAS  1143



>ref|XP_008796382.1| PREDICTED: uncharacterized protein LOC103711856 [Phoenix dactylifera]
Length=282

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 89/178 (50%), Gaps = 24/178 (13%)
 Frame = -1

Query  1195  PYKLLEINVISAHDL-PPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             P  LLE+ VISA DL P  ++++R Y  AW+    KL T+ +  G  +PTWN +L F  D
Sbjct  19    PCHLLELTVISAQDLFPATARSMRAYATAWVHPDRKLLTRTDRAGRTDPTWNDKLVFRVD  78

Query  1018  DRILDSDEGAVKFEIYNVA-----WLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIR  854
                L S   AV  +I+         LRD  +GT  + L++F P   ++    R AA+++R
Sbjct  79    AAFLLSVTSAVTVDIFAARRRLSPRLRDPHLGTVRVLLSAFRPEPGSR----RFAALQVR  134

Query  853   RPSTGQVQGTLNVTVQL------------IHDS--PPETESGSQLSVSTLNKRGGETS  722
             RP++ + QG LNV + L            +HD    P   +   L   ++ +R GE S
Sbjct  135   RPNSLRPQGILNVGIALLDGLAYVDRMVPLHDDIGEPYAFAYKDLEALSMERRAGEES  192



>gb|EYU38921.1| hypothetical protein MIMGU_mgv1a022778mg [Erythranthe guttata]
Length=242

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 12/136 (9%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEIN+ISA  L P S  LR   TY + W+D   KL T V+  G  NPTWN +  F   
Sbjct  4     QILEINLISAQGLKPPSANLRRIQTYAITWIDPATKLRTHVDSVGGENPTWNDKFLFRVS  63

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFY-----PPLSAKKPAV---RHAAV  863
             D  +  D  AV  EI+ V +++D+ IGT    L++       P  SA + ++       +
Sbjct  64    DEFIAGDTSAVAVEIFAVGYIKDILIGTVRFLLSTCLKRAASPIDSAGEGSIGTPSCTGL  123

Query  862   EIRRPSTGQVQGTLNV  815
             +IRRPS G+ QG LN+
Sbjct  124   QIRRPS-GRFQGVLNI  138



>ref|XP_006842598.1| hypothetical protein AMTR_s00077p00167680 [Amborella trichopoda]
 gb|ERN04273.1| hypothetical protein AMTR_s00077p00167680 [Amborella trichopoda]
Length=355

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 88/311 (28%), Positives = 132/311 (42%), Gaps = 37/311 (12%)
 Frame = -1

Query  1216  DKMIPQAPYKLLEINVISAHDLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYR  1037
             D   P     LLE+N+ISA D+ P ++ +  Y VAW+   HKL+T+ +  GH  PTWN +
Sbjct  12    DPRAPDPSLHLLELNIISAQDIHPATQAMHPYAVAWVHRDHKLSTRTDPQGHTEPTWNDK  71

Query  1036  LAFPFDDRILDSDEGAVKFEIYN---VAWLRDLPIGTATLTLNSFYPPLSAKKPA-----  881
               F   +  L SD  AV  +I+         D  IGT  + + +    LSA+  A     
Sbjct  72    FIFRVTETFLRSDTAAVTIQIFTHRPCCVFPDPLIGTVRVLVGNL---LSAQSHAPGYSG  128

Query  880   VRHAAVEIRRPSTGQVQGTLNVTVQLIHDS----PPETESGSQLSVSTLNKRGGETSGEd  713
             +R  A+++RRPS G+ QG LN+ + L+  +    P   ++ S L    L        G+ 
Sbjct  129   MRFTALQVRRPS-GRPQGILNLGITLLDPALRSMPLYVQATSALGYQDL-------MGQT  180

Query  712   dddddkidgDQENPEPEIKRGKSVRIVSEKDDASPGDMKLKNCPSFSASYVSGMHPLPSE  533
                          P        S    SE     P  +K ++ PS        + P+ + 
Sbjct  181   RILRRSKSAYPSEPASSTIWTNSPG-PSELSVGEPNKLKPQSNPSSPP-----IKPMTTP  234

Query  532   VAAGLKKGLYYFPGEEEEYGSSIFENWSVP--GETKSKSSKTVSWRMEHKVIPMAGKDHG  359
                    G  ++P    E GSS+ E+WSV   G  +    K   WRME   +P      G
Sbjct  235   RTELTPIGEEFYPA---EVGSSVLEDWSVASSGGKEELKLKLERWRME---LPPIYDPPG  288

Query  358   GAAGGSYNTKR  326
              A+ G   T+R
Sbjct  289   FASIGRNPTRR  299



>ref|XP_006339653.1| PREDICTED: uncharacterized protein LOC102592387 [Solanum tuberosum]
Length=269

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 77/141 (55%), Gaps = 11/141 (8%)
 Frame = -1

Query  1189  KLLEINVISAHDL-PPVS--KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEIN+ISA  L  PV+  + ++TY + W+DS  KL TK++H G  NPTWN +  F   
Sbjct  6     QILEINLISAQSLKTPVANLRRMQTYAILWVDSSTKLRTKIDHLGGENPTWNDKFLFRVS  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYP-----PLSAKKPAVRHAAVEIR  854
                +  +   V  EIY V +++D  IGT  L ++S         ++   PA    AV++R
Sbjct  66    PEFISGETSGVSVEIYAVGYIKDFLIGTVRLLISSCLKGIANHGITTATPA--FTAVQVR  123

Query  853   RPSTGQVQGTLNVTVQLIHDS  791
             RPS G+  G LN+   +   S
Sbjct  124   RPS-GRFHGVLNIAAAVYCSS  143



>ref|XP_011023248.1| PREDICTED: uncharacterized protein LOC105124808 [Populus euphratica]
Length=260

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 74/140 (53%), Gaps = 9/140 (6%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPF  1022
              K+LE+N+ISA  L P S  LR   TY + W+D   KL T+ +  G  NPTWN +  F  
Sbjct  3     MKVLEVNLISAQGLKPPSANLRRMQTYAIVWIDPSTKLRTRTDRVGSENPTWNDKFLFKV  62

Query  1021  DDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRH---AAVEIRR  851
                 L S+   V  +IY +  +RD  IGT    +++   PLS  + A+      A++IRR
Sbjct  63    TPEYLSSETSGVSIQIYAIGCIRDALIGTVRFLVSNL--PLSTPRAAITMPSCIALQIRR  120

Query  850   PSTGQVQGTLNVTVQLIHDS  791
             PS G+  G +N+   +I  S
Sbjct  121   PS-GRFHGVINIGANVIDGS  139



>ref|XP_004229965.1| PREDICTED: BON1-associated protein 2 [Solanum lycopersicum]
Length=270

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 77/141 (55%), Gaps = 11/141 (8%)
 Frame = -1

Query  1189  KLLEINVISAHDLP-PVS--KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEIN+ISA  L  PV+  + ++TY + W+DS  KL TK++H G  NPTWN +  F   
Sbjct  6     QILEINLISAQSLKTPVANLRRMQTYAILWVDSSTKLRTKIDHLGGENPTWNDKFLFRVS  65

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYP-----PLSAKKPAVRHAAVEIR  854
                +  +   V  EIY V +++D  IGT  L ++S         ++   PA    AV++R
Sbjct  66    PEFISGETSGVSVEIYAVGYIKDFLIGTVRLLISSCLKGIAKHGITTATPAFN--AVQVR  123

Query  853   RPSTGQVQGTLNVTVQLIHDS  791
             RPS G+  G LN+   +   S
Sbjct  124   RPS-GRFHGVLNIAAAVYSSS  143



>gb|KDO86360.1| hypothetical protein CISIN_1g047341mg [Citrus sinensis]
Length=254

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 73/136 (54%), Gaps = 6/136 (4%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEI +ISA  L   S  +R   TY + W+DS  KL T+V+  G  +P WN +  F   
Sbjct  4     QILEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLCTRVDRAGAESPIWNEKFLFKVT  63

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
                L S+  A+  EIY   +LRD  IGT    +++    ++ K P+    A +IRRPS G
Sbjct  64    PEFLSSETSAISVEIYASGYLRDYLIGTVRFLVSNISLSVATKTPS--FTAFQIRRPS-G  120

Query  838   QVQGTLNVTVQLIHDS  791
             + QG L++   LI  S
Sbjct  121   RFQGVLSIGSMLIDGS  136



>ref|XP_006444911.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
 ref|XP_006491213.1| PREDICTED: BON1-associated protein 2-like [Citrus sinensis]
 gb|ESR58151.1| hypothetical protein CICLE_v10021815mg [Citrus clementina]
Length=254

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 73/136 (54%), Gaps = 6/136 (4%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEI +ISA  L   S  +R   TY + W+DS  KL T+V+  G  +P WN +  F   
Sbjct  4     QILEIILISAQGLKSPSSKMRRMQTYALVWIDSSTKLCTRVDRAGAESPIWNEKFLFKVT  63

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTG  839
                L S+  A+  EIY   +LRD  IGT    +++    ++ K P+    A +IRRPS G
Sbjct  64    PEFLSSETSAISVEIYASGYLRDYLIGTVRFLVSNISLSVATKTPS--FTAFQIRRPS-G  120

Query  838   QVQGTLNVTVQLIHDS  791
             + QG L++   LI  S
Sbjct  121   RFQGVLSIGSMLIDGS  136



>gb|EPS68074.1| hypothetical protein M569_06693, partial [Genlisea aurea]
Length=233

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 74/136 (54%), Gaps = 12/136 (9%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEI +ISA  + P S  LR   TY V W++   KL T+V+  G  NPTWN +  F   
Sbjct  4     RILEITLISAQGIKPPSGNLRRLQTYAVTWVNPATKLRTRVDSMGGENPTWNDKFLFRVC  63

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYP-----PLSAKKPAV---RHAAV  863
             +  +  D  AV  EI+ V +++D  IGT    L+S +       LS ++  +      AV
Sbjct  64    NDFISGDTSAVSVEIFAVGYIKDFLIGTVRFLLSSCFKRPGSVELSREEGTIGTPAFTAV  123

Query  862   EIRRPSTGQVQGTLNV  815
             +IRRPS G+ QG LN+
Sbjct  124   QIRRPS-GRFQGVLNI  138



>emb|CDP17419.1| unnamed protein product [Coffea canephora]
Length=293

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 73/148 (49%), Gaps = 7/148 (5%)
 Frame = -1

Query  1201  QAPYKLLEINVISAHDLPPVS---KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLA  1031
             Q   ++LEIN+ISA  L   S   + ++TY +AW+D   KL T+ +  G  NPTWN    
Sbjct  16    QGENQILEINLISAQGLKTPSGSRRRMQTYALAWVDPATKLRTRTDRVGAENPTWNELFL  75

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAV---RHAAVE  860
             F      L  +   V  EIY V ++RD  IGT    L+S      +   A+      AV+
Sbjct  76    FRVSSHFLACEPSGVTVEIYAVGYIRDYLIGTVRFLLSSCLGKFPSSADAIGTPAFTAVQ  135

Query  859   IRRPSTGQVQGTLNVTVQLIHDSPPETE  776
             IRRPS G+  G LN+   +   +  + E
Sbjct  136   IRRPS-GRFHGVLNIAASVCSSTCSDFE  162



>emb|CDP08734.1| unnamed protein product [Coffea canephora]
Length=296

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 76/150 (51%), Gaps = 9/150 (6%)
 Frame = -1

Query  1201  QAPYKLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLA  1031
             Q   ++LEIN+ISA  L   S + R   TY +AW+D   KL T+ +  G  NPTWN +  
Sbjct  17    QEGDQILEINLISAQGLKTPSGSRRRMHTYALAWVDPTAKLRTRTDRVGAENPTWNDKFL  76

Query  1030  FPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYP--PLSAKKPAV---RHAA  866
             F    R L  +   V  EIY V ++RD  IGT    L+S     P SA   A+      A
Sbjct  77    FRVSSRFLACETSGVTVEIYAVGYIRDYLIGTVRFLLSSCLGKFPSSADAIAIGTPAFTA  136

Query  865   VEIRRPSTGQVQGTLNVTVQLIHDSPPETE  776
             V+I+RPS G+  G LN+   +   +  + E
Sbjct  137   VQIQRPS-GRFHGVLNIAASVCSSACSDFE  165



>ref|XP_002301388.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
 gb|EEE80661.2| hypothetical protein POPTR_0002s16800g, partial [Populus trichocarpa]
Length=243

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 71/140 (51%), Gaps = 9/140 (6%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPF  1022
              K+LEIN+ISA  L P S  LR   TY + W+D   KL T+ +  G  NPTWN +  F  
Sbjct  3     MKVLEINLISAQGLKPPSANLRRMQTYAIVWIDPSTKLRTRTDRVGSENPTWNDKFLFKV  62

Query  1021  DDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFY---PPLSAKKPAVRHAAVEIRR  851
                 L S+   V  EIY +  +RD  IGT    + +     P  +   P+    A++IRR
Sbjct  63    TPEYLSSETSGVSIEIYAIGCIRDALIGTVRFLVGNLRLSTPSAAITMPSC--IALQIRR  120

Query  850   PSTGQVQGTLNVTVQLIHDS  791
             PS G+  G +N+   +I  S
Sbjct  121   PS-GRFHGVINIGANVIDGS  139



>ref|XP_011093241.1| PREDICTED: uncharacterized protein LOC105173247 [Sesamum indicum]
Length=262

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 77/144 (53%), Gaps = 12/144 (8%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPF  1022
             +++LEIN+I+A  L   S  LR   TY V W++ G KL T+++  G  NPTWN +  F  
Sbjct  4     HQILEINLITAQGLKTPSANLRRMQTYAVIWVNPGKKLRTRLDSLGGENPTWNDKFLFRV  63

Query  1021  DDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYP---PL----SAKKPAVRHAAV  863
              +  +  D  AV  EI+ + +++D  IGT    L++      P+         +    AV
Sbjct  64    SNEFISGDTSAVSVEIFALGYIKDFLIGTVRFLLSTCLKRTIPIASAGGGSVGSSAFTAV  123

Query  862   EIRRPSTGQVQGTLNVTVQLIHDS  791
             +IRRPS G+ QG LN+    ++DS
Sbjct  124   QIRRPS-GRFQGVLNIATA-VYDS  145



>ref|XP_010055064.1| PREDICTED: uncharacterized protein LOC104443389 [Eucalyptus grandis]
 gb|KCW71540.1| hypothetical protein EUGRSUZ_E00081 [Eucalyptus grandis]
Length=267

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 73/137 (53%), Gaps = 6/137 (4%)
 Frame = -1

Query  1186  LLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             +LE+++ISA +L P    +R   TY + W+D   KL T+++  G  NPTWN +  F    
Sbjct  11    ILELHLISAQNLKPPPANMRRTETYSLVWVDPSTKLRTRLDRVGSDNPTWNDKFFFRVGP  70

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSF--YPPLSAKKPAVRHAAVEIRRPST  842
               L S   AV  EIY V ++RD  +G+  L L++   +P            AV IRRPS 
Sbjct  71    DFLSSHTSAVTVEIYAVGYIRDYLVGSVRLLLSTVLSWPDFVGNSKLPYFTAVGIRRPS-  129

Query  841   GQVQGTLNVTVQLIHDS  791
             G++ G LN+ + L + S
Sbjct  130   GKIHGVLNIGIMLTNGS  146



>ref|XP_003553776.1| PREDICTED: uncharacterized protein LOC100793541 [Glycine max]
Length=260

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 71/138 (51%), Gaps = 7/138 (5%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVS---KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPF  1022
             +++LEIN+ISA  L P S   + L+TY V W+D   KL T+V+  G  NPTWN +  F  
Sbjct  8     HQVLEINLISAQGLKPPSSPRRRLQTYAVTWIDPATKLRTRVDKLGGHNPTWNDKFLFRV  67

Query  1021  DDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTL-NSFYPPLSAKKPAVRHAAVEIRRPS  845
                 L  D  +V   IY V   RD  +GT    + N F P      P    +A +IRRPS
Sbjct  68    TPDFLAGDTSSVCVAIYAVGTFRDHLVGTVRFLISNMFSPDADYATPCF--SAFQIRRPS  125

Query  844   TGQVQGTLNVTVQLIHDS  791
              G+  G +N+   ++  S
Sbjct  126   -GRFHGVMNIGAMVMDSS  142



>emb|CAN79006.1| hypothetical protein VITISV_040896 [Vitis vinifera]
Length=380

 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 79/151 (52%), Gaps = 13/151 (9%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +LLEI +IS  DL P S  LR   T  + W+DS +KL T+V+  G  NPTWN +  F   
Sbjct  27    QLLEIILISTQDLKPPSGNLRRMQTCALVWVDSANKLRTQVDRVGVENPTWNDKFIFRAS  86

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPP-------LSAKKPAVRHAAVE  860
                L      V  EIY V  +RD  IGT  + +++  P         +A+ P++   AV+
Sbjct  87    SDFLACATSIVAVEIYAVGVIRDHLIGTVRILISNCLPAADLRSRNFAARSPSL--TAVQ  144

Query  859   IRRPSTGQVQGTLNVTVQLIHDSPPETESGS  767
             IRRPS G+    LNV   +++ S   + +G+
Sbjct  145   IRRPS-GRFHSVLNVAAAVVNASDFASLTGT  174



>ref|XP_011093070.1| PREDICTED: uncharacterized protein LOC105173112 [Sesamum indicum]
Length=258

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 71/140 (51%), Gaps = 8/140 (6%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             ++LEI++ISA  L   S  LR   TY V W++S  KL T  +  G  NP WN +  F   
Sbjct  4     QILEIDLISAQGLKTPSGNLRRLQTYAVTWINSAAKLRTCTDSLGGENPNWNDKFLFRVS  63

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFY----PPLSAKKPAVRHAAVEIRR  851
             +  +  +  AV  EI+ V  ++D+ IG+    L++      P  S         AV+IRR
Sbjct  64    NEFISRETSAVAVEIFVVGRIKDILIGSVRFLLSTCLKRATPLASGSTGTPVFTAVQIRR  123

Query  850   PSTGQVQGTLNVTVQLIHDS  791
             PS G+ QG LN+   + H S
Sbjct  124   PS-GRFQGVLNIAAAVYHSS  142



>gb|KDP30266.1| hypothetical protein JCGZ_17048 [Jatropha curcas]
Length=200

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVS---KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPF  1022
              K+LEIN+ISA  L P S   + ++TY V  +DS  KL ++++ +G  +P W  +  F  
Sbjct  1     MKILEINLISAQGLNPPSSSRRRMQTYAVVSIDSSTKLRSRIDLDGGEDPIWGDKFLFKV  60

Query  1021  DDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPST  842
                 L  +  +V  EI+ V  LRD  +GT  L +++  P  S +       A++IRRPS 
Sbjct  61    TPEFLSGETTSVSVEIFAVGCLRDKLLGTVRLLISNI-PLFSQEMRTPSFVAMQIRRPS-  118

Query  841   GQVQGTLNVTVQLIHDS  791
             G+ QG LN+   +IHD+
Sbjct  119   GRFQGLLNIGA-IIHDA  134



>ref|XP_006577334.1| PREDICTED: BON1-associated protein 2-like [Glycine max]
Length=208

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 76/153 (50%), Gaps = 6/153 (4%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVS---KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPF  1022
             +++LEIN+ISA  + P S   + L+TY V W+D   KL T+V+  G  NPTWN +  F  
Sbjct  8     HQVLEINLISAQGMKPPSSPRRRLQTYAVTWIDPATKLRTRVDKLGGHNPTWNDKFLFGV  67

Query  1021  DDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPST  842
                 L  D  +V   IY V   R   +GT    +++ + P  A       +A +IRRPS 
Sbjct  68    TKDFLAGDTSSVCVAIYAVGTFRHHLVGTVRFLISNMFSP-DADDATPCFSAFQIRRPS-  125

Query  841   GQVQGTLNVTVQLIHDSP-PETESGSQLSVSTL  746
             G+  G +N+   ++  S  P  E  S L    L
Sbjct  126   GRFHGVMNIGAMVMDGSGFPALEKISALGYRDL  158



>ref|XP_008679175.1| PREDICTED: uncharacterized protein LOC103654122 [Zea mays]
 gb|AFW64016.1| hypothetical protein ZEAMMB73_220242 [Zea mays]
Length=271

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 7/136 (5%)
 Frame = -1

Query  1198  APYKLLEINVISAHDL--PPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFP  1025
             +P  LLE+ VISA DL    + + +R Y VAW D+  KL T V+H G   PTWN R  F 
Sbjct  13    SPSHLLEVTVISAQDLQRRRLGRRVRAYAVAWADARQKLRTGVDHAGGAAPTWNDRFLFR  72

Query  1024  FDDRILDSDEGAVKFEIYNVAWL-RDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRP  848
              D   L S+  AV  E+     L  D  +G   + +++F  P    +     AA+++RRP
Sbjct  73    VDGAFLRSETAAVTVEVRGAGVLGGDTVLGVTRIVVSTFVRPAGGAQ----VAALQLRRP  128

Query  847   STGQVQGTLNVTVQLI  800
              + + QG +NV V L+
Sbjct  129   RSLRPQGIVNVAVALL  144



>ref|XP_004133823.1| PREDICTED: uncharacterized protein LOC101212280 [Cucumis sativus]
 ref|XP_004155854.1| PREDICTED: uncharacterized protein LOC101225970 [Cucumis sativus]
 gb|KGN56448.1| hypothetical protein Csa_3G119780 [Cucumis sativus]
Length=279

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 69/138 (50%), Gaps = 7/138 (5%)
 Frame = -1

Query  1204  PQAPYKLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             P  P  +LEIN+ISA DL   S       TY VAW+   H+L T+++  G  NPTWN + 
Sbjct  13    PATPMHVLEINLISAQDLKIPSNHFNPKHTYAVAWVHPSHRLRTRLDTIGGENPTWNDKF  72

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTL-NSFYPPLSAKKPAVRHAAVEI  857
              F      L  +   V  EIY++    D  +GT    + N   P   +  P+    AV++
Sbjct  73    LFRVSPEFLARETSGVSIEIYSLGRFCDTLVGTVRFLIGNVIAPNDCSTTPSF--TAVQV  130

Query  856   RRPSTGQVQGTLNVTVQL  803
             RRPS G+  G LNV V +
Sbjct  131   RRPS-GRFHGVLNVAVMV  147



>gb|ABK23345.1| unknown [Picea sitchensis]
Length=194

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = -1

Query  1132  LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRILDSDEGAVKFEIYNVAWLR  953
             +R Y VA++D   K +T+++ +G +NPTWN +L    DD +L +   A+  EIY+ + +R
Sbjct  1     MRCYAVAYIDPEQKASTRIDQDGGINPTWNEKLVLAADDELLSNVLAAITVEIYSYSHIR  60

Query  952   DLPIGTATLTLNSFY---PPLSAKKPAVRHAAVEIRRPSTGQVQGTLNVTV  809
             D  +GTA + ++       P +     ++  AV++RRPS+ + QG LNV V
Sbjct  61    DKLVGTARILISDLLKGGDPANPSDNPIQCIAVQVRRPSS-RPQGILNVWV  110



>ref|XP_007031704.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY02630.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=306

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 70/131 (53%), Gaps = 10/131 (8%)
 Frame = -1

Query  1186  LLEINVISAHDL--PPV--SKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +LE+N ISA  L  P +   + L+TY VAW+DS  KL T+V+  G  NPTWN +  F   
Sbjct  7     VLELNFISAQGLVHPSLIPDRHLKTYAVAWVDSSTKLHTRVDRVGGENPTWNDKFLFKVS  66

Query  1018  DRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA---KKPAVRHAAVEIRRP  848
                L +    V  EIY     RD  IG+  L +++F P  SA   K PA   AA+ I  P
Sbjct  67    PEFLFNKTSTVSVEIYAAGTFRDRLIGSVRLLIHNFIPTASAAAMKTPAF--AALLIHSP  124

Query  847   STGQVQGTLNV  815
               GQ  GTLNV
Sbjct  125   -FGQFFGTLNV  134



>gb|AES82742.2| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=256

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 72/145 (50%), Gaps = 10/145 (7%)
 Frame = -1

Query  1204  PQAPYKLLEINVISAHDLPPVS---KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             P     +LEIN+ISA  L P S   +  +TY + W+DS  KL T+V+  G  NPTWN + 
Sbjct  8     PAKTQLVLEINLISAQGLKPPSSPRRNFQTYALTWIDSSTKLRTRVDKIGGQNPTWNDKF  67

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA----KKPAVRHAA  866
              F      L S+   V   IY V   RD  +GT    +++     SA    + P    +A
Sbjct  68    LFRITPEFLASETSGVSVAIYAVGTFRDHLVGTVRFLISNILSSSSADSGNRTPC--FSA  125

Query  865   VEIRRPSTGQVQGTLNVTVQLIHDS  791
             V+IRRPS G   G LN+   ++  S
Sbjct  126   VQIRRPS-GSFCGILNIGAMVVDGS  149



>ref|XP_007147256.1| hypothetical protein PHAVU_006G109100g [Phaseolus vulgaris]
 gb|ESW19250.1| hypothetical protein PHAVU_006G109100g [Phaseolus vulgaris]
Length=249

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 71/137 (52%), Gaps = 5/137 (4%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVS---KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPF  1022
             +++LEIN+ISA  L P S   + L+TY V W+    KL T+V+  G  NPTWN +  F  
Sbjct  7     HQVLEINLISAQGLKPPSSPRRRLQTYAVTWIHPDTKLRTRVDKLGGHNPTWNDKFLFRV  66

Query  1021  DDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPST  842
                 L SD  ++   IY V   RD  +GT    +++      A +     +A +IRRPS 
Sbjct  67    SPEFLSSDTSSICIAIYAVGTFRDHLVGTLRFLISNIL-SRDADESTPCFSAFQIRRPS-  124

Query  841   GQVQGTLNVTVQLIHDS  791
             G+  G +N+   ++  S
Sbjct  125   GRFHGVMNIGAMVMEGS  141



>ref|XP_003626524.1| hypothetical protein MTR_7g116840 [Medicago truncatula]
Length=284

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 72/145 (50%), Gaps = 10/145 (7%)
 Frame = -1

Query  1204  PQAPYKLLEINVISAHDLPPVS---KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             P     +LEIN+ISA  L P S   +  +TY + W+DS  KL T+V+  G  NPTWN + 
Sbjct  8     PAKTQLVLEINLISAQGLKPPSSPRRNFQTYALTWIDSSTKLRTRVDKIGGQNPTWNDKF  67

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSA----KKPAVRHAA  866
              F      L S+   V   IY V   RD  +GT    +++     SA    + P    +A
Sbjct  68    LFRITPEFLASETSGVSVAIYAVGTFRDHLVGTVRFLISNILSSSSADSGNRTPC--FSA  125

Query  865   VEIRRPSTGQVQGTLNVTVQLIHDS  791
             V+IRRPS G   G LN+   ++  S
Sbjct  126   VQIRRPS-GSFCGILNIGAMVVDGS  149



>gb|ABK22654.1| unknown [Picea sitchensis]
Length=203

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 69/134 (51%), Gaps = 6/134 (4%)
 Frame = -1

Query  1201  QAPYKLLEINVISAHDLPPVS--KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAF  1028
             Q   + +E+ +ISA DL  V     +R Y V ++D  HK +T+++ NG +NP WN  L  
Sbjct  12    QPKKRAIEVRIISAQDLEDVKLIGKMRCYAVLYIDPEHKASTRIDENGGINPFWNELLVL  71

Query  1027  PFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKK---PAVRHAAVEI  857
               DD +L  +  AV  +IY    +RD  +GT+ + ++       A       +    V +
Sbjct  72    QADDELLSQNMAAVNVDIYARGHMRDKLVGTSRILISQVLKGGDAANLYDNPIGCMPVLV  131

Query  856   RRPSTGQVQGTLNV  815
             RRPS G+ QG LN+
Sbjct  132   RRPS-GRPQGILNI  144



>ref|XP_004494776.1| PREDICTED: uncharacterized protein LOC101496947 [Cicer arietinum]
Length=260

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 69/142 (49%), Gaps = 7/142 (5%)
 Frame = -1

Query  1204  PQAPYKLLEINVISAHDLPPVS---KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             P     +LEIN+ISA  L P S   +  +TY + W+DS  KL T+V+  G  NPTWN + 
Sbjct  4     PAKTQLVLEINLISAQGLKPPSSPRRRFQTYALTWIDSSTKLRTQVDKIGGQNPTWNDKF  63

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTAT-LTLNSFYPPLSAKKPAVRHAAVEI  857
              F      L S+   V   IY V   RD  +GT   LT N        + P    +A +I
Sbjct  64    LFRVTPEFLASETSGVCVAIYAVGTFRDHIVGTVRFLTSNILSSDGGNRTPC--FSACQI  121

Query  856   RRPSTGQVQGTLNVTVQLIHDS  791
             RR S G+  G +N+   +I  S
Sbjct  122   RRES-GRFHGVMNIGAMVIDGS  142



>ref|XP_008437926.1| PREDICTED: uncharacterized protein LOC103483209 [Cucumis melo]
 gb|ADN34173.1| c2 domain-containing protein [Cucumis melo subsp. melo]
Length=279

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 70/142 (49%), Gaps = 7/142 (5%)
 Frame = -1

Query  1204  PQAPYKLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             P  P  +LEIN+ISA DL   S       TY VAW+   H+L T+++  G  NPTWN + 
Sbjct  13    PATPMPVLEINLISAQDLKVPSNPFNPKHTYAVAWIHPSHRLRTRLDTIGGENPTWNDKF  72

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWLRDLPIGTATLTL-NSFYPPLSAKKPAVRHAAVEI  857
              F      L  +   V  EIY++    D  +GT    + N       +  PA    AV++
Sbjct  73    LFRVSPEFLARETSGVSIEIYSLGRFCDTLVGTVRFLIGNVVASNDCSATPA--FTAVQV  130

Query  856   RRPSTGQVQGTLNVTVQLIHDS  791
             RRPS G+  G LN+ V +  +S
Sbjct  131   RRPS-GRFHGVLNIGVMVNGNS  151



>ref|XP_008791481.1| PREDICTED: uncharacterized protein LOC103708363 [Phoenix dactylifera]
Length=244

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 70/140 (50%), Gaps = 7/140 (5%)
 Frame = -1

Query  1192  YKLLEINVISAHDLPPVS--KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             Y  LEIN+I A  L P +  +  + Y VAW+D   KL T+V+  G  NPTWN +  F   
Sbjct  3     YHFLEINLICAQGLKPPAGFRRAQAYAVAWVDPAFKLRTRVDRTGGENPTWNDKFIFHVP  62

Query  1018  DRIL-DSDEGAVKFEIYNVA-W-LRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRP  848
                L D    AV  EIY  A W L D  +GT  L + +    LS +       AV IRRP
Sbjct  63    AGFLADDSSSAVSVEIYATAGWILTDSLLGTVRLLVGNLR-LLSRRDGCPVFDAVGIRRP  121

Query  847   STGQVQGTLNVTVQLIHDSP  788
             S G++ G LNV   L+   P
Sbjct  122   S-GRLHGVLNVGAMLLRRVP  140



>gb|EAY87999.1| hypothetical protein OsI_09421 [Oryza sativa Indica Group]
Length=281

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 74/137 (54%), Gaps = 6/137 (4%)
 Frame = -1

Query  1192  YKLLEINVISAHDL-PPVSKTLRT-YVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
              +LLE+ VISA DL   + + +R  Y VAW D  HKL T V+  G  +PTWN R  F  D
Sbjct  23    LQLLEVTVISAQDLHRRLGRRVRAAYAVAWADVAHKLRTGVDLAGGADPTWNDRFLFRVD  82

Query  1018  DRILDSDEGAVKFEIYN-VAWLRDLPIGTATLTLNSFYPPL--SAKKPAVRH-AAVEIRR  851
             +  L SD  AV  E+     +  D  +G   + +++F      SA+    R  AA+++RR
Sbjct  83    EAFLRSDTAAVTVEVRAPRRFGGDAVLGVTRIVVSTFVGSASSSARGTTGRQVAALQLRR  142

Query  850   PSTGQVQGTLNVTVQLI  800
             P + + QG +NV V ++
Sbjct  143   PRSLRPQGIVNVAVAVL  159



>gb|AFG52315.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52316.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52319.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52325.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52327.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52330.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 71/123 (58%), Gaps = 6/123 (5%)
 Frame = -1

Query  1162  AHDLPPVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRILDSDEGA  989
             A DL  V +   ++ Y VA++D  HK +T+++ +G +NP W+ +L    DD +L +   A
Sbjct  1     AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  988   VKFEIYNVAWLRDLPIGTATLTLNSFYP---PLSAKKPAVRHAAVEIRRPSTGQVQGTLN  818
             +  +IY+ + +RD  +GTA + +        P +     ++ +AV++RRPS G+ QG LN
Sbjct  61    ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANPSDNPIQCSAVQVRRPS-GRPQGILN  119

Query  817   VTV  809
             + V
Sbjct  120   IWV  122



>ref|XP_008798687.1| PREDICTED: uncharacterized protein LOC103713510 [Phoenix dactylifera]
Length=238

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 72/135 (53%), Gaps = 7/135 (5%)
 Frame = -1

Query  1186  LLEINVISAHDL-PPVS-KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDR  1013
             +LEIN+ISA  L PP   + ++ Y VAW+D   K+ T+V+  G  NPTWN +  F     
Sbjct  5     VLEINLISAQGLKPPFGLRRVQAYAVAWVDPAFKVRTRVDRTGGENPTWNDKFIFRVPAG  64

Query  1012  IL-DSDEGAVKFEIYNVA-W-LRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPST  842
              L D    AV  EIY  A W L D  +GT  L + +    LS ++      AV IRRPS 
Sbjct  65    FLADDSTSAVSIEIYAAAGWILPDPLLGTVRLLVGNLR-LLSRRRACPAFDAVGIRRPS-  122

Query  841   GQVQGTLNVTVQLIH  797
             G+  G LNV   L+H
Sbjct  123   GRFHGILNVGATLLH  137



>gb|AFG52320.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52321.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52326.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 72/126 (57%), Gaps = 12/126 (10%)
 Frame = -1

Query  1162  AHDLPPVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRILDSDEGA  989
             A DL  V +   ++ Y VA++D  HK +T+++ +G +NP W+ +L    DD +L +   A
Sbjct  1     AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  988   VKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPA------VRHAAVEIRRPSTGQVQG  827
             +  +IY+ + +RD  +GTA + +      L    PA      ++ +AV++RRPS G+ QG
Sbjct  61    ITVDIYSYSHIRDKLVGTARILVPDL---LKGGDPANPFDNPIQCSAVQVRRPS-GRPQG  116

Query  826   TLNVTV  809
              LN+ V
Sbjct  117   ILNIWV  122



>gb|AEW08214.1| hypothetical protein 2_3193_01, partial [Pinus radiata]
 gb|AFG52317.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52318.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52322.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52323.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52324.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52328.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52329.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52331.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
 gb|AFG52332.1| hypothetical protein 2_3193_01, partial [Pinus taeda]
Length=138

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 70/123 (57%), Gaps = 6/123 (5%)
 Frame = -1

Query  1162  AHDLPPVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRILDSDEGA  989
             A DL  V +   ++ Y VA++D  HK +T+++ +G +NP W+ +L    DD +L +   A
Sbjct  1     AEDLKNVKRIRKMKCYAVAYIDPDHKASTRIDQDGGINPNWHQKLVLAADDELLSNVLAA  60

Query  988   VKFEIYNVAWLRDLPIGTATLTLNSFYP---PLSAKKPAVRHAAVEIRRPSTGQVQGTLN  818
             +  +IY+ + +RD  +GTA + +        P +     ++  AV++RRPS G+ QG LN
Sbjct  61    ITVDIYSYSHIRDKLVGTARILVPDLLKGGDPANPSDNPIQCIAVQVRRPS-GRPQGILN  119

Query  817   VTV  809
             + V
Sbjct  120   IWV  122



>ref|XP_010936622.1| PREDICTED: uncharacterized protein LOC105056210 [Elaeis guineensis]
Length=207

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 59/114 (52%), Gaps = 11/114 (10%)
 Frame = -1

Query  1126  TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDDRILDSDEGAVKFEIYNVAWLRDL  947
             TY VAW+D  HKL T+++  GH+ P WN +  F  DD IL SD   V   I+  A  R L
Sbjct  27    TYTVAWIDPAHKLHTRLDAVGHIEPIWNDKFVFSLDDAILHSDTTTVTINIF-TARPRFL  85

Query  946   P-----IGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQVQGTLNVTVQLI  800
                   IGTA   L++ YP  +      R   V++ RP +   QG LN+ V L+
Sbjct  86    SGSNTLIGTARALLSALYPSTTT-----RFITVQVHRPQSLCPQGILNLDVSLL  134



>ref|XP_003569491.1| PREDICTED: uncharacterized protein LOC100842238 [Brachypodium 
distachyon]
Length=306

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 81/157 (52%), Gaps = 16/157 (10%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVS---KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +LLE+ +ISA  L P S   + L+ Y VAW+D+ H+L T+ + +G V+P W+ R  F   
Sbjct  17    RLLEVTIISAQGLKPPSGLRRRLQAYAVAWVDAAHRLQTQPDCSGGVDPAWHERFLFRVH  76

Query  1018  DRILDSD-EGAVKFEIY---NVAWL--RDLPIGTATLTL--NSFYPPLSAKKPAVRHAAV  863
             +  L  D   AV  EIY   N AW    D  IG+A   L  N     LS    +    AV
Sbjct  77    EAALAEDSRAAVTVEIYAAPNGAWHIGGDSLIGSARFLLGDNCL---LSRPVGSPAMFAV  133

Query  862   EIRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVS  752
              +RRPS G+V G LNV   L+  +PP   +   LS S
Sbjct  134   GVRRPS-GRVHGLLNVAASLVA-APPSPAASHALSRS  168



>ref|XP_002970540.1| hypothetical protein SELMODRAFT_441151 [Selaginella moellendorffii]
 gb|EFJ28670.1| hypothetical protein SELMODRAFT_441151 [Selaginella moellendorffii]
Length=270

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 73/131 (56%), Gaps = 7/131 (5%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVSKT--LRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             ++LE+  ISA DL  V     ++TYVVAW+D   K +T ++     NP WN +L    +D
Sbjct  6     RMLEVTPISAEDLKDVKLVGKMQTYVVAWVDPSRKASTNLSQLPGKNPRWNEKLMLSVED  65

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVEIRRPSTGQ  836
             ++L      +  EIY+  +L    +G A + L      +SAK       + ++RRPS G+
Sbjct  66    QLLQQPGAFLVLEIYHRGFLESTIVGRANIPLQE----ISAKGSGDAPLSFKVRRPS-GR  120

Query  835   VQGTLNVTVQL  803
             +QGT++V+V++
Sbjct  121   LQGTIHVSVKV  131



>emb|CDM83573.1| unnamed protein product [Triticum aestivum]
Length=305

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 80/157 (51%), Gaps = 16/157 (10%)
 Frame = -1

Query  1189  KLLEINVISAHDLPPVS---KTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +LLE+ +ISA  L P S   + L+ Y VAW+D+ H+L T+ + +G  +P W+ R  F   
Sbjct  17    RLLEVTIISAQGLKPPSGLRRRLQAYAVAWVDTAHRLQTQPDRSGGPDPAWHERFLFRVH  76

Query  1018  DRILDSD-EGAVKFEIY---NVAWL--RDLPIGTATLTL--NSFYPPLSAKKPAVRHAAV  863
             +  L  D   AV  EIY   N AW    D  IG+A   L  N     LS    +    AV
Sbjct  77    EAALAEDSRAAVTVEIYASPNGAWHIGGDSLIGSARFLLGDNCL---LSRPVGSPAMFAV  133

Query  862   EIRRPSTGQVQGTLNVTVQLIHDSPPETESGSQLSVS  752
              +RRPS G+V G LNV   L+  +PP   +   LS S
Sbjct  134   GVRRPS-GRVHGLLNVAASLVA-APPSPAASHALSFS  168



>ref|XP_002976843.1| hypothetical protein SELMODRAFT_443351 [Selaginella moellendorffii]
 gb|EFJ21953.1| hypothetical protein SELMODRAFT_443351 [Selaginella moellendorffii]
Length=301

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 67/136 (49%), Gaps = 10/136 (7%)
 Frame = -1

Query  1189  KLLEINVISAH--DLPPVSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFDD  1016
             + +EIN+ISA    L P      TY V W+    K  T V+  G  NP WN +L    D 
Sbjct  4     RRVEINIISAEGLKLSPSFGKPHTYAVVWIHPSKKFYTHVDQEGAKNPVWNQKLVISADT  63

Query  1015  RILDSDEGAVKFEIYNVAWLRDLPIGTATLTLNSFYPPLSAK-----KPAVRHAAVEIRR  851
               L+   G    EI++   + D PIGT  +       P  A+        +++ A EIRR
Sbjct  64    YSLEQGSGKFTIEIFHRGHIHDKPIGTVEVPFKEL--PHEARFNRETPSEIQYMAFEIRR  121

Query  850   PSTGQVQGTLNVTVQL  803
             PS G+++G LN++++L
Sbjct  122   PS-GRMKGVLNLSIRL  136



>dbj|BAK03653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 73/151 (48%), Gaps = 16/151 (11%)
 Frame = -1

Query  1204  PQAPYKLLEINVISAHDLPPVSKTLR---TYVVAWLDSGHKLTTKVNHNGHVNPTWNYRL  1034
             P  P  LLE+ VISA DL    +       Y VAW+D   KL T+V+  G  +PTWN R 
Sbjct  14    PSPPLYLLEVTVISAQDLHRRRRLSHRVRAYAVAWIDGARKLRTEVDLAGGADPTWNDRF  73

Query  1033  AFPFDDRILDSDEGAVKFEIYNVAWL-RDLPIGTATLTLNSFYPPLSAKK----------  887
              F  D   L S+  AV  E+     L  D+ +G   + +++F    S+ +          
Sbjct  74    LFRVDAGFLKSETAAVVVEVRETRRLGSDVVLGRTGIVVSTFLRVHSSSRLTAAAPAVAA  133

Query  886   --PAVRHAAVEIRRPSTGQVQGTLNVTVQLI  800
                  + AA+++RRP + + QG LNV V L+
Sbjct  134   APTGRQVAALQLRRPRSLRPQGVLNVAVTLL  164



>ref|NP_001170657.1| hypothetical protein [Zea mays]
 gb|ACR34374.1| unknown [Zea mays]
 tpg|DAA58266.1| TPA: hypothetical protein ZEAMMB73_711692 [Zea mays]
Length=278

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 74/144 (51%), Gaps = 12/144 (8%)
 Frame = -1

Query  1189  KLLEINVISAHDLPP---VSKTLRTYVVAWLDSGHKLTTKVNHNGHVNPTWNYRLAFPFD  1019
             +LLE+ +ISA  L P   V + L+ Y VAW+D+GHKL T  +  G ++P W+ RL F   
Sbjct  17    RLLEVALISAQGLKPPSGVRRRLQAYAVAWVDAGHKLQTLPDATGGLDPAWHARLLFRVR  76

Query  1018  DRIL-DSDEGAVKFEIYNVA------WLRDLPIGTATLTLNSFYPPLSAKKPAVRHAAVE  860
             +  L D    AV  EIY  A      +  D  +G+A   +   +  LS    +    AV 
Sbjct  77    EASLADDSPAAVSVEIYAAAAAGSWHFGGDSLVGSARFLIGD-HRLLSRPVGSPSMFAVG  135

Query  859   IRRPSTGQVQGTLNVTVQLIHDSP  788
             +RRPS G+V G LNV   L+   P
Sbjct  136   VRRPS-GRVHGLLNVAASLVAVPP  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3808606879987