BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82197_g1_i1 len=2396 path=[2374:0-2395]

Length=2396
                                                                      Score     E

ref|XP_009769259.1|  PREDICTED: uncharacterized protein LOC104220140    759   0.0      
ref|XP_004250882.1|  PREDICTED: uncharacterized protein LOC101257138    758   0.0      
ref|XP_006356375.1|  PREDICTED: uncharacterized protein LOC102596128    757   0.0      
ref|XP_009618754.1|  PREDICTED: uncharacterized protein LOC104110901    741   0.0      
ref|XP_011090181.1|  PREDICTED: uncharacterized protein LOC105170937    714   0.0      
ref|XP_002280699.1|  PREDICTED: uncharacterized protein LOC100259697    699   0.0      Vitis vinifera
ref|XP_007221823.1|  hypothetical protein PRUPE_ppa002963mg             684   0.0      
ref|XP_008224021.1|  PREDICTED: uncharacterized protein LOC103323787    682   0.0      
emb|CDP09650.1|  unnamed protein product                                681   0.0      
ref|XP_004308621.1|  PREDICTED: uncharacterized protein LOC101311809    680   0.0      
ref|XP_010096128.1|  hypothetical protein L484_002619                   672   0.0      
ref|XP_009341617.1|  PREDICTED: uncharacterized protein LOC103933...    659   0.0      
ref|XP_009341616.1|  PREDICTED: uncharacterized protein LOC103933...    659   0.0      
ref|XP_002523548.1|  transferase, transferring glycosyl groups, p...    659   0.0      Ricinus communis
ref|XP_003528735.1|  PREDICTED: uncharacterized protein LOC100775691    658   0.0      
ref|XP_008366121.1|  PREDICTED: uncharacterized protein LOC103429768    656   0.0      
ref|XP_002314015.1|  hypothetical protein POPTR_0009s07130g             655   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011025008.1|  PREDICTED: uncharacterized protein LOC105126...    655   0.0      
gb|KGN48074.1|  hypothetical protein Csa_6G428550                       655   0.0      
ref|XP_008449622.1|  PREDICTED: uncharacterized protein LOC103491452    654   0.0      
ref|XP_002298453.2|  hypothetical protein POPTR_0001s27930g             654   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007015361.1|  30S ribosomal protein S3, putative isoform 1       652   0.0      
ref|XP_011025006.1|  PREDICTED: uncharacterized protein LOC105126...    652   0.0      
ref|XP_004301527.1|  PREDICTED: uncharacterized protein LOC101294374    651   0.0      
ref|XP_004510564.1|  PREDICTED: uncharacterized protein LOC101514737    652   0.0      
ref|XP_008366346.1|  PREDICTED: uncharacterized protein LOC103429988    649   0.0      
ref|XP_004140181.1|  PREDICTED: uncharacterized protein LOC101202835    648   0.0      
ref|XP_011036384.1|  PREDICTED: uncharacterized protein LOC105133923    648   0.0      
gb|KDP38619.1|  hypothetical protein JCGZ_03972                         644   0.0      
ref|XP_010261054.1|  PREDICTED: uncharacterized protein LOC104599977    640   0.0      
ref|XP_006470513.1|  PREDICTED: uncharacterized protein LOC102622818    639   0.0      
ref|XP_003627441.1|  hypothetical protein MTR_8g023050                  638   0.0      
gb|KHN01469.1|  hypothetical protein glysoja_009675                     638   0.0      
ref|XP_010536145.1|  PREDICTED: uncharacterized protein LOC104811206    636   0.0      
ref|XP_010673796.1|  PREDICTED: uncharacterized protein LOC104890...    634   0.0      
ref|XP_006446350.1|  hypothetical protein CICLE_v10014615mg             633   0.0      
ref|XP_007134752.1|  hypothetical protein PHAVU_010G072800g             626   0.0      
ref|XP_010938830.1|  PREDICTED: uncharacterized protein LOC105057825    619   0.0      
ref|XP_010031698.1|  PREDICTED: uncharacterized protein LOC104421448    619   0.0      
emb|CDX69692.1|  BnaA10g20410D                                          608   0.0      
ref|XP_009121861.1|  PREDICTED: uncharacterized protein LOC103846650    608   0.0      
ref|XP_009412191.1|  PREDICTED: uncharacterized protein LOC103993741    604   0.0      
ref|XP_006287245.1|  hypothetical protein CARUB_v10000433mg             603   0.0      
ref|XP_010419816.1|  PREDICTED: uncharacterized protein LOC104705500    601   0.0      
emb|CDX97181.1|  BnaC09g44440D                                          600   0.0      
ref|XP_010491984.1|  PREDICTED: uncharacterized protein LOC104769466    601   0.0      
ref|XP_010453292.1|  PREDICTED: uncharacterized protein LOC104735241    600   0.0      
ref|XP_003565675.1|  PREDICTED: uncharacterized protein LOC100842839    598   0.0      
gb|KFK25502.1|  hypothetical protein AALP_AA8G123000                    597   0.0      
ref|XP_002871521.1|  predicted protein                                  596   0.0      
ref|XP_006399741.1|  hypothetical protein EUTSA_v10012969mg             595   0.0      
ref|XP_006644072.1|  PREDICTED: uncharacterized protein LOC102715342    594   0.0      
gb|EPS70165.1|  hypothetical protein M569_04597                         592   0.0      
ref|XP_009393099.1|  PREDICTED: uncharacterized protein LOC103978...    593   0.0      
ref|XP_008810362.1|  PREDICTED: uncharacterized protein LOC103721799    589   0.0      
gb|EAY73544.1|  hypothetical protein OsI_01427                          589   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001042762.1|  Os01g0283000                                       586   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97305.1|  predicted protein                                      585   0.0      
ref|NP_196787.1|  uncharacterized protein                               585   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405439.1|  hypothetical protein EUTSA_v10028084mg             584   0.0      
ref|XP_002457678.1|  hypothetical protein SORBIDRAFT_03g011520          581   0.0      Sorghum bicolor [broomcorn]
ref|XP_004967661.1|  PREDICTED: uncharacterized protein LOC101765...    577   0.0      
ref|XP_009131269.1|  PREDICTED: uncharacterized protein LOC103855966    577   0.0      
ref|XP_009393100.1|  PREDICTED: uncharacterized protein LOC103978...    570   0.0      
emb|CDX78477.1|  BnaA03g03890D                                          570   0.0      
gb|EMT25495.1|  hypothetical protein F775_06261                         556   0.0      
ref|XP_008673938.1|  PREDICTED: uncharacterized protein LOC103650047    551   0.0      
gb|KHN39578.1|  hypothetical protein glysoja_020656                     548   0.0      
ref|XP_006854787.1|  hypothetical protein AMTR_s00063p00142620          547   0.0      
ref|XP_008384201.1|  PREDICTED: uncharacterized protein LOC103446...    456   3e-149   
ref|XP_008384202.1|  PREDICTED: uncharacterized protein LOC103446...    441   7e-144   
ref|XP_010673797.1|  PREDICTED: uncharacterized protein LOC104890...    442   1e-143   
ref|XP_002963901.1|  hypothetical protein SELMODRAFT_79807              419   1e-134   
ref|XP_002988305.1|  hypothetical protein SELMODRAFT_183718             419   2e-134   
gb|EMS64322.1|  hypothetical protein TRIUR3_29616                       416   2e-131   
ref|XP_001781812.1|  predicted protein                                  377   2e-119   
ref|XP_008778176.1|  PREDICTED: uncharacterized protein LOC103698003    342   2e-106   
ref|XP_009358047.1|  PREDICTED: uncharacterized protein LOC103948712    336   3e-104   
emb|CDX70461.1|  BnaC03g05450D                                          314   4e-96    
gb|EYU35956.1|  hypothetical protein MIMGU_mgv1a019316mg                308   6e-94    
gb|KDO66439.1|  hypothetical protein CISIN_1g0444321mg                  296   4e-89    
ref|XP_007015362.1|  30S ribosomal protein S3, putative isoform 2       293   6e-86    
gb|KDO66438.1|  hypothetical protein CISIN_1g0444322mg                  275   5e-82    
gb|EYU35957.1|  hypothetical protein MIMGU_mgv1a022526mg                262   1e-77    
ref|XP_006836246.1|  hypothetical protein AMTR_s00101p00129070          249   2e-72    
ref|XP_006446348.1|  hypothetical protein CICLE_v10017537mg             226   2e-63    
ref|XP_009492636.1|  hypothetical protein, variant 8                    182   2e-45    
ref|XP_009492638.1|  hypothetical protein, variant 3                    182   7e-45    
ref|XP_009492643.1|  hypothetical protein H696_00498                    182   1e-44    
ref|XP_009492637.1|  hypothetical protein, variant 2                    182   1e-44    
ref|XP_006377113.1|  hypothetical protein POPTR_0012s15140g             155   2e-39    
ref|XP_005715832.1|  unnamed protein product                            135   2e-30    
gb|AFM95207.1|  hypothetical protein                                    119   9e-28    
ref|XP_005824698.1|  hypothetical protein GUITHDRAFT_165425             125   2e-26    
ref|XP_005828343.1|  hypothetical protein GUITHDRAFT_142059             122   6e-25    
ref|XP_009492640.1|  hypothetical protein, variant 5                    120   8e-25    
ref|XP_009492642.1|  hypothetical protein, variant 7                    120   8e-25    
ref|XP_009492639.1|  hypothetical protein, variant 4                    120   9e-25    
ref|XP_005828362.1|  hypothetical protein GUITHDRAFT_142073             119   4e-24    
gb|ELU18430.1|  hypothetical protein CAPTEDRAFT_185049                  115   8e-24    
gb|EPS66725.1|  hypothetical protein M569_08051                         110   1e-22    
ref|XP_011014936.1|  PREDICTED: uncharacterized protein LOC105118649    113   2e-22    
ref|XP_011040898.1|  PREDICTED: uncharacterized protein LOC105137030    113   2e-22    
ref|XP_001754447.1|  predicted protein                                  112   3e-22    
ref|XP_007261352.1|  hypothetical protein FOMMEDRAFT_24784              110   1e-21    
ref|XP_001756912.1|  predicted protein                                  109   2e-21    
ref|XP_009613820.1|  PREDICTED: uncharacterized protein LOC104106...    108   4e-21    
ref|XP_009613805.1|  PREDICTED: uncharacterized protein LOC104106...    109   4e-21    
gb|AES88566.2|  glycosyltransferase family 2 protein                    109   5e-21    
ref|XP_009784117.1|  PREDICTED: uncharacterized protein LOC104232581    108   8e-21    
ref|XP_010322401.1|  PREDICTED: uncharacterized protein LOC101258666    108   9e-21    
ref|XP_009770819.1|  PREDICTED: uncharacterized protein LOC104221445    108   1e-20    
ref|XP_009631262.1|  PREDICTED: uncharacterized protein LOC104121073    108   1e-20    
ref|XP_010089967.1|  hypothetical protein L484_008045                   108   1e-20    
gb|KHG05738.1|  Poly (A) polymerase                                     105   1e-20    
gb|KHG18499.1|  Anion exchange 4                                        107   2e-20    
ref|XP_006365756.1|  PREDICTED: uncharacterized protein LOC102579416    107   2e-20    
ref|XP_006846820.1|  hypothetical protein AMTR_s00148p00087220          107   2e-20    
ref|NP_200878.2|  glycosyltransferase family protein 2                  106   2e-20    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483721.1|  PREDICTED: uncharacterized protein LOC104762...    107   2e-20    
ref|XP_002866391.1|  predicted protein                                  107   2e-20    
gb|ELT91165.1|  hypothetical protein CAPTEDRAFT_217577                  104   2e-20    
ref|XP_004515514.1|  PREDICTED: uncharacterized protein LOC101506183    107   2e-20    
dbj|BAB09843.1|  unnamed protein product                                107   2e-20    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009023364.1|  hypothetical protein HELRODRAFT_192903             103   2e-20    
ref|XP_009120603.1|  PREDICTED: uncharacterized protein LOC103845483    107   2e-20    
ref|XP_006384913.1|  hypothetical protein POPTR_0004s22170g             107   2e-20    
ref|XP_004251147.1|  PREDICTED: uncharacterized protein LOC101262484    107   3e-20    
ref|XP_001751662.1|  predicted protein                                  106   3e-20    
ref|XP_007363080.1|  hypothetical protein DICSQDRAFT_101090             106   3e-20    
emb|CDY31518.1|  BnaA10g13530D                                          106   3e-20    
emb|CDY52707.1|  BnaC09g54350D                                          106   3e-20    
ref|XP_011089273.1|  PREDICTED: uncharacterized protein LOC105170283    106   3e-20    
ref|XP_010456674.1|  PREDICTED: uncharacterized protein LOC104738147    106   3e-20    
ref|XP_010443872.1|  PREDICTED: uncharacterized protein LOC104726658    106   4e-20    
ref|XP_006279968.1|  hypothetical protein CARUB_v10025834mg             106   4e-20    
ref|XP_002454742.1|  hypothetical protein SORBIDRAFT_04g036530          106   4e-20    Sorghum bicolor [broomcorn]
gb|EPS59719.1|  hypothetical protein M569_15086                         105   4e-20    
ref|XP_004291705.1|  PREDICTED: uncharacterized protein LOC101294726    106   4e-20    
ref|XP_008462712.1|  PREDICTED: uncharacterized protein LOC103501...    106   4e-20    
ref|XP_007016776.1|  Glycosyltransferase family protein 2               105   5e-20    
ref|XP_008462729.1|  PREDICTED: uncharacterized protein LOC103501...    105   5e-20    
emb|CDS14009.1|  hypothetical protein LRAMOSA06180                      105   5e-20    
ref|XP_006591138.1|  PREDICTED: uncharacterized protein LOC100813...    105   6e-20    
ref|XP_009392188.1|  PREDICTED: uncharacterized protein LOC103978197    105   6e-20    
ref|XP_007401187.1|  hypothetical protein PHACADRAFT_178618             105   6e-20    
gb|KDP44035.1|  hypothetical protein JCGZ_05502                         105   7e-20    
gb|KHN38756.1|  hypothetical protein glysoja_008305                     105   7e-20    
ref|XP_003539203.1|  PREDICTED: uncharacterized protein LOC100813...    105   7e-20    
ref|XP_002314281.2|  hypothetical protein POPTR_0009s01610g             105   7e-20    Populus trichocarpa [western balsam poplar]
ref|XP_011044401.1|  PREDICTED: uncharacterized protein LOC105139601    105   8e-20    
ref|XP_006340407.1|  PREDICTED: uncharacterized protein LOC102579905    105   8e-20    
gb|KDQ61549.1|  hypothetical protein JAAARDRAFT_190293                  105   8e-20    
emb|CDH55045.1|  glycosyl transferase family 2 protein                  105   8e-20    
ref|XP_010535609.1|  PREDICTED: uncharacterized protein LOC104810862    105   9e-20    
ref|XP_009126589.1|  PREDICTED: uncharacterized protein LOC103851489    105   1e-19    
ref|XP_002969177.1|  hypothetical protein SELMODRAFT_90221              104   1e-19    
ref|XP_006592260.1|  PREDICTED: uncharacterized protein LOC100790...    104   1e-19    
ref|XP_006592259.1|  PREDICTED: uncharacterized protein LOC100790...    104   1e-19    
gb|KHN05675.1|  hypothetical protein glysoja_024641                     104   1e-19    
gb|KHG21348.1|  Poly (A) polymerase                                     104   1e-19    
ref|XP_002973886.1|  hypothetical protein SELMODRAFT_100224             103   1e-19    
emb|CDY09190.1|  BnaA02g06160D                                          104   1e-19    
dbj|BAG70977.1|  glycosyl transferase family 2 protein                  104   1e-19    Musa balbisiana [starchy banana]
ref|XP_009382480.1|  PREDICTED: uncharacterized protein LOC103970426    104   1e-19    
ref|XP_003570333.1|  PREDICTED: uncharacterized protein LOC100838904    104   1e-19    
ref|XP_007132269.1|  hypothetical protein PHAVU_011G080500g             104   1e-19    
ref|XP_010253707.1|  PREDICTED: uncharacterized protein LOC104594876    104   1e-19    
emb|CDO73305.1|  hypothetical protein BN946_scf185008.g67               103   2e-19    
gb|EJK65743.1|  hypothetical protein THAOC_13369                        103   2e-19    
gb|KFK27596.1|  hypothetical protein AALP_AA8G404200                    103   2e-19    
emb|CDP07096.1|  unnamed protein product                                103   2e-19    
ref|XP_011089932.1|  PREDICTED: uncharacterized protein LOC105170732    103   2e-19    
ref|XP_002529934.1|  transferase, transferring glycosyl groups, p...    103   2e-19    Ricinus communis
ref|XP_009418335.1|  PREDICTED: uncharacterized protein LOC103998566    103   2e-19    
gb|EMT26013.1|  hypothetical protein F775_01966                         103   3e-19    
ref|XP_008225913.1|  PREDICTED: uncharacterized protein LOC103325510    103   3e-19    
ref|XP_010264657.1|  PREDICTED: uncharacterized protein LOC104602607    103   3e-19    
ref|XP_004160910.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   3e-19    
ref|XP_007206436.1|  hypothetical protein PRUPE_ppa001021mg             103   4e-19    
gb|KGN64839.1|  hypothetical protein Csa_1G124520                       103   4e-19    
ref|XP_004139558.1|  PREDICTED: uncharacterized protein LOC101202906    103   4e-19    
ref|XP_009349735.1|  PREDICTED: uncharacterized protein LOC103941265    102   4e-19    
ref|XP_009367054.1|  PREDICTED: uncharacterized protein LOC103956752    102   5e-19    
ref|XP_010689523.1|  PREDICTED: uncharacterized protein LOC104903223    102   5e-19    
ref|XP_006400820.1|  hypothetical protein EUTSA_v10012601mg             102   6e-19    
ref|XP_008355202.1|  PREDICTED: uncharacterized protein LOC103418872    101   7e-19    
ref|XP_008359358.1|  PREDICTED: uncharacterized protein LOC103423066    102   8e-19    
ref|XP_010043762.1|  PREDICTED: uncharacterized protein LOC104432887    101   1e-18    
gb|EMD39225.1|  hypothetical protein CERSUDRAFT_93273                   101   1e-18    
dbj|GAA98239.1|  hypothetical protein E5Q_04922                         102   1e-18    
ref|XP_009549388.1|  hypothetical protein HETIRDRAFT_323869             101   1e-18    
emb|CAN61137.1|  hypothetical protein VITISV_013983                     101   2e-18    Vitis vinifera
ref|XP_002285243.1|  PREDICTED: uncharacterized protein LOC100262081    100   2e-18    Vitis vinifera
ref|XP_004954285.1|  PREDICTED: uncharacterized protein LOC101776528    100   2e-18    
emb|CBI16328.3|  unnamed protein product                                100   2e-18    
ref|XP_010911071.1|  PREDICTED: uncharacterized protein LOC105037065  97.4    2e-18    
gb|EPB91970.1|  hypothetical protein HMPREF1544_01264                   100   2e-18    
ref|XP_008646404.1|  PREDICTED: uncharacterized protein LOC103627873    100   2e-18    
ref|XP_006488643.1|  PREDICTED: uncharacterized protein LOC102606698    100   3e-18    
ref|XP_006424549.1|  hypothetical protein CICLE_v10030090mg             100   3e-18    
gb|KDO73334.1|  hypothetical protein CISIN_1g046508mg                   100   3e-18    
ref|XP_002984703.1|  hypothetical protein SELMODRAFT_120665             100   3e-18    
ref|XP_002978788.1|  hypothetical protein SELMODRAFT_109643             100   4e-18    
gb|KDE08140.1|  hypothetical protein MVLG_01621                       99.8    5e-18    
ref|NP_001173193.1|  Os02g0806500                                     99.4    5e-18    
emb|CEG70794.1|  hypothetical protein RMATCC62417_06625               98.6    7e-18    
ref|XP_008791567.1|  PREDICTED: uncharacterized protein LOC103708423  99.0    7e-18    
ref|XP_006648077.1|  PREDICTED: uncharacterized protein LOC102708127  99.0    8e-18    
ref|XP_009025666.1|  hypothetical protein HELRODRAFT_189271           95.9    8e-18    
emb|CEJ01502.1|  hypothetical protein RMCBS344292_15526               97.4    9e-18    
gb|EYU18816.1|  hypothetical protein MIMGU_mgv1a001032mg              98.6    1e-17    
ref|XP_010906511.1|  PREDICTED: uncharacterized protein LOC105033416  98.2    1e-17    
ref|XP_008805206.1|  PREDICTED: uncharacterized protein LOC103718255  98.2    1e-17    
ref|XP_009023365.1|  hypothetical protein HELRODRAFT_176859           94.7    2e-17    
gb|KDR65732.1|  hypothetical protein GALMADRAFT_1220405               97.4    2e-17    
ref|XP_008807485.1|  PREDICTED: uncharacterized protein LOC103719835  97.4    2e-17    
gb|ELT95652.1|  hypothetical protein CAPTEDRAFT_197326                94.4    3e-17    
emb|CDH51079.1|  glycosyltransferase family protein 2                 97.1    3e-17    
gb|EJK57711.1|  hypothetical protein THAOC_22215                      95.1    3e-17    
ref|XP_007386423.1|  hypothetical protein PUNSTDRAFT_136755           96.3    4e-17    
emb|CDS12682.1|  hypothetical protein LRAMOSA04868                    96.7    4e-17    
ref|XP_005839692.1|  hypothetical protein GUITHDRAFT_101866           96.7    4e-17    
ref|XP_004337083.1|  hypothetical protein ACA1_214990                 96.3    4e-17    
ref|XP_005821491.1|  hypothetical protein GUITHDRAFT_147205           94.0    6e-17    
emb|CDS06903.1|  hypothetical protein LRAMOSA09426                    95.5    8e-17    
emb|CCM02448.1|  predicted protein                                    95.1    1e-16    
gb|EJK64351.1|  hypothetical protein THAOC_14926                      94.4    1e-16    
ref|XP_008038815.1|  hypothetical protein TRAVEDRAFT_123656           94.4    2e-16    
gb|KFH70962.1|  hypothetical protein MVEG_03808                       94.4    2e-16    
gb|EPT00689.1|  hypothetical protein FOMPIDRAFT_1030324               94.4    2e-16    
gb|ELT92203.1|  hypothetical protein CAPTEDRAFT_192810                94.0    2e-16    
gb|EGU11213.1|  Glycosyltransferase 2                                 94.4    2e-16    
gb|EMS21736.1|  glycosyl transferase family 2 protein                 94.4    2e-16    
ref|XP_005703917.1|  hypothetical protein Gasu_49950                  90.5    2e-16    
emb|CDH60707.1|  glycosyltransferase 2                                94.0    3e-16    
ref|XP_007865170.1|  hypothetical protein GLOTRDRAFT_128380           93.6    3e-16    
ref|XP_009018463.1|  hypothetical protein HELRODRAFT_173601           90.1    5e-16    
gb|ELU16230.1|  hypothetical protein CAPTEDRAFT_194714                90.5    5e-16    
ref|XP_007844178.1|  glycosyltransferase 2                            92.0    8e-16    
ref|XP_009309299.1|  hypothetical protein DQ04_01681120               89.4    1e-15    
gb|ELU06378.1|  hypothetical protein CAPTEDRAFT_216276                89.0    1e-15    
ref|XP_007304368.1|  hypothetical protein STEHIDRAFT_168656           91.3    2e-15    
gb|EPB89374.1|  hypothetical protein HMPREF1544_03743                 91.3    2e-15    
ref|XP_002910881.1|  glycosyltransferase 2                            90.5    3e-15    
ref|XP_005777351.1|  hypothetical protein EMIHUDRAFT_443743           90.5    4e-15    
gb|EIE88405.1|  hypothetical protein RO3G_13116                       89.0    5e-15    
ref|XP_009022937.1|  hypothetical protein HELRODRAFT_162503           88.2    6e-15    
gb|ESL11871.1|  hypothetical protein TRSC58_00370                     87.8    6e-15    
gb|EJK49616.1|  hypothetical protein THAOC_31488                      89.0    7e-15    
gb|EKF39410.1|  hypothetical protein MOQ_000363                       86.7    1e-14    
gb|ERZ96811.1|  hypothetical protein GLOINDRAFT_340501                88.2    1e-14    
ref|XP_009025503.1|  hypothetical protein HELRODRAFT_163373           86.7    1e-14    
ref|XP_003606369.1|  hypothetical protein MTR_4g058760                88.2    1e-14    
emb|CCA77893.1|  hypothetical protein PIIN_00537                      87.8    2e-14    
ref|XP_007327672.1|  hypothetical protein AGABI1DRAFT_126235          87.0    3e-14    
ref|XP_009025504.1|  hypothetical protein HELRODRAFT_163374           85.5    4e-14    
gb|ELU07979.1|  hypothetical protein CAPTEDRAFT_206229                84.3    6e-14    
ref|XP_808922.1|  hypothetical protein                                83.6    1e-13    Trypanosoma cruzi strain CL Brener
gb|ELU14685.1|  hypothetical protein CAPTEDRAFT_204427                83.2    1e-13    
emb|CBN77366.1|  conserved unknown protein                            84.3    1e-13    
dbj|GAA95930.1|  hypothetical protein E5Q_02588                       85.5    1e-13    
gb|ELU16029.1|  hypothetical protein CAPTEDRAFT_200183                82.0    2e-13    
gb|ELU18185.1|  hypothetical protein CAPTEDRAFT_216271                82.8    2e-13    
gb|EPB88147.1|  hypothetical protein HMPREF1544_05091                 84.3    2e-13    
gb|EKC33249.1|  hypothetical protein CGI_10022227                     82.0    3e-13    
gb|ESS70378.1|  hypothetical protein TCDM_00845                       83.2    3e-13    
ref|XP_006462011.1|  hypothetical protein AGABI2DRAFT_118862          84.0    3e-13    
gb|EKG07337.1|  hypothetical protein TCSYLVIO_001521                  82.8    3e-13    
ref|XP_815527.1|  hypothetical protein                                82.0    4e-13    Trypanosoma cruzi strain CL Brener
gb|ELT94152.1|  hypothetical protein CAPTEDRAFT_214128                80.5    7e-13    
emb|CCO28434.1|  putative mitochondrial carrier C8C9,12c              82.4    1e-12    
ref|XP_007770944.1|  hypothetical protein CONPUDRAFT_145357           81.6    2e-12    
gb|ESA02394.1|  hypothetical protein GLOINDRAFT_86398                 81.3    2e-12    
emb|CDS08991.1|  hypothetical protein LRAMOSA10351                    81.3    2e-12    
gb|EXX66594.1|  hypothetical protein RirG_122340                      81.3    2e-12    
gb|EPZ35541.1|  GDP-fucose protein O-fucosyltransferase domain-co...  80.1    4e-12    
gb|EPB90643.1|  hypothetical protein HMPREF1544_02553                 80.1    5e-12    
gb|EUC59671.1|  carrier protein C8C9,12c, putative                    79.7    7e-12    
emb|CDH58078.1|  glycosyltransferase 2                                79.3    9e-12    
gb|EJU03554.1|  hypothetical protein DACRYDRAFT_105713                79.0    1e-11    
gb|ELU11776.1|  hypothetical protein CAPTEDRAFT_203658                76.3    2e-11    
emb|CDS02894.1|  hypothetical protein LRAMOSA00296                    78.2    2e-11    
gb|ELU17657.1|  hypothetical protein CAPTEDRAFT_204248                75.9    3e-11    
ref|XP_003326637.2|  hypothetical protein PGTG_07615                  77.8    3e-11    
gb|ELU06032.1|  hypothetical protein CAPTEDRAFT_219903                75.9    3e-11    
emb|CDH53701.1|  protein                                              77.4    3e-11    
emb|CEG78439.1|  hypothetical protein RMATCC62417_13047               77.0    4e-11    
gb|EMS23274.1|  EXTL3, alpha-1,4-N-acetylglucosaminyltransferase,...  77.0    5e-11    
emb|CEJ04070.1|  hypothetical protein RMCBS344292_18040               75.5    1e-10    
emb|CEJ04241.1|  hypothetical protein RMCBS344292_18208               74.7    2e-10    
ref|XP_007320619.1|  hypothetical protein SERLADRAFT_440103           74.7    2e-10    
ref|WP_034659692.1|  hypothetical protein                             70.1    2e-09    
ref|WP_036195967.1|  hypothetical protein                             69.7    3e-09    
ref|WP_029446084.1|  hypothetical protein                             70.1    3e-09    
ref|WP_039329831.1|  hypothetical protein                             69.7    4e-09    
ref|XP_005763490.1|  hypothetical protein EMIHUDRAFT_104841           70.1    6e-09    
ref|XP_006836902.1|  hypothetical protein AMTR_s00099p00126100        65.1    7e-09    
ref|WP_002288206.1|  hypothetical protein                             68.6    9e-09    
ref|WP_033541202.1|  hypothetical protein                             67.4    2e-08    
ref|WP_013665229.1|  family 2 glycosyl transferase                    67.0    3e-08    
ref|WP_025069979.1|  hypothetical protein                             67.0    3e-08    
ref|WP_028900687.1|  hypothetical protein                             66.6    3e-08    
gb|EIE76565.1|  hypothetical protein RO3G_01269                       67.8    3e-08    
gb|EES70737.1|  hypothetical protein BSIG_1010                        66.6    4e-08    
ref|WP_032840749.1|  hypothetical protein                             66.2    4e-08    
gb|ELT89082.1|  hypothetical protein CAPTEDRAFT_193798                65.5    7e-08    
ref|XP_005538076.1|  hypothetical protein, conserved                  64.7    1e-07    
gb|EGN96538.1|  hypothetical protein SERLA73DRAFT_75427               65.5    2e-07    
ref|WP_004381070.1|  hypothetical protein                             63.9    3e-07    
gb|ELT98640.1|  hypothetical protein CAPTEDRAFT_196531                63.2    3e-07    
gb|KDQ19170.1|  hypothetical protein BOTBODRAFT_103262                62.4    5e-07    
gb|ELU43625.1|  carrier protein                                       64.3    5e-07    
ref|WP_019967296.1|  hypothetical protein                             62.8    5e-07    
ref|WP_036799301.1|  hypothetical protein                             62.4    6e-07    
ref|XP_001749831.1|  hypothetical protein                             63.2    7e-07    
ref|WP_034235457.1|  hypothetical protein                             62.4    8e-07    
ref|XP_002507005.1|  predicted protein                                62.0    9e-07    
ref|XP_007416604.1|  hypothetical protein MELLADRAFT_68006            60.5    3e-06    
ref|XP_011115939.1|  hypothetical protein H072_10478                  61.2    3e-06    
ref|WP_013622187.1|  polysaccharide deacetylase Est4B                 60.1    4e-06    
ref|XP_011117931.1|  hypothetical protein AOL_s00006g320              60.1    7e-06    
ref|XP_004992712.1|  hypothetical protein PTSG_05819                  60.1    8e-06    
ref|WP_022104104.1|  putative uncharacterized protein                 58.2    2e-05    
ref|WP_018613824.1|  hypothetical protein                             57.8    2e-05    
gb|KHD03945.1|  hypothetical protein OT06_57315                       57.8    2e-05    
ref|WP_036949940.1|  MULTISPECIES: hypothetical protein               57.0    2e-05    
ref|XP_004992699.1|  hypothetical protein PTSG_05807                  57.8    4e-05    
gb|KDS66813.1|  GNT-I family protein                                  56.6    6e-05    
ref|WP_012056190.1|  glycosyltransferase                              56.6    6e-05    
ref|WP_036631851.1|  hypothetical protein                             56.2    6e-05    
ref|WP_034256625.1|  hypothetical protein                             55.5    1e-04    
ref|WP_031583003.1|  hypothetical protein                             53.5    2e-04    
ref|XP_009040713.1|  hypothetical protein AURANDRAFT_67109            55.5    2e-04    
ref|WP_022963951.1|  glycosyl transferase family 2                    54.3    3e-04    
ref|WP_005843705.1|  hypothetical protein                             53.9    3e-04    
ref|WP_008782125.1|  hypothetical protein                             53.9    3e-04    
ref|WP_034475835.1|  hypothetical protein                             53.5    4e-04    
gb|EPQ63099.1|  hypothetical protein BGT96224_2399                    53.1    0.001    



>ref|XP_009769259.1| PREDICTED: uncharacterized protein LOC104220140 [Nicotiana sylvestris]
Length=622

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/581 (64%), Positives = 463/581 (80%), Gaps = 2/581 (0%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASL  2152
             P      +++FTFIIK+L +NR  SLSRCLNSL+ A YD+H VHLHI+IDHF   +   +
Sbjct  43    PYNNPQTHQNFTFIIKVLTFNRFESLSRCLNSLSKAKYDNHVVHLHIYIDHFQDSSKGYV  102

Query  2151  DVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD  1972
              +D  LN S+RILDFVD F W+FG K+VHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD
Sbjct  103   VIDERLNLSKRILDFVDGFNWEFGEKLVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD  162

Query  1971  LEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQ  1792
             LE+SPLYFRFLK+LI NYYYN SNFSPMIYGASLQRPRFV GKHGNKM+ID  T++FLYQ
Sbjct  163   LELSPLYFRFLKSLIENYYYNESNFSPMIYGASLQRPRFVAGKHGNKMQIDDGTQLFLYQ  222

Query  1791  LVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHA  1612
             LVGTWGQLLFPRPWKEFR+WYD HK+KG+KPVLDGMVTTGWYKKMGERIWTPWFIKFIHA
Sbjct  223   LVGTWGQLLFPRPWKEFRIWYDIHKAKGLKPVLDGMVTTGWYKKMGERIWTPWFIKFIHA  282

Query  1611  RGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYD  1432
             RGYFNIYTNLL+ERA S+SHRDAGVNYGKSVGPDS+LV E S D+N L+   L S+KWYD
Sbjct  283   RGYFNIYTNLLHERAFSVSHRDAGVNYGKSVGPDSSLVDEKSFDLNLLKLQSLRSLKWYD  342

Query  1431  FCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYI  1252
             FCFK+VFP R+V   ++L  V+ S+QK+  +I V+L Q SES++RNLLCHF+RL I+NY+
Sbjct  343   FCFKEVFPGRVVHSSDDLVPVLQSVQKLKTIIYVNLQQVSESIIRNLLCHFDRLNIQNYV  402

Query  1251  LMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLE  1072
             ++GP++DLLLDLA RG+PVIDTD+ +D+IR+ +  NF++S  KL K+I VKA+V++K+LE
Sbjct  403   ILGPQTDLLLDLARRGYPVIDTDQFFDSIRLQNSINFDKSHEKLGKDIVVKAHVIRKSLE  462

Query  1071  LGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQ  892
             L +   V D + +PL+SDSFL+  D  A NDFF+GKN +LVF R+SSSA K W +++  +
Sbjct  463   LKYSTWVVDSDVIPLSSDSFLDSYDP-AGNDFFLGKNFKLVFIRNSSSALKIWVDNVLDK  521

Query  891   LGAELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQ-  715
             + A +    +  S  T +NFV +V+KL EQK   F   DE   SLNIS +D+++T S   
Sbjct  522   IVASIANLKTRGSIATERNFVNLVEKLLEQKRTTFNRVDETDFSLNISYMDSNQTSSRNG  581

Query  714   EQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             ++F FWS E  +  IQ++L Q  +W+VDS++SC AV+C+PS
Sbjct  582   KKFAFWSPEIGSETIQKRLEQFAMWVVDSELSCNAVVCHPS  622



>ref|XP_004250882.1| PREDICTED: uncharacterized protein LOC101257138 [Solanum lycopersicum]
Length=620

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/578 (64%), Positives = 459/578 (79%), Gaps = 3/578 (1%)
 Frame = -3

Query  2322  TTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVD  2143
             T   +++FTF++K+L +NRL SLSRCLNSL+ AHYD+H VHLH++IDHF    N  +++D
Sbjct  45    TPQTHQNFTFLVKVLTFNRLESLSRCLNSLSKAHYDNHVVHLHVYIDHFQDSPNGYVEID  104

Query  2142  RNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEV  1963
             + LN S+ ILDFVD F WK+G K VHYR SNAGLQAQWLEAWWPSSDDEFAFVVEDDLE+
Sbjct  105   QKLNLSKSILDFVDGFSWKYGEKSVHYRASNAGLQAQWLEAWWPSSDDEFAFVVEDDLEL  164

Query  1962  SPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVG  1783
             SPLYFRFLK+LI NYYYN SNFSPMIYGASLQRPRFVPGKHGNKM+ID RT++FLYQLVG
Sbjct  165   SPLYFRFLKSLIDNYYYNESNFSPMIYGASLQRPRFVPGKHGNKMQIDDRTQLFLYQLVG  224

Query  1782  TWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGY  1603
             TWGQLLFPRPWKEFR+WYDTHK+KG+KP LDGMVTTGWYKKMGE+IWTPWFIKFIHARGY
Sbjct  225   TWGQLLFPRPWKEFRIWYDTHKAKGLKPFLDGMVTTGWYKKMGEKIWTPWFIKFIHARGY  284

Query  1602  FNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCF  1423
             FNIYTNLL+ERA S+SHRDAGVNYGKS GPDS LV E S DIN L+   LHS+KWYDFCF
Sbjct  285   FNIYTNLLHERAFSVSHRDAGVNYGKSAGPDSYLVDEKSFDINLLKMQSLHSLKWYDFCF  344

Query  1422  KQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMG  1243
             K+V P RIV   ++L +V+ S+QK   ++ ++L Q SES++RNLLCHFERL I+NY+L+G
Sbjct  345   KEVSPGRIVLSADDLVTVLHSVQKSRTILFLNLQQVSESIIRNLLCHFERLNIQNYVLLG  404

Query  1242  PKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGF  1063
             P+S  LLDLA RGHPVIDTD+ +D+IR+ +  NF+ES  KL KEI VKA+VV+K+LEL +
Sbjct  405   PQSSFLLDLARRGHPVIDTDQFFDSIRLQNSINFDESHEKLGKEIVVKAHVVRKSLELKY  464

Query  1062  GILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGA  883
                V D + +PL+SDSFL+    D  +DF +GKN +LVF R+S+SA K W +++  ++ A
Sbjct  465   NTWVVDSDVIPLSSDSFLH--SYDLAHDFLLGKNFKLVFIRNSASALKIWVDNVLDKVVA  522

Query  882   ELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQ-EQF  706
              + +  +  S  T  NFV +V+KL EQK   F   DE   SLNIS +DA+ T S   ++F
Sbjct  523   SVASLKTRGSIATEGNFVNLVEKLLEQKKATFNRVDETDFSLNISFMDANETSSRNGKKF  582

Query  705   VFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              FWS E  +  IQ++L +  +W+VDSD+SC AV+C+PS
Sbjct  583   AFWSPEMGSEQIQKRLEEFAMWVVDSDLSCNAVVCHPS  620



>ref|XP_006356375.1| PREDICTED: uncharacterized protein LOC102596128 [Solanum tuberosum]
Length=620

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/579 (65%), Positives = 460/579 (79%), Gaps = 3/579 (1%)
 Frame = -3

Query  2325  TTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDV  2146
              T   +++FTF+IK+L +NRL SLSRCLNSL+ AHYD+H VHLHI+IDHF    N  +++
Sbjct  44    NTPQTHQNFTFLIKVLTFNRLESLSRCLNSLSKAHYDNHVVHLHIYIDHFQDSPNGYVEI  103

Query  2145  DRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLE  1966
             D+ LN S+RILDFVD F WK+G K+VHYR SNAGLQAQWLEAWWPSSDDEFAFVVEDDLE
Sbjct  104   DQKLNLSKRILDFVDGFSWKYGEKLVHYRASNAGLQAQWLEAWWPSSDDEFAFVVEDDLE  163

Query  1965  VSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLV  1786
             +SPLYFRFLK+LI NYYYN SN+SPMIYGASLQRPRFVPGKHGNKM+ID  T++FLYQLV
Sbjct  164   LSPLYFRFLKSLIDNYYYNDSNYSPMIYGASLQRPRFVPGKHGNKMQIDDGTQLFLYQLV  223

Query  1785  GTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARG  1606
             GTWGQLLFP+PWKEFR+WYDTHK+KG+KP LDGMVTTGWYKKMGERIWTPWFIKFIHARG
Sbjct  224   GTWGQLLFPKPWKEFRIWYDTHKAKGLKPFLDGMVTTGWYKKMGERIWTPWFIKFIHARG  283

Query  1605  YFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFC  1426
             YFNIYTNLL+ERA S+SHRDAGVNYGKS GPDS LV E S DIN L+   L S+KWYDFC
Sbjct  284   YFNIYTNLLHERAFSVSHRDAGVNYGKSAGPDSYLVDEKSFDINLLKMQSLQSLKWYDFC  343

Query  1425  FKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILM  1246
             FK+V P RIV+  ++L SV+ S+QK   ++ V+L Q SES++RNLLCHFERL I+NY+L+
Sbjct  344   FKEVSPGRIVRSSDDLASVLHSVQKSRTILFVNLQQVSESIIRNLLCHFERLNIQNYVLL  403

Query  1245  GPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELG  1066
             GP+S  LLDLA RGH VIDTD+L+D+IR+ +  NF+ES  KL KEI VKA+VV+K+LEL 
Sbjct  404   GPQSSFLLDLARRGHHVIDTDQLFDSIRLQNSINFDESHEKLGKEIVVKAHVVRKSLELK  463

Query  1065  FGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLG  886
             +   V D + +PL+SDSFL+    D  NDF +GKN +LVF R+S+ A K W +++  ++ 
Sbjct  464   YNTWVVDGDVIPLSSDSFLD--SYDPANDFLLGKNFKLVFIRNSAFALKFWVDNVLDKVV  521

Query  885   AELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQ-EQ  709
             A + T  +  S  T  NFV +V+KL EQK   F   DE   SLNIS +DA++T S   ++
Sbjct  522   ASVATLKTRGSIATEGNFVNLVEKLLEQKKTTFNRVDETDFSLNISFMDANQTSSRNGKK  581

Query  708   FVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             F FWS E  +  IQ++L +  +W+VDSD+SC AV+C+PS
Sbjct  582   FAFWSPEMGSERIQKRLEEFAMWVVDSDLSCNAVVCHPS  620



>ref|XP_009618754.1| PREDICTED: uncharacterized protein LOC104110901 [Nicotiana tomentosiformis]
Length=621

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/581 (62%), Positives = 454/581 (78%), Gaps = 3/581 (1%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASL  2152
             P      +++FTFIIK+L +NR  SLSRCLNSL+ A YD+H VHLHI+IDHF   +   +
Sbjct  43    PYNNPQTHQNFTFIIKVLTFNRFESLSRCLNSLSKAKYDNHVVHLHIYIDHFQDSSKGYV  102

Query  2151  DVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD  1972
             ++D+ LN +++ILDFVD F W+FG K+VHYRTSNAGLQAQWLE WWPSSDDEFAFVVEDD
Sbjct  103   EIDQRLNLAKKILDFVDGFNWEFGEKLVHYRTSNAGLQAQWLETWWPSSDDEFAFVVEDD  162

Query  1971  LEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQ  1792
             LE+SPLYFRFLK+LI NYY+N SN+SPMIYGASLQRPRFV GKHG KM+ID  T++FLYQ
Sbjct  163   LELSPLYFRFLKSLIENYYFNVSNYSPMIYGASLQRPRFVAGKHGKKMQIDDGTQLFLYQ  222

Query  1791  LVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHA  1612
             LVGTWGQLLFPRPWKEFR+WYDTHKSKG+KPVL+GMVTTGWYKKMGERIWTPWFIKFIHA
Sbjct  223   LVGTWGQLLFPRPWKEFRIWYDTHKSKGLKPVLNGMVTTGWYKKMGERIWTPWFIKFIHA  282

Query  1611  RGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYD  1432
             RGYFNIYTNLL+ERA S+SHRDAGVNYGKS GPDS+LV E   D+  L+   LH++KWYD
Sbjct  283   RGYFNIYTNLLHERAFSVSHRDAGVNYGKSAGPDSSLVDEKFFDLTLLKLQSLHNLKWYD  342

Query  1431  FCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYI  1252
             FCF++VFP R V   ++L  V+ ++Q +  +I V+L Q S+S+ RNLLCHFER  I+NY+
Sbjct  343   FCFREVFPGRTVHSSDDLVPVLHAVQTLKTIIFVNLQQVSDSITRNLLCHFERFNIQNYV  402

Query  1251  LMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLE  1072
             L+GP+SDLLLDLA RG+PVIDTD+ +D+IR+ +  NF++S  KL KEI VKA+V++K+LE
Sbjct  403   LLGPQSDLLLDLARRGYPVIDTDQFFDSIRLQNSINFDKSHEKLGKEIIVKAHVIRKSLE  462

Query  1071  LGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQ  892
             L +   V D + +PL+ DSFL+    D  NDF +GKN +L+F R+SSSA K W + +  +
Sbjct  463   LKYSTWVVDSDVIPLSGDSFLD--SNDPANDFSLGKNFKLIFIRNSSSALKVWVDDVLDK  520

Query  891   LGAELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQ-  715
             + A + +  +  S  TG NFV +V KL EQK   F   DE   SLNIS +D+++T S   
Sbjct  521   VVALVASLKTRGSIATGGNFVNLVGKLLEQKRTAFNRVDETDFSLNISYMDSNQTSSRNG  580

Query  714   EQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             ++F FWS E  +  IQ++L Q  +W+VDSD+SC AV+C+PS
Sbjct  581   KKFAFWSPEIGSETIQKRLEQFAMWVVDSDLSCNAVVCHPS  621



>ref|XP_011090181.1| PREDICTED: uncharacterized protein LOC105170937 [Sesamum indicum]
Length=624

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/582 (62%), Positives = 445/582 (76%), Gaps = 6/582 (1%)
 Frame = -3

Query  2328  ITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYD-HHAVHLHIFIDHFPVPA-NAS  2155
             I +     +FTFIIK+L +NRLSSLSRCLNSL+ AHYD +  VHLH+FIDHF + + N S
Sbjct  46    IQSPEPGPNFTFIIKVLTFNRLSSLSRCLNSLSRAHYDVNDKVHLHVFIDHFLLDSQNGS  105

Query  2154  LDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVED  1975
              D+D  LN S++ILDFVD F WKFG K+VHYRTSNAGLQAQWLEAWWP+SD EFAFVVED
Sbjct  106   ADLDHKLNVSKQILDFVDGFDWKFGEKLVHYRTSNAGLQAQWLEAWWPTSDHEFAFVVED  165

Query  1974  DLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLY  1795
             DLEVSPLY+RFLK +I NYYYNASNFSP IYGASLQRPRFVPGKHGNKM++D   R+FLY
Sbjct  166   DLEVSPLYYRFLKAVISNYYYNASNFSPSIYGASLQRPRFVPGKHGNKMQLDGGARIFLY  225

Query  1794  QLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIH  1615
             QLVGTWGQLLFPRPWKEFRLWYD HK KGMKP LDGMVTTGWY+KMGE+IWTPWFIKFI 
Sbjct  226   QLVGTWGQLLFPRPWKEFRLWYDEHKVKGMKPFLDGMVTTGWYRKMGEKIWTPWFIKFIQ  285

Query  1614  ARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWY  1435
             + GYFNIYTN L+ERALSISHRDAGVNYGK+ GPDS L+ ENSID N LE +PL S+KWY
Sbjct  286   SHGYFNIYTNFLHERALSISHRDAGVNYGKTAGPDSYLLDENSIDSNFLELYPLSSLKWY  345

Query  1434  DFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNY  1255
             DFCF++V  +RIV+  N+LGS++ S+Q+ + V+LVSL++ SE++VRN+LCH ERL IRNY
Sbjct  346   DFCFREVLINRIVKSSNDLGSILQSVQQNNTVVLVSLYRVSETIVRNMLCHLERLNIRNY  405

Query  1254  ILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTL  1075
             IL+GP S  LLDLA RGHPVID  +  +  ++    NF +S V+L KEI VKAY  +K+L
Sbjct  406   ILVGPTSHFLLDLARRGHPVIDASQFSEFSQLAKSINFQDSTVELIKEILVKAYATRKSL  465

Query  1074  ELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISS  895
             ELG+   + D N +P++SDSF++       NDF++GK   L F RSSSS  K W +    
Sbjct  466   ELGYSTWLLDGNMLPISSDSFIDSFGHS--NDFYIGKTAGLFFVRSSSSTLKIWADHFLY  523

Query  894   QLGAELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLS-I  718
              + A L+ T    S       +  V+KL E++ + F   D  +  L+ S++ A++TLS I
Sbjct  524   DV-ASLVDTLRKQSGSNDGMIISAVEKLLEKQKIAFKNIDVMQLGLDASTIHANQTLSHI  582

Query  717   QEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             + +F+FWSS T  ++IQ+QLV L  W+VDSD SCTAVIC+ S
Sbjct  583   KNKFIFWSSGTELDIIQRQLVLLDFWVVDSDSSCTAVICHRS  624



>ref|XP_002280699.1| PREDICTED: uncharacterized protein LOC100259697 [Vitis vinifera]
 emb|CBI36796.3| unnamed protein product [Vitis vinifera]
Length=638

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/591 (60%), Positives = 438/591 (74%), Gaps = 10/591 (2%)
 Frame = -3

Query  2340  LQTPITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPAN  2161
             L   + +     +F+FI+K+L ++RLSSLSRCL SLAAAHY    VHLHI++DHFP   N
Sbjct  50    LNPSLNSIPSPSNFSFILKVLTFDRLSSLSRCLRSLAAAHYGRDTVHLHIYVDHFPHADN  109

Query  2160  ---ASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFA  1990
                + L +D+ L+ SRRIL+F+D F WKFG KVVHYRT N GLQAQWLEAWWPSSD EFA
Sbjct  110   VGKSELLLDQKLDESRRILEFIDGFDWKFGQKVVHYRTGNVGLQAQWLEAWWPSSDHEFA  169

Query  1989  FVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRT  1810
             FVVEDDLEVSPLY++FLK LI NYYYN+SNFSP IYGASLQRPRFVPGKHGNK+++D  T
Sbjct  170   FVVEDDLEVSPLYYKFLKALIQNYYYNSSNFSPSIYGASLQRPRFVPGKHGNKIQLDDET  229

Query  1809  RVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWF  1630
              +FLYQLVGTWGQLLFP+PWKEFRLWYD HK+KG+KP L GMVTTGWYKKMGERIWTPWF
Sbjct  230   HIFLYQLVGTWGQLLFPKPWKEFRLWYDIHKAKGIKPFLQGMVTTGWYKKMGERIWTPWF  289

Query  1629  IKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLH  1450
             I FIH+RGYFNIYTN L+ERALS+SHRDAGVNYGK+ GPDS L+ E+S+DI+ LE  PL 
Sbjct  290   ISFIHSRGYFNIYTNFLHERALSVSHRDAGVNYGKTAGPDSYLLDESSLDIDLLEMQPLT  349

Query  1449  SMKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERL  1270
              +KWYDFCFK+V P  +V+ F ELGSV+ S+QK   +ILVSL   SE V+RNLLCHFE  
Sbjct  350   KLKWYDFCFKEVHPGTVVRSFEELGSVLHSVQKQDTIILVSLFGASERVIRNLLCHFESF  409

Query  1269  YIRNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYV  1090
              I+NYI MG  SD LLDLA RGHPVID D+   ++R +   +  +S +++ K I VKAYV
Sbjct  410   NIQNYIFMGLNSDFLLDLARRGHPVIDVDQFLSSVRAHKMKSLQDSDMEVKKYILVKAYV  469

Query  1089  VKKTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWG  910
             ++K LE G+   V D N + L S  FL+ I  DA  DF  GK  E++F RSSSSA K W 
Sbjct  470   IQKCLESGYNSWVVDGNMLFLRSTPFLDVI--DATYDFHAGKTPEILFIRSSSSARKIWV  527

Query  909   ESISSQ--LGAELITTTSSDSDPT--GKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSL  742
             +    +  L  + +        PT  GK FVY+V +LF+Q+G++    DE    L I S 
Sbjct  528   DDFIHKVALMVDSVLEKGRGRIPTTEGKKFVYIVGELFKQEGMRVKWVDEGSLGLEIDSR  587

Query  741   DASRT-LSIQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +A++T    +++ VFWS E  +++IQ++L +LGLWI+D+D SCTAV+C+ S
Sbjct  588   NANQTSQGNRKKMVFWSPEIGSDMIQKRLEELGLWIIDTDSSCTAVVCHQS  638



>ref|XP_007221823.1| hypothetical protein PRUPE_ppa002963mg [Prunus persica]
 gb|EMJ23022.1| hypothetical protein PRUPE_ppa002963mg [Prunus persica]
Length=617

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/571 (58%), Positives = 435/571 (76%), Gaps = 7/571 (1%)
 Frame = -3

Query  2304  SFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSS  2125
             +FTFI+K+L +NRL S++RCL SLAAA Y    V LH++IDHF +  +AS +V + L  S
Sbjct  54    NFTFIVKVLTFNRLESVARCLRSLAAADYLTDKVQLHVYIDHFAL-GDASSNVGQKLQES  112

Query  2124  RRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFR  1945
              RIL+FVD F WK+G K++HYRT+NAGLQAQWLEAWWPSSD+EFAFVVEDDLEVSPLY++
Sbjct  113   HRILEFVDGFEWKYGDKLIHYRTANAGLQAQWLEAWWPSSDNEFAFVVEDDLEVSPLYYK  172

Query  1944  FLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLL  1765
             FL++LIVNYYYNASN+ P IYGASLQRPRFVPGKHGNK+++D RTR+FLYQLVGTWGQLL
Sbjct  173   FLRSLIVNYYYNASNYRPYIYGASLQRPRFVPGKHGNKIQLDDRTRLFLYQLVGTWGQLL  232

Query  1764  FPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTN  1585
             FP+PWKEFRLWYD HK+KG+KP LDGMVTTGWYKK+GE+IWTPWFIKFIH RGYFNIYTN
Sbjct  233   FPKPWKEFRLWYDNHKAKGIKPFLDGMVTTGWYKKIGEKIWTPWFIKFIHTRGYFNIYTN  292

Query  1584  LLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFPD  1405
              L+ERALS+SHRDAGVNYGK+ GPDS+++ E+S+D    +  PL  ++WYDFCF+++FP+
Sbjct  293   CLHERALSVSHRDAGVNYGKTAGPDSHILDESSLDFGFWDLQPLSDLRWYDFCFREIFPE  352

Query  1404  RIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLL  1225
             R+V + +ELGSV+ S+QK   VI+VSL    E V+RNLLCHFE L + +Y+L+GP+SD L
Sbjct  353   RVVGNLDELGSVLNSVQKQDTVIIVSLFGVPEMVIRNLLCHFESLNLWHYVLIGPESDFL  412

Query  1224  LDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVAD  1045
              +LA RGHPVI TD+   ++  Y   +F +S V++ KE+ VKAYV+KK LE  + I V D
Sbjct  413   FELARRGHPVIGTDQFLRSVGAYKLMSFQDSNVEMIKEVLVKAYVLKKCLESRYNIWVVD  472

Query  1044  CNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITTT  865
              N +P+NSD    FI++D   DF++GK+ EL FAR SSSA    G    S+     +   
Sbjct  473   GNMLPVNSDL---FIESDPSYDFYIGKSSELFFARRSSSARSIGGNDFLSKFA---MMVN  526

Query  864   SSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSSET  685
             S  +     +F Y++ K  EQKGV+    DE    L I + + +++L   +Q VFWSS+ 
Sbjct  527   SLLAKRHSLSFGYIMAKFLEQKGVRVKDLDETSLCLRIGNSNVNQSLGDGKQMVFWSSDM  586

Query  684   STNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +++L+++ L +LG+WIV+ D SC AV+C+ S
Sbjct  587   ASDLLRKGLQELGIWIVNDDFSCKAVVCHKS  617



>ref|XP_008224021.1| PREDICTED: uncharacterized protein LOC103323787 [Prunus mume]
Length=614

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/573 (58%), Positives = 433/573 (76%), Gaps = 7/573 (1%)
 Frame = -3

Query  2310  NKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLN  2131
             N +FTFI+K+L +NRL S++RCL SLAAA Y    V LH++IDHF +  +AS +V + L 
Sbjct  49    NPNFTFIVKVLTFNRLESVARCLRSLAAADYCTDKVQLHVYIDHFAL-GDASSNVGQKLQ  107

Query  2130  SSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLY  1951
              S RIL+FVD F WK+G K++HYRT+NAGLQAQWLEAWWPSSD+EFAFVVEDDLEVSPLY
Sbjct  108   ESHRILEFVDGFEWKYGDKLIHYRTANAGLQAQWLEAWWPSSDNEFAFVVEDDLEVSPLY  167

Query  1950  FRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQ  1771
             ++FL++LIVNYYYNASN+ P IYGASLQRPRFVPGKHGNK+++D RTR+FLYQLVGTWGQ
Sbjct  168   YKFLRSLIVNYYYNASNYRPYIYGASLQRPRFVPGKHGNKIQLDDRTRLFLYQLVGTWGQ  227

Query  1770  LLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIY  1591
             LLFP+PWKEFRLWYD HK+KG+KP LDGMVTTGWYKK+GE+IWTPWFIKFIH RGYFNIY
Sbjct  228   LLFPKPWKEFRLWYDNHKAKGIKPFLDGMVTTGWYKKIGEKIWTPWFIKFIHTRGYFNIY  287

Query  1590  TNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVF  1411
             TN L+ERALS+SHRDAGVNYGK+ GPDS+++ E+S+D    +  PL  ++WYDFCF+++F
Sbjct  288   TNFLHERALSVSHRDAGVNYGKTAGPDSHILDESSLDFGVWDMQPLSDLRWYDFCFREIF  347

Query  1410  PDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSD  1231
             P+R+V   +ELGSV+ S+QK   VI+VSL    E V+RNLLCHFE L + +Y+L+G +SD
Sbjct  348   PERVVGSLDELGSVLNSVQKQDTVIIVSLFGVPEMVIRNLLCHFESLNLWHYVLIGSESD  407

Query  1230  LLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILV  1051
              L DLA RGHPVI TD+   ++  Y   +F +S V++ KE+ VKAY +KK LE  + I V
Sbjct  408   FLFDLARRGHPVIGTDQFLRSVGAYKLMSFQDSNVEMIKEVLVKAYALKKCLESRYNIWV  467

Query  1050  ADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELIT  871
              D N +P+NSD    FI++    DF++GK+ EL FAR SSSA    G    S+     + 
Sbjct  468   VDGNMLPVNSDL---FIESHPSYDFYIGKSSELFFARRSSSARSIGGNDFISKFA---MM  521

Query  870   TTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSS  691
               S  +     +F Y++ K  EQKGV+    DE    L I + + +++L   +Q VFWSS
Sbjct  522   VNSLLAKRHSLSFGYIMAKFLEQKGVRVKNLDETNLGLRIGNGNVNQSLGDGKQMVFWSS  581

Query  690   ETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             + +++L+Q++L +LG+WIV+ D SC AV+C+ S
Sbjct  582   DMASDLLQKRLQELGIWIVNDDFSCKAVVCHKS  614



>emb|CDP09650.1| unnamed protein product [Coffea canephora]
Length=642

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/573 (60%), Positives = 436/573 (76%), Gaps = 6/573 (1%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHYDHHA-VHLHIFIDHFPVPAN-ASLDVDRNLNS  2128
             FT IIK+L +NRL SLSRCL SL+ AHYD+   VHLHIFIDHFP+  +  S D+D  LN 
Sbjct  73    FTLIIKVLTFNRLPSLSRCLTSLSNAHYDNSTTVHLHIFIDHFPLENDKGSQDLDSKLNL  132

Query  2127  SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYF  1948
             SR+ILDFVD F W FG K+VHYR  NAGLQ+QWLEAWWPSSD EFAFVVEDDLEVSPLYF
Sbjct  133   SRQILDFVDGFKWDFGEKLVHYRNWNAGLQSQWLEAWWPSSDHEFAFVVEDDLEVSPLYF  192

Query  1947  RFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQL  1768
             R+LK LI+NYYYN SNFSPMIYGASLQRPRFVPGKHGNK++ D+++R+FLYQLVGTWGQL
Sbjct  193   RYLKALILNYYYNESNFSPMIYGASLQRPRFVPGKHGNKLQADNQSRLFLYQLVGTWGQL  252

Query  1767  LFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYT  1588
             LFP+PWKEFRLWYDTHK KG+KP+LDGMVTTGWYK+MGERIWTPWFIKFIHARGYFNIYT
Sbjct  253   LFPKPWKEFRLWYDTHKVKGIKPILDGMVTTGWYKRMGERIWTPWFIKFIHARGYFNIYT  312

Query  1587  NLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFP  1408
             NL  E AL++SHRDAGVNYGKS GPDS LVGE +I  + LE  P  S+KWYDFCF++V P
Sbjct  313   NLKNETALAVSHRDAGVNYGKSAGPDSYLVGEKTIS-DLLELQPSSSLKWYDFCFREVIP  371

Query  1407  DRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDL  1228
             +RIV+   +LG V+ S+Q+++ +ILV+LH  SE  +RNL+CHFERL I NYI +G KS L
Sbjct  372   NRIVKSLEQLGFVLQSIQRLNTIILVNLHGASEPALRNLICHFERLAIGNYIFVGQKSYL  431

Query  1227  LLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVA  1048
              LDLA RGHPVID D++  + ++Y    F ES+ +  + I   A V+KK+LEL +   + 
Sbjct  432   SLDLARRGHPVIDVDQILRSTKLYRSLKFQESSKEWIQNIRACASVIKKSLELQYHTWLL  491

Query  1047  DCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITT  868
             D N VPL+S+ F  F   D   DF  GKNL+L+F +SSS++++ W +    +L     + 
Sbjct  492   DNNIVPLSSNFF--FESPDPACDFITGKNLKLLFIKSSSASSRFWVDVFMHKLTVITGSW  549

Query  867   TSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRT-LSIQEQFVFWSS  691
                 SD    NF+  V+K+ E   VK++  DE +  L+I++ D++ T L+  ++F FWSS
Sbjct  550   GPKTSDSMAVNFLSSVEKILESYRVKYSKIDEMQLGLSINTSDSNLTSLANGKKFAFWSS  609

Query  690   ETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +T    +Q++LV+LG+W+VD ++SCTAV+C+ S
Sbjct  610   DTDQERVQKKLVELGMWVVDDELSCTAVVCHQS  642



>ref|XP_004308621.1| PREDICTED: uncharacterized protein LOC101311809 [Fragaria vesca 
subsp. vesca]
Length=612

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/572 (59%), Positives = 431/572 (75%), Gaps = 9/572 (2%)
 Frame = -3

Query  2304  SFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSS  2125
             SFTF+IKLLA+NRL SLSRCL SLAAA Y    VHLH+ IDHF +P ++  D DR L+ S
Sbjct  49    SFTFVIKLLAFNRLDSLSRCLRSLAAADYLSDRVHLHLHIDHFALPDSS--DADRQLHES  106

Query  2124  RRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFR  1945
             RRILD VD F W FG KVVHYRT NAGLQAQWLEAWWPSSD EFAFVVEDD+EVSPLY++
Sbjct  107   RRILDVVDGFRWSFGEKVVHYRTQNAGLQAQWLEAWWPSSDHEFAFVVEDDVEVSPLYYK  166

Query  1944  FLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLL  1765
             FL+NLI+NYYYNASN  P IYGASLQRPRFVPGKHGNK+++D+RTR+FLYQLVGTWGQLL
Sbjct  167   FLRNLILNYYYNASNSRPYIYGASLQRPRFVPGKHGNKLQLDNRTRLFLYQLVGTWGQLL  226

Query  1764  FPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTN  1585
             FP+PWKEFRLWYD HK+KG+KP+L+GMVTTGWYKKM E+IWTPWFIKFIH RGYFNIYTN
Sbjct  227   FPKPWKEFRLWYDEHKAKGIKPILNGMVTTGWYKKMEEKIWTPWFIKFIHTRGYFNIYTN  286

Query  1584  LLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFPD  1405
              L+ERALS+SHRDAGVNYGK+VGPDS+++ E+S+D+   +  PL  +KWYDFCF+++FP+
Sbjct  287   FLHERALSVSHRDAGVNYGKTVGPDSHILDESSLDLKFWDMQPLSDLKWYDFCFREIFPE  346

Query  1404  RIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLL  1225
             R+V + +EL S++ S+QK ++VI+V+L    E V+RNLLCHFE L + NYIL+GP+S+L+
Sbjct  347   RVVVNLDELASILDSVQKHNSVIIVNLFGAKEMVIRNLLCHFETLNLLNYILIGPESELM  406

Query  1224  LDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVAD  1045
              DL+ RGHPVI T+   +++  +   +   S V+   EI VK YV++K L+ G+   V D
Sbjct  407   FDLSRRGHPVIATNHFLESVGAHKLISMQHSQVQKIDEILVKIYVLEKCLKSGYSSWVVD  466

Query  1044  CNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITTT  865
              N +P++SD+   F+D D    F++GK  EL FAR SSSA K W   I ++     +   
Sbjct  467   GNMLPVSSDA---FVDYDPSYGFYIGKTSELFFARRSSSARKVWDNDIITKFA---VVVN  520

Query  864   SSDSDPTGKNFVYVVKKLFEQ-KGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSSE  688
             S        NFV V+ ++ EQ KGV+    DE   +L I +   +++L   +Q  FWS++
Sbjct  521   SLLVKQQSINFVNVMAQILEQDKGVRVKYLDETSFALRIDNSKVNQSLGDGKQVAFWSND  580

Query  687   TSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              ++NL+Q +L +LG WIVD D SC AVIC+ S
Sbjct  581   MASNLVQHRLQELGAWIVDDDYSCKAVICHQS  612



>ref|XP_010096128.1| hypothetical protein L484_002619 [Morus notabilis]
 gb|EXB63370.1| hypothetical protein L484_002619 [Morus notabilis]
Length=611

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/574 (59%), Positives = 426/574 (74%), Gaps = 12/574 (2%)
 Frame = -3

Query  2307  KSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNS  2128
             + FTFI+K+LA+NRL SL+RCL SLAAA Y    VHLHI +DHF    N S +VDR L  
Sbjct  48    REFTFIVKVLAFNRLDSLTRCLRSLAAADYLSDRVHLHIHVDHF----NGSAEVDRKLGE  103

Query  2127  SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYF  1948
             S RIL+FVD F WKFG K+VHYRT NAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSP Y+
Sbjct  104   SHRILEFVDGFDWKFGEKIVHYRTQNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPFYY  163

Query  1947  RFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQL  1768
             +FL++LI+NYYYN +NF P IYGASLQRPRFVPGKHGNKM++DS TR+FLYQLVGTWGQL
Sbjct  164   KFLRSLILNYYYNDANFRPYIYGASLQRPRFVPGKHGNKMQLDSGTRLFLYQLVGTWGQL  223

Query  1767  LFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYT  1588
             LFP+PWKEFRLWYD HK+KG+KP LDGMVTTGWYKKMGERIWTPWFIKFIH+RGY+N YT
Sbjct  224   LFPKPWKEFRLWYDDHKAKGIKPFLDGMVTTGWYKKMGERIWTPWFIKFIHSRGYYNFYT  283

Query  1587  NLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFP  1408
             NLL+ERALS+SHRDAGVNYGK+ GPDS+L+ ENS+D + LE  PL ++KWYDFCF++V P
Sbjct  284   NLLHERALSVSHRDAGVNYGKTAGPDSHLLDENSLDFDLLEMWPLSNLKWYDFCFREVLP  343

Query  1407  DRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDL  1228
             +R+V+ F+ELGSV+ S+QK   +ILVSL+   E V RNLLC+FE+L I N I +GP+SD 
Sbjct  344   ERVVRRFDELGSVLHSVQKQETIILVSLYGVPEMVTRNLLCNFEKLNIWNCIFIGPESDF  403

Query  1227  LLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVA  1048
             LL+L  +GHPVI  D    ++      +  +S  +L   I VKAYV+KK +E G+  LV 
Sbjct  404   LLELVRKGHPVIIGDLFLRSVVPPKMMDIQDSHTELMHTILVKAYVIKKCIEFGYSSLVM  463

Query  1047  DCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITT  868
             + N + +    +L F   D  +DFF GK+ +L F RSS+SA K W +   S +    IT 
Sbjct  464   EGNMLLVGRYPYLEF---DHNSDFFAGKSSDLFFIRSSTSARKIWVDKFISDVA---ITV  517

Query  867   TSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSI--QEQFVFWS  694
              S  S+    +FV+VV  L  QKGV     DE    ++I+S       S+   ++ VFWS
Sbjct  518   NSLVSEKETTSFVHVVANLLVQKGVTIKRVDETSFGVDIASSGNVNQFSLGTGKKIVFWS  577

Query  693   SETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              +  ++L++++L +LGLW+VD D+SC AV+C+ S
Sbjct  578   RKIGSDLVRKRLEELGLWMVDDDLSCKAVVCHQS  611



>ref|XP_009341617.1| PREDICTED: uncharacterized protein LOC103933650 isoform X2 [Pyrus 
x bretschneideri]
Length=608

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/573 (57%), Positives = 429/573 (75%), Gaps = 14/573 (2%)
 Frame = -3

Query  2310  NKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLN  2131
             N +FTFIIK+LA+NRL S++RCL+SLAAA+Y    VHLH+++DHF +  +   ++D+ L 
Sbjct  50    NPNFTFIIKVLAFNRLDSVARCLHSLAAANYLTDEVHLHVYVDHFAL-GDPPSNIDQKLQ  108

Query  2130  SSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLY  1951
              S  IL+FVD F WKFG K+VHYRT+N GLQAQWLEAWWPS+D+EFAFVVEDDLEVSPLY
Sbjct  109   ESHHILEFVDGFEWKFGNKLVHYRTANVGLQAQWLEAWWPSTDNEFAFVVEDDLEVSPLY  168

Query  1950  FRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQ  1771
             ++FL++LIVNYYYNASN+ P IYGASLQRPRFVPGKHGNK+++D RTR+FLYQLVGTWGQ
Sbjct  169   YKFLRSLIVNYYYNASNYRPYIYGASLQRPRFVPGKHGNKLQLDDRTRLFLYQLVGTWGQ  228

Query  1770  LLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIY  1591
             LLFP+PWKEFR+WYD HK+KG+KP LDGMVTTGWYKKMGE+IWTPWFIKFIH RGYFNIY
Sbjct  229   LLFPKPWKEFRMWYDDHKAKGIKPFLDGMVTTGWYKKMGEKIWTPWFIKFIHTRGYFNIY  288

Query  1590  TNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVF  1411
             TN L+ERALS+SHRDAGVNYGK+ GPDS+++ ++ +D +  +  PL  +KWYDFCF++ F
Sbjct  289   TNFLHERALSVSHRDAGVNYGKTAGPDSHILDKSYLDSDFWDMQPLSDLKWYDFCFREKF  348

Query  1410  PDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSD  1231
             PDR+V   +ELGSV+ S+QK   VI+VSL   SE  VRNLLCHFE L I NY+L+GP+SD
Sbjct  349   PDRVVGSLDELGSVLNSVQKHDTVIIVSLFGVSELAVRNLLCHFESLNIWNYVLIGPESD  408

Query  1230  LLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILV  1051
              + DLA RGHPVI T++   ++  Y   +  +S V++     +K YV++K LE G+   V
Sbjct  409   FVFDLARRGHPVIGTNQFLKSVGAYKLMSLQDSYVEM-----IKVYVLRKCLESGYNAWV  463

Query  1050  ADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELIT  871
              D N +PL+SD    F+++D   DF+VGK+ EL FAR  S A    G+   S+      T
Sbjct  464   VDGNMLPLSSDL---FVESDPSYDFYVGKSSELFFAR-KSFAQNIGGDDFISKFA----T  515

Query  870   TTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSS  691
               +S       +F Y++ KL E+KGVK  + DE    L I + + + +L   +Q VFWSS
Sbjct  516   MANSLLVRQSISFGYIMAKLLEEKGVKVKSLDETSFGLMIVNSNVNESLVDGKQMVFWSS  575

Query  690   ETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             + +++L+Q++L + G+W V+ D+SC AV+C  S
Sbjct  576   DMASDLVQKRLQEFGVWTVNDDLSCKAVVCQQS  608



>ref|XP_009341616.1| PREDICTED: uncharacterized protein LOC103933650 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009341618.1| PREDICTED: uncharacterized protein LOC103933650 isoform X1 [Pyrus 
x bretschneideri]
Length=608

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/573 (57%), Positives = 428/573 (75%), Gaps = 14/573 (2%)
 Frame = -3

Query  2310  NKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLN  2131
             N +FTFIIK+LA+NRL S++RCL+SLAAA+Y    VHLH+++DHF +  +   ++D+ L 
Sbjct  50    NPNFTFIIKVLAFNRLDSVARCLHSLAAANYLTDEVHLHVYVDHFAL-GDPPSNIDQKLQ  108

Query  2130  SSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLY  1951
              S  IL+FVD F WKFG K+VHYRT+N GLQAQWLEAWWPS+D+EFAFVVEDDLEVSPLY
Sbjct  109   ESHHILEFVDGFEWKFGNKLVHYRTANVGLQAQWLEAWWPSTDNEFAFVVEDDLEVSPLY  168

Query  1950  FRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQ  1771
             ++FL++LIVNYYYNASN+ P IYGASLQRPRFVPGKHGNK+++D RTR+FLYQLVGTWGQ
Sbjct  169   YKFLRSLIVNYYYNASNYRPYIYGASLQRPRFVPGKHGNKLQLDDRTRLFLYQLVGTWGQ  228

Query  1770  LLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIY  1591
             LLFP+PWKEFR+WYD HK+KG+KP LDGMVTTGWYKKMGE+IWTPWFIKFIH RGYFNIY
Sbjct  229   LLFPKPWKEFRMWYDDHKAKGIKPFLDGMVTTGWYKKMGEKIWTPWFIKFIHTRGYFNIY  288

Query  1590  TNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVF  1411
             TN L+ERALS+SHRDAGVNYGK+ GPDS+++ ++ +D +  +  PL  +KWYDFCF++ F
Sbjct  289   TNFLHERALSVSHRDAGVNYGKTAGPDSHILDKSYLDSDFWDMQPLSDLKWYDFCFREKF  348

Query  1410  PDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSD  1231
             PDR+V   +ELGSV+ S+QK   VI+VSL   SE  VRNLLCHFE L I NY+L+GP+SD
Sbjct  349   PDRVVGSLDELGSVLNSVQKHDTVIIVSLFGVSELAVRNLLCHFESLNIWNYVLIGPESD  408

Query  1230  LLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILV  1051
              + DLA RGHPVI T++   ++  Y   +   S V++     +K YV+KK LE G+   V
Sbjct  409   FVFDLARRGHPVIGTNQFLKSVGAYKLMSLQGSYVEM-----IKVYVLKKCLESGYNAWV  463

Query  1050  ADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELIT  871
              D N +PL+SD    F+++D   DF+VGK+ EL FAR  S A    G+   S+      T
Sbjct  464   VDGNMLPLSSDL---FVESDPSYDFYVGKSSELFFAR-KSFAQNIGGDDFISKFA----T  515

Query  870   TTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSS  691
               +S       +F Y++ KL E+KGVK  + DE    L I + + + +L   +Q VFWSS
Sbjct  516   MANSLLVRQSISFGYIMAKLLEEKGVKVKSLDETSFGLMIVNSNVNESLVDGKQMVFWSS  575

Query  690   ETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             + +++L+Q++L + G+W V+ D+SC AV+C  S
Sbjct  576   DMASDLVQKRLQEFGVWTVNDDLSCKAVVCQQS  608



>ref|XP_002523548.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF38887.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=624

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/574 (56%), Positives = 420/574 (73%), Gaps = 9/574 (2%)
 Frame = -3

Query  2310  NKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDV-DRNL  2134
             N SFTF+IK+LA+NRL SLSRCL SLA A+Y+   VHLH++IDHFP  AN S +V D+ L
Sbjct  59    NPSFTFLIKVLAFNRLDSLSRCLQSLANANYEGDTVHLHVYIDHFPF-ANDSFNVLDQKL  117

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
               + ++L++VD F W FG KVVHYRTSN GLQAQWLEAWWPSS++EFAFVVEDDLEVSPL
Sbjct  118   EETHKMLEYVDGFHWNFGNKVVHYRTSNVGLQAQWLEAWWPSSNNEFAFVVEDDLEVSPL  177

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             +++F+K +IVNYYYN +  SP IYG SLQRPRFVPGKHGNK+++D  TR+FLYQLVGTWG
Sbjct  178   FYKFVKAVIVNYYYNVTGSSPSIYGVSLQRPRFVPGKHGNKIQLDPGTRLFLYQLVGTWG  237

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             Q++FP+PWKEFRLWYD HKSKG+KP LDGMVT GWYK++GERIWTPWFIKF+H+ GYFNI
Sbjct  238   QIIFPKPWKEFRLWYDKHKSKGIKPFLDGMVTNGWYKRLGERIWTPWFIKFVHSNGYFNI  297

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTNL +ERALS+SHRDAGVNYGK+ GPDS LV E+S D N LE  PL ++KWYDFCF++V
Sbjct  298   YTNLGHERALSVSHRDAGVNYGKTAGPDSQLVDESSFDYNFLEMQPLSNLKWYDFCFREV  357

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+ ++ ++LGS++PS+QK   ++LVS+   S+ + RNLLCH ERL I+NYI+MGP S
Sbjct  358   LPGRVARNMDDLGSLLPSVQKQQTILLVSMFGTSDEITRNLLCHLERLNIQNYIIMGPSS  417

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             D L DLA RGHP++D D+L +++R      F     K   ++ VK YV+KK LE  +   
Sbjct  418   DFLYDLARRGHPIVDADQLLESLRSQKLIGFRNPNSKQV-DVLVKGYVIKKCLE-HYNSW  475

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             + D N + +N D F  F+   A ND + GK  E+ F R SSSA K W +   +++G  + 
Sbjct  476   MVDTNMLLVNDDLFHGFV--GASNDMYAGKRSEIFFVRGSSSARKIWTDDFVNKVGTAVD  533

Query  873   TTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWS  694
               +SS      +NFVY V KL EQ G++    DE    + I +   +R+     + ++WS
Sbjct  534   QASSSGG---SRNFVYAVSKLLEQNGIRINWIDETSFGMKIGADSINRSSLEAGKMIYWS  590

Query  693   SETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +E   NL+Q++L +L +W +D D SC AVIC+ S
Sbjct  591   AEMGLNLVQKRLEELDMWAIDGDSSCKAVICHQS  624



>ref|XP_003528735.1| PREDICTED: uncharacterized protein LOC100775691 [Glycine max]
Length=617

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/583 (59%), Positives = 424/583 (73%), Gaps = 13/583 (2%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASL  2152
             PI T + + +FTF+IK+LA+NRL++LSRCL SLAAAHY    VHLH+ IDHF  P NAS 
Sbjct  45    PIRTQS-SPNFTFVIKVLAFNRLAALSRCLRSLAAAHYLADRVHLHLHIDHF-APDNAS-  101

Query  2151  DVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD  1972
              VD  L  + +IL+FVD F WKFG KVVHYRT N GLQAQWLEAWWPSSD EFAFVVEDD
Sbjct  102   HVDPKLREAHQILEFVDGFDWKFGEKVVHYRTGNVGLQAQWLEAWWPSSDHEFAFVVEDD  161

Query  1971  LEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQ  1792
             LEVSPLY+ F+K LI+N+YYNASN+SP I+G SLQR RFVPGKHGNK+++D +TR+FLYQ
Sbjct  162   LEVSPLYYEFVKALIMNFYYNASNYSPSIFGVSLQRARFVPGKHGNKLQLDDQTRLFLYQ  221

Query  1791  LVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHA  1612
             LVGTWGQ+LFP+PWKEFRLWYD +K+KG KP L+GMVTTGWYKKMGERIWTPWFIKFI +
Sbjct  222   LVGTWGQILFPKPWKEFRLWYDENKAKGNKPFLEGMVTTGWYKKMGERIWTPWFIKFIQS  281

Query  1611  RGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYD  1432
             RGYFNIYTNLL+ERALS+SHRDAGVNYGK+ GPDS L+ E S+D N LE  PL S++WYD
Sbjct  282   RGYFNIYTNLLHERALSVSHRDAGVNYGKTAGPDSKLLEEKSLDFNILEVQPLRSLRWYD  341

Query  1431  FCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYI  1252
             FCF++V P ++  +  ELGS++ SLQK  +V LV+L   S+++ RNLLCHFERL IRNYI
Sbjct  342   FCFREVHPGKVATNLEELGSLLHSLQKQDSVFLVNLFGVSDAISRNLLCHFERLDIRNYI  401

Query  1251  LMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLT--KEIFVKAYVVKKT  1078
             LMGP SD L DLA RGHPVI+ D+   ++ +   S F    +     K I  K Y +KK 
Sbjct  402   LMGPPSDSLFDLARRGHPVINVDKFISSVGL---SKFTSQGLSFETIKGILAKTYAIKKC  458

Query  1077  LELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESIS  898
             +E  +   V D + + L SD FL+    D+  DFFV  NLEL +A+SSSS+ K W +   
Sbjct  459   IENRYNTWVMDGSML-LTSDLFLS-ESEDSNGDFFVANNLELFYAKSSSSSQKIWVDGFV  516

Query  897   SQLGAELITTTSSDSDPTGK-NFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLS  721
             S++ A   +    DS   G  +FVYVV KL EQ G +    DEN  +  I S   S T  
Sbjct  517   SKVVAMAESLAGKDSATHGSLSFVYVVIKLLEQNGARIRRVDENSFATKIGS--GSETSL  574

Query  720   IQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
               ++ V+WSSE   N IQ+ L +  LW +DSD+SCTAV+C+ S
Sbjct  575   RDKKLVYWSSEMELNSIQKWLDEFNLWSIDSDLSCTAVVCHKS  617



>ref|XP_008366121.1| PREDICTED: uncharacterized protein LOC103429768 [Malus domestica]
Length=596

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/573 (57%), Positives = 428/573 (75%), Gaps = 18/573 (3%)
 Frame = -3

Query  2310  NKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLN  2131
             N +FTFIIK+LA+NRL S++RCL SLAAA+Y    VH+H+++DHF +  +   ++D+ L 
Sbjct  40    NPNFTFIIKVLAFNRLDSVARCLRSLAAANYLTDEVHIHVYVDHFAL-GDPPSNIDQKLQ  98

Query  2130  SSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLY  1951
              S RIL+FVD F WKFG K+VHYRT+N GLQAQWLEAWWPSS++EFAFVVEDDLEVSPLY
Sbjct  99    ESHRILEFVDGFEWKFGNKLVHYRTANVGLQAQWLEAWWPSSNNEFAFVVEDDLEVSPLY  158

Query  1950  FRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQ  1771
             ++FL++LIVNYYYNASN+ P IYGASLQRPRFVPGKHGNK+++D RTR+FLYQLVGTWGQ
Sbjct  159   YKFLRSLIVNYYYNASNYRPYIYGASLQRPRFVPGKHGNKLQMDDRTRLFLYQLVGTWGQ  218

Query  1770  LLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIY  1591
             LLFP+PWKEFR+WYD HK+ G+KP LDGMVTTGWYKKMGE+IWTPWFIKFIH RGYFNIY
Sbjct  219   LLFPKPWKEFRMWYDDHKAXGIKPFLDGMVTTGWYKKMGEKIWTPWFIKFIHTRGYFNIY  278

Query  1590  TNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVF  1411
             TN L+ERALS+SHRDAGVNYGK+ GPDS+++ ++S+D +  +  PL  +KWYDFCF++  
Sbjct  279   TNFLHERALSVSHRDAGVNYGKTXGPDSHILDKSSLDSDFWDMQPLSDLKWYDFCFREKL  338

Query  1410  PDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSD  1231
             PDR+V   +ELGSV+ S+QK   VI+VSL   SE  VRNLLCHFE L I NY+L+GP+SD
Sbjct  339   PDRVVGSLDELGSVLNSVQKHDTVIIVSLFGVSELAVRNLLCHFESLNIWNYVLIGPESD  398

Query  1230  LLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILV  1051
             L+ DLA RGHPVI T++   ++  Y   +  +S V++     +K YV+KK LE G+   V
Sbjct  399   LVFDLARRGHPVIGTNQFLKSVGAYKLMSLQDSYVEM-----IKVYVLKKCLESGYNAWV  453

Query  1050  ADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLG--AEL  877
              D N +PL+SD    F+++D   DF++GK+ EL FAR  S A    G+   S+    A  
Sbjct  454   VDGNMLPLSSDL---FVESDLSYDFYIGKSSELFFAR-RSFAQNIGGDDFISKFATMANA  509

Query  876   ITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFW  697
             +    S S      F Y++ KL E+KGVK  + +E    L I + + + +L   +Q VFW
Sbjct  510   LLVRQSIS------FGYIMAKLLEEKGVKVKSLNETSFGLMIGNSNVNESLGDGKQMVFW  563

Query  696   SSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
             SS+ +++L+ ++L + G+W V+ D+SC AV+C+
Sbjct  564   SSDMASDLVHKRLQEFGIWTVNDDLSCKAVVCH  596



>ref|XP_002314015.1| hypothetical protein POPTR_0009s07130g [Populus trichocarpa]
 gb|EEE87970.1| hypothetical protein POPTR_0009s07130g [Populus trichocarpa]
Length=617

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/588 (56%), Positives = 433/588 (74%), Gaps = 19/588 (3%)
 Frame = -3

Query  2340  LQTPITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPAN  2161
             ++ PI   A  ++FT +IK+LA+NRL SLSRCLNSL++A+Y    VHLHI IDHF +  N
Sbjct  44    IKAPIARFAP-QNFTLLIKVLAFNRLDSLSRCLNSLSSANYGGDTVHLHIHIDHFAL-TN  101

Query  2160  ASLDV-DRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
              SL+V D+ L  SR++L+FVD F WKFG KVVHYRT+N GLQAQWLEAWWPSSD EF+F+
Sbjct  102   ESLNVIDKKLEESRKVLNFVDGFDWKFGNKVVHYRTNNVGLQAQWLEAWWPSSDHEFSFI  161

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRV  1804
             VEDD+EVSPL+++F++ LIVNYYYN SNFSP IYGASLQRPRFVPGKHGNK+++DS T +
Sbjct  162   VEDDVEVSPLFYKFVRGLIVNYYYNVSNFSPFIYGASLQRPRFVPGKHGNKIQLDSETHL  221

Query  1803  FLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIK  1624
             FLYQLVGTWGQ+LFP+PWKEFRLWYD HKSKG+KP+LDGMVT GWYK++GERIWTPWFIK
Sbjct  222   FLYQLVGTWGQILFPKPWKEFRLWYDLHKSKGIKPLLDGMVTNGWYKRIGERIWTPWFIK  281

Query  1623  FIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSM  1444
             FIH+RGYFNIYTN  +ERALS+SHRDAGVNYGK+ GPDS L+  +S+D N LE  PL ++
Sbjct  282   FIHSRGYFNIYTNFQHERALSVSHRDAGVNYGKTAGPDSQLLDGSSLDFNLLEMQPLSNL  341

Query  1443  KWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYI  1264
             KWYD+CF++V P R+ +  +E+GS++ ++Q+  +V+LV++   S+++ RN+LCHFERL I
Sbjct  342   KWYDYCFREVLPGRVGRTLDEVGSILRTVQEDQSVLLVNIFGASDTITRNMLCHFERLNI  401

Query  1263  RNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVK  1084
             RNYIL+GP SD L DLA RGHPVID D+ ++  R      F  S+ +L K I V AYV+K
Sbjct  402   RNYILIGPGSDFLFDLARRGHPVIDADQFFNYHRAQKVMGFQHSSAELMKNILVNAYVIK  461

Query  1083  KTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGES  904
             K LE G+  L+ D N + L+      FI  D  NDF+ GK+L   F +SSSSA + W   
Sbjct  462   KCLENGYDSLIVDANMLVLSKVQ--EFI--DPANDFYAGKSLGFFFVKSSSSAQEIWAGL  517

Query  903   ISSQLGAELITTTSSDSDPTGKN--FVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASR  730
             +        +  T  +    G+N  FVY+V KL EQ GV+    DE    + I + D S 
Sbjct  518   LKK------VAVTKGNVLFQGENTDFVYLV-KLLEQNGVRIHRVDEASVGIQIHA-DTSN  569

Query  729   TLSIQ--EQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
               S++  ++  +W + T  +LIQ++L +L LW+VD D SC+AV+C+ S
Sbjct  570   QSSLEAGKKMAYWFAGTGVDLIQKRLQELSLWVVDGDSSCSAVVCHQS  617



>ref|XP_011025008.1| PREDICTED: uncharacterized protein LOC105126008 isoform X2 [Populus 
euphratica]
Length=614

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/577 (57%), Positives = 423/577 (73%), Gaps = 21/577 (4%)
 Frame = -3

Query  2307  KSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNS  2128
             + FTF+IK+LA+NRL SLSRCLNSL+AA+Y    VHLHI IDHF +   +   +D+ L  
Sbjct  54    QDFTFLIKVLAFNRLDSLSRCLNSLSAANYGGDTVHLHIHIDHFALTNESINVIDKKLED  113

Query  2127  SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYF  1948
             SR++L+F+D F WKFG KVVHYRT+N GLQAQWLEAWWPSSD EFAF+VEDDLEVSPL++
Sbjct  114   SRKVLNFIDGFDWKFGNKVVHYRTNNVGLQAQWLEAWWPSSDHEFAFIVEDDLEVSPLFY  173

Query  1947  RFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQL  1768
             +F++ LIVNYYYNASNFSP +YGASLQRPRFVPGKHGNK+ +DS TR+FLYQLVGTWGQ+
Sbjct  174   KFVRGLIVNYYYNASNFSPSVYGASLQRPRFVPGKHGNKIHLDSETRLFLYQLVGTWGQI  233

Query  1767  LFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYT  1588
             LFP+PWKEFRLWYD HKSKG+KP LDGMVT GWYK+MGERIWTPWFIKFI++R YFNIYT
Sbjct  234   LFPKPWKEFRLWYDLHKSKGIKPFLDGMVTNGWYKRMGERIWTPWFIKFIYSRSYFNIYT  293

Query  1587  NLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFP  1408
             N  +ERALS+SHRDAGVNYGK+ GPDS L+  +S+D N LE  PL ++KWYD+CF++V  
Sbjct  294   NFQHERALSVSHRDAGVNYGKTAGPDSQLLDGSSLDFNLLEMQPLSNLKWYDYCFREVLS  353

Query  1407  DRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDL  1228
              RI +  +E+GS++ ++QK  +V+LVS+  +S ++ RN+LCH ERL IRNYIL+GP SD 
Sbjct  354   GRIARTLDEVGSILRTVQKDQSVLLVSIFGKSGTITRNMLCHLERLNIRNYILIGPGSDF  413

Query  1227  LLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVA  1048
             L DLA RGHPVID D+ ++ +R      F  S+ +L K + V AYV+KK LE G+  L  
Sbjct  414   LFDLARRGHPVIDADQFFNYLRAQRVMGFQHSSAELMKNVLVNAYVIKKCLEDGYDSLTV  473

Query  1047  DCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGE---SISSQLGAEL  877
             D N +      FL FI+  +  D   GK+L   + RSS SA + W +    +++ +G  L
Sbjct  474   DANVL------FLKFINPSS--DLCAGKSLGFFYVRSSFSAQEIWADLLKKVAAIIGKGL  525

Query  876   ITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQ--EQFV  703
             +   S+       NFVY V K  EQ G      DE    + I  ++A    S++  ++ V
Sbjct  526   LQGEST-------NFVYFVVKFLEQNGAGILRVDEASIGIKI-GVNAFNQSSVEAGKKMV  577

Query  702   FWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +WS++TS +LIQ++L +L LW+VD D SCTAV+C+ S
Sbjct  578   YWSTDTSLDLIQRRLQELSLWVVDGDSSCTAVVCHES  614



>gb|KGN48074.1| hypothetical protein Csa_6G428550 [Cucumis sativus]
Length=618

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/575 (57%), Positives = 414/575 (72%), Gaps = 9/575 (2%)
 Frame = -3

Query  2322  TTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVD  2143
             T      FT I+K+LAYNRL S+SRCL S+A A Y    VHLH++IDH+P     + D  
Sbjct  49    TDPKTSGFTLIVKVLAYNRLDSVSRCLRSIANADYLSDRVHLHVYIDHYP-----NDDAH  103

Query  2142  RNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEV  1963
               LN S RIL FVD F W FG K+VHYRT N GLQAQWLEAWWPSSD+EFAFVVEDDLE+
Sbjct  104   IKLNESHRILQFVDQFAWNFGEKIVHYRTGNVGLQAQWLEAWWPSSDNEFAFVVEDDLEL  163

Query  1962  SPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVG  1783
             SPLY++FL++LIVNYYYN SN+ P IYGASLQRPRFVPGKHGNK+K+D  TR+FLYQ+VG
Sbjct  164   SPLYYKFLRSLIVNYYYNTSNYDPSIYGASLQRPRFVPGKHGNKIKLDEGTRMFLYQIVG  223

Query  1782  TWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGY  1603
             TWGQLLFPRPWKEFRLWYD HK+ G+KP+LDGMVTTGWYKK+GERIWTPWFIKFIH+RGY
Sbjct  224   TWGQLLFPRPWKEFRLWYDEHKAMGIKPLLDGMVTTGWYKKLGERIWTPWFIKFIHSRGY  283

Query  1602  FNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCF  1423
             FNIYTN L+ERALS SHRDAGVNYGK+ GPDS+L+ E+S+D N LE  P  ++KWYDFCF
Sbjct  284   FNIYTNFLHERALSTSHRDAGVNYGKTAGPDSHLLDESSLDFNLLEMKPRSNLKWYDFCF  343

Query  1422  KQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMG  1243
             ++V P RIV+  +EL SV+ S+QK  N+++VS+   SES +RN LCHFERL I+NYIL+G
Sbjct  344   REVVPQRIVKSKSELVSVLHSVQKHENIVIVSVFGVSESTMRNFLCHFERLNIKNYILLG  403

Query  1242  PKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGF  1063
              +S+LL DL  RGHPVI  D+    +     + F  +  +L K +  K YV+K  LELG+
Sbjct  404   HESELLNDLTRRGHPVIYADQFLKTLITSKFTTFEGTTSELVKLVLAKFYVIKSCLELGY  463

Query  1062  GILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGA  883
                + D N + +N ++   F D    ND   G++ EL F +SSSS+ K W   +  +  A
Sbjct  464   SPGLVDGNMLFVNGNT---FTDLSLANDIVSGQSYELFFIKSSSSSQKMWASHMVVEAEA  520

Query  882   ELITTTSSDSDPT-GKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQF  706
              L +  S  S    G +FV +  KL E+ GVKF T +E    +NI +  A+ +L   ++ 
Sbjct  521   ILESLMSKGSSSLDGISFVGIATKLLEKHGVKFKTAEEMSFGVNIGNNPANTSLGDGKRL  580

Query  705   VFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVIC  601
             VFW +ETS N +Q++L ++G WI+D D+SC AV C
Sbjct  581   VFWPAETSNNDVQKRLEEVGFWIIDGDLSCKAVYC  615



>ref|XP_008449622.1| PREDICTED: uncharacterized protein LOC103491452 [Cucumis melo]
Length=618

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/569 (58%), Positives = 411/569 (72%), Gaps = 9/569 (2%)
 Frame = -3

Query  2304  SFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSS  2125
              FT I+K+LAYNRL S+SRCL S+A A Y    VHLH++IDH+P       D    LN S
Sbjct  55    GFTLIVKVLAYNRLDSVSRCLRSIANADYLSDRVHLHVYIDHYPTD-----DAHIKLNES  109

Query  2124  RRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFR  1945
              RIL FVD F W FG K+VHYRT N GLQAQWLEAWWPSSD+EFAFVVEDDLE+SPLY++
Sbjct  110   HRILQFVDQFAWNFGEKIVHYRTGNVGLQAQWLEAWWPSSDNEFAFVVEDDLELSPLYYK  169

Query  1944  FLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLL  1765
             FL++LIVNYYYN SN+ P IYGASLQRPRFVPGKHGNK+K+D  TR+FLYQ+VGTWGQLL
Sbjct  170   FLRSLIVNYYYNTSNYDPSIYGASLQRPRFVPGKHGNKIKLDEGTRIFLYQIVGTWGQLL  229

Query  1764  FPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTN  1585
             FPRPWKEFRLWYD HK+ G+KP+LDGMVTTGWYKK+GERIWTPWFIKFIH+RGYFNIYTN
Sbjct  230   FPRPWKEFRLWYDEHKAMGIKPLLDGMVTTGWYKKLGERIWTPWFIKFIHSRGYFNIYTN  289

Query  1584  LLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFPD  1405
              L+ERALS SHRDAGVNYGK+ GPDS+L+ E+S+D N LE  PL ++KWYDFCF++V P 
Sbjct  290   FLHERALSTSHRDAGVNYGKTAGPDSHLLDESSLDFNLLEMKPLSNLKWYDFCFREVIPQ  349

Query  1404  RIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLL  1225
             RIV+  +EL SV+ S+QK  N+I+VS+   SES +RN LCHFERL I+NYIL+G +S+LL
Sbjct  350   RIVKIKSELVSVLHSVQKHENIIIVSIFGVSESTMRNFLCHFERLNIKNYILLGHESELL  409

Query  1224  LDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVAD  1045
              DL  RGHPVI  D+    +     + F  +A +L K +  K Y+++  LELG+   + D
Sbjct  410   NDLTRRGHPVIYADQFLKTLITSKFTTFEGTASELVKLVLAKFYIIRSCLELGYSPGLVD  469

Query  1044  CNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITTT  865
              N + +N D    F D    +D   G++ EL F +SSS + K W   +  +  A L +  
Sbjct  470   GNMLFVNGDP---FTDLGLADDVVSGQSYELFFIKSSSFSQKMWASHMVVEAEAILESLM  526

Query  864   SSDSDPT-GKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSSE  688
             S  S    G +FV +  KL E+ GVKF T +E    LNI +   + +L   ++ VFW +E
Sbjct  527   SRGSSSLDGISFVGIATKLLEKHGVKFKTAEEKSFGLNIGNNPTNTSLGDGKRLVFWPAE  586

Query  687   TSTNLIQQQLVQLGLWIVDSDMSCTAVIC  601
             TS N IQ++L +LG WI+D D++C AV C
Sbjct  587   TSNNDIQKRLEELGFWIIDGDLTCKAVYC  615



>ref|XP_002298453.2| hypothetical protein POPTR_0001s27930g [Populus trichocarpa]
 gb|EEE83258.2| hypothetical protein POPTR_0001s27930g [Populus trichocarpa]
Length=618

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/580 (57%), Positives = 420/580 (72%), Gaps = 23/580 (4%)
 Frame = -3

Query  2307  KSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNS  2128
             + FTF+IK+LA+NRL SLSRCLNSL+AA+Y    VHLHI IDHF +       +D+ L  
Sbjct  54    QDFTFLIKVLAFNRLDSLSRCLNSLSAANYGGDTVHLHIHIDHFALTNEPINVIDKKLEE  113

Query  2127  SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYF  1948
             SR++L+F+D F WKFG KVVHYRT+N GLQAQWLEAWWPSSD EFAF+VEDDLEVSPL++
Sbjct  114   SRKVLNFIDGFDWKFGNKVVHYRTNNVGLQAQWLEAWWPSSDHEFAFIVEDDLEVSPLFY  173

Query  1947  RFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQL  1768
             +F++ LIVNYYYNASNFSP +YGASLQRPRFVPGKHGNK+ +DS T +FLYQLVGTWGQ+
Sbjct  174   KFVRGLIVNYYYNASNFSPSVYGASLQRPRFVPGKHGNKIHLDSETHLFLYQLVGTWGQI  233

Query  1767  LFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYT  1588
             LFP+PWKEFRLWYD HKSKG+KP LDGMVT GWYK+MGERIWTPWFIKFI++RGYFNIYT
Sbjct  234   LFPKPWKEFRLWYDLHKSKGIKPFLDGMVTNGWYKRMGERIWTPWFIKFIYSRGYFNIYT  293

Query  1587  NLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFP  1408
             N  +ERALS+SHRDAGVNYGK+ GPDS L+  +S+D N LE  PL ++KWYD+CF++V  
Sbjct  294   NFQHERALSVSHRDAGVNYGKTAGPDSQLLDGSSLDFNLLEMQPLSNLKWYDYCFREVLS  353

Query  1407  DRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDL  1228
              RI +  +E+GS++ ++QK  +V+LV++  ES ++ RN+LCH ERL IRNYIL+GP SD 
Sbjct  354   GRIGRTLDEVGSILRTVQKDRSVLLVTIFGESGTITRNMLCHLERLNIRNYILIGPGSDF  413

Query  1227  LLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVA  1048
             L DLA RGHPVID D+ ++ +R      F  S+ +L K + V  YV+KK LE G+  L  
Sbjct  414   LFDLARRGHPVIDADQFFNYLRAQRVMGFQHSSAELMKNVLVNGYVIKKCLEDGYDSLTV  473

Query  1047  DCNRVPLNS-DSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELIT  871
             D N + L+    F+N       +D   GK+L   F RSSSSA + W + +     A  I 
Sbjct  474   DANVLFLSKVQEFIN-----PSSDMCAGKSLGFFFVRSSSSAQEIWADLLKKV--AATIG  526

Query  870   TTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDE-------NKSSLNISSLDASRTLSIQE  712
               S   + T  NFVY+V K  EQ G      DE         ++ N SSL+A + +    
Sbjct  527   KGSLQGEST--NFVYIVVKFLEQNGAGILRVDEASIGIQIRANAFNQSSLEAGKKM----  580

Query  711   QFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
               V+WS++TS +LIQ++L +L LW+VD D SCTAV+C+ S
Sbjct  581   --VYWSTDTSLDLIQRRLQELSLWVVDGDSSCTAVVCHVS  618



>ref|XP_007015361.1| 30S ribosomal protein S3, putative isoform 1 [Theobroma cacao]
 gb|EOY32980.1| 30S ribosomal protein S3, putative isoform 1 [Theobroma cacao]
Length=614

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/573 (57%), Positives = 416/573 (73%), Gaps = 10/573 (2%)
 Frame = -3

Query  2304  SFTFIIKLLAYnrlsslsrclnsLAAAHY-DHHAVHLHIFIDHFPVPANASLDVDRNLNS  2128
             +F+  IK+L +NRL+SL+RCL SL+ A+Y   H VHLHIFIDHFP  + +   +D  L  
Sbjct  50    TFSLTIKVLTFNRLNSLTRCLTSLSNAYYLPDHPVHLHIFIDHFPNQSKSG--IDPKLQD  107

Query  2127  SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYF  1948
             S  IL FVD F WK+G K+VHYRT+N GLQAQWLEAWWP+SD+EFAFVVEDDLE+SPL+F
Sbjct  108   SLGILQFVDGFEWKWGQKIVHYRTTNVGLQAQWLEAWWPTSDNEFAFVVEDDLELSPLFF  167

Query  1947  RFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQL  1768
             ++L+ LI+NYYYNASNFSP +YGASLQRPRFVPGKHGNKM +DS + +FLYQLVGTWGQL
Sbjct  168   KYLRALILNYYYNASNFSPFVYGASLQRPRFVPGKHGNKMLLDSTSGLFLYQLVGTWGQL  227

Query  1767  LFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYT  1588
             LFP+PWKEFRLWYD HK KG+KP L+GMVTTGWYKKMGE+IWTPWFIKFIH+RGYFNIYT
Sbjct  228   LFPKPWKEFRLWYDDHKGKGIKPFLEGMVTTGWYKKMGEKIWTPWFIKFIHSRGYFNIYT  287

Query  1587  NLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFP  1408
                 E++LS+SHRD GVNYGK+ GPDS L+  NS+D N  E   L +MKWYDFCF++V P
Sbjct  288   KFPDEKSLSVSHRDVGVNYGKTAGPDSQLLDVNSLDSNSREMKSLSTMKWYDFCFREVVP  347

Query  1407  DRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDL  1228
              R+V++ N+LGS++PS+Q    V+LVSL   SE+V RNLLCHFERL I NYI +GP +D 
Sbjct  348   GRVVRNLNDLGSILPSVQTSGTVLLVSLFAASEAVTRNLLCHFERLNIWNYIFIGPATDF  407

Query  1227  LLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVA  1048
             L DLA RGHPVID D+  +NIR Y      +   +   +I +KAYVVKK LE  +   V 
Sbjct  408   LFDLARRGHPVIDADQFLNNIRAYKSMGIQDLKARFKNDILLKAYVVKKCLEFSYNTWVV  467

Query  1047  DCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITT  868
             D N V +N+D FL  I  D+  +F+ G++L+L F ++S SA K   +     + A L   
Sbjct  468   DGNMVLVNNDLFLKSI--DSTYNFYAGESLDLFFVKNSPSAHKILADDFLYDVAALL---  522

Query  867   TSSDSDPT-GKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSS  691
                +S PT  + FV V+ KL E+KG +    DE      + + + +RTL   ++ V+WS 
Sbjct  523   -DKNSLPTDSRKFVSVMAKLLEKKGFRVKRIDEKSFGEKLGNQNLNRTLETDKRVVYWSR  581

Query  690   ETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             E+  + IQ +L +L LW++D+D SCTAV+C+ S
Sbjct  582   ESDIDSIQMRLQELSLWVIDNDSSCTAVVCHKS  614



>ref|XP_011025006.1| PREDICTED: uncharacterized protein LOC105126008 isoform X1 [Populus 
euphratica]
Length=618

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/578 (56%), Positives = 423/578 (73%), Gaps = 19/578 (3%)
 Frame = -3

Query  2307  KSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNS  2128
             + FTF+IK+LA+NRL SLSRCLNSL+AA+Y    VHLHI IDHF +   +   +D+ L  
Sbjct  54    QDFTFLIKVLAFNRLDSLSRCLNSLSAANYGGDTVHLHIHIDHFALTNESINVIDKKLED  113

Query  2127  SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYF  1948
             SR++L+F+D F WKFG KVVHYRT+N GLQAQWLEAWWPSSD EFAF+VEDDLEVSPL++
Sbjct  114   SRKVLNFIDGFDWKFGNKVVHYRTNNVGLQAQWLEAWWPSSDHEFAFIVEDDLEVSPLFY  173

Query  1947  RFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQL  1768
             +F++ LIVNYYYNASNFSP +YGASLQRPRFVPGKHGNK+ +DS TR+FLYQLVGTWGQ+
Sbjct  174   KFVRGLIVNYYYNASNFSPSVYGASLQRPRFVPGKHGNKIHLDSETRLFLYQLVGTWGQI  233

Query  1767  LFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYT  1588
             LFP+PWKEFRLWYD HKSKG+KP LDGMVT GWYK+MGERIWTPWFIKFI++R YFNIYT
Sbjct  234   LFPKPWKEFRLWYDLHKSKGIKPFLDGMVTNGWYKRMGERIWTPWFIKFIYSRSYFNIYT  293

Query  1587  NLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFP  1408
             N  +ERALS+SHRDAGVNYGK+ GPDS L+  +S+D N LE  PL ++KWYD+CF++V  
Sbjct  294   NFQHERALSVSHRDAGVNYGKTAGPDSQLLDGSSLDFNLLEMQPLSNLKWYDYCFREVLS  353

Query  1407  DRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDL  1228
              RI +  +E+GS++ ++QK  +V+LVS+  +S ++ RN+LCH ERL IRNYIL+GP SD 
Sbjct  354   GRIARTLDEVGSILRTVQKDQSVLLVSIFGKSGTITRNMLCHLERLNIRNYILIGPGSDF  413

Query  1227  LLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVA  1048
             L DLA RGHPVID D+ ++ +R      F  S+ +L K + V AYV+KK LE G+  L  
Sbjct  414   LFDLARRGHPVIDADQFFNYLRAQRVMGFQHSSAELMKNVLVNAYVIKKCLEDGYDSLTV  473

Query  1047  DCNRVPLNS-DSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGE---SISSQLGAE  880
             D N + L+    F+N       +D   GK+L   + RSS SA + W +    +++ +G  
Sbjct  474   DANVLFLSKVQEFIN-----PSSDLCAGKSLGFFYVRSSFSAQEIWADLLKKVAAIIGKG  528

Query  879   LITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQ--EQF  706
             L+   S+       NFVY V K  EQ G      DE    + I  ++A    S++  ++ 
Sbjct  529   LLQGEST-------NFVYFVVKFLEQNGAGILRVDEASIGIKI-GVNAFNQSSVEAGKKM  580

Query  705   VFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             V+WS++TS +LIQ++L +L LW+VD D SCTAV+C+ S
Sbjct  581   VYWSTDTSLDLIQRRLQELSLWVVDGDSSCTAVVCHES  618



>ref|XP_004301527.1| PREDICTED: uncharacterized protein LOC101294374 [Fragaria vesca 
subsp. vesca]
Length=612

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/580 (57%), Positives = 424/580 (73%), Gaps = 7/580 (1%)
 Frame = -3

Query  2328  ITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLD  2149
             +T    N  FTFIIKLLAYNRL SLSRCL SLAAA Y    VHLH+ IDHF      + D
Sbjct  39    LTLRPQNPDFTFIIKLLAYNRLDSLSRCLRSLAAADYLSDRVHLHVHIDHFA--LADADD  96

Query  2148  VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDL  1969
              DR L  SRRILD VDAF W+FG K+VHYRT+N GLQAQWLEAWWPSSD EFAFVVEDDL
Sbjct  97    ADRKLRESRRILDLVDAFEWRFGEKLVHYRTANVGLQAQWLEAWWPSSDHEFAFVVEDDL  156

Query  1968  EVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQL  1789
             EVSPLY++FLKNLIVNYYYNASN  P IYGASLQRPRFVPGKHGNK+K+D RTR+FLYQL
Sbjct  157   EVSPLYYKFLKNLIVNYYYNASNSRPYIYGASLQRPRFVPGKHGNKLKVDDRTRLFLYQL  216

Query  1788  VGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHAR  1609
             VGTWGQLLFP+PWKEFRLWYD HK+KG+KP LDGMVTTGWYKK+GE+IWTPWFIKF+H R
Sbjct  217   VGTWGQLLFPKPWKEFRLWYDKHKAKGIKPFLDGMVTTGWYKKIGEKIWTPWFIKFVHTR  276

Query  1608  GYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDF  1429
             GYFNIYTN L+ERALS+SHRDAGVNYGK+ GPDS+++ E+S++       PL  +KWYDF
Sbjct  277   GYFNIYTNFLHERALSVSHRDAGVNYGKTAGPDSHILDESSLEPKFWNTLPLGDLKWYDF  336

Query  1428  CFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYIL  1249
             CF+++FP+R++   +ELGSV+ S+Q  + VI+VSL    E VV NLLC FE L +RNYIL
Sbjct  337   CFREIFPERVIGSLDELGSVLNSVQTNNTVIIVSLFGVKEMVVSNLLCQFESLNLRNYIL  396

Query  1248  MGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLEL  1069
              GP+S+ L DLA RGHPVI T+R  +++  Y   + + S V+L  EI VK YV++K LE 
Sbjct  397   TGPESEFLFDLARRGHPVIITNRFLESVGAYKLLSVHNSYVQLISEILVKVYVLQKCLES  456

Query  1068  GFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQL  889
              +   V D N +P+++D F+  +++D   DF++G + EL FAR+SSSA K  G +     
Sbjct  457   RYSSWVVDGNMLPVSADPFV--VESDPSYDFYIGTSPELFFARASSSAQKDVGGTDFISN  514

Query  888   GAELITTTSSDSDPTGKNFVYVVKKLFE-QKGVKFTTFDENKSSLNISSLDASRTLSIQE  712
              A L+ +          +F YV+ K  E +K  +  T DE    L + +   +++L   +
Sbjct  515   FAMLVNSLLVRQQSV--SFGYVMAKFLEMKKSARVNTLDETSFGLRVDNSIVNQSLGDGK  572

Query  711   QFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             + VFW S+ ++ ++Q++L ++ +W+++ D SC A++C+ S
Sbjct  573   KIVFWPSDMASEIVQKRLQEIDIWVINDDSSCKAIVCHQS  612



>ref|XP_004510564.1| PREDICTED: uncharacterized protein LOC101514737 [Cicer arietinum]
Length=621

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/586 (58%), Positives = 427/586 (73%), Gaps = 9/586 (2%)
 Frame = -3

Query  2340  LQTP--ITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVP  2167
             L+TP  I T + + +FTF+IKLLA+NRL SLSRCL SL+AA Y    VHLH++IDHF  P
Sbjct  42    LRTPFQIQTHSISPNFTFLIKLLAFNRLDSLSRCLRSLSAADYLGDTVHLHVYIDHFLPP  101

Query  2166  ANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAF  1987
              ++S  VD  L  S RIL+FVD F WKFG KVVHYRT N GLQAQWLEAWWP+SDDEFAF
Sbjct  102   DDSS--VDSKLLESHRILEFVDGFYWKFGEKVVHYRTGNVGLQAQWLEAWWPASDDEFAF  159

Query  1986  VVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTR  1807
             VVEDDLEVSPLY+ F+K LIVN+YYN SN+SP I+GA+LQR RFVPGKHGNK+++D +TR
Sbjct  160   VVEDDLEVSPLYYEFVKTLIVNFYYNGSNYSPSIFGATLQRARFVPGKHGNKLQLDDQTR  219

Query  1806  VFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFI  1627
             +FLYQLVGTWGQ+LFP+PWKEFRLWYD +K+KG+KP L+GMVTTGWYKKMGERIWTPWFI
Sbjct  220   LFLYQLVGTWGQILFPKPWKEFRLWYDKNKAKGIKPFLEGMVTTGWYKKMGERIWTPWFI  279

Query  1626  KFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHS  1447
             KFI + GYFNIY N L+ERALS+SHRDAGVNYGK+ GPDS L+ E S+D N LE  PL S
Sbjct  280   KFIQSHGYFNIYANFLHERALSVSHRDAGVNYGKTAGPDSQLLEERSLDFNILEMQPLGS  339

Query  1446  MKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLY  1267
             +KW+DFCF +VFP R+V++  ELG+++ SLQK   + LV+L   S++VVRNLLCHFERL 
Sbjct  340   LKWFDFCFSEVFPGRLVRNIKELGALLHSLQKQDTIFLVNLFGVSDAVVRNLLCHFERLN  399

Query  1266  IRNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVV  1087
             IRNYILMGP SD L DLA RGHPVID D+   +IR+ +K +   S+ +  K I  KAYV+
Sbjct  400   IRNYILMGPPSDSLFDLARRGHPVIDVDQFVSSIRM-NKLSSQSSSFESIKGIVAKAYVI  458

Query  1086  KKTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGE  907
             KK +E  +   V D + + L SD  L    T+  +DF V  NL+L +A+SS S+ K W  
Sbjct  459   KKFIENKYNTWVLDGSML-LTSDILLESGVTN--DDFCVANNLDLFYAKSSLSSEKIWTN  515

Query  906   SISSQLGAELITTTSSDSDP-TGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASR  730
                S++ A   +    DS   +  NFV ++ KL E  G      DE    + I S    +
Sbjct  516   GFVSKIVAMADSLGRKDSSTHSSLNFVNIITKLLEHNGASIRRVDETSFGMRIGSDGVGK  575

Query  729   TLSIQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +     + V+WS+E + + IQ++L +L LW +DSD+SCTAV+C+ S
Sbjct  576   SSLGDAKLVYWSTEVAPDSIQKRLKELNLWSIDSDLSCTAVVCHKS  621



>ref|XP_008366346.1| PREDICTED: uncharacterized protein LOC103429988 [Malus domestica]
 ref|XP_008366353.1| PREDICTED: uncharacterized protein LOC103429988 [Malus domestica]
Length=608

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/579 (55%), Positives = 421/579 (73%), Gaps = 18/579 (3%)
 Frame = -3

Query  2322  TTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVD  2143
              +  N +FTFIIK+LA+NRL S++RCL SLAAA+Y    VH H+++DHF +  +   ++D
Sbjct  46    NSXSNPNFTFIIKVLAFNRLDSVARCLRSLAAANYLTDEVHJHVYVDHFAL-GDPPSNID  104

Query  2142  RNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEV  1963
             + L  S  IL+FVD F WKFG K+ HYRT+N GLQAQWLEAWWPSSD+EF FVVEDDLEV
Sbjct  105   QKLQESHXILEFVDGFEWKFGNKLXHYRTANVGLQAQWLEAWWPSSDNEFVFVVEDDLEV  164

Query  1962  SPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVG  1783
             SPLY++FL++L+VNYYYNASN+ P IYGASLQRPRFVPGKHGNK+++D RTR+FLYQLVG
Sbjct  165   SPLYYKFLRSLVVNYYYNASNYRPYIYGASLQRPRFVPGKHGNKLQMDDRTRLFLYQLVG  224

Query  1782  TWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGY  1603
             TWGQLLFP+PWKEFR+WYD HK+KG+KP LDGMVTTGWYKKMGE+IWTPWFIKFIH RGY
Sbjct  225   TWGQLLFPKPWKEFRMWYDBHKAKGIKPFLDGMVTTGWYKKMGEKIWTPWFIKFIHTRGY  284

Query  1602  FNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCF  1423
             FNIYTN L+ERALS+SHRDAGVNYGK+ GPDS+++ +  +D +  +  PL  +KWYDFCF
Sbjct  285   FNIYTNFLHERALSVSHRDAGVNYGKTAGPDSHVLDKXXLDSDFWDMQPLSDLKWYDFCF  344

Query  1422  KQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMG  1243
             ++  PDR+V   +ELGSV+ S+QK    I+VSL   SE  VRNLLCHFE L I NY+L+G
Sbjct  345   REKXPDRVVGSLDELGSVLNSVQKHDTXIIVSLFGVSELAVRNLLCHFESLNIWNYVLIG  404

Query  1242  PKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGF  1063
             P+SD + DLA RGHPVI T++   ++  Y   +  +S V++     +K YV+KK LE G+
Sbjct  405   PESDXVFDLARRGHPVIGTNQFLKSVGAYKLMSLQDSYVEM-----IKVYVLKKCLESGY  459

Query  1062  GILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLG-  886
                V D N +PL+SD    F+++D   DF+ GK+ EL FAR  S A    G+   S+   
Sbjct  460   NAWVVDGNMLPLSSDL---FVESDXSYDFYXGKSSELFFAR-RSFAQNIGGDDFISKFAT  515

Query  885   -AELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQ  709
              A  +    S S      F Y++ KL E+KGVK  + +E    L I + + + +L   +Q
Sbjct  516   MANXLLVRQSIS------FGYIMAKLLEEKGVKVKSLBETSXGLMIXNSNVNESLGDGKQ  569

Query  708   FVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              VFWS + +++L+ ++L + G+W V+ D+SC AV+C+ S
Sbjct  570   MVFWSXDMASDLVXKRLQEFGIWTVBDDLSCKAVVCHXS  608



>ref|XP_004140181.1| PREDICTED: uncharacterized protein LOC101202835 [Cucumis sativus]
 ref|XP_004169215.1| PREDICTED: uncharacterized LOC101202835 [Cucumis sativus]
Length=604

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/574 (57%), Positives = 410/574 (71%), Gaps = 21/574 (4%)
 Frame = -3

Query  2322  TTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVD  2143
             T      FT I+K+LAYNRL S+SRCL S+A A Y    VHLH++IDH+P     + D  
Sbjct  49    TDPKTSGFTLIVKVLAYNRLDSVSRCLRSIANADYLSDRVHLHVYIDHYP-----NDDAH  103

Query  2142  RNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEV  1963
               LN S RIL FVD F W FG K+VHYRT N GLQAQWLEAWWPSSD+EFAFVVEDDLE+
Sbjct  104   IKLNESHRILQFVDQFAWNFGEKIVHYRTGNVGLQAQWLEAWWPSSDNEFAFVVEDDLEL  163

Query  1962  SPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVG  1783
             SPLY++FL++LIVNYYYN SN+ P IYGASLQRPRFVPGKHGNK+K+D  TR+FLYQ+VG
Sbjct  164   SPLYYKFLRSLIVNYYYNTSNYDPSIYGASLQRPRFVPGKHGNKIKLDEGTRMFLYQIVG  223

Query  1782  TWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGY  1603
             TWGQLLFPRPWKEFRLWYD HK+ G+KP+LDGMVTTGWYKK+GERIWTPWFIKFIH+RGY
Sbjct  224   TWGQLLFPRPWKEFRLWYDEHKAMGIKPLLDGMVTTGWYKKLGERIWTPWFIKFIHSRGY  283

Query  1602  FNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCF  1423
             FNIYTN L+ERALS SHRDAGVNYGK+ GPDS+L+ E+S+D N LE  P  ++KWYDFCF
Sbjct  284   FNIYTNFLHERALSTSHRDAGVNYGKTAGPDSHLLDESSLDFNLLEMKPRSNLKWYDFCF  343

Query  1422  KQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMG  1243
             ++V P RIV+  +EL SV+ S+QK  N+++VS+   SES +RN LCHFERL I+NYIL+G
Sbjct  344   REVVPQRIVKSKSELVSVLHSVQKHENIVIVSVFGVSESTMRNFLCHFERLNIKNYILLG  403

Query  1242  PKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGF  1063
              +S+LL DL  RGHPVI  D+    +     + F  +  +L K +  K YV+K  LELG+
Sbjct  404   HESELLNDLTRRGHPVIYADQFLKTLITSKFTTFEGTTSELVKLVLAKFYVIKSCLELGY  463

Query  1062  GILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGA  883
                + D N + +N ++   F D    ND   G++ EL F +SSSS+ K W   +  +  A
Sbjct  464   SPGLVDGNMLFVNGNT---FTDLSLANDIVSGQSYELFFIKSSSSSQKMWASHMVVEAEA  520

Query  882   ELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFV  703
              L             +FV +  KL E+ GVKF T +E    +NI +  A+ +L   ++ V
Sbjct  521   IL-------------DFVGIATKLLEKHGVKFKTAEEMSFGVNIGNNPANTSLGDGKRLV  567

Query  702   FWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVIC  601
             FW +ETS N +Q++L ++G WI+D D+SC AV C
Sbjct  568   FWPAETSNNDVQKRLEEVGFWIIDGDLSCKAVYC  601



>ref|XP_011036384.1| PREDICTED: uncharacterized protein LOC105133923 [Populus euphratica]
Length=617

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/588 (56%), Positives = 429/588 (73%), Gaps = 19/588 (3%)
 Frame = -3

Query  2340  LQTPITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPAN  2161
             ++ PI   A   +FT +IK+LA+NRL SLSRCLNSL++A+Y    VHLHI IDHF +  N
Sbjct  44    IKAPIARFAP-LNFTLLIKVLAFNRLDSLSRCLNSLSSANYGGDTVHLHIHIDHFAL-TN  101

Query  2160  ASLDV-DRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
              SL+V D+ L  SR++L+FVD F WKFG KVVHYRT+N GLQAQWLEAWWPSSD EFAF+
Sbjct  102   ESLNVIDKKLEESRKVLNFVDGFDWKFGNKVVHYRTNNVGLQAQWLEAWWPSSDHEFAFI  161

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRV  1804
             VEDDLEVSPL+++F++ LIVNYYYN SNFSP IYGASLQRPRFVPGKHGNK+++DS T +
Sbjct  162   VEDDLEVSPLFYKFVRGLIVNYYYNVSNFSPSIYGASLQRPRFVPGKHGNKIQLDSETHL  221

Query  1803  FLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIK  1624
             FLYQLVGTWGQ+LFP+PWKEFRLWYD HKSKG+KP+LDGMVT GWYK++GERIWTPWFIK
Sbjct  222   FLYQLVGTWGQILFPKPWKEFRLWYDLHKSKGIKPLLDGMVTNGWYKRIGERIWTPWFIK  281

Query  1623  FIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSM  1444
             FI++R YFNIYTN  +ERALS+SHRDAGVNYGK+ GPDS L+  +S+D N LE  PL ++
Sbjct  282   FIYSRSYFNIYTNFQHERALSVSHRDAGVNYGKTAGPDSQLLDGSSLDFNLLEMQPLSNL  341

Query  1443  KWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYI  1264
             KWYD+CF++V P R+ +  +E+GSV+ ++Q+  +V+LV++   S ++ RN+LCHFERL I
Sbjct  342   KWYDYCFREVLPGRVGRTSDEVGSVLRTVQEDQSVLLVNIFGASYTITRNMLCHFERLNI  401

Query  1263  RNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVK  1084
             RNYIL+GP SD L DLA RGHPVID D+ ++  R      F  S+ +L K I V AYV+K
Sbjct  402   RNYILIGPGSDFLFDLARRGHPVIDADQFFNYHRAQKVMGFQHSSAELVKNILVNAYVIK  461

Query  1083  KTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWG--  910
             K LE G+  L+ D N + L+      FI  D   DF+ GK+L   F RSSSSA + W   
Sbjct  462   KCLENGYDSLIVDANMLVLSKVQ--EFI--DPTTDFYAGKSLGFFFVRSSSSAQEIWAGL  517

Query  909   -ESISSQLGAELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDAS  733
                ++  +G  L    S+D       F Y+V KL EQ GV+    DE    + I +  ++
Sbjct  518   LRKVADTIGNVLFQGESTD-------FFYLV-KLLEQNGVRIHRVDEPSIGIQIHADTSN  569

Query  732   R-TLSIQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             + +L   ++  +W + T  +LIQ++L +L LW+VD D SC+AV+C+ S
Sbjct  570   QSSLEAGKKMAYWFAGTGVDLIQKRLQELSLWVVDGDSSCSAVVCHQS  617



>gb|KDP38619.1| hypothetical protein JCGZ_03972 [Jatropha curcas]
Length=627

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/578 (58%), Positives = 421/578 (73%), Gaps = 7/578 (1%)
 Frame = -3

Query  2322  TTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVD  2143
             +  +  +FTF+IK+LA+NRL SLSRCL SLA A+YD   VHLH++IDHFP   ++S  +D
Sbjct  55    SPQNTPTFTFLIKVLAFNRLDSLSRCLQSLANANYDGDIVHLHVYIDHFPFVNDSSNVLD  114

Query  2142  RNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEV  1963
             + L  S+R+L+FVD F W FG KVVHYRT N GLQAQWLEAWWPSS+DEFAFVVEDDLEV
Sbjct  115   QKLEDSQRMLEFVDGFLWNFGNKVVHYRTGNVGLQAQWLEAWWPSSNDEFAFVVEDDLEV  174

Query  1962  SPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVG  1783
             SPL+++F+K +IVNYYYN S+ SP IYG SLQRPRFVPGKHGNK+ +D+   +FLYQLVG
Sbjct  175   SPLFYKFVKAVIVNYYYNVSSSSPSIYGVSLQRPRFVPGKHGNKLHLDTGRELFLYQLVG  234

Query  1782  TWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGY  1603
             TWGQ+LFP+PWKEFRLWYD  K+KG+KP LDGMVTTGWYK+MGERIWTPWFIKFIH  GY
Sbjct  235   TWGQILFPKPWKEFRLWYDKCKAKGIKPFLDGMVTTGWYKRMGERIWTPWFIKFIHYSGY  294

Query  1602  FNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCF  1423
             FNIYTNL +ERALS+SHRDAGVNYGK+VGPDS LV E+S D N LE  PL ++KWYDFCF
Sbjct  295   FNIYTNLGHERALSVSHRDAGVNYGKTVGPDSQLVDESSFDYNLLEMQPLSNLKWYDFCF  354

Query  1422  KQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMG  1243
             ++V P R+V+  ++LGSV+ S+QK+  V+LVS+   SE++ RNLLCHFERL I+NYI+MG
Sbjct  355   REVVPGRVVRGVDDLGSVLQSVQKLQTVLLVSIFGTSETITRNLLCHFERLNIQNYIIMG  414

Query  1242  PKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGF  1063
             P SD L DLA RGHPVID + L DN+R      F  S  +L  +I VKAY++KK LE  +
Sbjct  415   PHSDFLYDLARRGHPVIDANNLLDNMRAQKLIRFQGSKSELA-DILVKAYMIKKCLEYEY  473

Query  1062  GILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGA  883
                  D N + +++D F  FI  +   +   GK+ E+ F RSSSS  K W +   +++  
Sbjct  474   NSWTIDANMLFVSNDFFHEFI-INKSKECIAGKSSEIFFVRSSSSVRKIWTDVFLNKVA-  531

Query  882   ELITTTSSDSDPT-GKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQF  706
                T       PT  KNFV++V KL EQ GV  T  DE    + IS     +++    + 
Sbjct  532   ---TAAVQAPLPTENKNFVFLVTKLLEQNGVGITWVDETSFGMKISINSVIQSILGAWKI  588

Query  705   VFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             V+WS E   +L+Q+QL ++G+W +D D SC AVIC+ S
Sbjct  589   VYWSMEIGLDLVQRQLEEMGMWALDGDSSCKAVICHQS  626



>ref|XP_010261054.1| PREDICTED: uncharacterized protein LOC104599977 [Nelumbo nucifera]
Length=633

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/583 (55%), Positives = 428/583 (73%), Gaps = 8/583 (1%)
 Frame = -3

Query  2325  TTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPV--PANASL  2152
              +T  + +F+F IK+LA++R++SLSRCL+SLA A Y    V+LH+FIDHF        S 
Sbjct  54    NSTLVSPNFSFTIKVLAFDRINSLSRCLHSLANADYGDDRVNLHVFIDHFKEIDSGERSA  113

Query  2151  DVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD  1972
             D+D+ L+ S R+L+FVD F WKFG K++HYRT N GLQAQWLEAWWP SDDEF FVVEDD
Sbjct  114   DLDKKLDESHRMLNFVDGFSWKFGEKLLHYRTGNVGLQAQWLEAWWPCSDDEFVFVVEDD  173

Query  1971  LEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQ  1792
             LEVSPLY++FLK +IVNYYYN+SNFSP IYGASLQRPRFV GKHGNK+++D+ TR+FLYQ
Sbjct  174   LEVSPLYYKFLKGIIVNYYYNSSNFSPSIYGASLQRPRFVAGKHGNKLQLDNGTRLFLYQ  233

Query  1791  LVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHA  1612
             LVGTWGQLLFP+PWKEFRLWYD HK+K +KPVL GMVTTGWYKKMGERIWTPWFIKFI +
Sbjct  234   LVGTWGQLLFPKPWKEFRLWYDEHKAKSIKPVLQGMVTTGWYKKMGERIWTPWFIKFIQS  293

Query  1611  RGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYD  1432
             R YFNIYTN L ERALS+SHRDAGVNYGK+ GPDS L+  +S D+N LE  PL  +KWYD
Sbjct  294   RAYFNIYTNFLNERALSVSHRDAGVNYGKTAGPDSYLIEGSSSDLNLLEMQPLSILKWYD  353

Query  1431  FCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYI  1252
             FCF++V P R+V +F+EL  V+ ++QK  ++ILV L +  ++++RNLLCHFERL I+NYI
Sbjct  354   FCFREVLPGRVVTNFDELRHVLHTVQKQKSIILVGLFRTPQTIIRNLLCHFERLDIQNYI  413

Query  1251  LMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLE  1072
             L+GP+S+ L DLA RG+PVI   +L ++IR +   +F  S  +L  E+ VKAYVVK+ L+
Sbjct  414   LVGPESEFLHDLARRGNPVISAQKLLNDIRGHKVMDFQGSDAELISEVLVKAYVVKRCLD  473

Query  1071  LGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQ  892
               +   V + + VPL SD F +    + + DF  G++ +++F + SS+A+  W +    +
Sbjct  474   SSYNSWVINGDMVPLKSDLFSD--ANEQLYDFSAGRDSDILFVKGSSTASGIWIDDFIYK  531

Query  891   LGAELITTTSSDSDPTGK--NFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSI  718
             + AE+  +      P+    +F  +  K  E+ GV+    DE   ++ + + + ++T++ 
Sbjct  532   V-AEMANSLRGGGFPSKSHLHFEGIAAKSLEEHGVRIKRLDEMSFAMKVETGNTNQTVAE  590

Query  717   -QEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              +++ +FWSSE   + IQ++L  LG+WIVD D SCTAV+C+ S
Sbjct  591   DRKRIIFWSSEMDLDNIQKRLEDLGMWIVDGDSSCTAVVCHQS  633



>ref|XP_006470513.1| PREDICTED: uncharacterized protein LOC102622818 [Citrus sinensis]
Length=621

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/584 (56%), Positives = 429/584 (73%), Gaps = 14/584 (2%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDH-FPVPANAS  2155
             P    + + +FT IIK+L +NRL+SLSRCL+SL+AA Y    VHLH+++DH  P+   +S
Sbjct  48    PQNAPSHSSNFTLIIKVLTFNRLNSLSRCLHSLSAADYLTDRVHLHVYVDHSAPLADQSS  107

Query  2154  LDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVED  1975
              + D     SR IL F+D F WKFG K VHYRT+NAGLQAQWLEAWWP+SD EFAFVVED
Sbjct  108   SESD-----SRAILRFLDGFEWKFGDKFVHYRTANAGLQAQWLEAWWPTSDHEFAFVVED  162

Query  1974  DLEVSPLYFRFLKNLIVNYYYNA-SNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFL  1798
             DLEVSPL+++FL+ LIVNYYY+A SN +  IYGASLQRPRFVPGKHGNK+ +D  T++FL
Sbjct  163   DLEVSPLFYKFLRGLIVNYYYHAPSNLTRSIYGASLQRPRFVPGKHGNKIHLDDGTQLFL  222

Query  1797  YQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFI  1618
             YQLVGTWGQLLFP+PWKEFRLWYD HK++G+KP LDGMVTTGWYKKMGERIWTPWFIKFI
Sbjct  223   YQLVGTWGQLLFPQPWKEFRLWYDDHKARGIKPFLDGMVTTGWYKKMGERIWTPWFIKFI  282

Query  1617  HARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKW  1438
             H+RGYFN YT+   ERALS+SHRDAGVNYGKS GPDS L+ E+S+D N L+  PL ++KW
Sbjct  283   HSRGYFNFYTHFPNERALSVSHRDAGVNYGKSAGPDSKLLDESSLDFNILKMQPLSNLKW  342

Query  1437  YDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRN  1258
             YDFCF++VFP R+V+  ++LG+V+PS+Q+   V++VSL   S++V RNLLC FER+  +N
Sbjct  343   YDFCFREVFPGRVVKSMDDLGTVLPSVQRQETVLVVSLFGASDAVTRNLLCQFERINSQN  402

Query  1257  YILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKT  1078
             +I +G  SD L DLA RGHPVID D+  ++IR Y+  +   S  +LTKE+ VK YV+KK 
Sbjct  403   HIFLGSHSDFLYDLARRGHPVIDADQFLNDIRAYESLSLQSSDARLTKEVLVKVYVIKKC  462

Query  1077  LELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESIS  898
             LE  +   V D N +P ++D FL  I  DA +DF+ G++ +L+F +SSSS  K W ++  
Sbjct  463   LEYRYSAWVVDANFLPFSNDLFLEPI--DATSDFYYGESSKLLFVKSSSSVQKIWTKNFL  520

Query  897   SQLGAELITTTSSDSDPTGKNFVYVVKKLFEQK-GVKFTTFDENKSSLNISSLDASRTLS  721
              ++ A L+   S   D   +NF  ++  L  QK GV     DE+   L+I +  A+++ S
Sbjct  521   YEV-ANLVDKVSLPRD--HRNFANIMANLLRQKAGVMIKRVDESNIGLDIGTGSANQSSS  577

Query  720   -IQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              + ++ V+WS++  ++ IQ+QL  L +W +DSD SC AVIC+ S
Sbjct  578   AVGKKIVYWSADLGSDRIQKQLEALSMWNIDSDSSCKAVICHQS  621



>ref|XP_003627441.1| hypothetical protein MTR_8g023050 [Medicago truncatula]
 gb|AET01917.1| transferring glycosyl group transferase, putative [Medicago truncatula]
Length=622

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/581 (57%), Positives = 416/581 (72%), Gaps = 9/581 (2%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASL  2152
             P +T + N  FTF+IK+LA+NRL S+SRCL SLAAA Y    VHLH++IDHF  P N S 
Sbjct  50    PNSTISPN--FTFLIKVLAFNRLDSVSRCLRSLAAADYLGDRVHLHVYIDHF-APLNNS-  105

Query  2151  DVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD  1972
             DVD  L  S RILDFVD F WK+G KVVHYRT N GLQAQWLEAWWP SDDEFAFVVEDD
Sbjct  106   DVDLKLIESHRILDFVDVFEWKYGEKVVHYRTGNVGLQAQWLEAWWPGSDDEFAFVVEDD  165

Query  1971  LEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQ  1792
             LEVS LY+ ++K LIVN+YYN SN+SP I+GA+LQR RFVPGKHGNK+++D +TR+FLYQ
Sbjct  166   LEVSSLYYEYVKALIVNFYYNGSNYSPSIFGATLQRARFVPGKHGNKLQLDDQTRLFLYQ  225

Query  1791  LVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHA  1612
             LVGTWGQ+LFP+PWKEFRLWYD +K+KG KP L+GMVTTGWYKKMGERIWTPWFIKFI +
Sbjct  226   LVGTWGQILFPKPWKEFRLWYDKNKAKGNKPFLEGMVTTGWYKKMGERIWTPWFIKFIQS  285

Query  1611  RGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYD  1432
              GY+NIY N L+ERALS+SHRDAGVNYGK+ GPDS L+ E S+D N LE  PL S+KW+D
Sbjct  286   HGYYNIYANFLHERALSVSHRDAGVNYGKTAGPDSQLLEERSLDFNILEMQPLSSLKWFD  345

Query  1431  FCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYI  1252
             FCF++V P R V++  ELG+++ S+QK  +V LV+L   S++V RNLLCHFERL IRNYI
Sbjct  346   FCFREVLPGRFVRNLEELGALLHSMQKQDSVFLVNLLGVSDAVARNLLCHFERLNIRNYI  405

Query  1251  LMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLE  1072
             LM P SD L DLA RGHPVI+ D+   +I   +K +   S+ +  K I  KAYV+KK +E
Sbjct  406   LMAPPSDSLFDLARRGHPVINVDQFVSSIGT-NKLSSQGSSFETIKGIVAKAYVIKKCIE  464

Query  1071  LGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQ  892
               +   V D + + L SD  L     +  +DF V   LEL +A+SS S+ K W     S+
Sbjct  465   NEYNTWVLDGSLL-LTSDVLLE--SRNPNDDFCVANKLELFYAKSSPSSEKIWTNGFVSK  521

Query  891   LGAELITTTSSDSDPTGK-NFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQ  715
             + A   +    DS   G  +FVY+V KL EQ G      D     L I S   S++    
Sbjct  522   IVAMADSLGRKDSSNQGSLSFVYIVTKLLEQNGASIRRVDGTSFGLKIGSGGVSKSSLED  581

Query  714   EQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             ++ V+WS+E   + IQ++L +L LW +D+++SCTAV+C+ S
Sbjct  582   KKLVYWSTEMELDSIQKRLEELNLWSIDNELSCTAVVCHKS  622



>gb|KHN01469.1| hypothetical protein glysoja_009675 [Glycine soja]
Length=631

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/550 (59%), Positives = 395/550 (72%), Gaps = 12/550 (2%)
 Frame = -3

Query  2232  AAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTS  2053
             AAA Y    VHLH+ IDHF  P NAS  VD  L  + RIL+FVD F WKFG KVVHYRT 
Sbjct  91    AAADYLADRVHLHLHIDHF-APDNAS-HVDPKLLQAHRILEFVDGFDWKFGDKVVHYRTG  148

Query  2052  NAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGAS  1873
             N GLQAQWLEAWWP+SD EFAFVVEDDLEVSPLY+ F+K LI+N+YYNASN+SP I+G S
Sbjct  149   NVGLQAQWLEAWWPNSDHEFAFVVEDDLEVSPLYYEFVKALIMNFYYNASNYSPSIFGVS  208

Query  1872  LQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVL  1693
             LQR RFVPGKHGNK+++D +TR+FLYQLVGTWGQ+LFP+PWKEFRLWYD +K+KG KP L
Sbjct  209   LQRARFVPGKHGNKLQLDDQTRLFLYQLVGTWGQILFPKPWKEFRLWYDENKAKGNKPFL  268

Query  1692  DGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGP  1513
             +GMVTTGWYKKMGERIWTPWFIKFI +RGYFNIYTNLL+ERALS+SHRDAGVNYGK+ GP
Sbjct  269   EGMVTTGWYKKMGERIWTPWFIKFIQSRGYFNIYTNLLHERALSVSHRDAGVNYGKTAGP  328

Query  1512  DSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVIL  1333
             DS L+ E S+D N LE  PL S++WYDFCF++V P ++  +  ELGS++ SLQK  +V L
Sbjct  329   DSKLLEEKSLDFNLLEVQPLRSLRWYDFCFREVHPGKVATNLEELGSLLHSLQKQDSVFL  388

Query  1332  VSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYD  1153
             V+L   S+++ RNLLCHFERL IRNYILMGP SD L DLA RGHPVI+ D+   ++ +  
Sbjct  389   VNLFGVSDAISRNLLCHFERLDIRNYILMGPPSDSLFDLARRGHPVINVDKFISSVGL--  446

Query  1152  KSNFNESAVKLT--KEIFVKAYVVKKTLELGFGILVADCNRVPLNSDSFLNFIDTDAVND  979
              S F    +     K I  K Y +KK +E  +   V D + + L SD FL+    D+  D
Sbjct  447   -SKFTSQGLSFETIKGILAKTYAIKKCIENRYNTWVMDGSML-LTSDLFLS-ESEDSNGD  503

Query  978   FFVGKNLELVFARSSSSAAKTWGESISSQLGAELITTTSSDSDPTGK-NFVYVVKKLFEQ  802
             FFV  NLEL +A+SSSS+ K W +   S++ A   +    DS   G  +FVYVV KL EQ
Sbjct  504   FFVANNLELFYAKSSSSSQKIWVDGFVSKVVAMAESLAGKDSATHGSLSFVYVVIKLLEQ  563

Query  801   KGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDM  622
              G +    DEN  +  I S   S T    ++ V+WSSE   N IQ+ L +  LW +DSD+
Sbjct  564   NGARIRRVDENSFATKIGS--GSETSLRDKKLVYWSSEMELNSIQKWLDEFNLWSIDSDL  621

Query  621   SCTAVICYPS  592
             SCTAV+C+ S
Sbjct  622   SCTAVVCHKS  631



>ref|XP_010536145.1| PREDICTED: uncharacterized protein LOC104811206 [Tarenaya hassleriana]
Length=608

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/581 (55%), Positives = 415/581 (71%), Gaps = 28/581 (5%)
 Frame = -3

Query  2319  TADNKSFTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASL  2152
             + D   FTF++K+L +NRL SLSRCL SLAAA Y    D   VHLH++IDHF +  N + 
Sbjct  49    SGDVPPFTFLVKVLTFNRLLSLSRCLRSLAAADYSVAGDAGRVHLHVYIDHFSLARNDT-  107

Query  2151  DVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD  1972
               + NL ++R IL+FVD F W+FG KVV YRT N GLQAQWLEAWWPSSD EFAFVVEDD
Sbjct  108   SAEDNLKNAREILEFVDGFEWRFGKKVVQYRTDNVGLQAQWLEAWWPSSDHEFAFVVEDD  167

Query  1971  LEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQ  1792
             LEVSPLYFRFL+++I NYYY+AS+FSP IYGASLQRPRFVPGKHGNK+++D  T+VFLYQ
Sbjct  168   LEVSPLYFRFLESVIRNYYYDASSFSPSIYGASLQRPRFVPGKHGNKLRLDPGTKVFLYQ  227

Query  1791  LVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHA  1612
             LVGTWGQLLFP+PWKEFRLWYD HK+KG+KP+LDGMVTTGWYKKMGERIWTPWFIKFIH+
Sbjct  228   LVGTWGQLLFPKPWKEFRLWYDDHKAKGIKPILDGMVTTGWYKKMGERIWTPWFIKFIHS  287

Query  1611  RGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYD  1432
             RGYFNIYTN   ERALS+SHRDAGVNYGK+ GPDS L+ ++S D N L+  PL S+KWYD
Sbjct  288   RGYFNIYTNFQNERALSVSHRDAGVNYGKTAGPDSELLDKSSFDSNFLKLQPLSSLKWYD  347

Query  1431  FCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYI  1252
             FCF++V P R+V++ ++LG+++PS+Q    ++LVSL+   E ++RNL+CHFE+L  RN+I
Sbjct  348   FCFREVVPSRVVRNLDQLGTLLPSVQSEKTILLVSLYDAQEMLMRNLICHFEKLDTRNHI  407

Query  1251  LMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLE  1072
              +GP S+LL DLA RGHPVID+D+  DN+  Y+ +    S     KE    A+VVKK LE
Sbjct  408   FIGPSSELLFDLARRGHPVIDSDQFLDNVGAYNLAKSQSSYPNAVKEALGTAHVVKKCLE  467

Query  1071  LGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQ  892
             LG+   +     + ++  + L+ + ++   DF+ G+   ++  R SS+A K W +     
Sbjct  468   LGYSSWIFTSKALLVDKTALLDRVGSEY--DFYAGEGSRILGVRHSSAAQKLWTDEFLRT  525

Query  891   LGAELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQE  712
             + A+  +  +S+      N + +V KL EQKG K    D N                  +
Sbjct  526   IAAKTPSLKASE------NSIVLVSKLLEQKGKKIKNIDVNSEE--------------GK  565

Query  711   QFVFWSSETSTNLIQQQLVQLGLWIV-DSDMSCTAVICYPS  592
               V+WS E  +N+I++QL +L LW++ D+D+SC AV+C+ S
Sbjct  566   PMVYWSLEADSNMIRKQLKELNLWLIDDADLSCKAVVCHRS  606



>ref|XP_010673796.1| PREDICTED: uncharacterized protein LOC104890122 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=617

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/573 (56%), Positives = 417/573 (73%), Gaps = 10/573 (2%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSSR  2122
             FTF IK+LA++RLSS+SRCLNSL++A Y    + LHIFIDHF   +++S D+   L +S 
Sbjct  52    FTFTIKVLAFDRLSSISRCLNSLSSARYFGDTIDLHIFIDHFHNSSSSS-DLGPKLENSH  110

Query  2121  RILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRF  1942
             +ILDFVD F W FG K+VHYRT N GLQAQWLE+WWPSSDDEF FVVEDDLEVSPLY++F
Sbjct  111   KILDFVDGFKWAFGKKLVHYRTLNVGLQAQWLESWWPSSDDEFVFVVEDDLEVSPLYYQF  170

Query  1941  LKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLF  1762
             LK LI+NYYYN SNFSP IYGASLQRPRFVPGKHGNKM +DS TR+FLYQLVGTWGQLLF
Sbjct  171   LKGLILNYYYNYSNFSPWIYGASLQRPRFVPGKHGNKMNLDSGTRLFLYQLVGTWGQLLF  230

Query  1761  PRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNL  1582
             PRPWKEFRLWYD HK+KG+KPVL+GMVT GWYK+MGERIWTPWFIKF+H+RGY+NIYTN 
Sbjct  231   PRPWKEFRLWYDDHKAKGIKPVLEGMVTNGWYKRMGERIWTPWFIKFVHSRGYYNIYTNF  290

Query  1581  LYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFPDR  1402
             L+ERALSISHRDAGVNYGK+ GPDS L+   S DIN LE   L +++WYDFCFK++ P R
Sbjct  291   LHERALSISHRDAGVNYGKTAGPDSQLLEGKSFDINPLEMPSLSNLEWYDFCFKRILPGR  350

Query  1401  IVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGP--KSDL  1228
             + +  +E+G ++ ++ K   V+LVSL    E+++RNL+CHFERL I+NYI M P  KSDL
Sbjct  351   VAKKLDEIGPILHTMGKQKPVLLVSLLNSREAIIRNLICHFERLNIQNYIFMVPNSKSDL  410

Query  1227  LLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVA  1048
             L DL  RGHPVI T+ ++D+I     +   +++ +L KE  VKAYV+KK L+ GF   V 
Sbjct  411   LHDLPRRGHPVIVTEEVFDSI-----TRSKKTSSELVKETVVKAYVIKKILDSGFDSWVI  465

Query  1047  DCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITT  868
               + +PL+S+  L+       N+F+VGKN  +   RSSSS+   W      +  + + + 
Sbjct  466   TSDMLPLSSNPELDST-ISIKNNFYVGKNSRIFVVRSSSSSQAVWDVRFVEKFASSVESL  524

Query  867   TSSDSDPTGK-NFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSS  691
              + DS    K NF  +V++  E   ++  + D+   SL +  ++ +++L    + + WS+
Sbjct  525   VTQDSSQKEKGNFADIVERFAENHALRLKSVDDIGFSLKLEEVNGNQSLPTDTKMITWSA  584

Query  690   ETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
                 + +++ L +LG+WI+DSD SC AVIC+ S
Sbjct  585   AMDRDSVRKHLEELGMWIIDSDSSCKAVICHQS  617



>ref|XP_006446350.1| hypothetical protein CICLE_v10014615mg [Citrus clementina]
 gb|ESR59590.1| hypothetical protein CICLE_v10014615mg [Citrus clementina]
Length=621

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/584 (56%), Positives = 429/584 (73%), Gaps = 14/584 (2%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDH-FPVPANAS  2155
             P    + + +FT IIK+L +NRL+SLSRCL+SL+AA Y    VHLH+++DH  P+   +S
Sbjct  48    PQNAPSHSSNFTLIIKVLTFNRLNSLSRCLHSLSAADYLTDRVHLHVYVDHSAPLADQSS  107

Query  2154  LDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVED  1975
              + D     SR IL F+D F WKFG K VHYRT+NAGLQAQWLEAWWP+SD EFAFVVED
Sbjct  108   SESD-----SRAILRFLDGFEWKFGDKFVHYRTANAGLQAQWLEAWWPTSDHEFAFVVED  162

Query  1974  DLEVSPLYFRFLKNLIVNYYYNA-SNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFL  1798
             DLEVSPL+++FL+ LIVNYYY+A SN +  IYGASLQRPRFVPGKHGNK+ +D+ T++FL
Sbjct  163   DLEVSPLFYKFLRGLIVNYYYHAPSNLTRSIYGASLQRPRFVPGKHGNKIHLDNGTQLFL  222

Query  1797  YQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFI  1618
             YQLVGTWGQLLFP+PWKEFRLWYD HK++G+KP LDGMVTTGWYKKMGERIWTPWFIKFI
Sbjct  223   YQLVGTWGQLLFPQPWKEFRLWYDDHKARGIKPFLDGMVTTGWYKKMGERIWTPWFIKFI  282

Query  1617  HARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKW  1438
             ++ GYFN YT+   ERALS+SHRDAGVNYGKS GPDS L+ E+S+D N L+  PL ++KW
Sbjct  283   YSHGYFNFYTHFPNERALSVSHRDAGVNYGKSAGPDSKLLDESSLDFNILKMQPLSNLKW  342

Query  1437  YDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRN  1258
             YDFCF++VFP R+V+  ++LG+V+PS+Q+   V++VSL   S++V RNLLC FER+  +N
Sbjct  343   YDFCFREVFPGRVVKSMDDLGTVLPSVQRQETVLVVSLFGASDAVTRNLLCQFERINSQN  402

Query  1257  YILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKT  1078
             +I +G  SD L DLA RG+PVID D   ++IR Y+  +   S  +LTKE+ VK YV+KK 
Sbjct  403   HIFLGSHSDFLYDLARRGNPVIDADLFLNDIRAYESLSLQSSDARLTKEVLVKVYVIKKC  462

Query  1077  LELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESIS  898
             LE  +   V D N +P ++D FL  I  DA +DF+ G++ +L+F +SSSS  K W ++  
Sbjct  463   LEYRYSAWVVDANFLPFSNDLFLEPI--DATSDFYYGESSKLLFVKSSSSVQKMWTKNFL  520

Query  897   SQLGAELITTTSSDSDPTGKNFVYVVKKLFEQK-GVKFTTFDENKSSLNISSLDASRTLS  721
              ++ A L+   S   D   +NF  ++  L  QK GV     DE+K  L+I +  A+++ S
Sbjct  521   YEV-ANLVDKVSLPRD--HRNFANIMANLLRQKAGVMIKRVDESKIGLDIGTGSANQSSS  577

Query  720   -IQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              + ++ V+WS++   + IQ+QL +L LW +DSD SC AVIC+ S
Sbjct  578   AVGKKIVYWSADLGPDRIQKQLEELSLWDIDSDSSCKAVICHQS  621



>ref|XP_007134752.1| hypothetical protein PHAVU_010G072800g [Phaseolus vulgaris]
 gb|ESW06746.1| hypothetical protein PHAVU_010G072800g [Phaseolus vulgaris]
Length=618

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/578 (56%), Positives = 414/578 (72%), Gaps = 9/578 (2%)
 Frame = -3

Query  2319  TADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDR  2140
             T ++ +F F++ +LA+NRL++LSRCL SLAAA Y    VHLH+ IDHF    NAS  VD 
Sbjct  48    TLNHPNFNFVVNVLAFNRLAALSRCLRSLAAADYLGDRVHLHLHIDHFAYD-NAS-SVDP  105

Query  2139  NLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVS  1960
              L  +RRIL+FVDAF WKFG KVVHYRT N GLQAQWLEAWWP+SD EFAFVVEDDLEVS
Sbjct  106   KLREARRILEFVDAFDWKFGEKVVHYRTGNVGLQAQWLEAWWPTSDHEFAFVVEDDLEVS  165

Query  1959  PLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGT  1780
              LY+ F+K LI+N+YYNASN+SP I+G SLQR RFVPGKHGNK+++D +TR+FLYQLVGT
Sbjct  166   SLYYEFVKALILNFYYNASNYSPSIFGVSLQRARFVPGKHGNKLQLDDKTRLFLYQLVGT  225

Query  1779  WGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYF  1600
             WGQ+LFP+PWKEFRLWYD +K+KG +P L+GMVTTGWYKKMGERIWTPWFIKFIH+RGYF
Sbjct  226   WGQILFPKPWKEFRLWYDENKAKGNRPFLEGMVTTGWYKKMGERIWTPWFIKFIHSRGYF  285

Query  1599  NIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFK  1420
             NIYTNLL+ERALS+SHRDAGVNYGK+ GPDS L+ +  +D N LE  PL S+KW+DFCF+
Sbjct  286   NIYTNLLHERALSVSHRDAGVNYGKTAGPDSKLLEKRYMDFNILEMQPLSSLKWFDFCFR  345

Query  1419  QVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGP  1240
             +V P +IV +  ELG ++   QK  +V LV+L   S+ + RNLLCHFERL IRNYILMGP
Sbjct  346   EVHPGKIVTNLEELGLLLHYWQKRDSVFLVNLFGVSDDIARNLLCHFERLNIRNYILMGP  405

Query  1239  KSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFG  1060
              SD L DLA RGHPVI+ D+   ++ +Y K     S  +  K    K YV KK +E  + 
Sbjct  406   PSDSLFDLARRGHPVINVDQFLSSVGLY-KLTSQGSNSEAIKGFLAKIYVTKKCIENKYN  464

Query  1059  ILVADCNRVPLNSDSFLNFIDTDAVND-FFVGKNLELVFARSSSSAAKTWGESISSQLGA  883
               V D N +P  SD    F +++  ND FFV    EL +A+SSSS+ K W +   S++ A
Sbjct  465   TWVMDGNMLP-TSDF---FSESENPNDNFFVANTFELFYAKSSSSSEKIWVDGFVSKVVA  520

Query  882   ELITTTSSDSDPT-GKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQF  706
              + +    DS+     +FV++V KL EQ G +    DE+  +  I   + S +    ++ 
Sbjct  521   AVESLAGKDSETHYSLSFVHIVTKLLEQNGARIGRVDESSLATKIGHGNVSESFLRDKKL  580

Query  705   VFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             V+WS+E   + IQ+   ++ LW +D+D+SCTAV+C  S
Sbjct  581   VYWSTEMELDSIQKWFKEVNLWSIDNDLSCTAVVCQKS  618



>ref|XP_010938830.1| PREDICTED: uncharacterized protein LOC105057825 [Elaeis guineensis]
Length=617

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/585 (54%), Positives = 413/585 (71%), Gaps = 10/585 (2%)
 Frame = -3

Query  2337  QTPITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPV--PA  2164
             Q P  +  + + FTF IKLL ++R+ SL RCL S+AAA Y    V LH+F+DHF    PA
Sbjct  37    QNP-NSNPNPQRFTFTIKLLTFDRIDSLRRCLRSIAAADYGGDRVSLHVFVDHFRAVDPA  95

Query  2163  NASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             N S  +DR L  SRRILD VD F W  G K+VH+RT+N GLQAQWLEAWWP SDD+FAFV
Sbjct  96    NESALLDRKLEESRRILDLVDGFSWPHGEKLVHHRTANVGLQAQWLEAWWPKSDDDFAFV  155

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRV  1804
             VEDDLE+SPLY++FLK LI+ YYY+ SN+SP IYGASLQRPRFV GKHGNK+++DS T +
Sbjct  156   VEDDLELSPLYYKFLKELILKYYYDRSNYSPSIYGASLQRPRFVAGKHGNKLRLDSETHL  215

Query  1803  FLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIK  1624
             FLYQ+VGTWGQLLFPRPWKEFRLWYD HK+KG+KP+L GMVTTGWYKKMGERIWTPWFIK
Sbjct  216   FLYQMVGTWGQLLFPRPWKEFRLWYDIHKAKGIKPILQGMVTTGWYKKMGERIWTPWFIK  275

Query  1623  FIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSM  1444
             +IHARGY+NIYTN ++ERALSIS+RDAGVNYGK+ GPDSNL+ +NS+D +     PL ++
Sbjct  276   YIHARGYYNIYTNFVHERALSISYRDAGVNYGKTAGPDSNLLDKNSLDFDLWALQPLKNL  335

Query  1443  KWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYI  1264
             KWYDFCF++V   RIV+ ++EL SV+ S ++   +ILVS ++  + + RNL+CH ER+ +
Sbjct  336   KWYDFCFREVHLGRIVRRYDELESVLRSFKEQKTIILVSFYRTVQRIARNLICHLERVGL  395

Query  1263  RNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSN-FNESAVKLTKEIFVKAYVV  1087
             +N++ +G  S+ L+DLA RG+PVID + L   +   DKSN F  S + L KEI+ KA V+
Sbjct  396   QNFMFIGDDSEFLIDLARRGYPVIDANLLVSKMGS-DKSNGFEHSDMNLMKEIWAKANVI  454

Query  1086  KKTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGE  907
             KK LELG+ + V D N +P+ S+S L     D   DFF  KN+ L++ +SSSS+ K W  
Sbjct  455   KKFLELGYNLWVLDWNIIPM-SNSLLEV--PDPSYDFFAAKNVGLMYMKSSSSSLKVWVA  511

Query  906   SISSQLGAELITTTSSDS-DPTGKNFVYVVKKLFEQKG-VKFTTFDENKSSLNISSLDAS  733
                S + A   +   S+S     KNFVY   K  E KG V+    DE+   + +     +
Sbjct  512   DFISNVAAVGKSLIGSNSVSLEHKNFVYFATKALEDKGDVRLRRLDESVIGVRLGYDAMN  571

Query  732   RTLSIQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
             R+     + +F S   S   +Q++L  L +W++D D SC AV+C+
Sbjct  572   RSALDSGKMLFLSPAMSLTSVQRELENLEMWLIDGDSSCAAVVCH  616



>ref|XP_010031698.1| PREDICTED: uncharacterized protein LOC104421448 [Eucalyptus grandis]
 gb|KCW51059.1| hypothetical protein EUGRSUZ_J00670 [Eucalyptus grandis]
Length=628

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/572 (53%), Positives = 403/572 (70%), Gaps = 6/572 (1%)
 Frame = -3

Query  2304  SFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSS  2125
             +F  +IK+LA+NRL SLSRCL SLAAA Y    VHLH++IDHF    N S D   +L+++
Sbjct  62    NFALLIKVLAFNRLDSLSRCLRSLAAADYLSDTVHLHVYIDHF---GNGSGDAGSSLDAA  118

Query  2124  RRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFR  1945
             RRILDFVD F W FG K VHYRT+NAGLQAQWLEAWWPSSDDEFAF+VEDDLEVSPL+++
Sbjct  119   RRILDFVDGFEWGFGEKRVHYRTANAGLQAQWLEAWWPSSDDEFAFIVEDDLEVSPLFYK  178

Query  1944  FLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLL  1765
             F+K++I N+YYNA+NFSPMIYG +LQRPRFVPGKHGNK+++D R++VFLYQLVGTWGQ+L
Sbjct  179   FVKSVIWNFYYNATNFSPMIYGVTLQRPRFVPGKHGNKLQVDGRSQVFLYQLVGTWGQIL  238

Query  1764  FPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTN  1585
             FP+ WKEFR WYD HK+KG+KP+L+GMVTTGWY+++GE+IWTPWFIKFIH RGYFNIYTN
Sbjct  239   FPKHWKEFRRWYDYHKAKGIKPILEGMVTTGWYRRLGEKIWTPWFIKFIHDRGYFNIYTN  298

Query  1584  LLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFPD  1405
              L ERALS+SHRD GVNYGK+ GPDS+L+ E   D N L+  PL ++KWYDFCF++V   
Sbjct  299   FLQERALSVSHRDTGVNYGKTAGPDSHLLNEVPHDFNLLKMQPLSNLKWYDFCFREVLRG  358

Query  1404  RIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLL  1225
             R+V++FN+LG V+ ++Q    ++ VSL    E +VRN+LCHFERL IRNYILMGP S+LL
Sbjct  359   RVVRNFNDLGVVLDTVQINETIVFVSLFGLQEIIVRNMLCHFERLNIRNYILMGPTSNLL  418

Query  1224  LDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVAD  1045
              DLA RGHPVID D+  D++          S+ +L K +    Y +KK LEL +   V D
Sbjct  419   FDLARRGHPVIDADQFLDSVGANKLKRPQNSSPELIKNVMTSTYAIKKCLELKYNAWVVD  478

Query  1044  CNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITTT  865
              N +  N         TD+  D +  K+L L+F RSSS+  K W ++    + A      
Sbjct  479   ANMLFPNGGMLQAL--TDSTFDLYAVKSLALIFVRSSSAVRKLWLDNFVHAIEAGDSLWD  536

Query  864   SSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASR-TLSIQEQFVFWSSE  688
                      NF  +     E K V+    D+    +NI +    R +  ++ + ++WS +
Sbjct  537   KLSISRENSNFADIAASFLESKRVRVKRIDDRSLGVNIGTSSVERASPGLENKVLYWSPD  596

Query  687   TSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              + ++I+++L +L +W +D D SC+AV+C+ S
Sbjct  597   AALDIIRKRLEELKMWTLDGDDSCSAVVCHQS  628



>emb|CDX69692.1| BnaA10g20410D [Brassica napus]
Length=616

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/574 (53%), Positives = 413/574 (72%), Gaps = 20/574 (3%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             FTF+IK+L +NRL SLSRCL SL+AA Y    +   +HLHI+IDHF + +  S  V   L
Sbjct  57    FTFLIKVLTFNRLHSLSRCLLSLSAADYGLAGNSQRIHLHIYIDHFSLSSPDSKSVGDRL  116

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
             ++++ ILDFVD F W+FG K+VHYRT NAGLQ QWLEAWWPSSD EFAFVVEDDLEVSPL
Sbjct  117   SNAKEILDFVDKFEWRFGEKLVHYRTGNAGLQGQWLEAWWPSSDHEFAFVVEDDLEVSPL  176

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+ FL+++I NYYY+ SN+ P +YGASLQRPRFVPGKHGNK+ +D +T VFLYQLVGTWG
Sbjct  177   YYGFLESVIRNYYYDRSNYDPSVYGASLQRPRFVPGKHGNKLHLDPKTNVFLYQLVGTWG  236

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD HKSK  KP LDGMVT GWYK++GERIWTPWFIKFIH+RGYFNI
Sbjct  237   QLLFPKPWKEFRLWYDEHKSKDKKPFLDGMVTNGWYKRLGERIWTPWFIKFIHSRGYFNI  296

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   ERALS+SHRDAGVNYGK+ GPDS L+ +++I  + L+  PL ++KWYD+CF +V
Sbjct  297   YTNFQNERALSVSHRDAGVNYGKTAGPDSQLLNKSTISSDFLKLQPLSNLKWYDYCFSEV  356

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+V+  NELG+++PS+Q+   V+LVSL    +  +RNLLCHFE++  RN++ +GP S
Sbjct  357   VPGRVVKSLNELGTILPSVQREKTVVLVSLFAADKMFIRNLLCHFEKIDTRNHVFIGPSS  416

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +L  DL+ RGHPVID D   D + V  +++++ S     KE    AYVVKK LELG+   
Sbjct  417   ELFYDLSRRGHPVIDADLFLDKL-VKSETSYSNSV----KEALGNAYVVKKCLELGYSTW  471

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             V   N + ++  + L+ + ++   DF++G++  ++  +SS    K W    S++L   +I
Sbjct  472   VFSSNALLVDKGTLLDRVRSEY--DFYIGESSGILIVKSSPVTQKLW----SNELLNSII  525

Query  873   TTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWS  694
             ++ + + D     F+++VK+L E+KG    T +    + N ++   +++L   +  V+WS
Sbjct  526   SSATKNLD-----FIHLVKELVERKGKMIKTVETMSIAENNNANSVNQSLGDGKPVVYWS  580

Query  693   SETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              E  +N+I+ +L +L LW++D D+SC AVIC+ S
Sbjct  581   PEADSNIIRTKLEELKLWLIDDDLSCKAVICHSS  614



>ref|XP_009121861.1| PREDICTED: uncharacterized protein LOC103846650 [Brassica rapa]
Length=616

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/574 (53%), Positives = 413/574 (72%), Gaps = 20/574 (3%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             FTF+IK+L +NRL SLSRCL SL+AA Y    +   +HLH++IDHF + +  S  V   L
Sbjct  57    FTFLIKVLTFNRLHSLSRCLLSLSAADYGLAGNSQRIHLHVYIDHFSLSSPDSKSVGDRL  116

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
             ++++ ILDFVD F W+FG K+VHYRT NAGLQ QWLEAWWPSSD EFAFVVEDD+EVSPL
Sbjct  117   SNAKEILDFVDKFEWRFGEKLVHYRTGNAGLQGQWLEAWWPSSDHEFAFVVEDDVEVSPL  176

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+ FL+++I NYYY+ SN+ P +YGASLQRPRFVPGKHGNK+ +D +T VFLYQLVGTWG
Sbjct  177   YYGFLESVIRNYYYDRSNYDPSVYGASLQRPRFVPGKHGNKLHVDPKTNVFLYQLVGTWG  236

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD HKSK  KP LDGMVT GWYK++GERIWTPWFIKFIH+RGYFNI
Sbjct  237   QLLFPKPWKEFRLWYDEHKSKDKKPFLDGMVTNGWYKRLGERIWTPWFIKFIHSRGYFNI  296

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YT    ERALS+SHRDAGVNYGK+ GPDS L+ +++I  + L+  PL ++KWYD+CF +V
Sbjct  297   YTKFPNERALSVSHRDAGVNYGKTAGPDSQLLNKSTISSDFLKLQPLSNLKWYDYCFSEV  356

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+V+  NELG+++PS+Q+   V+LVSL    +  +RNLLCHFE++  RN++ +GP S
Sbjct  357   VPGRVVKSLNELGTILPSVQREKTVVLVSLFDADKMFIRNLLCHFEKIGTRNHVFIGPSS  416

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +L  DL+ RGHPVID D   D + V  KS+++ SA    KE    AYVVKK LELG+   
Sbjct  417   ELFYDLSRRGHPVIDADMFLDKL-VKSKSSYSNSA----KEAMGNAYVVKKCLELGYSTW  471

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             V   N + ++    L+ + ++   DF++G++  ++  +SS  + K W    S++L   +I
Sbjct  472   VFSSNALLVDKSPLLDRVRSEY--DFYIGESSGVLIVQSSPVSQKLW----SNELLNSII  525

Query  873   TTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWS  694
             ++ + + D     F+++VK+L E+KG    T +    + N ++   +++L   +  V+WS
Sbjct  526   SSATKNLD-----FIHLVKELVERKGKMIKTVETMSIAENNNANSVNQSLGDGKPVVYWS  580

Query  693   SETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              E  +N+I+ +L +L LW++D D+SC AVIC+ S
Sbjct  581   PEVDSNVIRTKLEELKLWLIDDDLSCKAVICHSS  614



>ref|XP_009412191.1| PREDICTED: uncharacterized protein LOC103993741 [Musa acuminata 
subsp. malaccensis]
Length=619

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/575 (53%), Positives = 409/575 (71%), Gaps = 9/575 (2%)
 Frame = -3

Query  2310  NKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHF-PVPANASLDVDRNL  2134
             N  FTFIIKLL ++R+ SL RCL SLAAA Y    VHLH+ +DHF P+  ++   +DR L
Sbjct  47    NPRFTFIIKLLTFDRIDSLRRCLRSLAAADYTGDRVHLHVLVDHFRPLNGSSGATLDRKL  106

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
               SRRIL  VD   W  G K+VHYRT+NAGLQAQWLEAWWPSSDDEFAFVVEDDLE+SPL
Sbjct  107   EESRRILYLVDRLHWPHGDKIVHYRTANAGLQAQWLEAWWPSSDDEFAFVVEDDLELSPL  166

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y++FLK LI+ YYY+ +N+ P IYGASLQRPRFV GK+GNK+++ S TR+FLYQ+VGTWG
Sbjct  167   YYKFLKGLILKYYYDPANYDPSIYGASLQRPRFVAGKNGNKLQVGSETRIFLYQMVGTWG  226

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD HKSK +KP+L GMVTTGWYK+ GERIWTPWFIKFIH+RGY+NI
Sbjct  227   QLLFPKPWKEFRLWYDEHKSKEIKPILQGMVTTGWYKRFGERIWTPWFIKFIHSRGYYNI  286

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   ERALSISHRDAGVNYGK+VGPDS+L+ + S+  N  E  PL ++KWYDFCF + 
Sbjct  287   YTNFEQERALSISHRDAGVNYGKTVGPDSSLLVDESLSFNLWEVPPLRNLKWYDFCFTET  346

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P RIV  F+ L S++ SL++   +I++SL+Q +E + +NL+C+ E+    N+IL+G   
Sbjct  347   LPGRIVSDFSGLRSLLYSLKQQKTIIVISLYQTTERIAKNLICNLEKAGSLNFILLGGNP  406

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             + L+DLA RG+PVID D+L  +IR +DKS + E    + +EI+VKA +V+K LELG+ + 
Sbjct  407   EFLIDLARRGYPVIDADQLISSIR-HDKSVYLERETDIIREIWVKATIVQKCLELGYNLW  465

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             + D N +P  S S           DF V K++ L+F +SS  + K W +    ++ AE  
Sbjct  466   LIDGNMIP-GSGSLSEL--PHPSYDFVVVKDVGLLFVKSSPPSLKMWNDDYIHKVVAECQ  522

Query  873   TTTSSDSD-PTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFW  697
             + T S+S     KNFVY+ +K  +         D++   + + ++  +RT S +   VFW
Sbjct  523   SLTGSNSHLMEHKNFVYLARKALDDNAD--VRVDDSAVGVKLGAITMNRTES-KLNMVFW  579

Query  696   SSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             S E ++ L+Q++L +LG+W +D D SC +V+C+ +
Sbjct  580   SQEMASALVQKELERLGMWSIDVDSSCVSVVCHKT  614



>ref|XP_006287245.1| hypothetical protein CARUB_v10000433mg [Capsella rubella]
 gb|EOA20143.1| hypothetical protein CARUB_v10000433mg [Capsella rubella]
Length=645

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/572 (53%), Positives = 401/572 (70%), Gaps = 15/572 (3%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             FTF+IK+L YNRL SLSRCL SL+AA Y    D   +HLH++IDHF +  N +  V+ NL
Sbjct  84    FTFLIKVLTYNRLHSLSRCLRSLSAADYGAAGDRGQIHLHVYIDHFNLARNDT-PVEDNL  142

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
             N++R IL FVD F W+FG KVVHYRT NAGLQAQWLEAWWPSSD EFAFVVEDDLEVSPL
Sbjct  143   NNAREILGFVDRFDWRFGEKVVHYRTDNAGLQAQWLEAWWPSSDHEFAFVVEDDLEVSPL  202

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+ FL+ +I NYYY+ SNFSP +YGASLQRPRFVPGKHGNK+ +D +T +FLYQLVGTWG
Sbjct  203   YYGFLERVIRNYYYDTSNFSPSVYGASLQRPRFVPGKHGNKIHVDPKTNIFLYQLVGTWG  262

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFPRPWKEFRLWYD HK+ G KP LDGMV+ GWYK++GERIWTPWFIKFIH+RGYFNI
Sbjct  263   QLLFPRPWKEFRLWYDEHKANGKKPFLDGMVSNGWYKRLGERIWTPWFIKFIHSRGYFNI  322

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   E ALS+SHRD+GVNY K+ GPDS L+ ++SI  + L+  PL ++KWYDFCF +V
Sbjct  323   YTNFPNEGALSVSHRDSGVNYAKTAGPDSKLLNKSSISSDSLKLQPLSNLKWYDFCFSEV  382

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+V++ NELG+++PS+Q    +ILVSL+   +   RNLLCHFE+L  +N+I +GP S
Sbjct  383   VPGRVVRNLNELGTILPSVQIEKTIILVSLYDADKMFTRNLLCHFEKLNTQNHIFIGPSS  442

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +L  DL+ RGHPVID D   D +    K+++  S     KE    AYVVKK LELG+   
Sbjct  443   ELFYDLSRRGHPVIDADLFLDKLIKKSKTSYPNSV----KEALGNAYVVKKCLELGYSTW  498

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             V   N + ++    ++ + +    DF+ G++  ++  +SSS + K W       + A   
Sbjct  499   VFSSNTLLVDKGPLIDRVSSQY--DFYTGESSGILIVQSSSVSQKLWSNEFLHSIAA---  553

Query  873   TTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWS  694
             + T + +     +F ++VK+L EQKG +  T +    + N     A+++L   +  ++WS
Sbjct  554   SATENLTPKQSLDFSHLVKELVEQKGKRIKTVETMGIAENTVG-SANQSLGDGKAVLYWS  612

Query  693   SETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
              E  +N+I+ +L +L LW++D   SC  V+C+
Sbjct  613   PEVGSNIIRTKLEELNLWLIDDVFSCKTVVCH  644



>ref|XP_010419816.1| PREDICTED: uncharacterized protein LOC104705500 [Camelina sativa]
Length=618

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/577 (52%), Positives = 407/577 (71%), Gaps = 22/577 (4%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             FTF+IK+L YNRL  LSRCL SL+AA Y    D   +HLH++IDHF +  N +  V+ NL
Sbjct  55    FTFLIKVLTYNRLHPLSRCLRSLSAADYGVSGDRGQIHLHVYIDHFNLSRNDT-PVEDNL  113

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
             NS+R IL FVD F W+FG KVVHYRT NAGLQ+QWLEAWWPSSD EFAF+VEDDLE+SPL
Sbjct  114   NSAREILGFVDRFDWRFGEKVVHYRTDNAGLQSQWLEAWWPSSDHEFAFIVEDDLELSPL  173

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+ FL+ +I NYYY+ SNF+P +YGASLQRPRFVPGKHG ++ ID +T + LYQLVGTWG
Sbjct  174   YYGFLERVIRNYYYDPSNFNPSVYGASLQRPRFVPGKHGKRIHIDPKTNLLLYQLVGTWG  233

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFPRPWKEFRLW+D HK+ G KP LDGMV+ GWYK++GERIWTPWFIKF+H+RGYFNI
Sbjct  234   QLLFPRPWKEFRLWFDEHKANGKKPFLDGMVSNGWYKRLGERIWTPWFIKFVHSRGYFNI  293

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   E ALS+SHRD+GVNY K+ GPDS L+ ++SI  + L+  PL ++KWYDFCF +V
Sbjct  294   YTNFPNEGALSVSHRDSGVNYAKTAGPDSQLLNKSSISSDSLKLQPLSNLKWYDFCFSEV  353

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+V++ NELG+++PS+Q    +IL+SL++  ++ +RNLLCHFE+L  +N+I +GP S
Sbjct  354   VPGRVVRNLNELGTILPSVQIERTIILISLYEADKAFIRNLLCHFEKLNTQNHIFVGPSS  413

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +L  DL+ RGHPVID D   D + +  K+++  S     KE    AYVVKK LELG+   
Sbjct  414   ELFYDLSRRGHPVIDADMFLDKL-IKSKTSYPNSV----KEALGNAYVVKKCLELGYSTW  468

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             V   N + ++    ++ + ++   DF+ G++  ++  +SSS + K W       +     
Sbjct  469   VVSSNALLVDKGPIIDRVSSEY--DFYTGESSGILIVQSSSVSQKLWSNEFLRSI-----  521

Query  873   TTTSSDSDPTGKN---FVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFV  703
              T+S   +PT K    F+++VK+L EQKG    T +    + N  +   +++L   +  +
Sbjct  522   -TSSPTKNPTPKQSIYFIHLVKELVEQKGKSIKTLETMGVAENTVT-STNQSLGDGKAVL  579

Query  702   FWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +WS E  +N+I+ +L +L LW++D D+SC  V+C+ S
Sbjct  580   YWSPEVGSNIIRTKLEELNLWLIDDDLSCKTVVCHRS  616



>emb|CDX97181.1| BnaC09g44440D [Brassica napus]
Length=616

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/574 (52%), Positives = 409/574 (71%), Gaps = 20/574 (3%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             FTF+IK+L +NR  SLSRCL SL+AA Y    D   +HLH+++DHF   +  S  V   L
Sbjct  57    FTFLIKVLTFNRPHSLSRCLLSLSAADYGVAGDTQRIHLHVYVDHFKPLSPNSKSVGDRL  116

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
             ++++ ILDFVD F W+FG K+VHYRT NAGLQ QWLEAWWPSSD EFAFVVEDDLEVSPL
Sbjct  117   SNAKEILDFVDKFEWRFGEKLVHYRTGNAGLQGQWLEAWWPSSDHEFAFVVEDDLEVSPL  176

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+ FL+++I +YYY+ SN+ P +YGASLQRPRFVPGKHGNK+ +D +T VFLYQLVGTWG
Sbjct  177   YYGFLESVIRSYYYDRSNYDPSVYGASLQRPRFVPGKHGNKLHLDPKTNVFLYQLVGTWG  236

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD HKSK  KP LDGMVT GWYK++GERIWTPWFIKFIH+RGYFNI
Sbjct  237   QLLFPKPWKEFRLWYDEHKSKDKKPFLDGMVTNGWYKRLGERIWTPWFIKFIHSRGYFNI  296

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   ERALS+SHRDAGVNYGK+ GPDS L+ +++I  + L+  PL ++KWYD+CF +V
Sbjct  297   YTNFQNERALSVSHRDAGVNYGKTAGPDSELLNKSTITSDFLKLQPLSNLKWYDYCFSEV  356

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
                R+V+  NELG+++PS+Q+   V+LVSL    +  +RNLLCHFE++  RN++ +GP S
Sbjct  357   VSGRVVRSLNELGAILPSVQRDKTVVLVSLFGADKMFIRNLLCHFEKIDTRNHVFIGPSS  416

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +L  DL+ RGHPVID D   D + V  K++++ S     KE    AYVVKK LELG+   
Sbjct  417   ELFYDLSRRGHPVIDADMFLDKL-VKSKTSYSNSV----KEALGNAYVVKKCLELGYSTW  471

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             V   N + ++    L+ + ++   DF++G++  ++  +SS  A K W    S++L   +I
Sbjct  472   VFSSNALLVDKSPLLDRVRSEY--DFYIGESSGILIVQSSPVAQKLW----SNELLNNII  525

Query  873   TTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWS  694
             ++ + + D     F+ +VK+L E+KG    T +    + N ++   +++L   +  V+WS
Sbjct  526   SSATKNLD-----FIQLVKELVERKGKMIKTVETMSIAENNNANSVNQSLGDGKPVVYWS  580

Query  693   SETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              E  +N+I+ +L +L LW++D D+SC AVIC+ S
Sbjct  581   PEVDSNIIRTKLEELKLWLIDDDLSCKAVICHSS  614



>ref|XP_010491984.1| PREDICTED: uncharacterized protein LOC104769466 [Camelina sativa]
Length=636

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/577 (52%), Positives = 405/577 (70%), Gaps = 21/577 (4%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             FTF+IK+L YNRL SLSRCL SL+AA Y    D   +HLH++IDHF +  N +  V+ NL
Sbjct  72    FTFLIKVLTYNRLHSLSRCLRSLSAADYGVSGDRGQIHLHVYIDHFNLARNDTTPVEDNL  131

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
             NS++ IL FVD F W+FG KVVHYRT N GLQ+QWLEAWWPSSD EFAF+VEDDLE+SPL
Sbjct  132   NSAKEILGFVDRFDWRFGEKVVHYRTDNVGLQSQWLEAWWPSSDHEFAFIVEDDLELSPL  191

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+ FL+ +I +YYY+ SNF+P +YGASLQRPRFVPGKHGNK+ +D +T + LYQLVGTWG
Sbjct  192   YYGFLERVIRHYYYDTSNFNPSVYGASLQRPRFVPGKHGNKIHVDPKTNLLLYQLVGTWG  251

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFPRPWKEFRLW+D HK+ G KP LDGMV+ GWYKK+GERIWTPWFIKF+H+RGYFNI
Sbjct  252   QLLFPRPWKEFRLWFDEHKANGKKPFLDGMVSNGWYKKLGERIWTPWFIKFVHSRGYFNI  311

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   E ALS+SHRD+GVNY K+ GPDS L+ ++SI  + L+  PL ++KWYDFCF +V
Sbjct  312   YTNFPNEGALSVSHRDSGVNYAKTAGPDSQLLNKSSISYDSLKLQPLSNLKWYDFCFSEV  371

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+V++ NELG+++PS+Q    VIL+SL+   E  +RNLLCHFE+L   N+I +GP S
Sbjct  372   VPGRVVRNLNELGTILPSVQIERTVILISLYDADEMFIRNLLCHFEKLNTPNHIFIGPSS  431

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +L  DL+ RGHPVID D   D + +  K+++  S     KE    AYVVKK LELG+   
Sbjct  432   ELFYDLSRRGHPVIDADMFLDKL-IKSKTSYPNSV----KEALGNAYVVKKCLELGYSTW  486

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             V   N + ++    ++ + ++   DF+ G++  ++  +SSS + K W       + +   
Sbjct  487   VFSSNALLVDKGPLIDKVSSEY--DFYTGESSGILIVQSSSVSRKLWSNEFLHSIAS---  541

Query  873   TTTSSDSDPTGK---NFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFV  703
                S+  +PT K   +F+++VK+L EQKG +  T +    + N  +   +++L   +   
Sbjct  542   ---SATKNPTPKQSIDFIHLVKELVEQKGKRIKTLETMGVADNTVT-STNQSLGDGKAVF  597

Query  702   FWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +WS E  +N+I+ +L  L LW++D D+SC  V+C+ S
Sbjct  598   YWSPEVRSNIIRTKLEDLNLWLIDDDLSCKTVVCHRS  634



>ref|XP_010453292.1| PREDICTED: uncharacterized protein LOC104735241 [Camelina sativa]
Length=634

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/577 (52%), Positives = 407/577 (71%), Gaps = 22/577 (4%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             FTF+IK+L YNRL SLSRCL SL+AA Y    D   +HLH++IDHF +  N +  V+ NL
Sbjct  71    FTFLIKVLTYNRLHSLSRCLRSLSAADYGVSGDRGKIHLHVYIDHFNLARNDT-PVEDNL  129

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
             NS+R IL FVD F W+FG KVVHYRT NAGLQAQWLEAWWPSSD EFAFVVEDDLE+SPL
Sbjct  130   NSAREILGFVDRFDWRFGEKVVHYRTDNAGLQAQWLEAWWPSSDHEFAFVVEDDLELSPL  189

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+ FL+ +I NYYY+ SNF+P +YGASLQRPRFVPGKHGNK+ +D +T + LYQLVGTWG
Sbjct  190   YYGFLERVIRNYYYDPSNFNPSVYGASLQRPRFVPGKHGNKIHVDPKTNLLLYQLVGTWG  249

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFPRPWKEFRLW+D HK+ G KP LDGMV+ GWYK++GERIWTPWFIKF+H+RGYFNI
Sbjct  250   QLLFPRPWKEFRLWFDEHKANGKKPFLDGMVSNGWYKRLGERIWTPWFIKFVHSRGYFNI  309

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   E ALS+SHRD+GVNY K+ GPDS L+ ++S+  + L+  PL ++KWYDFCF +V
Sbjct  310   YTNFPNEGALSVSHRDSGVNYAKTAGPDSQLLNKSSVSFDSLKLQPLSNLKWYDFCFSEV  369

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+V++ NELG+++PS+Q    +IL+SL+   +  +RNLLCHFE+L  +N+I +GP S
Sbjct  370   VPGRVVRNLNELGTILPSVQIEKTIILISLYDADKIFIRNLLCHFEKLNTQNHIFIGPSS  429

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +L  DL+ RGHPVID D   D + +  K+++  S     KE    AYVV+K LELG+   
Sbjct  430   ELFYDLSRRGHPVIDADMFLDKL-IKSKTSYPNSV----KEALGNAYVVQKCLELGYSTW  484

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             V   N + ++    ++ + ++   DF+ G++  ++  +SSS + K W       +     
Sbjct  485   VVSSNALLVDKGPIIDRVSSEY--DFYTGESSGILIVQSSSVSRKLWSNEFLHSIA----  538

Query  873   TTTSSDSDPTGK---NFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFV  703
               +S+  +PT K   +F+++VK+L EQKG +  T  E       +    +++L   +  +
Sbjct  539   --SSATKNPTPKQSIDFIHLVKELVEQKGKRIKTL-ETMGVAESTVTSTNQSLGDGKAVL  595

Query  702   FWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +WS +  +N+I+ +L +L LW++D D+SC  V+C+ S
Sbjct  596   YWSPKVGSNIIRTKLEELNLWLIDDDLSCKTVVCHKS  632



>ref|XP_003565675.1| PREDICTED: uncharacterized protein LOC100842839 [Brachypodium 
distachyon]
Length=614

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/575 (52%), Positives = 400/575 (70%), Gaps = 17/575 (3%)
 Frame = -3

Query  2313  DNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             D + F+ +IKLLAY+R + L RCL SLAAA Y    V LH+ +DH P  ++A+L     L
Sbjct  48    DPRHFSLLIKLLAYDRPAPLLRCLRSLAAADYAGDRVALHVLLDHRPPNSSAAL-----L  102

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
              +S  IL  VDAF W  G K VHYRT+NAGLQAQW+EAWWP SDDEFAFVVEDDLEVSPL
Sbjct  103   AASHEILTAVDAFRWPHGEKSVHYRTANAGLQAQWIEAWWPGSDDEFAFVVEDDLEVSPL  162

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+ FLK +++ YYY+  N+SP ++GASLQRPRFV GKHGNK+++DS+TR+FLYQ+VGTWG
Sbjct  163   YYGFLKRVVMRYYYDRENYSPYVFGASLQRPRFVAGKHGNKIQLDSQTRLFLYQMVGTWG  222

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD  K+KG KP+L GM TTGWYKKMGERIWTPWFIKF+H+RGYFNI
Sbjct  223   QLLFPKPWKEFRLWYDEQKAKGAKPILQGMKTTGWYKKMGERIWTPWFIKFVHSRGYFNI  282

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN L ERALSISHRDAGVNYG+SVGPDS L+  N++D N  E  PL  +KWYDFCF ++
Sbjct  283   YTNFLKERALSISHRDAGVNYGRSVGPDSTLLDGNNLDFNIRELQPLKKLKWYDFCFAEI  342

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+V  ++ELGSV+ S+Q  ++V+L+SLH     ++RNL+CH E+  +RNYI +G  S
Sbjct  343   LPGRVVSKYSELGSVLKSVQLENSVVLISLHSVEHRIMRNLICHLEKAGMRNYIFLGDNS  402

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             + L DLA RGH VID   L  +I +    N +        EI  K+YV++  L+LG+ + 
Sbjct  403   EFLDDLAHRGHAVIDAIGLLQSITMSSSMNSD----GFIMEILAKSYVIQSCLDLGYNLW  458

Query  1053  VADCNRVPLNSDSFLNFID-TDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAEL  877
             + + N +PL S      I+ +D   DFF   +++L+F RSS  + KTW E I S +   +
Sbjct  459   MLNGNMIPLGS----KLIEPSDQSVDFFAADSMDLMFIRSSQGSKKTWNERIMSSVAGSV  514

Query  876   ITTTSSDSDPTGK-NFVYVVKKLFEQKG-VKFTTFDENKSSLNISSLDASRTLS-IQEQF  706
             +++    +      NFV ++  + E  G  +    +E   ++ +    ++++LS  Q + 
Sbjct  515   MSSKGGFAASLKHLNFVDILTGVLENNGDARLAKLNEGIMAVELEPNISNKSLSDGQSKV  574

Query  705   VFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVIC  601
             +FWS   ++N +Q+QL  + LW++DSD+SC AV+C
Sbjct  575   LFWSHNMASNSVQRQLRNVDLWLIDSDLSCGAVVC  609



>gb|KFK25502.1| hypothetical protein AALP_AA8G123000 [Arabis alpina]
Length=609

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/579 (53%), Positives = 403/579 (70%), Gaps = 23/579 (4%)
 Frame = -3

Query  2316  ADNKSFTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLD  2149
              D   FTF+IK+L YNRL SLSRCL SL+AA Y    D   +HLH++IDHF +  N S  
Sbjct  50    GDLPPFTFLIKVLTYNRLHSLSRCLRSLSAADYGGAGDRGRIHLHVYIDHFSLARNKS--  107

Query  2148  VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDL  1969
             V+ NL S+R IL+FVD F W+FG KVVHYRT NAGLQ QWLEAWWPSSD EFAFVVEDDL
Sbjct  108   VEDNLKSAREILEFVDRFEWRFGEKVVHYRTDNAGLQEQWLEAWWPSSDHEFAFVVEDDL  167

Query  1968  EVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQL  1789
             EVSPLY++FL+ +I +YYY++SN +P IYGASLQRPR VPGKHGNK+++D +T VFLYQL
Sbjct  168   EVSPLYYKFLERVIRDYYYDSSNSNPSIYGASLQRPRLVPGKHGNKLRVDPKTNVFLYQL  227

Query  1788  VGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHAR  1609
             VGTWGQLLFP+PWKEFRLWYD HKS G KP L GMV+ GWYK+MGERIWTPWFIKF+ +R
Sbjct  228   VGTWGQLLFPKPWKEFRLWYDEHKSTGKKPFLVGMVSNGWYKRMGERIWTPWFIKFVQSR  287

Query  1608  GYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDF  1429
             GYFNIYTN   E ALS+SHRDAGVNY KS G DS L+ ++SI  + L+  PL ++KWYD+
Sbjct  288   GYFNIYTNFPNEGALSVSHRDAGVNYRKSAGADSQLLNKSSIGSDFLKLQPLRNLKWYDY  347

Query  1428  CFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYIL  1249
             CF +V P R+V++ NELG+++PS+Q+   +ILVSL    +  +RNLLCHFE+L  RN+I 
Sbjct  348   CFSEVVPGRVVRNMNELGTILPSVQRERTIILVSLFAADKMFIRNLLCHFEKLNTRNHIF  407

Query  1248  MGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLEL  1069
             +GP S+L  DL+ RG+PVID D   D + +  K+ +  S     KE    AYVVKK LEL
Sbjct  408   IGPSSELFYDLSRRGYPVIDADMFLDKL-IKSKTPYLNS----VKEALANAYVVKKCLEL  462

Query  1068  GFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQL  889
             G+   V   N + ++    ++ I ++   DF+VG++  ++  +SS    K W        
Sbjct  463   GYNTWVFSSNALLVDKGPLVDRISSEY--DFYVGESSGVLIVQSSPVTQKLWSN------  514

Query  888   GAELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQ  709
               E + + +S       +F+++VK+L +QKG +  T +    + NI +   +++L   + 
Sbjct  515   --EFLRSIASSKQSL--DFIHLVKELVKQKGKRIKTIETMSIAENIDARSVNQSLGDGKP  570

Query  708   FVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
              V WS E  +N+I+ +L +L LW+ D D+SC AV+C+ S
Sbjct  571   LVSWSPEVGSNIIRTKLTELNLWLTDDDLSCKAVLCHNS  609



>ref|XP_002871521.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=631

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/578 (52%), Positives = 403/578 (70%), Gaps = 15/578 (3%)
 Frame = -3

Query  2313  DNKSFTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDV  2146
             D   FTF+IK+L +NRL SLSRCL SL+AA Y    D   +HLH++IDHF +  N +  V
Sbjct  65    DPPPFTFLIKVLTFNRLYSLSRCLRSLSAADYGVSGDKGRIHLHVYIDHFNLARNDT-PV  123

Query  2145  DRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLE  1966
             + NLNS+R IL FVD F W+FG KVVHYRT NAGLQAQWLEAWWPSSD EFAFVVEDDLE
Sbjct  124   EDNLNSAREILGFVDRFEWRFGEKVVHYRTDNAGLQAQWLEAWWPSSDHEFAFVVEDDLE  183

Query  1965  VSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLV  1786
             VSPLY+  L+ LI  YYY+ SNF+P IYGASLQRPRFVPGKHGNK+ +D +T + LYQLV
Sbjct  184   VSPLYYGILERLIHKYYYDTSNFNPSIYGASLQRPRFVPGKHGNKLHVDPKTNLLLYQLV  243

Query  1785  GTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARG  1606
             GTWGQLLFP+PWKEFRLWYD HKS   KP LDGMVT GWYK++GERIWTPWFIKF+H+RG
Sbjct  244   GTWGQLLFPKPWKEFRLWYDEHKSNAKKPFLDGMVTNGWYKRLGERIWTPWFIKFVHSRG  303

Query  1605  YFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFC  1426
             YFNIYT+   E ALS+SHRDAGVNYGK+ GPDS L+ ++++  + L+  PL ++KWYDFC
Sbjct  304   YFNIYTSFPNEGALSVSHRDAGVNYGKTAGPDSQLLNKSALSSDSLKLQPLSNLKWYDFC  363

Query  1425  FKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILM  1246
             F +V P R+V++ NELG+++PS+Q    +ILVSL+   +   RNLLCHFE+L  +N+I +
Sbjct  364   FSEVVPGRVVRNLNELGTILPSVQSDKTIILVSLYGAEKMFTRNLLCHFEKLNTQNHIFI  423

Query  1245  GPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELG  1066
             GP S+L  DL+ RGHPVID D L D + +  K+++  S     KE    A+VVKK LELG
Sbjct  424   GPSSELFYDLSRRGHPVIDADMLLDKL-IKSKTSYPNSV----KEALGNAFVVKKCLELG  478

Query  1065  FGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLG  886
             +       N + ++    L+ +  +   D ++ ++  ++  +SSS   K W       + 
Sbjct  479   YSTWAFSSNSLLVDKGPLLDRVSAEY--DIYIRESSGILIVQSSSVTQKLWSNEFLHSIT  536

Query  885   AELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQF  706
             +     T + S     +++++VK+L EQKG +  T +    + N ++   +++L   +  
Sbjct  537   S---AATKNPSLNQSLDYIHLVKELVEQKGKRIKTVETMDIAENTNANSVNQSLGDGKPV  593

Query  705   VFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             V+WS + + N+I+ +L +L LW++D D+SC AV+C+ S
Sbjct  594   VYWSPKVAPNMIRSKLEELNLWLIDDDLSCKAVVCHNS  631



>ref|XP_006399741.1| hypothetical protein EUTSA_v10012969mg [Eutrema salsugineum]
 gb|ESQ41194.1| hypothetical protein EUTSA_v10012969mg [Eutrema salsugineum]
Length=624

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/577 (52%), Positives = 403/577 (70%), Gaps = 15/577 (3%)
 Frame = -3

Query  2316  ADNKSFTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLD  2149
              D   FTF+IK+L +NRL SLSRCL SLAAA Y    D   +HLH++IDHF + A     
Sbjct  50    GDAPPFTFLIKVLTFNRLHSLSRCLRSLAAAEYGVAGDTGRIHLHVYIDHFSL-AREDKS  108

Query  2148  VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDL  1969
             V+ NL S+R IL+FVD F W+FG K VHYRT NAGLQ QWLEAWWPSSD EFAFVVEDDL
Sbjct  109   VEANLKSAREILEFVDGFEWRFGEKSVHYRTDNAGLQRQWLEAWWPSSDHEFAFVVEDDL  168

Query  1968  EVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQL  1789
             EVSPLY+ FL+ +I +YYY+ SNF+P IYGASLQRPR VPGKHGNK+ +D +T VFLYQL
Sbjct  169   EVSPLYYGFLERVIRDYYYDTSNFNPSIYGASLQRPRLVPGKHGNKLYVDPKTNVFLYQL  228

Query  1788  VGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHAR  1609
             VGTWGQLLFP+PWKEFRLWYD HKS G KP LDGMVT GWYK++GERIWTPWFIKFI +R
Sbjct  229   VGTWGQLLFPKPWKEFRLWYDEHKSNGKKPFLDGMVTNGWYKRIGERIWTPWFIKFIQSR  288

Query  1608  GYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDF  1429
             GYFNIYT+   + ALS+SHRDAGVNY K+ G DS L+ ++SI  + L+  PL ++KWYD+
Sbjct  289   GYFNIYTHFPNDGALSVSHRDAGVNYRKTAGADSQLLNKSSITSDFLKLQPLSNLKWYDY  348

Query  1428  CFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYIL  1249
             CF +V P R+V++ NELG+++PS+Q+   +ILVSL    +  VRNLLCHFE+L  +N+I 
Sbjct  349   CFSEVVPCRVVRNLNELGTILPSVQREKTIILVSLFAADKMFVRNLLCHFEKLNTQNHIF  408

Query  1248  MGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLEL  1069
             +GP S+L  DL+ RGHPVID D   D + +  K+++  S     KE    AYVVKK LEL
Sbjct  409   IGPSSELFYDLSRRGHPVIDADMFLDKL-MKSKTSYPNS----VKEALGNAYVVKKCLEL  463

Query  1068  GFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQL  889
             G+   V   N + ++    +  I ++   DF+VG++  ++  +SSS+  K W   +   L
Sbjct  464   GYSTWVFSSNALLVDKGPLVRRISSEY--DFYVGESSGILVVQSSSATQKLWSNEL---L  518

Query  888   GAELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQ  709
              + + + T + S     +F+++VK+L E+KG +    +    + N +    +++L   + 
Sbjct  519   HSIISSATKNPSLKPSLDFIHLVKELVERKGKRIKNVEMMGIAENTNDNSVNQSLGEGKP  578

Query  708   FVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
              VFWS E  + +I+ +L +L LW++D D+SC AV+C+
Sbjct  579   VVFWSPEVGSKIIRTKLAELNLWLIDDDLSCKAVVCH  615



>ref|XP_006644072.1| PREDICTED: uncharacterized protein LOC102715342 [Oryza brachyantha]
Length=611

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/575 (53%), Positives = 407/575 (71%), Gaps = 21/575 (4%)
 Frame = -3

Query  2313  DNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             D + F+F+IK+LA +R + L RCL SLAAA Y    V LH+ +DH   P NASLD     
Sbjct  50    DPRRFSFLIKVLAXDRPAPLRRCLRSLAAADYAGDRVALHVLVDH--PPPNASLD-----  102

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
              +SR IL   DAF W  G K VHYR +NAGLQAQW+EAWWP SDDEFAFVVEDDLEVSPL
Sbjct  103   -ASREILAEADAFRWPHGEKRVHYRAANAGLQAQWIEAWWPGSDDEFAFVVEDDLEVSPL  161

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+RFLK +++ YYY+  N+SP ++GASLQRPRFV GKHGNK+++DS TR+FLYQ+VGTWG
Sbjct  162   YYRFLKRVVMTYYYDRKNYSPFVFGASLQRPRFVAGKHGNKIQLDSETRLFLYQMVGTWG  221

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD HKSKG+KP+L+GM TTGWYKKMGERIWTPWFIKF+H+RGYFN 
Sbjct  222   QLLFPKPWKEFRLWYDEHKSKGIKPILEGMKTTGWYKKMGERIWTPWFIKFVHSRGYFNF  281

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN L ERALS+SHRDAGVNYGKSVGPDS L+   ++D N  E  PL+ +KWYDFCF +V
Sbjct  282   YTNFLKERALSVSHRDAGVNYGKSVGPDSTLLDGKNLDFNIWELQPLNKLKWYDFCFSEV  341

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+V+ F+ELGSV+ S+Q  +N++L+SL+   + + RN++CH E+  ++NYI +    
Sbjct  342   LPGRVVRKFSELGSVLNSVQLENNIVLISLYSIEQRIARNMICHLEKAGMQNYIFLVSNP  401

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
                 DLA RGHPVID   L  +I++ + S +++  V   +EI VKA+VVKK L+LG+ + 
Sbjct  402   QFQDDLAHRGHPVIDGTGLLQSIKMSN-SMYSDDFV---EEIMVKAHVVKKCLDLGYNVW  457

Query  1053  VADCNRVPLNSDSFLNFID-TDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAEL  877
             V + N + L S      I+ +D   D F  ++++L+F R S S+ KTW E +  ++G  L
Sbjct  458   VLNGNMISLGS----KLIEPSDQSVDLFAAESVDLIFLRGSQSSKKTWNELVILRMGDGL  513

Query  876   ITTTSS-DSDPTGKNFVYVVKKLFEQKG-VKFTTFDENKSSLNISSLDASRTLSIQE-QF  706
             +++ S   S    KNFV ++ K+   KG V+    DE    + +    ++R+LS    + 
Sbjct  514   MSSKSDFYSSLERKNFVGMLTKVLGSKGDVRVGKLDE-IVPVELGPHTSNRSLSEGHCKV  572

Query  705   VFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVIC  601
             +FWS   +++ +Q QL  +GLW+ D+D SC+AV+C
Sbjct  573   IFWSHGMASDSVQSQLENMGLWLTDADSSCSAVVC  607



>gb|EPS70165.1| hypothetical protein M569_04597, partial [Genlisea aurea]
Length=571

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/585 (55%), Positives = 416/585 (71%), Gaps = 27/585 (5%)
 Frame = -3

Query  2307  KSFTFIIKLLAYnrlsslsrclnsLAAAHYD-HHAVHLHIFIDHFPVP-ANASLDVDRNL  2134
             + FTFIIK+LAY+R+SSLSRCLNSL+ AHYD    VHLH+FIDHF +     S   D++L
Sbjct  1     RDFTFIIKVLAYDRISSLSRCLNSLSRAHYDVGDKVHLHVFIDHFRLDYGTPSAVTDQSL  60

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
             N+S  ILDFVD F W FG KVVHYRTSN GLQAQWLE+WWPSS+ EFAFVVEDD+EVSPL
Sbjct  61    NTSNEILDFVDMFDWAFGEKVVHYRTSNVGLQAQWLESWWPSSNHEFAFVVEDDMEVSPL  120

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+RFLK LI+NYYYN+SN SP +YGASLQRPRFVPGKHGN++ +D  +R+FLYQLVGTWG
Sbjct  121   YYRFLKALILNYYYNSSNSSPKVYGASLQRPRFVPGKHGNEINLDVESRIFLYQLVGTWG  180

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP PWKEFR WYD  K+K MKP+LDGM+TT WYK+MGERIWTPWFIKFIH+ GYFN+
Sbjct  181   QLLFPGPWKEFRRWYDVRKAKNMKPILDGMITTRWYKRMGERIWTPWFIKFIHSSGYFNL  240

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGE-NSIDINHLEFHPLHSMKWYDFCFKQ  1417
             YTN     ALSISHR+AGV+     GPDS+L+ + NSI  + LE  PL ++KWYDFCF++
Sbjct  241   YTNFHNSTALSISHREAGVSNRAMSGPDSDLMMDGNSIGSDLLELPPLDNLKWYDFCFRE  300

Query  1416  VFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPK  1237
             V  +R +   N+LGSVI SLQK  +++ +SL++     +RN+LCHFERL IRNYIL+GP 
Sbjct  301   VLTNRFIGSLNDLGSVIQSLQKDGSILFLSLYRAHVKGIRNILCHFERLNIRNYILIGPS  360

Query  1236  SDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFN--ESAVKLTKEIFVKAYVVKKTLELGF  1063
             SD L+DL+ RGH VID  + Y     YD  + N  +S ++  +EI VKAY +KK+LEL  
Sbjct  361   SDFLIDLSRRGHAVIDAAQFY-----YDTKSLNLRDSNIERIEEIVVKAYAIKKSLELSL  415

Query  1062  GILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGA  883
               L  D + +PL +DSF + +     +DF++GK+  +++ R S+S +K W         A
Sbjct  416   NTLFLDGHLLPLYNDSFFDILGRSG-DDFYIGKSSGILYTRGSTSVSKIW--------SA  466

Query  882   ELITTTSSDSDPTGKN----FVYVVKKLFEQK-GVKFTTFDENKSSLNISSLDASRTLSI  718
             ELI + +SD +    +    F+Y V+K  E+K  VK    DE K    I S + S T S+
Sbjct  467   ELIHSFASDVNGESVSRDHLFLYGVEKFLEKKHNVKVKNIDEMKLGFEIGSYNVSMTKSL  526

Query  717   QE--QFVFWS-SETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +   +FV+WS   T  + IQ+ L   GLW+VD+D SCTAV C+ +
Sbjct  527   ENTVRFVYWSYGRTDIDTIQKGLEHFGLWVVDADSSCTAVFCHGT  571



>ref|XP_009393099.1| PREDICTED: uncharacterized protein LOC103978875 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/574 (52%), Positives = 405/574 (71%), Gaps = 9/574 (2%)
 Frame = -3

Query  2310  NKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHF-PVPANASLDVDRNL  2134
             N  FTFIIKLL ++R+ SL RCL SLA A Y    VHLH+ +DHF P   +++  VDR L
Sbjct  47    NPRFTFIIKLLTFDRIDSLRRCLRSLATADYAGDRVHLHVLVDHFRPANGSSAPSVDRKL  106

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
               SRRILD +D F W  G K+VHYRT+N GLQAQWLEAWWPSSDDEFAFVVEDDLE+SPL
Sbjct  107   EESRRILDLIDRFRWVHGEKIVHYRTANVGLQAQWLEAWWPSSDDEFAFVVEDDLELSPL  166

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y++FLK LI+ YYY+ +N++  IYGASLQRPRFV GK GNK+++ S TR+FLYQ+VGTWG
Sbjct  167   YYKFLKRLILKYYYDPANYNASIYGASLQRPRFVAGKKGNKLQLSSETRIFLYQMVGTWG  226

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PW EFRLWYD HK+K +KP+L GMVTTGWYK+ GERIWTPWFIKFIHARGY+N+
Sbjct  227   QLLFPKPWNEFRLWYDEHKAKEIKPILQGMVTTGWYKRFGERIWTPWFIKFIHARGYYNL  286

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   ERALSISHRDAGVNYGK+VGPDS+L+ + S+D +  E  PL ++KWYDFCF + 
Sbjct  287   YTNFKQERALSISHRDAGVNYGKTVGPDSSLLVDESLDFSLTELPPLRNLKWYDFCFAET  346

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P RIV +F++L S++ SL K   + ++SL+Q +E + RNL+C+ E++ + N+IL+G   
Sbjct  347   HPGRIVSNFDQLRSILHSL-KQKTIFVISLYQTTERIARNLICNLEKVGLVNFILLGGSP  405

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +LL+DLA RG+PV+DT +L  +IR   KS   E    + KEI++KA  V+K LE G+ + 
Sbjct  406   ELLIDLARRGYPVVDTSQLVSSIRQV-KSIDLEHEPDIIKEIWIKATTVQKCLEFGYDLW  464

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             + D N +P      L  +   +  DF + KN EL+F +SS S+ KTW +    ++ AE  
Sbjct  465   LIDGNMIP--GSGLLPELPNPSY-DFAIAKNAELLFVKSSPSSLKTWNDDYIHKVAAECK  521

Query  873   TTTSSDS-DPTGKNFVYV-VKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVF  700
             + T ++S +   KNF Y+ ++ L E  G +    D++   + +     + T S +   VF
Sbjct  522   SLTGTNSPEMEHKNFAYLAMRGLDENAGARLWRLDDSDIGVKLGYDTMNHTES-KLNMVF  580

Query  699   WSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
             W  E +   +Q++L + G+W++D D SC +V+C+
Sbjct  581   WDQEMALTSVQRELDRSGMWLIDVDSSCVSVVCH  614



>ref|XP_008810362.1| PREDICTED: uncharacterized protein LOC103721799, partial [Phoenix 
dactylifera]
Length=524

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/534 (55%), Positives = 378/534 (71%), Gaps = 21/534 (4%)
 Frame = -3

Query  2169  PANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFA  1990
             PAN S  +DR L  SRRILD VD F W  G K+VHYRT+N GLQAQWLEAWWP SDD+FA
Sbjct  1     PANGSALLDRKLEESRRILDLVDGFSWPHGEKLVHYRTANVGLQAQWLEAWWPKSDDDFA  60

Query  1989  FVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRT  1810
             FVVEDDLE+SPLY++FLK LI+ YYY+ SN+SP+IYGASLQRPRFV GKHGNK+ +DS T
Sbjct  61    FVVEDDLELSPLYYKFLKELILKYYYDRSNYSPLIYGASLQRPRFVAGKHGNKLWLDSET  120

Query  1809  RVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWF  1630
              +FLYQ+VGTWGQLLFPRPWKEFRLWYD HK+KG+KP+L GMVTTGWYKKMG+RIWTPWF
Sbjct  121   HLFLYQMVGTWGQLLFPRPWKEFRLWYDVHKAKGIKPILQGMVTTGWYKKMGDRIWTPWF  180

Query  1629  IKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLH  1450
             IK+IH+RGY+NIYT+ L+ERALSIS+RDAGVNYGK+ GPDS L+ +NSID +  E  PL 
Sbjct  181   IKYIHSRGYYNIYTHFLHERALSISYRDAGVNYGKTAGPDSKLLDKNSIDFDLWELQPLK  240

Query  1449  SMKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERL  1270
             ++KWYDFCF++V   RIV+ + EL SV+ S ++   +ILVSL++  + + RNL+CH ER+
Sbjct  241   NLKWYDFCFREVHLGRIVRRYEELESVLRSFKEQKTIILVSLYRTVQRIARNLICHLERV  300

Query  1269  YIRNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSN-FNESAVKLTKEIFVKAY  1093
              ++N+IL+   S+ L+DLA RG+ VID   L  +I   DKSN F    + L KEI+VKA 
Sbjct  301   GLQNFILISDDSEFLIDLAQRGYSVIDAKLLISSIGS-DKSNGFEHFDMNLMKEIWVKAN  359

Query  1092  VVKKTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTW  913
             VVKK LELG+ + V D N +P+ S+  L     D   DFF  K++ L++ +SS S+ K W
Sbjct  360   VVKKILELGYNLWVLDWNIIPI-SNPLLEL--PDPSYDFFAAKDVGLMYMKSSPSSLKVW  416

Query  912   GESISSQLGAELITTTSSDS-DPTGKNFVYVVKKLFEQKG-VKFTTFDENK-------SS  760
                  S + A   +   S+S     KNF+Y   K  E KG V+    DE+         +
Sbjct  417   VADFISNVAAVGKSLLGSNSISLEQKNFLYFATKALEDKGDVRLWQLDESSIGVRLGDDA  476

Query  759   LNISSLDASRTLSIQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
             LN+S+LD+ + L       FWS   S   +Q++L  L +W++D D SC AV C+
Sbjct  477   LNLSALDSRKML-------FWSPGMSLTSVQRELENLDMWLIDGDSSCVAVFCH  523



>gb|EAY73544.1| hypothetical protein OsI_01427 [Oryza sativa Indica Group]
Length=609

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/574 (53%), Positives = 401/574 (70%), Gaps = 18/574 (3%)
 Frame = -3

Query  2313  DNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             D + F+ +IK+LAY+R   L RCL SLAAA Y    V L++ +DH P P NASLD     
Sbjct  46    DPRRFSLLIKVLAYDRPGPLRRCLRSLAAADYAGDRVALYVLVDH-PRP-NASLD-----  98

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
              +SR IL   DA  W  G K VHYR +NAGLQAQW+EAWWP SDDEFAFVVEDDLEVSPL
Sbjct  99    -ASREILAEADALRWPHGEKRVHYRAANAGLQAQWIEAWWPGSDDEFAFVVEDDLEVSPL  157

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+RFLK L++ YYY+  N+SP ++GASLQRPRFV GKHGNK+++DS T +FLYQ+VGTWG
Sbjct  158   YYRFLKRLVMAYYYDRENYSPYVFGASLQRPRFVAGKHGNKIQLDSETHLFLYQMVGTWG  217

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD HKSKG+KP+L+GM TTGWYKKMGERIWTPWFIKF+H+RGYFN 
Sbjct  218   QLLFPKPWKEFRLWYDEHKSKGIKPILEGMKTTGWYKKMGERIWTPWFIKFVHSRGYFNF  277

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN L ERALS+SHRDAGVNYG+SVGPDS L+   ++D N  E  PL+ +KWYDFCF +V
Sbjct  278   YTNFLKERALSVSHRDAGVNYGRSVGPDSTLLDGKNLDFNLWELQPLNKLKWYDFCFAEV  337

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+++ F+ELGSV+ S+Q  +NV+L+SL+   + + RNL+CH E+  +RNYI +   +
Sbjct  338   LPGRVIRKFSELGSVLKSVQLENNVVLISLYSLEQRIARNLICHLEKSGMRNYIFLVDNT  397

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             + L DLA RGHPVID   L  +I++   S +++  V   KEI VKAYV+K  L+LG+ + 
Sbjct  398   EFLDDLAHRGHPVIDAISLLQSIKM-SSSIYSDDFV---KEIVVKAYVIKNCLDLGYNLW  453

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGE-SISSQLGAEL  877
             V + N + L S   LN     +V DFF  ++++L+F R S S+ KTW E  I       +
Sbjct  454   VLNGNTISLGSK--LNEPSDQSV-DFFAAESVDLMFLRGSQSSKKTWNELDILRMADGMM  510

Query  876   ITTTSSDSDPTGKNFVYVVKKLFEQKG-VKFTTFDENKSSLNISSLDASRTLSIQE-QFV  703
              + +   S    KNFV V+  +    G V+    DE   ++ +    ++R+LS    + +
Sbjct  511   SSKSGFSSSLEHKNFVRVLTGVLGNNGAVRLGKLDEEIMAVELGPNTSNRSLSEGHCKVL  570

Query  702   FWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVIC  601
             FWS   +++ +Q QL   GLW++DSD SC+AV+C
Sbjct  571   FWSHSMTSDSVQSQLENRGLWLIDSDSSCSAVVC  604



>ref|NP_001042762.1| Os01g0283000 [Oryza sativa Japonica Group]
 dbj|BAB39953.1| OSJNBa0004B13.7 [Oryza sativa Japonica Group]
 dbj|BAB64213.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04676.1| Os01g0283000 [Oryza sativa Japonica Group]
 gb|EAZ11463.1| hypothetical protein OsJ_01332 [Oryza sativa Japonica Group]
Length=609

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/574 (53%), Positives = 400/574 (70%), Gaps = 18/574 (3%)
 Frame = -3

Query  2313  DNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             D + F+ +IK+LAY+R   L RCL SLAAA Y    V LH+ +DH P P NASLD     
Sbjct  46    DPRRFSLLIKVLAYDRPGPLRRCLRSLAAADYAGDRVALHVLVDH-PRP-NASLD-----  98

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
              +SR IL   DA  W  G K VHYR +NAGLQAQW+EAWWP SDDEFAFVVEDDLEVSPL
Sbjct  99    -ASREILAEADALRWPHGEKRVHYRAANAGLQAQWIEAWWPGSDDEFAFVVEDDLEVSPL  157

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+RFLK L++ YYY+  N+SP ++GASLQRPRFV GKHGNK+++DS T +FLYQ+VGTWG
Sbjct  158   YYRFLKRLVMAYYYDRENYSPYVFGASLQRPRFVAGKHGNKIQLDSETHLFLYQMVGTWG  217

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD HKSKG+KP+L+GM TTGWYKKMGERIWTPWFIKF+H+ GYFN 
Sbjct  218   QLLFPKPWKEFRLWYDEHKSKGIKPILEGMKTTGWYKKMGERIWTPWFIKFVHSCGYFNF  277

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN L ERALS+SHRDAGVNYG+SVGPDS L+   ++D N  E  PL+ +KWYDFCF +V
Sbjct  278   YTNFLKERALSVSHRDAGVNYGRSVGPDSTLLDGKNLDFNLWELQPLNKLKWYDFCFAEV  337

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R+++ F+ELGSV+ S+Q  +NV+L+SL+   + + RNL+C+ E+  +RNYI +   +
Sbjct  338   LPGRVIRKFSELGSVLKSVQLENNVVLISLYSLEQRIARNLICYLEKSGMRNYIFLVDNT  397

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             + L DLA RGHPVID   L  +I++   S +++  V   KEI VKAYV+K  L+LG+ + 
Sbjct  398   EFLDDLAHRGHPVIDAISLLQSIKM-SSSIYSDDFV---KEIVVKAYVIKNCLDLGYNLW  453

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGE-SISSQLGAEL  877
             V + N + L S   LN     +V DFF  ++++L+F R S S+ KTW E  I       +
Sbjct  454   VLNGNTISLGSK--LNEPSDQSV-DFFAAESVDLMFLRGSQSSKKTWNELDILRMADGMM  510

Query  876   ITTTSSDSDPTGKNFVYVVKKLFEQKG-VKFTTFDENKSSLNISSLDASRTLSIQE-QFV  703
              + +   S    KNFV V+  +    G V+    DE   ++ +    ++R+LS    + +
Sbjct  511   SSKSGFSSSLEHKNFVRVLTGVLGNNGAVRLGKLDEEIMAVELGPNTSNRSLSEGHCKVL  570

Query  702   FWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVIC  601
             FWS   +++ +Q QL   GLW++DSD SC+AV+C
Sbjct  571   FWSHSMTSDSVQSQLENRGLWLIDSDSSCSAVVC  604



>dbj|BAJ97305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=612

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/577 (51%), Positives = 399/577 (69%), Gaps = 20/577 (3%)
 Frame = -3

Query  2313  DNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             D   F+ +IKLLAY+R + L RCL SLAAA YD   V LH+ +DH P  ++A L     L
Sbjct  45    DPHRFSLLIKLLAYDRPAPLLRCLRSLAAADYDGDRVALHVLLDHRPPNSSAPL-----L  99

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
              +S  IL  VDAF W  G K VHYR +N GLQAQW+EAWWP SDDEFAFVVEDDLEVSPL
Sbjct  100   AASHEILTAVDAFPWPHGEKRVHYRAANVGLQAQWIEAWWPGSDDEFAFVVEDDLEVSPL  159

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+RFLK +++ YYY+  N+SP ++GASLQRPRFV GKHGNK+++DS TR+FLYQ+VGTWG
Sbjct  160   YYRFLKRVVMRYYYDRENYSPHVFGASLQRPRFVAGKHGNKIQLDSETRLFLYQMVGTWG  219

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD  K++G++P+L GM TTGWY+KMGERIWTPWFIKF+H+RGYFNI
Sbjct  220   QLLFPKPWKEFRLWYDEQKAQGIRPILQGMKTTGWYRKMGERIWTPWFIKFVHSRGYFNI  279

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN L ERALSISHRDAGVNYG+SVGPDS L+  N++D N  +  PL  + WYDFCF ++
Sbjct  280   YTNFLKERALSISHRDAGVNYGRSVGPDSTLLDGNNLDFNVWQLQPLKKLNWYDFCFAEI  339

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P R V+ F+ELGSV+ S+Q  +NV+L+SL+   + +VRNL+CH E+  +RNYI +G  S
Sbjct  340   LPGRFVRKFSELGSVLKSVQLGNNVVLISLYSVEQRIVRNLICHLEKTGMRNYIFVGDNS  399

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             + L DLA RGH VID   L   I++    N +       KE+  KAYV++  L LG+   
Sbjct  400   EFLDDLAHRGHAVIDAIGLLKGIKMSSYMNSD----GFGKEVLAKAYVIQHCLNLGYNTW  455

Query  1053  VADCNRVPLNSDSFLNFID-TDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAEL  877
             V D N + L S      ++ ++   D F    ++L+F R+S  + KTW E I S++ A+ 
Sbjct  456   VLDGNMISLGS----KLVEPSNQSVDIFTADPVDLIFIRNSQGSKKTWNEHIISKV-ADG  510

Query  876   ITTTSSDSDPTGKN--FVYVVKKLFEQK--GVKFTTFDENKSSLNISSLDASRTLSI-QE  712
             + +   D   + K+  FV+++ ++ E    GV+    +E   ++ +    ++R+LS  Q 
Sbjct  511   LLSPKGDLIASLKHVSFVHILTRVLENNGGGVRLGKLNEGIMTMELGPNMSNRSLSEGQS  570

Query  711   QFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVIC  601
             + +FWS   +++ +Q+QL  + LW++DSD SC+ V+C
Sbjct  571   KLLFWSHNVASDSVQRQLGNVNLWLIDSDSSCSGVVC  607



>ref|NP_196787.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB10044.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM74504.1| AT5g12260/MXC9_22 [Arabidopsis thaliana]
 gb|AAQ65093.1| At5g12260/MXC9_22 [Arabidopsis thaliana]
 gb|AED91784.1| uncharacterized protein AT5G12260 [Arabidopsis thaliana]
Length=624

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/578 (52%), Positives = 408/578 (71%), Gaps = 22/578 (4%)
 Frame = -3

Query  2313  DNKSFTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDV  2146
             D   FTF+IK+L +NRL SLSRCL SL+AA Y    D   +HLH++IDHF +  N +  V
Sbjct  65    DPAPFTFLIKVLTFNRLHSLSRCLRSLSAADYGVSGDRGRIHLHVYIDHFNLARNDT-PV  123

Query  2145  DRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLE  1966
             + NL  +R IL FVD F W+FG KVVHYRT NAGLQAQWLEAWWP SD EFAFVVEDDLE
Sbjct  124   EDNLQIAREILGFVDRFEWRFGEKVVHYRTDNAGLQAQWLEAWWPISDHEFAFVVEDDLE  183

Query  1965  VSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLV  1786
             VSPLY+  L+ LI+ YYY+ SNF+P IYGASLQRPRFVPGKHGNK+ +D +T + LYQLV
Sbjct  184   VSPLYYGILERLILKYYYDTSNFNPSIYGASLQRPRFVPGKHGNKLHVDPKTNLILYQLV  243

Query  1785  GTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARG  1606
             GTWGQLLFP+PWKEFRLWYD HKSKG KP LDGMV+ GWYK++GERIWTPWFIKF+H+RG
Sbjct  244   GTWGQLLFPKPWKEFRLWYDEHKSKGKKPFLDGMVSNGWYKRLGERIWTPWFIKFVHSRG  303

Query  1605  YFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFC  1426
             YFNIYT+   E ALS+SHRDAGVNYG++ GPDS L+ ++S+  + L+  PL ++KWYDFC
Sbjct  304   YFNIYTSFPNEGALSVSHRDAGVNYGRTAGPDSQLLNKSSLSSDSLKLQPLSNLKWYDFC  363

Query  1425  FKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILM  1246
             F +V P R+V++ NELG+++PS+Q+   +ILVSL+   +  +RNLLCHFE+L I+N+I +
Sbjct  364   FSEVVPGRVVRNLNELGTILPSVQREKTIILVSLYGADKMFIRNLLCHFEKLNIQNHIFI  423

Query  1245  GPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELG  1066
             GP S+L  DL+ RGHPVID D ++ N  +  K+++  S     KE    +YVVKK LELG
Sbjct  424   GPSSELFHDLSRRGHPVIDAD-MFLNKLIKSKTSYPNSV----KEALGNSYVVKKCLELG  478

Query  1065  FGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLG  886
             +       N + ++    L+ + +D   D ++G++  ++  +SSS   K W         
Sbjct  479   YSTWAFSSNSLLVDKGRLLDRVSSDY--DIYIGESSGILIVQSSSVTQKLWSN-------  529

Query  885   AELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQF  706
              E + + +S       +F+++VK+L EQKG +  T +    + N ++   +++L   +  
Sbjct  530   -EFLHSIASPKQSL--DFIHLVKELVEQKGKRIKTVETMNIAENTNANSVNQSLGDGKPV  586

Query  705   VFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             V+WS E + N+I+ +L +L LW++D D+SC AV+C+ S
Sbjct  587   VYWSPEVAPNMIRSKLEELSLWLIDDDLSCKAVVCHSS  624



>ref|XP_006405439.1| hypothetical protein EUTSA_v10028084mg [Eutrema salsugineum]
 gb|ESQ46892.1| hypothetical protein EUTSA_v10028084mg [Eutrema salsugineum]
Length=604

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/575 (52%), Positives = 394/575 (69%), Gaps = 34/575 (6%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHYDHHA----VHLHIFIDHFPVPANASLDVDRNL  2134
             FTF+IK+L ++RL SLSRCL SLAAA Y        VHLH++IDHF +P      V   L
Sbjct  57    FTFLIKVLTFSRLHSLSRCLRSLAAAEYGVAGATGRVHLHVYIDHFSLPRKDK-SVKDQL  115

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
              S++ ILDFVD F W+FG K+VHYRT+NAGLQ QWLEAWWPSSD EFAFVVEDDLE+SPL
Sbjct  116   RSAKEILDFVDKFEWRFGGKLVHYRTANAGLQGQWLEAWWPSSDHEFAFVVEDDLELSPL  175

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+ FL+ +I NYYY+ SNF+P +YGASLQRPRFVPGKHGNK+ +D RT VFLYQLVGTWG
Sbjct  176   YYSFLETVIHNYYYDHSNFNPSVYGASLQRPRFVPGKHGNKLHVDPRTNVFLYQLVGTWG  235

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD HKS   KP LDGMVT GWYK++GERIWTPWFIKFIH+RGYFNI
Sbjct  236   QLLFPKPWKEFRLWYDDHKSNNKKPFLDGMVTNGWYKRIGERIWTPWFIKFIHSRGYFNI  295

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   E ALS+SHRDAGVNYGK+ GPDS L+ ++SI  + L+  PL ++KWYD+CF +V
Sbjct  296   YTNFQNEGALSVSHRDAGVNYGKTAGPDSQLLNKSSISSDFLKLQPLSNLKWYDYCFSEV  355

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P+R                    +ILVSL    +  +RNLLCHFE+L  +N+I +GP S
Sbjct  356   VPER-----------------ERTIILVSLFAADKMFIRNLLCHFEKLNTQNHIFIGPSS  398

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +L  DL+ RGHPVID D   DN+ V   +++  S     KE    +YVVKK LELG+   
Sbjct  399   ELFYDLSRRGHPVIDADMFLDNL-VKSTTSYPNSV----KEALGNSYVVKKCLELGYSTW  453

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             +   N + ++    L+ I ++   DF++G+   ++  +SSS   K W    SS+L   ++
Sbjct  454   IFSSNALLVDKGPLLDRIRSEY--DFYIGETSGILIVQSSSVTQKLW----SSELLHSIV  507

Query  873   TTTSSDSDP-TGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFW  697
             ++ + +  P  G +F+++VK+L E+KG    T +    + N ++   +R+L   +   +W
Sbjct  508   SSATKNPSPKQGLDFIHLVKELVERKGKMIKTVETMSIAENTNAKSVNRSLGDGKPVAYW  567

Query  696   SSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             S E  +N+I+ +L +L LW++D D+SC AVIC+ S
Sbjct  568   SPEVDSNVIRTKLAELNLWLIDDDLSCKAVICHSS  602



>ref|XP_002457678.1| hypothetical protein SORBIDRAFT_03g011520 [Sorghum bicolor]
 gb|EES02798.1| hypothetical protein SORBIDRAFT_03g011520 [Sorghum bicolor]
Length=614

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/577 (52%), Positives = 397/577 (69%), Gaps = 18/577 (3%)
 Frame = -3

Query  2319  TADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDR  2140
             + D + F+ +IKLLAYNR ++  RCL SLAAA YD   V LH+ +DH     N+S+    
Sbjct  49    SPDPRRFSLLIKLLAYNRPAAFRRCLRSLAAADYDGDRVALHVLLDH--STTNSSVP---  103

Query  2139  NLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVS  1960
              L +S  ILDFVDAF W  G K VHYR +NAGLQAQW+EAWWP SDDEFAFVVEDDL+VS
Sbjct  104   PLAASHEILDFVDAFPWPHGEKRVHYRAANAGLQAQWIEAWWPGSDDEFAFVVEDDLQVS  163

Query  1959  PLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGT  1780
             PLY+RFLK +++ YYY+  N+SP ++GASLQRPRFV GKHGNK+++DS TR+FLYQ+VGT
Sbjct  164   PLYYRFLKRVVMRYYYDRENYSPYVFGASLQRPRFVAGKHGNKIQLDSETRLFLYQMVGT  223

Query  1779  WGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYF  1600
             WGQLLFP+PWKEFRLWYD HK+KG+KP+L GM TTGWYKKMGERIWTPWFIKF+H+RGYF
Sbjct  224   WGQLLFPKPWKEFRLWYDDHKAKGLKPILQGMKTTGWYKKMGERIWTPWFIKFVHSRGYF  283

Query  1599  NIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFK  1420
             NIYTN L ERALS+SHRDAGVNYGKSVGPDS L+   ++D N  E  PL  +KWYDFCF 
Sbjct  284   NIYTNFLKERALSVSHRDAGVNYGKSVGPDSTLLDGKNLDFNLWELQPLKKLKWYDFCFN  343

Query  1419  QVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGP  1240
             +V P RIV   +ELGSV  S+Q  S V+LV+L+   E   RNL+CH ++  ++NYI +G 
Sbjct  344   EVIPGRIVTKSSELGSVFKSVQLKSTVVLVTLYSIEERFARNLICHLDKAGMKNYIFLGD  403

Query  1239  KSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFG  1060
              S+ L DLA RG+PVID  +   +I+V   S+   S     KE  VK+YV+K  L+LG+ 
Sbjct  404   NSEFLDDLAHRGYPVIDGMKFLQSIKV---SSLQRSD-DFVKEGLVKSYVIKACLDLGYN  459

Query  1059  ILVADCNRVPLNSDSFLNFID-TDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGA  883
             + + + N + L +      I+ +D   D F+     L+F RSS      W E   S++ A
Sbjct  460   LWLLNGNMISLGN----KLIEPSDQSVDLFIADE-GLMFIRSSLDLKNKWNELTMSRVKA  514

Query  882   ELITTTSSDSDPTGKNFVYVVKK-LFEQKGVKFTTFDENKSSLNISSLDASRTLSI-QEQ  709
              + T++        K+FV+++ + L    GV+    DE    + +    ++R++S  Q  
Sbjct  515   -MCTSSEFSVSIKQKSFVHMLSEVLASSAGVRLGKLDEAIRVIELGPSTSNRSISEDQSN  573

Query  708   FVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
              +FWS   +++ +Q+QL  + LW+VDSD SC+AV+C+
Sbjct  574   VLFWSRSKASDSVQKQLENMDLWLVDSDSSCSAVVCH  610



>ref|XP_004967661.1| PREDICTED: uncharacterized protein LOC101765971 isoform X1 [Setaria 
italica]
Length=612

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/577 (52%), Positives = 403/577 (70%), Gaps = 18/577 (3%)
 Frame = -3

Query  2319  TADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDR  2140
             + D + F+ +IKLLAY+R ++L RCL+SLAAA YD   V LH+ +DH P  ++ S     
Sbjct  48    SPDPRRFSLLIKLLAYDRPAALRRCLHSLAAADYDGDRVALHVLLDHRPPNSSLS-----  102

Query  2139  NLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVS  1960
             +L +S  ILDFVDAF W  G K VHYR +N GLQAQW+EAWWP SDDEFAFVVEDDL+VS
Sbjct  103   SLAASHEILDFVDAFPWPHGEKRVHYRAANVGLQAQWIEAWWPGSDDEFAFVVEDDLQVS  162

Query  1959  PLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGT  1780
             PLY+RFLK +++ YYY+  N+SP ++GASLQRPRFV GKHGNK+++DS TR+FLYQ+VGT
Sbjct  163   PLYYRFLKRVVMKYYYDRENYSPYVFGASLQRPRFVAGKHGNKIQLDSETRLFLYQMVGT  222

Query  1779  WGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYF  1600
             WGQLLFP+PWKEFRLWYD HK+KG+KP+L GM TTGWYKKMGERIWTPWFIKF+H+RGYF
Sbjct  223   WGQLLFPKPWKEFRLWYDEHKAKGLKPILQGMKTTGWYKKMGERIWTPWFIKFVHSRGYF  282

Query  1599  NIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFK  1420
             NIYTN L ERALS+SHRDAGVNYGKSVGPDS L+   ++D N  E  PL  +KWYDFCF 
Sbjct  283   NIYTNFLKERALSVSHRDAGVNYGKSVGPDSTLLDGKNLDFNLWELQPLKKLKWYDFCFD  342

Query  1419  QVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGP  1240
             +V P R+V+ F+EL SV+ S+Q  S V+LVSL+   E   RNL+CH ++  ++NYI +G 
Sbjct  343   EVRPGRVVRKFSELVSVLKSVQLKSTVVLVSLYSIEERFARNLICHLDKADMQNYIFLGD  402

Query  1239  KSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFG  1060
             KS+ L D+A RG+PVID      +I++   S+F  S     KE  VK+YV+K  L+LG+ 
Sbjct  403   KSEFLDDIAHRGYPVIDGIGFLQSIKM---SSFMGSDY-FAKETLVKSYVIKACLDLGYN  458

Query  1059  ILVADCNRVPLNSDSFLNFID-TDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGA  883
             + + + N + L        I+ +D   DFF   ++ L+F RSS  + K W E   S++ A
Sbjct  459   LWLQNGNMISLGG----KLIEPSDQSVDFF-SADVGLMFIRSSVESKKAWNEHTISRVKA  513

Query  882   ELITTTSSDSDPTGKNFVYVVKKLFEQ-KGVKFTTFDENKSSLNISSLDASRTLSI-QEQ  709
              + T++   +    KNFV ++ ++     G K     E    + +    ++++ S  Q  
Sbjct  514   -MCTSSDFSASLDQKNFVPILTEVLANGAGAKLGKLGEEMRVIELGPNTSNKSTSEGQSN  572

Query  708   FVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
              +FWS   +++ +Q+QL ++ LW++DSD SC+AV+C+
Sbjct  573   VLFWSHSMASDSVQKQLEKMDLWLIDSDSSCSAVVCH  609



>ref|XP_009131269.1| PREDICTED: uncharacterized protein LOC103855966 [Brassica rapa]
Length=609

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/576 (51%), Positives = 398/576 (69%), Gaps = 31/576 (5%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             FTF+IK+L +NRL SLSRCL SL++A Y    D   VHLH++IDHF +  N +  V+ +L
Sbjct  55    FTFLIKVLTFNRLHSLSRCLRSLSSAEYGVSGDRGRVHLHVYIDHFSLDQNDT-TVEDSL  113

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
              S++ ILDFVD F W+FG K+VHYRT NAGLQ QWLEAWWPSSD EFAFVVEDDLEVSPL
Sbjct  114   RSTKEILDFVDKFEWRFGEKLVHYRTGNAGLQGQWLEAWWPSSDHEFAFVVEDDLEVSPL  173

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             YF FL+ +I +YYY+AS+F+P IYGASLQRP  VPG++GNK+++D +T +FLYQLVGTWG
Sbjct  174   YFGFLERVIRDYYYDASSFNPSIYGASLQRPWLVPGENGNKLQVDPKTNIFLYQLVGTWG  233

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD HKSK  KP L GMVT  WY+ + ERIWTPWFIKF+H+RGYFNI
Sbjct  234   QLLFPKPWKEFRLWYDEHKSKDKKPYLSGMVTDEWYRALEERIWTPWFIKFVHSRGYFNI  293

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   E ALS+SHRDAGVNY ++VGPDS L+ ++    + L+  PL ++KWYD+CF +V
Sbjct  294   YTNFPNESALSVSHRDAGVNYRETVGPDSQLLNQSFTGSDFLKLQPLTNLKWYDYCFGEV  353

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
                R+V+  NELG+++PS+Q+   ++LVSL    E  +RNLLCHFE +  RN+I +GP+S
Sbjct  354   VTGRVVRSLNELGTILPSVQRDKTIVLVSLFDADEMFIRNLLCHFESINTRNHIFIGPRS  413

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +LL DL+ RGHPVID D    +  V              KE    AYVV K LELG+ I 
Sbjct  414   ELLYDLSRRGHPVIDADMFIKSDSV--------------KEALSSAYVVMKCLELGYSIW  459

Query  1053  VADCNRVPLNSDSFLNFIDTDAVN---DFFVGKNLELVFARSSSSAAKTWGESISSQLGA  883
             V   N + ++ D  L     D++    DF++G++  ++   SS  + K W     ++L  
Sbjct  460   VFSSNALLVDEDLIL----LDSIRSGYDFYIGESSGVLIVLSSPVSRKLW----RNELMP  511

Query  882   ELITTTSSDSDPT-GKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQF  706
              ++++ + +  P  G +F+ +VK+L EQKG K  T +    + N ++   ++ L   +  
Sbjct  512   SIVSSATKNPSPEHGLDFIQLVKELLEQKGKKVKTVETMSIAENTNAESVNQWLEDDKPV  571

Query  705   VFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
             V+WS E  +N+IQ +L +L LW++D D+SC AVIC+
Sbjct  572   VYWSPEVGSNIIQTKLAELNLWLIDDDLSCKAVICH  607



>ref|XP_009393100.1| PREDICTED: uncharacterized protein LOC103978875 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=604

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/558 (52%), Positives = 392/558 (70%), Gaps = 9/558 (2%)
 Frame = -3

Query  2310  NKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHF-PVPANASLDVDRNL  2134
             N  FTFIIKLL ++R+ SL RCL SLA A Y    VHLH+ +DHF P   +++  VDR L
Sbjct  47    NPRFTFIIKLLTFDRIDSLRRCLRSLATADYAGDRVHLHVLVDHFRPANGSSAPSVDRKL  106

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
               SRRILD +D F W  G K+VHYRT+N GLQAQWLEAWWPSSDDEFAFVVEDDLE+SPL
Sbjct  107   EESRRILDLIDRFRWVHGEKIVHYRTANVGLQAQWLEAWWPSSDDEFAFVVEDDLELSPL  166

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y++FLK LI+ YYY+ +N++  IYGASLQRPRFV GK GNK+++ S TR+FLYQ+VGTWG
Sbjct  167   YYKFLKRLILKYYYDPANYNASIYGASLQRPRFVAGKKGNKLQLSSETRIFLYQMVGTWG  226

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PW EFRLWYD HK+K +KP+L GMVTTGWYK+ GERIWTPWFIKFIHARGY+N+
Sbjct  227   QLLFPKPWNEFRLWYDEHKAKEIKPILQGMVTTGWYKRFGERIWTPWFIKFIHARGYYNL  286

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   ERALSISHRDAGVNYGK+VGPDS+L+ + S+D +  E  PL ++KWYDFCF + 
Sbjct  287   YTNFKQERALSISHRDAGVNYGKTVGPDSSLLVDESLDFSLTELPPLRNLKWYDFCFAET  346

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
              P RIV +F++L S++ SL K   + ++SL+Q +E + RNL+C+ E++ + N+IL+G   
Sbjct  347   HPGRIVSNFDQLRSILHSL-KQKTIFVISLYQTTERIARNLICNLEKVGLVNFILLGGSP  405

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             +LL+DLA RG+PV+DT +L  +IR   KS   E    + KEI++KA  V+K LE G+ + 
Sbjct  406   ELLIDLARRGYPVVDTSQLVSSIRQV-KSIDLEHEPDIIKEIWIKATTVQKCLEFGYDLW  464

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             + D N +P      L  +   +  DF + KN EL+F +SS S+ KTW +    ++ AE  
Sbjct  465   LIDGNMIP--GSGLLPELPNPSY-DFAIAKNAELLFVKSSPSSLKTWNDDYIHKVAAECK  521

Query  873   TTTSSDS-DPTGKNFVYV-VKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVF  700
             + T ++S +   KNF Y+ ++ L E  G +    D++   + +     + T S +   VF
Sbjct  522   SLTGTNSPEMEHKNFAYLAMRGLDENAGARLWRLDDSDIGVKLGYDTMNHTES-KLNMVF  580

Query  699   WSSETSTNLIQQQLVQLG  646
             W  E +   +Q++L + G
Sbjct  581   WDQEMALTSVQRELDRSG  598



>emb|CDX78477.1| BnaA03g03890D [Brassica napus]
Length=606

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/573 (51%), Positives = 393/573 (69%), Gaps = 25/573 (4%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHY----DHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             FTF+IK+L +NRL SLSRCL SL++A Y    D   VHLH++IDHF +  N +  V+ +L
Sbjct  52    FTFLIKVLTFNRLHSLSRCLRSLSSAEYGVSGDRGRVHLHVYIDHFSLDQNDT-TVEDSL  110

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
              S++ ILDFVD F W+FG K+VHYRT NAGLQ QWLEAWWPSSD EFAFVVEDDLEVSPL
Sbjct  111   RSTKEILDFVDKFEWRFGEKLVHYRTGNAGLQGQWLEAWWPSSDHEFAFVVEDDLEVSPL  170

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             YF FL+ +I +YYY+AS+F+P IYGASLQRP  VPG++GNK+++D +T +FLYQLVGTWG
Sbjct  171   YFGFLERVIRDYYYDASSFNPSIYGASLQRPWLVPGENGNKLQVDPKTNIFLYQLVGTWG  230

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             QLLFP+PWKEFRLWYD HKSK  KP L GMVT  WY+ + ERIWTPWFIKF+H+RGYFNI
Sbjct  231   QLLFPKPWKEFRLWYDEHKSKDKKPYLSGMVTDEWYRALEERIWTPWFIKFVHSRGYFNI  290

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
             YTN   E ALS+SHRDAGVNY ++VGPDS L+ ++    + L+  PL ++KWYD+CF +V
Sbjct  291   YTNFPNESALSVSHRDAGVNYRETVGPDSQLLNQSFTGSDFLKLQPLTNLKWYDYCFGEV  350

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
                R+V+  NELG+++PS+Q+   ++LVSL    E  +RNLLCHFER+  RN+I +GP+S
Sbjct  351   VTGRVVRSLNELGTILPSVQRDKTIVLVSLFDADEMFIRNLLCHFERINTRNHIFIGPRS  410

Query  1233  DLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGIL  1054
             + L DL+ RGHPVID D    +  V              KE    AYVV K LELG+   
Sbjct  411   EFLYDLSRRGHPVIDADMFIKSDSV--------------KEALSSAYVVMKCLELGYSTW  456

Query  1053  VADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELI  874
             V   N   L  +  L      +  DF++G++  ++   SS  + K W     ++L   ++
Sbjct  457   VFSSN-ALLVDEDLLLLDSIRSGYDFYIGESSGVLIVLSSPVSGKLW----RNELMPSIV  511

Query  873   TTTSSDSDPT-GKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFW  697
             ++ + +  P  G +F+ +VK+L EQKG K  T +    + N ++   ++ L   +  V+W
Sbjct  512   SSATKNPSPEHGLDFIQLVKELLEQKGRKVKTVETMSIAENTNAESVNQWLEDDKPVVYW  571

Query  696   SSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
             S E  +N+IQ +L +L LW++D D+SC AVIC+
Sbjct  572   SPEVGSNIIQTKLAELNLWLIDDDLSCKAVICH  604



>gb|EMT25495.1| hypothetical protein F775_06261 [Aegilops tauschii]
Length=621

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/541 (52%), Positives = 373/541 (69%), Gaps = 17/541 (3%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASL  2152
             P     D   F+ +IKLLAY+R + L RCL SLAAA YD   V LH+ +DH P  ++A L
Sbjct  39    PARPAPDPHRFSLLIKLLAYDRPAPLLRCLRSLAAADYDGDRVALHVLLDHLPPNSSAPL  98

Query  2151  DVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD  1972
                  L +S  IL  VDAF W  G K +HYR +N GLQAQW+EAWWP S+DEFAFVVEDD
Sbjct  99    -----LAASHEILTAVDAFPWPHGEKRIHYRAANVGLQAQWIEAWWPGSNDEFAFVVEDD  153

Query  1971  LEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQ  1792
             LEVSPLY+RFLK +++ YYY+  N+SP ++GASLQRPRFV GKHGNK+++DS TR+FLYQ
Sbjct  154   LEVSPLYYRFLKRVVMRYYYDRENYSPYVFGASLQRPRFVAGKHGNKIQLDSETRLFLYQ  213

Query  1791  LVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHA  1612
             +VGTWGQLLFP+PWKEFRLWYD  K+KG+KP+L GM TTGWY+KMGERIWTPWFIKF+H+
Sbjct  214   MVGTWGQLLFPKPWKEFRLWYDEQKAKGIKPILQGMKTTGWYRKMGERIWTPWFIKFVHS  273

Query  1611  RGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYD  1432
             RGYFNIYTN L ERALSISHRDAGVNYG+SVGPDS L+  N++D N  +  PL  +KWYD
Sbjct  274   RGYFNIYTNFLKERALSISHRDAGVNYGRSVGPDSTLLDRNNLDFNIWQLQPLKKLKWYD  333

Query  1431  FCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYI  1252
             FCF ++ P R V+ F+ELGSV+ S+Q  ++V+L+SL+   + +VRNL+CH E+  +RNY+
Sbjct  334   FCFAEILPGRFVRKFSELGSVLKSVQLGNSVVLISLYSVEQRIVRNLICHLEKTGMRNYV  393

Query  1251  LMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLE  1072
              +G  S+ L DLA RGH VID   L   I++  +S  N       KE+  KAYV++  L 
Sbjct  394   FLGDNSEFLDDLAHRGHAVIDAIELLQGIKI--RSYMNSDG--FVKEVLAKAYVIQHCLN  449

Query  1071  LGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQ  892
             LG+ + V + N + L  DS L      +V D F    ++L+F RSS  + KTW E I S+
Sbjct  450   LGYNLWVLNGNMISL--DSKLVEPSNQSV-DIFTADPVDLIFIRSSQGSKKTWNEHIISR  506

Query  891   LGAELITTTSSDSDPTGK--NFVYVVKKLFEQK--GVKFTTFDENKSSLNISSLDASRTL  724
             + A+ +     D   + K  +FV+++ +  E    GV+    +E   ++ +    ++R+L
Sbjct  507   V-ADGVLPPKGDFIASLKHVSFVHILTRALENNGGGVRLGKLNEEIMTMELGPNMSNRSL  565

Query  723   S  721
             S
Sbjct  566   S  566



>ref|XP_008673938.1| PREDICTED: uncharacterized protein LOC103650047 [Zea mays]
 tpg|DAA54231.1| TPA: hypothetical protein ZEAMMB73_303666 [Zea mays]
Length=613

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/564 (50%), Positives = 382/564 (68%), Gaps = 18/564 (3%)
 Frame = -3

Query  2319  TADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDR  2140
             ++D + F+ +IKLLAY+R ++  RCL SLAAA YD   V LH+ +DH   P N+SL    
Sbjct  48    SSDPRRFSLLIKLLAYDRPAAFRRCLRSLAAADYDGDRVALHVLLDH--RPPNSSLP---  102

Query  2139  NLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVS  1960
              L +S  ILDFVDAF W  G K VHYR SNAGLQAQW+EAWWP SDDEFAFVVEDDL+VS
Sbjct  103   PLATSHEILDFVDAFPWPHGEKRVHYRASNAGLQAQWIEAWWPGSDDEFAFVVEDDLQVS  162

Query  1959  PLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGT  1780
             PLY++FLK L++ YYY+  N+SP ++GASLQRPRFV GKHGNK+++DS TR+FLYQ+VGT
Sbjct  163   PLYYKFLKRLVLRYYYDRENYSPYLFGASLQRPRFVAGKHGNKIQLDSETRLFLYQMVGT  222

Query  1779  WGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYF  1600
             WGQLLFP+PWKEFRLWYD HK+KG+KP+L GM TTGWYKKMGERIWTPWF+KF+H+RGYF
Sbjct  223   WGQLLFPKPWKEFRLWYDDHKAKGLKPILQGMKTTGWYKKMGERIWTPWFVKFVHSRGYF  282

Query  1599  NIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFK  1420
             NIYTN L ERALS+SHRDAGVNY KSVGPDS L+   ++D N  E  PL  +KWYDFCF 
Sbjct  283   NIYTNFLKERALSVSHRDAGVNYEKSVGPDSTLLDGKNLDFNLWELQPLKKLKWYDFCFN  342

Query  1419  QVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGP  1240
             +  P RIV+  +ELGS++ SLQ  S V+LV+L+   E   RNL+CH ++  ++N I +G 
Sbjct  343   EALPGRIVRKNSELGSMLKSLQLKSTVVLVTLYSIEERFARNLICHLDKAGMKNTIFLGD  402

Query  1239  KSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFG  1060
              S+ L DLA RG+PVID      +IR+       + +    +E  V +YV+K  L+LG+ 
Sbjct  403   NSEFLDDLAHRGYPVIDGVNFLQSIRLSSL----QGSDGFVQETLVISYVIKACLDLGYN  458

Query  1059  ILVADCNRVPLNSDSFLNFID-TDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGA  883
             + + + N + L +      I+ +D   DFF      L+F RSS      W E   S++ A
Sbjct  459   LWLLNGNMISLGN----KLIEPSDQSVDFFTADE-GLMFIRSSLDMKNKWNELAMSRVKA  513

Query  882   ELITTTSSDSDPTGKNFVYVVKKLF-EQKGVKFTTFDENKSSLNISSLDASRT-LSIQEQ  709
              + T++        K+FV+++ ++     GV+    DE    + +    ++R+ L  +  
Sbjct  514   -MCTSSDLSVSIKQKSFVHMLTEVMASSAGVRLGKLDEAMRVIELGPNTSNRSILEDKSN  572

Query  708   FVFWSSETSTNLIQQQLVQLGLWI  637
              +FWS   +++ +Q+QL  + LW+
Sbjct  573   VLFWSRSRASDSVQKQLENMDLWL  596



>gb|KHN39578.1| hypothetical protein glysoja_020656, partial [Glycine soja]
Length=556

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/567 (52%), Positives = 375/567 (66%), Gaps = 32/567 (6%)
 Frame = -3

Query  2232  AAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTS  2053
             AAA Y    VHLH+ IDHF  P NAS  VD  L  + RIL+FVD F WKFG KVVHYRT 
Sbjct  2     AAADYLADRVHLHLHIDHF-APDNAS-HVDPKLLQAHRILEFVDGFDWKFGEKVVHYRTG  59

Query  2052  NAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGAS  1873
             N GLQAQWLEAWWP+SD EFAFVVEDDLEVSPLY+ F+K LI+N+YYNASN SP I+G S
Sbjct  60    NVGLQAQWLEAWWPNSDHEFAFVVEDDLEVSPLYYEFVKALIMNFYYNASNHSPSIFGVS  119

Query  1872  LQRPRFVP--------------GKHGNKMKIDSRTRVFLYQL-----VGTWGQLLFPRPW  1750
             LQR RFVP               ++  K    S+ +  L++L     +     L    PW
Sbjct  120   LQRARFVPVYILLMILVGDLTSMRYMAKTVYISKGQPILHELAFGIELAQSQILRILGPW  179

Query  1749  KEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYER  1570
             KEFRLWYD +K+KG +P L+GMVTTGWYKKMGERIW PWFIKFI +RGYFNIYTNLL+ER
Sbjct  180   KEFRLWYDENKAKGNRPFLEGMVTTGWYKKMGERIWAPWFIKFIQSRGYFNIYTNLLHER  239

Query  1569  ALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFPDRIVQH  1390
             ALS+SHRDAGVNYGK+ GPDS L+ E S+D N LE  PL  +KW+DFCF++V P ++V +
Sbjct  240   ALSVSHRDAGVNYGKTAGPDSKLLEEKSLDFNILEMQPLSCLKWFDFCFREVHPGKVVTN  299

Query  1389  FNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLLLDLAI  1210
               ELGS++ SLQK S+V LV+L   S+++ RNLLCHF+RL IRNYILMGP S  L DLA 
Sbjct  300   LEELGSLLHSLQKQSSVFLVNLFGVSDAIARNLLCHFKRLDIRNYILMGPPSGSLFDLAR  359

Query  1209  RGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVADCNRVP  1030
             RGHPVI+ D+   ++ +  K   + S+ +  K I  KAYVVKK +E  + + V D + + 
Sbjct  360   RGHPVINVDQFISSVGL-SKFTSHGSSFETIKGILTKAYVVKKCIENRYNMWVMDGSML-  417

Query  1029  LNSDSFLNFIDTDAVN-DFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITTTSSDS  853
             L SD      +++  N DFFV  NLE+ +A+SS+   K W +   S++ A     +++ S
Sbjct  418   LTSDL---LSESEPPNDDFFVANNLEVFYAKSSTFNQKIWVDGFVSRVVAMARKDSATHS  474

Query  852   DPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSSETSTNL  673
               +   FVYVV KL EQ G +    DE   +  I S   S T    ++ V+WSSE   N 
Sbjct  475   SLS---FVYVVTKLLEQNGARIRRVDETSFAAKIGS--GSETSLRDKKLVYWSSEMELNS  529

Query  672   IQQQLVQLGLWIVDSDMSCTAVICYPS  592
             IQ+ L +  LW +DS +SCTAV+C+ S
Sbjct  530   IQKWLEEFNLWSIDSVLSCTAVVCHKS  556



>ref|XP_006854787.1| hypothetical protein AMTR_s00063p00142620 [Amborella trichopoda]
 gb|ERN16254.1| hypothetical protein AMTR_s00063p00142620 [Amborella trichopoda]
Length=642

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/511 (52%), Positives = 352/511 (69%), Gaps = 12/511 (2%)
 Frame = -3

Query  2112  DFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKN  1933
             D+ D F WK G K+VHYRT N GLQAQWLE+WWP+SDDEF F+VEDDLE+SPL++++LK 
Sbjct  136   DYADEFQWKHGEKMVHYRTQNVGLQAQWLESWWPASDDEFVFIVEDDLELSPLFYKYLKT  195

Query  1932  LIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRP  1753
             LI NYYY+ SN S +IYGASLQRPRFV GKHGNK+++D++T VFLYQ+VGTWGQLLFP+P
Sbjct  196   LIANYYYDRSNSSELIYGASLQRPRFVAGKHGNKLQLDNQTNVFLYQMVGTWGQLLFPKP  255

Query  1752  WKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYE  1573
             WK+FRLWYDT K+ G+KP+L+GMVTT WYKK GERIWTPWFIKF+H+ GYFN+YTN+  E
Sbjct  256   WKQFRLWYDTQKTMGIKPILEGMVTTNWYKKKGERIWTPWFIKFLHSFGYFNLYTNISLE  315

Query  1572  RALSISHRDAGVNYGKSVGPDSNLV-GENSIDINHLEFHPLHSMKWYDFCFKQVFPDRIV  1396
             RALS+SHRDAGVNYG+S GPDS+L+ G + +DIN LE  PL  ++W+DFCF +V   R+ 
Sbjct  316   RALSVSHRDAGVNYGRSAGPDSSLINGSSPLDINLLEMKPLKDLEWFDFCFGEVVMGRVA  375

Query  1395  QHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLLLDL  1216
             ++FNELGS++ SLQK   VI+V L++ S++   NLLCHFERL IRNY+L+G  S  L DL
Sbjct  376   KNFNELGSLLLSLQKQGTVIVVDLYRISKANAMNLLCHFERLNIRNYVLLGDGSGFLYDL  435

Query  1215  AIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVADCNR  1036
             A RGHPV+D++ L   IR +D            KEI +K +V+ K LE G G  +   N 
Sbjct  436   ANRGHPVVDSELLVLEIRAFDPMKMQGVNSDFMKEILIKNHVINKCLESGLGAWLITANM  495

Query  1035  VPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITTTSSD  856
             VP+  + F N   T    D  + K+ EL+F R+S +  K W  S S +   E+  +  S 
Sbjct  496   VPI-ENMFSNM--TYQREDIVLVKDTELLFFRNSETMVKAW--SSSERKMVEMAQSLVSK  550

Query  855   SDPTG----KNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLS-IQEQFVFWSS  691
              +P G    + FVY+  K+    G+     D     + I   D ++T +  +++ VFWS 
Sbjct  551   GEPVGEERERAFVYIATKILRNIGITIEERDSTGFGVRIGG-DVNKTENGTRKRVVFWSD  609

Query  690   ETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
                  L++  L  + LW +D D++C AV+C+
Sbjct  610   GLDLGLVRDNLESMDLWGIDRDLACKAVVCH  640



>ref|XP_008384201.1| PREDICTED: uncharacterized protein LOC103446830 isoform X1 [Malus 
domestica]
Length=421

 Score =   456 bits (1173),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 221/419 (53%), Positives = 297/419 (71%), Gaps = 17/419 (4%)
 Frame = -3

Query  1848  GKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGW  1669
             GKHGNK+++D RTR+FLYQLVGTWGQLLFP+PWKEFR+WYD HK+KG+KP LDGMVTTGW
Sbjct  18    GKHGNKLQMDDRTRLFLYQLVGTWGQLLFPKPWKEFRMWYDDHKAKGIKPFLDGMVTTGW  77

Query  1668  YKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGEN  1489
             YKKMGE+IWTPWFIKFIH RGYFNIYTN L+ERALS+SHRDAGVNYGK+ GPDS+++ ++
Sbjct  78    YKKMGEKIWTPWFIKFIHTRGYFNIYTNFLHERALSVSHRDAGVNYGKTAGPDSHILDKS  137

Query  1488  SIDINHLEFHPLHSMKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESE  1309
             S+D +  +  PL  +KWYDFCF++  PDR+V   +ELGSV+ S+QK   VI+VSL   SE
Sbjct  138   SLDSDFWDMQPLSDLKWYDFCFREKLPDRVVGSLDELGSVLNSVQKHDTVIIVSLFGVSE  197

Query  1308  SVVRNLLCHFERLYIRNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESA  1129
               VRNLLCHFE L I NY+L+GP+SDL+ DLA RGHPVI T+    ++  Y   +  +S 
Sbjct  198   LAVRNLLCHFESLNIWNYVLIGPESDLVFDLARRGHPVIGTNZFLKSVGAYKLMSLQDSY  257

Query  1128  VKLTKEIFVKAYVVKKTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELV  949
             V++     +K YV+KK LE G+   V D N +PL+SD    F+++D   DF++GK+ EL 
Sbjct  258   VEM-----IKVYVLKKCLESGYNAWVVDGNMLPLSSDL---FVESDLSYDFYIGKSSELF  309

Query  948   FARSSSSAAKTWGESISSQLG--AELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFD  775
             FAR  S A    G+   S+    A  +    S S      F Y++ KL E+KGVK  + +
Sbjct  310   FAR-RSFAQNIGGDDFISKFATMANALLVRQSIS------FGYIMAKLLEEKGVKVKSLN  362

Query  774   ENKSSLNISSLDASRTLSIQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
             E    L I + + + +L   +Q VFWSS+ +++L+ ++L + G+W V+ D+SC AV+C+
Sbjct  363   ETSFGLMIGNSNVNESLGDGKQMVFWSSDMASDLVHKRLQEFGIWTVNDDLSCKAVVCH  421



>ref|XP_008384202.1| PREDICTED: uncharacterized protein LOC103446830 isoform X2 [Malus 
domestica]
 ref|XP_008384203.1| PREDICTED: uncharacterized protein LOC103446830 isoform X2 [Malus 
domestica]
Length=396

 Score =   441 bits (1135),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 215/411 (52%), Positives = 289/411 (70%), Gaps = 17/411 (4%)
 Frame = -3

Query  1824  IDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERI  1645
             +D RTR+FLYQLVGTWGQLLFP+PWKEFR+WYD HK+KG+KP LDGMVTTGWYKKMGE+I
Sbjct  1     MDDRTRLFLYQLVGTWGQLLFPKPWKEFRMWYDDHKAKGIKPFLDGMVTTGWYKKMGEKI  60

Query  1644  WTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLE  1465
             WTPWFIKFIH RGYFNIYTN L+ERALS+SHRDAGVNYGK+ GPDS+++ ++S+D +  +
Sbjct  61    WTPWFIKFIHTRGYFNIYTNFLHERALSVSHRDAGVNYGKTAGPDSHILDKSSLDSDFWD  120

Query  1464  FHPLHSMKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLC  1285
               PL  +KWYDFCF++  PDR+V   +ELGSV+ S+QK   VI+VSL   SE  VRNLLC
Sbjct  121   MQPLSDLKWYDFCFREKLPDRVVGSLDELGSVLNSVQKHDTVIIVSLFGVSELAVRNLLC  180

Query  1284  HFERLYIRNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIF  1105
             HFE L I NY+L+GP+SDL+ DLA RGHPVI T+    ++  Y   +  +S V++     
Sbjct  181   HFESLNIWNYVLIGPESDLVFDLARRGHPVIGTNZFLKSVGAYKLMSLQDSYVEM-----  235

Query  1104  VKAYVVKKTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSA  925
             +K YV+KK LE G+   V D N +PL+SD    F+++D   DF++GK+ EL FAR  S A
Sbjct  236   IKVYVLKKCLESGYNAWVVDGNMLPLSSDL---FVESDLSYDFYIGKSSELFFAR-RSFA  291

Query  924   AKTWGESISSQLG--AELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNI  751
                 G+   S+    A  +    S S      F Y++ KL E+KGVK  + +E    L I
Sbjct  292   QNIGGDDFISKFATMANALLVRQSIS------FGYIMAKLLEEKGVKVKSLNETSFGLMI  345

Query  750   SSLDASRTLSIQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
              + + + +L   +Q VFWSS+ +++L+ ++L + G+W V+ D+SC AV+C+
Sbjct  346   GNSNVNESLGDGKQMVFWSSDMASDLVHKRLQEFGIWTVNDDLSCKAVVCH  396



>ref|XP_010673797.1| PREDICTED: uncharacterized protein LOC104890122 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=424

 Score =   442 bits (1136),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 212/422 (50%), Positives = 292/422 (69%), Gaps = 9/422 (2%)
 Frame = -3

Query  1848  GKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGW  1669
             GKHGNKM +DS TR+FLYQLVGTWGQLLFPRPWKEFRLWYD HK+KG+KPVL+GMVT GW
Sbjct  9     GKHGNKMNLDSGTRLFLYQLVGTWGQLLFPRPWKEFRLWYDDHKAKGIKPVLEGMVTNGW  68

Query  1668  YKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGEN  1489
             YK+MGERIWTPWFIKF+H+RGY+NIYTN L+ERALSISHRDAGVNYGK+ GPDS L+   
Sbjct  69    YKRMGERIWTPWFIKFVHSRGYYNIYTNFLHERALSISHRDAGVNYGKTAGPDSQLLEGK  128

Query  1488  SIDINHLEFHPLHSMKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESE  1309
             S DIN LE   L +++WYDFCFK++ P R+ +  +E+G ++ ++ K   V+LVSL    E
Sbjct  129   SFDINPLEMPSLSNLEWYDFCFKRILPGRVAKKLDEIGPILHTMGKQKPVLLVSLLNSRE  188

Query  1308  SVVRNLLCHFERLYIRNYILMGP--KSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNE  1135
             +++RNL+CHFERL I+NYI M P  KSDLL DL  RGHPVI T+ ++D+I     +   +
Sbjct  189   AIIRNLICHFERLNIQNYIFMVPNSKSDLLHDLPRRGHPVIVTEEVFDSI-----TRSKK  243

Query  1134  SAVKLTKEIFVKAYVVKKTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLE  955
             ++ +L KE  VKAYV+KK L+ GF   V   + +PL+S+  L+       N+F+VGKN  
Sbjct  244   TSSELVKETVVKAYVIKKILDSGFDSWVITSDMLPLSSNPELDST-ISIKNNFYVGKNSR  302

Query  954   LVFARSSSSAAKTWGESISSQLGAELITTTSSDSDPTGK-NFVYVVKKLFEQKGVKFTTF  778
             +   RSSSS+   W      +  + + +  + DS    K NF  +V++  E   ++  + 
Sbjct  303   IFVVRSSSSSQAVWDVRFVEKFASSVESLVTQDSSQKEKGNFADIVERFAENHALRLKSV  362

Query  777   DENKSSLNISSLDASRTLSIQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICY  598
             D+   SL +  ++ +++L    + + WS+    + +++ L +LG+WI+DSD SC AVIC+
Sbjct  363   DDIGFSLKLEEVNGNQSLPTDTKMITWSAAMDRDSVRKHLEELGMWIIDSDSSCKAVICH  422

Query  597   PS  592
              S
Sbjct  423   QS  424



>ref|XP_002963901.1| hypothetical protein SELMODRAFT_79807, partial [Selaginella moellendorffii]
 gb|EFJ35772.1| hypothetical protein SELMODRAFT_79807, partial [Selaginella moellendorffii]
Length=451

 Score =   419 bits (1077),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 276/378 (73%), Gaps = 5/378 (1%)
 Frame = -3

Query  2310  NKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHF-PVPANASLDVDRNL  2134
             +K F F+I++LAY+R  SL RCL SLA A Y    V+L + +DHF P+ ++    V+RNL
Sbjct  76    SKKFEFVIQVLAYDRYDSLRRCLRSLAIADYGSDTVNLVVHLDHFKPLSSDP---VERNL  132

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
               +R++L+F+D F W  G+K VHYRT N GLQ QWLEAWWPSSD +FA VVEDD+++SPL
Sbjct  133   QQARQLLNFLDRFKWPHGSKQVHYRTQNVGLQVQWLEAWWPSSDHQFALVVEDDMQLSPL  192

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+R+++++I  YYY+ +NF P I+G +LQRPRFVPGK GN++ +D+ TR+FLYQLVGTWG
Sbjct  193   YYRYVRSVIAKYYYDPANFDPSIFGITLQRPRFVPGKGGNRIALDNSTRLFLYQLVGTWG  252

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             Q+LFP+PW+EFR W+D HK+K ++P++DGMVTT WYKK+G  IWTPWF+KF+H+ GYFN+
Sbjct  253   QILFPKPWREFRQWFDEHKTKEIEPIIDGMVTTDWYKKLGNNIWTPWFLKFVHSHGYFNV  312

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSI-DINHLEFHPLHSMKWYDFCFKQ  1417
             YTN L  RALS+SHR  GVNY K  GPDS L+  +   DI+  E   L ++KWYD+CF Q
Sbjct  313   YTNFLRGRALSVSHRTRGVNYHKDAGPDSKLIKRHGTPDIDMWEIPALSTLKWYDYCFHQ  372

Query  1416  VFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPK  1237
             VF +R++  F  L +++  +   + VILV+     + +VRN LC    L  +NY+L+G  
Sbjct  373   VFRNRLLNGFKHLEALLSDIHSENEVILVNSVGVDDELVRNWLCQMAVLRTKNYLLLGRD  432

Query  1236  SDLLLDLAIRGHPVIDTD  1183
              +   +LA RGHPV+ TD
Sbjct  433   YNTSSELARRGHPVLLTD  450



>ref|XP_002988305.1| hypothetical protein SELMODRAFT_183718, partial [Selaginella 
moellendorffii]
 gb|EFJ10724.1| hypothetical protein SELMODRAFT_183718, partial [Selaginella 
moellendorffii]
Length=451

 Score =   419 bits (1077),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 276/378 (73%), Gaps = 5/378 (1%)
 Frame = -3

Query  2310  NKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHF-PVPANASLDVDRNL  2134
             +K F F+I++LAY+R  SL RCL SLA A Y    V+L + +DHF P+ ++    V+RNL
Sbjct  76    SKKFEFVIQVLAYDRYDSLRRCLRSLAIADYGSDTVNLVVHLDHFKPLSSDP---VERNL  132

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
               +R++L+F+D F W  G+K VHYRT N GLQ QWLEAWWPSSD +FA VVEDD+++SPL
Sbjct  133   QQARQLLNFLDRFKWPHGSKQVHYRTQNVGLQVQWLEAWWPSSDHQFALVVEDDMQLSPL  192

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWG  1774
             Y+R+++++I  YYY+ +NF P I+G +LQRPRFVPGK GN++ +D+ TR+FLYQLVGTWG
Sbjct  193   YYRYVRSVIAKYYYDPANFDPSIFGITLQRPRFVPGKGGNRIALDNSTRLFLYQLVGTWG  252

Query  1773  QLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNI  1594
             Q+LFP+PW+EFR W+D HK+K ++P++DGMVTT WYKK+G  IWTPWF+KF+H+ GYFN+
Sbjct  253   QILFPKPWREFRQWFDEHKTKEIEPIIDGMVTTDWYKKLGNNIWTPWFLKFVHSHGYFNV  312

Query  1593  YTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSI-DINHLEFHPLHSMKWYDFCFKQ  1417
             YTN L  RALS+SHR  GVNY K  GPDS L+  +   DI+  E   L ++KWYD+CF Q
Sbjct  313   YTNFLRGRALSVSHRTRGVNYHKDAGPDSKLIKRHGTPDIDMWEIPALSTLKWYDYCFHQ  372

Query  1416  VFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPK  1237
             VF +R++  F  L +++  +   + VILV+     + +VRN LC    L  +NY+L+G  
Sbjct  373   VFRNRLLNGFKHLEALLSDIHSENEVILVNSVGVDDGLVRNWLCQMAVLRTKNYLLLGRD  432

Query  1236  SDLLLDLAIRGHPVIDTD  1183
              +   +LA RGHPV+ TD
Sbjct  433   YNTSSELARRGHPVLLTD  450



>gb|EMS64322.1| hypothetical protein TRIUR3_29616 [Triticum urartu]
Length=587

 Score =   416 bits (1068),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/420 (48%), Positives = 280/420 (67%), Gaps = 18/420 (4%)
 Frame = -3

Query  1848  GKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGW  1669
             GKHGNK+++DS TR+FLYQ+VGTWGQLLFP+PWKEFRLWYD  K+KG+KP+L GM TTGW
Sbjct  177   GKHGNKIQLDSETRLFLYQMVGTWGQLLFPKPWKEFRLWYDEQKAKGIKPILQGMKTTGW  236

Query  1668  YKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGEN  1489
             Y+KMGERIWTPWFIKFIH+RGYFNIYTN L ERALSISHRDAGVNYG+SVGPDS L+  N
Sbjct  237   YRKMGERIWTPWFIKFIHSRGYFNIYTNFLKERALSISHRDAGVNYGRSVGPDSTLLDGN  296

Query  1488  SIDINHLEFHPLHSMKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESE  1309
             ++D N  +  PL  +KWYDFCF ++ P R V+ F+ELGSV+ S+Q  +N +L+SL+   +
Sbjct  297   NLDFNVWQLQPLKKLKWYDFCFAEILPGRFVRKFSELGSVLKSVQLGNNAVLISLYSVEQ  356

Query  1308  SVVRNLLCHFERLYIRNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESA  1129
              +VRNL+CH E+  + NYI +G  S+ L DLA RGH VID   L   I++    N +   
Sbjct  357   RIVRNLICHLEKTGMENYIFLGDNSEFLDDLAHRGHAVIDAIELLQGIKMSGYMNSD---  413

Query  1128  VKLTKEIFVKAYVVKKTLELGFGILVADCNRVPLNSDSFLNFID-TDAVNDFFVGKNLEL  952
                 KEI  KAYV++  L LG+ + V + N + L S      ++ ++   D F    ++L
Sbjct  414   -GFVKEILAKAYVIQHCLNLGYNLWVLNGNMISLGS----KLVEPSNQSVDIFTADPVDL  468

Query  951   VFARSSSSAAKTWGESISSQLGAELITTTSSDSDPTGKNFVYVVKKLFEQK--GVKFTTF  778
             +F RSS  + KTW E I S++      +    S      FV+++ ++ E    GV+    
Sbjct  469   IFIRSSQGSKKTWNEHIISRVADGGFASVKHVS------FVHILTRVLENNGGGVRLGKL  522

Query  777   DENKSSLNISSLDASRTLSI-QEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVIC  601
             +E   ++ +    ++R+LS  Q + +FWS    ++ +Q+QL  + LW++DSD SC+AV+C
Sbjct  523   NEEIMTMELGPNMSNRSLSEGQSKMLFWSDSVPSDSVQRQLGNVNLWLIDSDSSCSAVVC  582


 Score =   150 bits (379),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  2130  SSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLY  1951
             +S  IL  VDAF W  G K +HYR +N GLQAQW+EAWWP SDDEFAFVVEDDLEVSPLY
Sbjct  18    ASHEILTAVDAFPWPHGEKRIHYRAANVGLQAQWIEAWWPGSDDEFAFVVEDDLEVSPLY  77

Query  1950  FRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGK  1843
             +RFLK +++ YYY+  N+SP ++GASLQRPRFV G+
Sbjct  78    YRFLKRVVMRYYYDRENYSPYVFGASLQRPRFVAGE  113



>ref|XP_001781812.1| predicted protein [Physcomitrella patens]
 gb|EDQ53366.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   377 bits (968),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/374 (51%), Positives = 254/374 (68%), Gaps = 4/374 (1%)
 Frame = -3

Query  2301  FTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRN--LNS  2128
             F  ++K+LA+NRL SLSRCL SLA A Y    V++ IFIDH         +  +N  L  
Sbjct  1     FRVVLKVLAFNRLESLSRCLRSLAKADYGGDRVNIQIFIDHIRYDDAKGNETCKNVSLEE  60

Query  2127  SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYF  1948
               +IL+FVD F W+ G K +HYR+ N GLQ QW+E+WWP+  DEFAF+VEDD+EVS LY+
Sbjct  61    FHKILEFVDNFWWRHGTKEIHYRSQNVGLQTQWIESWWPTDLDEFAFIVEDDVEVSSLYY  120

Query  1947  RFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQL  1768
             RFL+ +I  YYYN   +   +YG SLQRPRFVPGK G  +K +S   +F Y LVGTWGQL
Sbjct  121   RFLRTVIATYYYNPEQYDSSVYGISLQRPRFVPGKRGFPLKFNSTKNLFRYPLVGTWGQL  180

Query  1767  LFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYT  1588
             LFP+ WKEFRLWYD HKS+GMKPVL+GM+T  WYKK+GERIWTPWFIKF H+RGYFN+YT
Sbjct  181   LFPKQWKEFRLWYDNHKSRGMKPVLEGMITNSWYKKLGERIWTPWFIKFAHSRGYFNLYT  240

Query  1587  NLLYERALSISHRDAGVNYGKSVGPDSNLVGENSI--DINHLEFHPLHSMKWYDFCFKQV  1414
             N +   ALS+SHR+ G+NY KSVGPDS L+ +  +  D       P  ++  +DFCF+ +
Sbjct  241   NFMDNLALSVSHREPGLNYNKSVGPDSQLIDKVEVGNDTMLWVMSPSKTLPQFDFCFRGM  300

Query  1413  FPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKS  1234
                 +     EL  ++ +++   +V+LV+    +  +VRN LCH ERL +R +I++G  +
Sbjct  301   QSWSVATSLAELSPMLAAMEMNMSVLLVNTIGVNAVLVRNWLCHMERLGLRKFIILGDDN  360

Query  1233  DLLLDLAIRGHPVI  1192
             +   DLA RG+  +
Sbjct  361   EFSRDLARRGYATV  374



>ref|XP_008778176.1| PREDICTED: uncharacterized protein LOC103698003, partial [Phoenix 
dactylifera]
Length=329

 Score =   342 bits (876),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 173/328 (53%), Positives = 227/328 (69%), Gaps = 5/328 (2%)
 Frame = -3

Query  1776  GQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFN  1597
             GQLLFPRPWKEFRLWYD HK+KG+KP+L GMVTTGWYKKMG+RIWTPWFIK+IH+RGY+N
Sbjct  2     GQLLFPRPWKEFRLWYDIHKAKGIKPILQGMVTTGWYKKMGDRIWTPWFIKYIHSRGYYN  61

Query  1596  IYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQ  1417
             IYTN L+ERALSIS+RDAGVNYGK+ GPDS L+ +NSID +  E  PL ++KWYDFCF++
Sbjct  62    IYTNFLHERALSISYRDAGVNYGKTAGPDSKLLDKNSIDFDLWELQPLKNLKWYDFCFRE  121

Query  1416  VFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPK  1237
             V   RIV+ + EL SV+ S ++   +ILVSL++  + + RNL+CH E + ++N+IL+   
Sbjct  122   VHLGRIVRRYEELESVLRSFKEQKTIILVSLYRTVQRIARNLICHLESVGLQNFILISDD  181

Query  1236  SDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGI  1057
             S +L+DLA RG  VID + L  +I     ++F  S + L KEI+VKA VVKK LELGF +
Sbjct  182   SAILIDLAQRGS-VIDANLLMSSIGSDKSNDFEHSDMNLMKEIWVKANVVKKILELGFNL  240

Query  1056  LVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTW-GESISSQLGAE  880
              V D N +P+ S+  L     D   DFF  KN+ L++ +SS S+ K W  + IS+     
Sbjct  241   WVLDWNIIPI-SNPLLEL--PDPSYDFFAAKNVGLMYMKSSPSSLKVWVADFISNVAAVG  297

Query  879   LITTTSSDSDPTGKNFVYVVKKLFEQKG  796
                  S+      KNF+Y   K  E KG
Sbjct  298   KSLLGSNSLSLEQKNFLYFATKALEDKG  325



>ref|XP_009358047.1| PREDICTED: uncharacterized protein LOC103948712 [Pyrus x bretschneideri]
Length=344

 Score =   336 bits (862),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/358 (47%), Positives = 244/358 (68%), Gaps = 16/358 (4%)
 Frame = -3

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
             MGE+IWTPWFIKFIH RGYFNIYTN L ERALS+SHRDAGVNYGK+ GPDS+++ E+S+D
Sbjct  1     MGEKIWTPWFIKFIHTRGYFNIYTNFLQERALSVSHRDAGVNYGKTAGPDSHILYESSLD  60

Query  1479  INHLEFHPLHSMKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVV  1300
              +  +  PL  +KWYDFCF+++FPD +V  F+ELGSV+ S+QK   VI+VSL   SE  +
Sbjct  61    SDFWDMQPLSDLKWYDFCFREIFPDTVVGSFDELGSVLNSVQKHDTVIIVSLFGVSELAI  120

Query  1299  RNLLCHFERLYIRNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKL  1120
             RNL CHFERL I +Y+L+GP+SD + DLA RG+PVI T++   ++  Y   +  +S  ++
Sbjct  121   RNLFCHFERLNIWHYVLVGPESDFVFDLARRGYPVIGTNQFLKSVGAYKLMSLQDSHAEM  180

Query  1119  TKEIFVKAYVVKKTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFVGKNLELVFAR  940
                  +KAYV++K LE  +   V D N +P++SD    F+++D   DF++G++ EL FAR
Sbjct  181   -----IKAYVLRKCLESRYNAWVVDGNMLPVSSDL---FVESDPSYDFYIGQSSELFFAR  232

Query  939   SSSSAAKTWGESIS--SQLGAELITTTSSDSDPTGKNFVYVVKKLFEQKGVKFTTFDENK  766
              S +      + IS  + +   L+    S S      F +++ KL EQKGVK  + DE  
Sbjct  233   RSLAQNVDGDDFISKFATMANSLLVKRQSIS------FGFIMTKLLEQKGVKVKSLDETS  286

Query  765   SSLNISSLDASRTLSIQEQFVFWSSETSTNLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
               L I   + +++L   +Q VFWSS+T+++L+Q++L +LG+WIV++D+SC AV+C+ S
Sbjct  287   FGLKIDYSNVNQSLGDGKQMVFWSSDTASDLVQKRLQELGIWIVNNDLSCKAVVCHQS  344



>emb|CDX70461.1| BnaC03g05450D [Brassica napus]
Length=312

 Score =   314 bits (804),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 168/273 (62%), Positives = 199/273 (73%), Gaps = 23/273 (8%)
 Frame = -3

Query  2340  LQTPITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHA----VHLHIFIDHFP  2173
             L  P T+   N  FTF+IK+L +NRL SLSRCL SL+AA Y        VHLH++IDHF 
Sbjct  39    LTKPGTSFRQNPPFTFLIKVLTFNRLHSLSRCLKSLSAAKYGVAGHTGRVHLHVYIDHFS  98

Query  2172  VPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEF  1993
             +  N +  V+ +L S++ ILDFV  F W++G K+VHYRT NAGLQ QWLEAWWPSSD EF
Sbjct  99    LDLNDT-TVEDSLRSTKEILDFVVKFEWRYGEKLVHYRTGNAGLQGQWLEAWWPSSDHEF  157

Query  1992  AFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSR  1813
             AFVVEDDLEVSPLY+ FL+ +I +YYY+ASN +P IYGASLQRP  VPG++GNK+     
Sbjct  158   AFVVEDDLEVSPLYYWFLERVIRDYYYDASNVNPSIYGASLQRPWLVPGENGNKL-----  212

Query  1812  TRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPW  1633
                          QLLFP+PWKEFRLWYD HKSK  KP L GMVT  WY+ + ERIWTPW
Sbjct  213   -------------QLLFPKPWKEFRLWYDEHKSKDQKPYLSGMVTDEWYRALEERIWTPW  259

Query  1632  FIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             FIKF+H+RGYFNIYTN   E ALS+SHRDAGVN
Sbjct  260   FIKFVHSRGYFNIYTNFPNESALSVSHRDAGVN  292



>gb|EYU35956.1| hypothetical protein MIMGU_mgv1a019316mg, partial [Erythranthe 
guttata]
Length=325

 Score =   308 bits (790),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 228/328 (70%), Gaps = 4/328 (1%)
 Frame = -3

Query  1572  RALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFPDRIVQ  1393
             RALS+SHRDAGVNYGK+ GPDSNL+ ENS+D N LE +PL+S+KWYDFCF++V  +RIV+
Sbjct  1     RALSVSHRDAGVNYGKTAGPDSNLLDENSLDFNLLELYPLNSLKWYDFCFREVLTNRIVR  60

Query  1392  HFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLLLDLA  1213
               N+LGSV+ S+Q+ ++V+LVS+++  E++VRN+LCHFERL IRNY+L+GP S  LLDL+
Sbjct  61    SSNDLGSVLHSVQEKNSVVLVSIYRTPENIVRNILCHFERLDIRNYVLIGPHSPFLLDLS  120

Query  1212  IRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVADCNRV  1033
              RGHPVID  +  D  ++    NF +S V L KEI VKAY  KK+LELG+   + D + +
Sbjct  121   RRGHPVIDASQFSDFSQLAKSINFQDSTVDLIKEILVKAYATKKSLELGYSTWLVDGSTL  180

Query  1032  PLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITTTSSDS  853
             P++ DSF +     +  DF++GK   L+F RSSSS  K W +       A L+ T + +S
Sbjct  181   PISGDSFSDS--FSSAGDFYIGKTSRLIFLRSSSSTLKIWTDDFVYN-AASLVDTLTKES  237

Query  852   DPTGKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRT-LSIQEQFVFWSSETSTN  676
                     Y V+KL E++ +K+ + ++ + +L+I ++ A++T    + +F+FWSSET  +
Sbjct  238   VSHDDIIFYGVEKLLEKQNIKYNSIEDMQLALDIGTVRANQTSFDTKNRFIFWSSETELD  297

Query  675   LIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             +I++QL  L LW+VDSD SCT V C+ S
Sbjct  298   VIKRQLAHLDLWVVDSDSSCTGVFCHRS  325



>gb|KDO66439.1| hypothetical protein CISIN_1g0444321mg, partial [Citrus sinensis]
Length=324

 Score =   296 bits (757),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 221/329 (67%), Gaps = 7/329 (2%)
 Frame = -3

Query  1572  RALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFPDRIVQ  1393
             RALS+SHRDAGVNYGKS GPDS L+ E+S+D N L+  PL ++KWYDFCF++VFP R+V+
Sbjct  1     RALSVSHRDAGVNYGKSAGPDSKLLDESSLDFNILKMQPLSNLKWYDFCFREVFPGRVVK  60

Query  1392  HFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLLLDLA  1213
               ++LG+V+PS+Q+   V++VSL   S++V RNLLC FER+  +N+I +G  SD L DLA
Sbjct  61    SMDDLGTVLPSVQRQETVLVVSLFGASDAVTRNLLCQFERINSQNHIFLGSHSDFLYDLA  120

Query  1212  IRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVADCNRV  1033
              RGHPVID D+  ++IR Y+  +   S  +LTKE+ VK YV+KK LE  +   V D N +
Sbjct  121   RRGHPVIDADQFLNDIRAYESLSLQSSDARLTKEVLVKVYVIKKCLEYRYSAWVVDANFL  180

Query  1032  PLNSDSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITTTSSDS  853
             P ++D FL  I  DA +DF+ G++ +L+F +SSSS  K W ++   ++ A L+   S   
Sbjct  181   PFSNDLFLEPI--DATSDFYYGESSKLLFVKSSSSVQKMWTKNFLYEV-ANLVDKVSLPR  237

Query  852   DPTGKNFVYVVKKLFEQK-GVKFTTFDENKSSLNISSLDASRTLS-IQEQFVFWSSETST  679
             D   +NF  ++  L  QK GV     DE+K  L+I +  A+++ S + ++ V+WS++   
Sbjct  238   D--HRNFANIMANLLRQKAGVMIKRVDESKIGLDIGTGSANQSSSAVGKKIVYWSADLGP  295

Query  678   NLIQQQLVQLGLWIVDSDMSCTAVICYPS  592
             + IQ+QL +L LW +DSD SC AVIC+ S
Sbjct  296   DRIQKQLEELSLWDIDSDSSCKAVICHQS  324



>ref|XP_007015362.1| 30S ribosomal protein S3, putative isoform 2 [Theobroma cacao]
 gb|EOY32981.1| 30S ribosomal protein S3, putative isoform 2 [Theobroma cacao]
Length=504

 Score =   293 bits (751),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = -3

Query  2304  SFTFIIKLLAYnrlsslsrclnsLAAAHY-DHHAVHLHIFIDHFPVPANASLDVDRNLNS  2128
             +F+  IK+L +NRL+SL+RCL SL+ A+Y   H VHLHIFIDHFP  + +   +D  L  
Sbjct  50    TFSLTIKVLTFNRLNSLTRCLTSLSNAYYLPDHPVHLHIFIDHFPNQSKSG--IDPKLQD  107

Query  2127  SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYF  1948
             S  IL FVD F WK+G K+VHYRT+N GLQAQWLEAWWP+SD+EFAFVVEDDLE+SPL+F
Sbjct  108   SLGILQFVDGFEWKWGQKIVHYRTTNVGLQAQWLEAWWPTSDNEFAFVVEDDLELSPLFF  167

Query  1947  RFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQL  1768
             ++L+ LI+NYYYNASNFSP +YGASLQRPRFVPGKHGNKM +DS + +FLYQLVGTWGQL
Sbjct  168   KYLRALILNYYYNASNFSPFVYGASLQRPRFVPGKHGNKMLLDSTSGLFLYQLVGTWGQL  227

Query  1767  LFPRPWKEFRLWYDTHKSKGMKPVLDGMVT  1678
             LFP+PWKEFRLWYD HK KG+KP L+GM +
Sbjct  228   LFPKPWKEFRLWYDDHKGKGIKPFLEGMTS  257


 Score =   201 bits (510),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 158/264 (60%), Gaps = 9/264 (3%)
 Frame = -3

Query  1374  SVIPSLQKMSN--VILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLLLDLAIRGH  1201
              + P L+ M++  V+LVSL   SE+V RNLLCHFERL I NYI +GP +D L DLA RGH
Sbjct  247   GIKPFLEGMTSGTVLLVSLFAASEAVTRNLLCHFERLNIWNYIFIGPATDFLFDLARRGH  306

Query  1200  PVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVADCNRVPLNS  1021
             PVID D+  +NIR Y      +   +   +I +KAYVVKK LE  +   V D N V +N+
Sbjct  307   PVIDADQFLNNIRAYKSMGIQDLKARFKNDILLKAYVVKKCLEFSYNTWVVDGNMVLVNN  366

Query  1020  DSFLNFIDTDAVNDFFVGKNLELVFARSSSSAAKTWGESISSQLGAELITTTSSDSDPT-  844
             D FL  ID+    +F+ G++L+L F ++S SA K   +     + A L      +S PT 
Sbjct  367   DLFLKSIDS--TYNFYAGESLDLFFVKNSPSAHKILADDFLYDVAALL----DKNSLPTD  420

Query  843   GKNFVYVVKKLFEQKGVKFTTFDENKSSLNISSLDASRTLSIQEQFVFWSSETSTNLIQQ  664
              + FV V+ KL E+KG +    DE      + + + +RTL   ++ V+WS E+  + IQ 
Sbjct  421   SRKFVSVMAKLLEKKGFRVKRIDEKSFGEKLGNQNLNRTLETDKRVVYWSRESDIDSIQM  480

Query  663   QLVQLGLWIVDSDMSCTAVICYPS  592
             +L +L LW++D+D SCTAV+C+ S
Sbjct  481   RLQELSLWVIDNDSSCTAVVCHKS  504



>gb|KDO66438.1| hypothetical protein CISIN_1g0444322mg, partial [Citrus sinensis]
Length=260

 Score =   275 bits (702),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 177/218 (81%), Gaps = 7/218 (3%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDH-FPVPANAS  2155
             P    + + +FT IIK+L +NRL+SLSRCL+SL+AA Y    VHLH+++DH  P+   +S
Sbjct  48    PQNAPSHSSNFTLIIKVLTFNRLNSLSRCLHSLSAADYLTDRVHLHVYVDHSAPLADQSS  107

Query  2154  LDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVED  1975
              + D     SR IL F+D F WKFG K VHYRT+NAGLQAQWLEAWWP+SD EFAFVVED
Sbjct  108   SESD-----SRAILRFLDGFEWKFGDKFVHYRTANAGLQAQWLEAWWPTSDHEFAFVVED  162

Query  1974  DLEVSPLYFRFLKNLIVNYYYNA-SNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFL  1798
             DLEVSPL+++FL+ LIVNYYY+A SN +  IYGASLQRPRFVPGKHGNK+ +D+ T++FL
Sbjct  163   DLEVSPLFYKFLRGLIVNYYYHAPSNLTRSIYGASLQRPRFVPGKHGNKIHLDNGTQLFL  222

Query  1797  YQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGM  1684
             YQLVGTWGQLLFP+PWKEFRLWYD HK++G+KP LDGM
Sbjct  223   YQLVGTWGQLLFPQPWKEFRLWYDDHKARGIKPFLDGM  260



>gb|EYU35957.1| hypothetical protein MIMGU_mgv1a022526mg, partial [Erythranthe 
guttata]
Length=232

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 163/192 (85%), Gaps = 2/192 (1%)
 Frame = -3

Query  2337  QTPITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDH-HAVHLHIFIDHFPVPA-  2164
             Q  I T     +FTFI+KLL +NRLSSLSRCLNSL+ A+YD   AVHLH++IDHFP+ + 
Sbjct  41    QLQIATQTPGPNFTFIVKLLTFNRLSSLSRCLNSLSKANYDAGDAVHLHVYIDHFPLDSR  100

Query  2163  NASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             N S ++D  L+ SR+I+DFVD F WKFG K+VHYRT+NAGLQAQWLEAWWPSSD EFAFV
Sbjct  101   NDSAELDGKLSVSRQIVDFVDGFDWKFGEKLVHYRTTNAGLQAQWLEAWWPSSDHEFAFV  160

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRV  1804
             VEDDLEVSPLY+RFLK +I+NYYYNASNFSP IYGASLQRPRFVPGKHGNKM++D   ++
Sbjct  161   VEDDLEVSPLYYRFLKAVILNYYYNASNFSPSIYGASLQRPRFVPGKHGNKMQLDGENQI  220

Query  1803  FLYQLVGTWGQL  1768
             FLY+LVGTWGQL
Sbjct  221   FLYELVGTWGQL  232



>ref|XP_006836246.1| hypothetical protein AMTR_s00101p00129070 [Amborella trichopoda]
 gb|ERM99099.1| hypothetical protein AMTR_s00101p00129070 [Amborella trichopoda]
Length=277

 Score =   249 bits (637),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 167/262 (64%), Gaps = 4/262 (2%)
 Frame = -3

Query  1686  MVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDS  1507
             MVTT WYKK GERIWTPWFIKF+ + G FN+YTN+  E ALS+SHRDAGVNYG+S GPDS
Sbjct  1     MVTTNWYKKKGERIWTPWFIKFLRSFGCFNLYTNISLESALSVSHRDAGVNYGRSAGPDS  60

Query  1506  NLV-GENSIDINHLEFHPLHSMKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILV  1330
             NL+ G + +DIN  E  PL  +KW+DFCF +V   R+ ++FNELGS++ SLQK   VI+V
Sbjct  61    NLINGSSPLDINLWEMKPLKDLKWFDFCFGEVVMGRVAKNFNELGSLLLSLQKQGTVIVV  120

Query  1329  SLHQESESVVRNLLCHFERLYIRNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDK  1150
              L++ S++   NLL HFERL IRNYIL G     L DLA RGHPV+D++ L   IR  D 
Sbjct  121   DLYRISKANAMNLLSHFERLNIRNYILFGDGLGFLYDLANRGHPVVDSEPLVLEIRAVDP  180

Query  1149  SNFNESAVKLTKEIFVKAYVVKKTLELGFGILVADCNRVPLNSDSFLNFIDTDAVNDFFV  970
                        KEI +K +V+ K LE G G  +   N VP+  + F N   T    D  +
Sbjct  181   MKMQGVNSDFMKEILIKNHVINKCLESGLGAWLITANMVPI-ENLFSNM--TYQREDMVL  237

Query  969   GKNLELVFARSSSSAAKTWGES  904
              ++ EL+F R+  +  K W  S
Sbjct  238   VRDTELLFFRNLETMVKAWSSS  259



>ref|XP_006446348.1| hypothetical protein CICLE_v10017537mg [Citrus clementina]
 gb|ESR59588.1| hypothetical protein CICLE_v10017537mg [Citrus clementina]
Length=316

 Score =   226 bits (577),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 141/203 (69%), Gaps = 8/203 (4%)
 Frame = -3

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDI  1477
             GERIWTPWFIKF+H+R YFN YTN    RALS+SHRDAGVNYGKS GPDS  + E+S D 
Sbjct  6     GERIWTPWFIKFMHSRCYFNFYTNFPNARALSVSHRDAGVNYGKSAGPDSKPLDESSRDF  65

Query  1476  NHLEFHPLHSMKWYDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVR  1297
             N     PL ++KW+DFCF++V P R+V+  ++LGSV+PS+Q+   V++ SL   S++V R
Sbjct  66    NIPTMPPLSNLKWHDFCFREVLPGRVVKSMDDLGSVLPSVQRQETVLVASLFGASKAVTR  125

Query  1296  NLLCHFERLYIRNYILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLT  1117
             NLLC FER+  +N+I  GP S+ L DLA RG P+ID       IR Y+  +   S  +LT
Sbjct  126   NLLCQFERINSQNHIFGGPHSEFLYDLARRGRPMID-------IRAYESLSLQTSTARLT  178

Query  1116  KEIFVKAYVVKKTLEL-GFGILV  1051
             KE+ VK YV+KK LE   FG+ +
Sbjct  179   KEVLVKVYVIKKCLEYRNFGLTI  201



>ref|XP_009492636.1| hypothetical protein, variant 8 [Fonticula alba]
 gb|KCV72943.1| hypothetical protein, variant 8 [Fonticula alba]
Length=668

 Score =   182 bits (463),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 171/324 (53%), Gaps = 20/324 (6%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVP---AN  2161
             P+  T   K F   +K++A+NR  +L R   SL AA +    V L I+ID FP P   AN
Sbjct  330   PVPATV--KDFRLTVKIIAFNRPRALLRLFRSLDAADFMGDKVDLDIYID-FPSPELVAN  386

Query  2160  ASLD-------VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSD  2002
             A+L+        D +L    R+    + + W+ G K VH R  + GL  QWL +W+P   
Sbjct  387   ATLEQNDPNNEADISLQEYARVRQMSEVYRWRHGRKQVHARDKHYGLAGQWLASWFPMGT  446

Query  2001  DEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMK-  1825
              E A ++EDD  VSP ++ +LK  +  YY+N   F P +YG  LQ    +PG++  + K 
Sbjct  447   TEIAIILEDDNIVSPYFYVWLKRAVEYYYFNPEQFDPRVYGIMLQSQHMIPGRYPKRPKE  506

Query  1824  -IDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSK-GMKPVLDGMVTTGWY--KKM  1657
              +    + F YQL+ TWG + FP  W EF  W++   S    +P+   M+T  W+  +  
Sbjct  507   FLPHDAKFFRYQLLSTWGPVFFPHHWAEFISWFNEKSSDPSFQPLFSNMITNSWFLARGG  566

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDI  1477
             G  +W+ WF++F   RGY+ +YTN    +A  +++RD GVNY K  G +S +V      +
Sbjct  567   GRAVWSAWFMRFAAERGYYALYTNFPDGQAFVVNYRDKGVNYHKDQGANSPMVEHIMPYM  626

Query  1476  NHLEFHPLHSMKWYDFCFKQVFPD  1405
             + L   P+  +  YDF F ++ P+
Sbjct  627   DVLP--PMKELPLYDFHFNRIDPE  648



>ref|XP_009492638.1| hypothetical protein, variant 3 [Fonticula alba]
 gb|KCV72938.1| hypothetical protein, variant 3 [Fonticula alba]
Length=806

 Score =   182 bits (463),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 171/324 (53%), Gaps = 20/324 (6%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVP---AN  2161
             P+  T   K F   +K++A+NR  +L R   SL AA +    V L I+ID FP P   AN
Sbjct  468   PVPATV--KDFRLTVKIIAFNRPRALLRLFRSLDAADFMGDKVDLDIYID-FPSPELVAN  524

Query  2160  ASLD-------VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSD  2002
             A+L+        D +L    R+    + + W+ G K VH R  + GL  QWL +W+P   
Sbjct  525   ATLEQNDPNNEADISLQEYARVRQMSEVYRWRHGRKQVHARDKHYGLAGQWLASWFPMGT  584

Query  2001  DEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMK-  1825
              E A ++EDD  VSP ++ +LK  +  YY+N   F P +YG  LQ    +PG++  + K 
Sbjct  585   TEIAIILEDDNIVSPYFYVWLKRAVEYYYFNPEQFDPRVYGIMLQSQHMIPGRYPKRPKE  644

Query  1824  -IDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKS-KGMKPVLDGMVTTGWY--KKM  1657
              +    + F YQL+ TWG + FP  W EF  W++   S    +P+   M+T  W+  +  
Sbjct  645   FLPHDAKFFRYQLLSTWGPVFFPHHWAEFISWFNEKSSDPSFQPLFSNMITNSWFLARGG  704

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDI  1477
             G  +W+ WF++F   RGY+ +YTN    +A  +++RD GVNY K  G +S +V      +
Sbjct  705   GRAVWSAWFMRFAAERGYYALYTNFPDGQAFVVNYRDKGVNYHKDQGANSPMVEHIMPYM  764

Query  1476  NHLEFHPLHSMKWYDFCFKQVFPD  1405
             + L   P+  +  YDF F ++ P+
Sbjct  765   DVLP--PMKELPLYDFHFNRIDPE  786



>ref|XP_009492643.1| hypothetical protein H696_00498 [Fonticula alba]
 gb|KCV72935.1| hypothetical protein H696_00498 [Fonticula alba]
Length=859

 Score =   182 bits (463),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 171/324 (53%), Gaps = 20/324 (6%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVP---AN  2161
             P+  T   K F   +K++A+NR  +L R   SL AA +    V L I+ID FP P   AN
Sbjct  521   PVPATV--KDFRLTVKIIAFNRPRALLRLFRSLDAADFMGDKVDLDIYID-FPSPELVAN  577

Query  2160  ASLD-------VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSD  2002
             A+L+        D +L    R+    + + W+ G K VH R  + GL  QWL +W+P   
Sbjct  578   ATLEQNDPNNEADISLQEYARVRQMSEVYRWRHGRKQVHARDKHYGLAGQWLASWFPMGT  637

Query  2001  DEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMK-  1825
              E A ++EDD  VSP ++ +LK  +  YY+N   F P +YG  LQ    +PG++  + K 
Sbjct  638   TEIAIILEDDNIVSPYFYVWLKRAVEYYYFNPEQFDPRVYGIMLQSQHMIPGRYPKRPKE  697

Query  1824  -IDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKS-KGMKPVLDGMVTTGWY--KKM  1657
              +    + F YQL+ TWG + FP  W EF  W++   S    +P+   M+T  W+  +  
Sbjct  698   FLPHDAKFFRYQLLSTWGPVFFPHHWAEFISWFNEKSSDPSFQPLFSNMITNSWFLARGG  757

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDI  1477
             G  +W+ WF++F   RGY+ +YTN    +A  +++RD GVNY K  G +S +V      +
Sbjct  758   GRAVWSAWFMRFAAERGYYALYTNFPDGQAFVVNYRDKGVNYHKDQGANSPMVEHIMPYM  817

Query  1476  NHLEFHPLHSMKWYDFCFKQVFPD  1405
             + L   P+  +  YDF F ++ P+
Sbjct  818   DVLP--PMKELPLYDFHFNRIDPE  839



>ref|XP_009492637.1| hypothetical protein, variant 2 [Fonticula alba]
 ref|XP_009492644.1| hypothetical protein, variant 1 [Fonticula alba]
 gb|KCV72936.1| hypothetical protein, variant 1 [Fonticula alba]
 gb|KCV72937.1| hypothetical protein, variant 2 [Fonticula alba]
Length=845

 Score =   182 bits (462),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/324 (34%), Positives = 171/324 (53%), Gaps = 20/324 (6%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVP---AN  2161
             P+  T   K F   +K++A+NR  +L R   SL AA +    V L I+ID FP P   AN
Sbjct  507   PVPATV--KDFRLTVKIIAFNRPRALLRLFRSLDAADFMGDKVDLDIYID-FPSPELVAN  563

Query  2160  ASLD-------VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSD  2002
             A+L+        D +L    R+    + + W+ G K VH R  + GL  QWL +W+P   
Sbjct  564   ATLEQNDPNNEADISLQEYARVRQMSEVYRWRHGRKQVHARDKHYGLAGQWLASWFPMGT  623

Query  2001  DEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMK-  1825
              E A ++EDD  VSP ++ +LK  +  YY+N   F P +YG  LQ    +PG++  + K 
Sbjct  624   TEIAIILEDDNIVSPYFYVWLKRAVEYYYFNPEQFDPRVYGIMLQSQHMIPGRYPKRPKE  683

Query  1824  -IDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKS-KGMKPVLDGMVTTGWY--KKM  1657
              +    + F YQL+ TWG + FP  W EF  W++   S    +P+   M+T  W+  +  
Sbjct  684   FLPHDAKFFRYQLLSTWGPVFFPHHWAEFISWFNEKSSDPSFQPLFSNMITNSWFLARGG  743

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDI  1477
             G  +W+ WF++F   RGY+ +YTN    +A  +++RD GVNY K  G +S +V      +
Sbjct  744   GRAVWSAWFMRFAAERGYYALYTNFPDGQAFVVNYRDKGVNYHKDQGANSPMVEHIMPYM  803

Query  1476  NHLEFHPLHSMKWYDFCFKQVFPD  1405
             + L   P+  +  YDF F ++ P+
Sbjct  804   DVLP--PMKELPLYDFHFNRIDPE  825



>ref|XP_006377113.1| hypothetical protein POPTR_0012s15140g [Populus trichocarpa]
 gb|ERP54910.1| hypothetical protein POPTR_0012s15140g [Populus trichocarpa]
Length=187

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 121/191 (63%), Gaps = 14/191 (7%)
 Frame = -3

Query  1608  GYFNI--YTNLLYERALSIS-HRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKW  1438
             GY+N+  ++  +Y+  L  S H  + VN   S           S+D N LE  PL ++KW
Sbjct  4     GYYNVSNFSPFIYDMVLHFSVHGLSQVNMDGS-----------SLDFNLLEMQPLSNLKW  52

Query  1437  YDFCFKQVFPDRIVQHFNELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRN  1258
             +D+CF++V P R+ +  +E+GS++ ++Q+  +V+LV++   S+++ RN+LCHFERL IRN
Sbjct  53    FDYCFREVLPGRVGRTLDEVGSILRTVQEDQSVLLVNIFGASDTITRNMLCHFERLNIRN  112

Query  1257  YILMGPKSDLLLDLAIRGHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKT  1078
             YIL+ P SD L DLA RGHPVID D+ +++ R      F  S+ +L K I V AYV+KK 
Sbjct  113   YILIRPGSDFLFDLARRGHPVIDADQFFNHHRAQKVMGFQHSSAELMKNILVNAYVIKKC  172

Query  1077  LELGFGILVAD  1045
             LE G+  L+ +
Sbjct  173   LENGYDSLIVN  183



>ref|XP_005715832.1| unnamed protein product [Chondrus crispus]
 emb|CDF36013.1| unnamed protein product [Chondrus crispus]
Length=437

 Score =   135 bits (339),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 130/241 (54%), Gaps = 22/241 (9%)
 Frame = -3

Query  2226  AHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNA  2047
             A+Y    V L I+ID     AN     +  L++ ++++       WK G K VH R +NA
Sbjct  173   ANYGEDHVDLDIWIDR----ANDKPIHEGVLHACQKVI-------WKQGTKTVHKRAANA  221

Query  2046  GLQAQWLEAWWPSSDD-EFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASL  1870
             GL  QW+  W  +S+  EFA ++EDDLEVSP ++++L+     Y  ++      +   +L
Sbjct  222   GLYQQWIYTWNITSETTEFAVILEDDLEVSPAFYQWLRVARAAYAQDSD-----VGAFTL  276

Query  1869  QRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLD  1690
             QR    P      + I +   VF Y+L+GTWG       W EFR W++  +++G KP +D
Sbjct  277   QRSTLRPRGASRPLDIPAEHPVFKYRLLGTWGFAPQRDTWVEFRKWFEEKRARGEKPYVD  336

Query  1689  GMVTTGWYKKM-----GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGK  1525
             G++TT WYK          +W+ W+IKF   +GYF +  +L    +L+ + R++G++Y K
Sbjct  337   GLITTQWYKSQEKDGFAPNMWSQWWIKFADEKGYFTVTGHLPDGTSLASNWRESGLHYSK  396

Query  1524  S  1522
             +
Sbjct  397   N  397



>gb|AFM95207.1| hypothetical protein, partial [Cynara cardunculus var. scolymus]
Length=117

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = -3

Query  1386  NELGSVIPSLQKMSNVILVSLHQESESVVRNLLCHFERLYIRNYILMGPKSDLLLDLAIR  1207
             +EL  V+ + +KM++++LVS+++ SE   RNLLCHFERL IRNYI +GP  + LLDL+ R
Sbjct  2     HELEPVLKTARKMNSLVLVSIYRTSEMFTRNLLCHFERLDIRNYIFIGPDRNFLLDLSRR  61

Query  1206  GHPVIDTDRLYDNIRVYDKSNFNESAVKLTKEIFVKAYVVKKTLELGFGILVADCNRVPL  1027
             GHPVID +R  D+I+ Y        + K  KEIFVKAYV+KK LE+     V D N +P+
Sbjct  62    GHPVIDVNRFVDDIKEY-------KSFKYQKEIFVKAYVIKKALEMNCDTWVLDHNMLPV  114

Query  1026  NSD  1018
              +D
Sbjct  115   KND  117



>ref|XP_005824698.1| hypothetical protein GUITHDRAFT_165425 [Guillardia theta CCMP2712]
 gb|EKX37718.1| hypothetical protein GUITHDRAFT_165425 [Guillardia theta CCMP2712]
Length=801

 Score =   125 bits (315),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 134/280 (48%), Gaps = 28/280 (10%)
 Frame = -3

Query  2295  FIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRI  2116
              IIK+L + R SSL R L SL  A+Y      L I+ID    P+  S D +R     ++ 
Sbjct  107   LIIKVLTFARPSSLLRLLRSLDLANYSPDRADLEIWIDG---PSGGSRDEER-----KKT  158

Query  2115  LDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSD----DEFAFVVEDDLEVSPLYF  1948
             L   + F W+ G K +  R  N GL  QWL  W P       +    + EDD+EVSP+Y+
Sbjct  159   LQVAEEFSWRHGKKTLEVRDKNVGLVGQWLGCWQPEEGARLFESIVVIFEDDMEVSPVYW  218

Query  1947  RFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQL  1768
             R+LK++   Y    +    +I G SLQ    V     + ++ID+    FLY++ G+WG  
Sbjct  219   RWLKSMWPRYRRALARRQDLI-GISLQTQHLVASDGRDNLRIDNEYEPFLYKVPGSWGFS  277

Query  1767  LFPRPWKEFRLWYDTHKSKGMKP-----VLDGMVTTGWYKKM-----GERIWTPWFIKFI  1618
               PR W+ F  W     + G +P         ++T+ W+K +       R+WT W ++F+
Sbjct  278   PHPRTWRLFLRWQQAKSATGYEPDDLKFRGGDVITSKWWKDIKRSGKSPRMWTAWCMRFM  337

Query  1617  HARGYFNIYTNLLYERALSIS-----HRDAGVNYGKSVGP  1513
                G F +Y NL   RA + +       DAG   G+  GP
Sbjct  338   EDEGLFGMYPNLPGRRAFTATWSEPGEHDAGHMGGRLSGP  377



>ref|XP_005828343.1| hypothetical protein GUITHDRAFT_142059 [Guillardia theta CCMP2712]
 gb|EKX41363.1| hypothetical protein GUITHDRAFT_142059 [Guillardia theta CCMP2712]
Length=1410

 Score =   122 bits (306),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 125/254 (49%), Gaps = 24/254 (9%)
 Frame = -3

Query  2229  AAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSN  2050
             +A+YD     LH+  D  P                ++    V++  W +G K +H  +++
Sbjct  260   SAYYDGIRADLHVHQDRLP-----------GQPPDQQTAYVVESLDWPWGIKELHQWSTH  308

Query  2049  AGLQAQWLEAWWPSSDD--EFAFVVEDDLEVSPLYFRFLKNLIVNYY--YNASNFSPMIY  1882
              G+   W+E+W PSS D  +    +EDDLEVSP + R+       +   ++ + FS M  
Sbjct  309   VGIMGNWIESWQPSSHDSNKIPIFLEDDLEVSPFFARWFLAAHKRFAKDHSVAGFSGMRA  368

Query  1881  GASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKS-KGM  1705
                   PR   G  GN   I +   VF Y+L+GTW     PR W+EFR+WY+  +  +G 
Sbjct  369   QLRASDPR-EEGLMGNT--IPNTFTVFKYKLMGTWSYSPKPRVWREFRIWYEKVRGVQGF  425

Query  1704  KPVLDGMVTTGWY-----KKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
              PV++G+  + WY         E IW  W I+F+H RG + +Y  L  E+ L  + R+AG
Sbjct  426   LPVVEGIQPSVWYLSFLETGRAETIWEMWHIRFMHERGLYCVYPWLFNEKTLVANWREAG  485

Query  1539  VNYGKSVGPDSNLV  1498
             ++Y  + G D  L+
Sbjct  486   LHYEVAGGKDFQLL  499



>ref|XP_009492640.1| hypothetical protein, variant 5 [Fonticula alba]
 ref|XP_009492641.1| hypothetical protein, variant 6 [Fonticula alba]
 gb|KCV72940.1| hypothetical protein, variant 5 [Fonticula alba]
 gb|KCV72941.1| hypothetical protein, variant 6 [Fonticula alba]
Length=756

 Score =   120 bits (302),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 122/240 (51%), Gaps = 24/240 (10%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVP---AN  2161
             P+  T   K F   +K++A+NR  +L R   SL AA +    V L I+ID FP P   AN
Sbjct  507   PVPATV--KDFRLTVKIIAFNRPRALLRLFRSLDAADFMGDKVDLDIYID-FPSPELVAN  563

Query  2160  ASLD-------VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSD  2002
             A+L+        D +L    R+    + + W+ G K VH R  + GL  QWL +W+P   
Sbjct  564   ATLEQNDPNNEADISLQEYARVRQMSEVYRWRHGRKQVHARDKHYGLAGQWLASWFPMGT  623

Query  2001  DEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMK-  1825
              E A ++EDD  VSP ++ +LK  +  YY+N   F P +YG  LQ    +PG++  + K 
Sbjct  624   TEIAIILEDDNIVSPYFYVWLKRAVEYYYFNPEQFDPRVYGIMLQSQHMIPGRYPKRPKE  683

Query  1824  -IDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGER  1648
              +    + F YQL+ TWG + FP  W EF  W        + P +   V  G ++++G R
Sbjct  684   FLPHDAKFFRYQLLSTWGPVFFPHHWAEFISWC-------VCPAV--CVCGGPHRRLGSR  734



>ref|XP_009492642.1| hypothetical protein, variant 7 [Fonticula alba]
 gb|KCV72942.1| hypothetical protein, variant 7 [Fonticula alba]
Length=717

 Score =   120 bits (302),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 122/240 (51%), Gaps = 24/240 (10%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVP---AN  2161
             P+  T   K F   +K++A+NR  +L R   SL AA +    V L I+ID FP P   AN
Sbjct  468   PVPATV--KDFRLTVKIIAFNRPRALLRLFRSLDAADFMGDKVDLDIYID-FPSPELVAN  524

Query  2160  ASLD-------VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSD  2002
             A+L+        D +L    R+    + + W+ G K VH R  + GL  QWL +W+P   
Sbjct  525   ATLEQNDPNNEADISLQEYARVRQMSEVYRWRHGRKQVHARDKHYGLAGQWLASWFPMGT  584

Query  2001  DEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMK-  1825
              E A ++EDD  VSP ++ +LK  +  YY+N   F P +YG  LQ    +PG++  + K 
Sbjct  585   TEIAIILEDDNIVSPYFYVWLKRAVEYYYFNPEQFDPRVYGIMLQSQHMIPGRYPKRPKE  644

Query  1824  -IDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGER  1648
              +    + F YQL+ TWG + FP  W EF  W        + P +   V  G ++++G R
Sbjct  645   FLPHDAKFFRYQLLSTWGPVFFPHHWAEFISWC-------VCPAV--CVCGGPHRRLGSR  695



>ref|XP_009492639.1| hypothetical protein, variant 4 [Fonticula alba]
 gb|KCV72939.1| hypothetical protein, variant 4 [Fonticula alba]
Length=770

 Score =   120 bits (302),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 122/240 (51%), Gaps = 24/240 (10%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVP---AN  2161
             P+  T   K F   +K++A+NR  +L R   SL AA +    V L I+ID FP P   AN
Sbjct  521   PVPATV--KDFRLTVKIIAFNRPRALLRLFRSLDAADFMGDKVDLDIYID-FPSPELVAN  577

Query  2160  ASLD-------VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSD  2002
             A+L+        D +L    R+    + + W+ G K VH R  + GL  QWL +W+P   
Sbjct  578   ATLEQNDPNNEADISLQEYARVRQMSEVYRWRHGRKQVHARDKHYGLAGQWLASWFPMGT  637

Query  2001  DEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMK-  1825
              E A ++EDD  VSP ++ +LK  +  YY+N   F P +YG  LQ    +PG++  + K 
Sbjct  638   TEIAIILEDDNIVSPYFYVWLKRAVEYYYFNPEQFDPRVYGIMLQSQHMIPGRYPKRPKE  697

Query  1824  -IDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGER  1648
              +    + F YQL+ TWG + FP  W EF  W        + P +   V  G ++++G R
Sbjct  698   FLPHDAKFFRYQLLSTWGPVFFPHHWAEFISWC-------VCPAV--CVCGGPHRRLGSR  748



>ref|XP_005828362.1| hypothetical protein GUITHDRAFT_142073 [Guillardia theta CCMP2712]
 gb|EKX41382.1| hypothetical protein GUITHDRAFT_142073 [Guillardia theta CCMP2712]
Length=913

 Score =   119 bits (297),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 122/254 (48%), Gaps = 26/254 (10%)
 Frame = -3

Query  2226  AHYDHHAVHLHIFIDHFPV-PANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSN  2050
             AHYD     LH+  D  P  P +A                 V++F W  G K +H  +++
Sbjct  379   AHYDGIQADLHVHQDRPPSSPPDAQTTA------------IVESFTWPHGVKTLHQWSTH  426

Query  2049  AGLQAQWLEAWWPSSDDE--FAFVVEDDLEVSPLYFRFLKNLIVNYYYN--ASNFSPMIY  1882
              G+   W+ +W P++ DE   A  +EDDLE SP + R+     + +  +   S FS M  
Sbjct  427   VGILGNWIHSWQPNAQDENKIAIFLEDDLEASPHFARWFLAAHLRFLSDPAVSCFSAMRA  486

Query  1881  GASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD-THKSKGM  1705
                   PR   G+   +  +   T VF Y+L+GTW      + W+EFR W++   + KG 
Sbjct  487   QLRASDPR---GEGNLESTMKEGTTVFKYKLMGTWSFSPKAKAWREFRAWFERMQEKKGF  543

Query  1704  KPVLDGMVTTGWYKKMGER-----IWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
              P+++G++ + WY++  +      +W  WFI+F+  R  F +Y  L   + L  + R+ G
Sbjct  544   VPLVEGIMPSMWYQQFQQEGRESSMWEMWFIRFMEERKEFCVYPWLAGSKTLMANWREKG  603

Query  1539  VNYGKSVGPDSNLV  1498
             ++Y   VG D  L+
Sbjct  604   LHYQGEVGRDHELL  617



>gb|ELU18430.1| hypothetical protein CAPTEDRAFT_185049 [Capitella teleta]
Length=414

 Score =   115 bits (287),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 127/250 (51%), Gaps = 28/250 (11%)
 Frame = -3

Query  2217  DHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQ  2038
             D  +  L IF+D  P         +R  +S+ ++    + F W+ GA  VH R  + GL 
Sbjct  159   DGDSARLEIFVDRIP-------KGNRPYSSTIKV---AEKFKWRHGATRVHVRQRHTGLL  208

Query  2037  AQWLEAWWPS-SDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRP  1861
              QW+ +W P     E A ++EDDL VSP  +++L+ +        + +   + G SLQ  
Sbjct  209   GQWIYSWAPQVGTKEIALILEDDLSVSPYAYKWLRAV-------RNAYPTDVQGYSLQSE  261

Query  1860  RFVPGKHGNKMKIDSRT--RVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDG  1687
                  K  N+  +   T   VF+Y+++GTWG    P  W+EF+ W+ T K+  +KP +  
Sbjct  262   NVKDVKLKNRRDLHGGTIDTVFMYRVLGTWGFAPHPESWREFQHWFMT-KNASVKPYMPD  320

Query  1686  MVTTGWYKKMGER-IWTPWFIKFIHARGYFNIYTNLLY-----ERALSISHRDAGVNY-G  1528
              + T WYK  G+R +W+ W I F  ++G+  +Y NL +        L ++ ++ G++Y G
Sbjct  321   SIITKWYKDSGDRNMWSIWHIYFSSSQGFSCVYNNLNFYLNTTSACLVVNRQEKGLHYHG  380

Query  1527  KSVGPDSNLV  1498
             K+V    NL+
Sbjct  381   KAVNNIGNLL  390



>gb|EPS66725.1| hypothetical protein M569_08051 [Genlisea aurea]
Length=336

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 111/222 (50%), Gaps = 19/222 (9%)
 Frame = -3

Query  2115  LDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLK  1936
             L  V  F W  G K +  R    GL     E+W+PSS+ +F  ++EDD+EVSP Y+ ++K
Sbjct  48    LKLVTTFNWAHGTKTIRKRVLRGGLIKSVSESWYPSSNHDFGLLLEDDIEVSPYYYLWIK  107

Query  1935  NLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNKMKIDS-RTRVFLYQLVGTW  1777
               ++ Y+Y+     P +   SL  PR +      P  +  +   D+ R   +L+QL  +W
Sbjct  108   YALLTYHYDPKASFPELSSISLYTPRVIEVLRERPFWNPTEFFDDADRNMPYLHQLPCSW  167

Query  1776  GQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARG  1606
             G + FP+ W+EF  + +      S G +  +   VT GW     +R W  +FI+ ++ RG
Sbjct  168   GAVFFPKHWREFNAYINLRSDRNSTGDQVEIPRSVTNGW-----KRSWKKFFIEMMYLRG  222

Query  1605  YFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
             Y ++Y N   + + S +H + GV+    +   +N V E   D
Sbjct  223   YVSLYPNFPNQTSFSTNHMEPGVH----IQAKNNAVNEKRKD  260



>ref|XP_011014936.1| PREDICTED: uncharacterized protein LOC105118649 [Populus euphratica]
Length=923

 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 118/253 (47%), Gaps = 41/253 (16%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V++FGW  G K +  R    GL     E+W+PSS
Sbjct  618   DEIPISFNMDSKVDEE------TIRLVNSFGWPHGPKTLRRRIIQGGLIRAVSESWYPSS  671

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVP--------  1849
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V         
Sbjct  672   DDDYGLLLEDDIEVSPFYYLWMKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKW  731

Query  1848  -------GKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV  1696
                    G H N          +L+QL  +WG + FP+ W+EF ++ +T  ++  K  PV
Sbjct  732   NATEFFKGIHPNT--------PYLHQLPCSWGAMFFPKQWREFYVYMNTRFTEDAKANPV  783

Query  1695  -LDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSV  1519
              +    T GW     +  W  +FI  ++ RGY ++Y N   + + S +H + G +    +
Sbjct  784   QIPKSRTNGW-----QASWKKFFIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----I  834

Query  1518  GPDSNLVGENSID  1480
                 N+V  +  D
Sbjct  835   SAKDNVVKHDKTD  847



>ref|XP_011040898.1| PREDICTED: uncharacterized protein LOC105137030 [Populus euphratica]
Length=923

 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 118/253 (47%), Gaps = 41/253 (16%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V++FGW  G K +  R    GL     E+W+PSS
Sbjct  618   DEIPISFNMDSKVDEE------TIRLVNSFGWPHGPKTLRRRIIQGGLIRAVSESWYPSS  671

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVP--------  1849
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V         
Sbjct  672   DDDYGLLLEDDIEVSPFYYLWMKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKW  731

Query  1848  -------GKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV  1696
                    G H N          +L+QL  +WG + FP+ W+EF ++ +T  ++  K  PV
Sbjct  732   NATEFFKGIHPNT--------PYLHQLPCSWGAMFFPKQWREFYVYMNTRFTEDAKANPV  783

Query  1695  -LDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSV  1519
              +    T GW     +  W  +FI  ++ RGY ++Y N   + + S +H + G +    +
Sbjct  784   QIPKSRTNGW-----QASWKKFFIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----I  834

Query  1518  GPDSNLVGENSID  1480
                 N+V  +  D
Sbjct  835   SAKDNVVKHDKTD  847



>ref|XP_001754447.1| predicted protein [Physcomitrella patens]
 gb|EDQ80897.1| predicted protein [Physcomitrella patens]
Length=666

 Score =   112 bits (280),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 109/222 (49%), Gaps = 17/222 (8%)
 Frame = -3

Query  2157  SLDVDRNLNSS--RRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             ++D+  N++S+     L+ VD+F W  G K+V  R    GL     E+W+P+S+DEF  +
Sbjct  363   TIDISFNMDSAVDNPTLNMVDSFDWPHGKKIVRRRIIQGGLIRAVSESWYPASNDEFGLL  422

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV----PGKHGNKMKIDS  1816
             +EDD+EVSP Y+ +LK  ++ YYYN +   P +   +L  PR V       H N     S
Sbjct  423   LEDDIEVSPYYYMWLKYALMQYYYNPNVHLPELNSIALYTPRVVEVVKERPHWNATDFFS  482

Query  1815  RTR---VFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKMG  1654
                    +L+QL  +WG L  P  W+EF  +     T  +K     +    T GW     
Sbjct  483   PVHPNTPYLHQLPCSWGALFMPARWREFYKYMGMRFTEDAKSNPVQIPKSRTNGW-----  537

Query  1653  ERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYG  1528
             +  W  + I  ++ RGY  +Y N   + + S +H + G + G
Sbjct  538   QASWKKFLIDMMYLRGYVTLYPNFPNQTSFSTNHMEPGAHIG  579



>ref|XP_007261352.1| hypothetical protein FOMMEDRAFT_24784 [Fomitiporia mediterranea 
MF3/22]
 gb|EJD07400.1| hypothetical protein FOMMEDRAFT_24784 [Fomitiporia mediterranea 
MF3/22]
Length=754

 Score =   110 bits (275),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 107/211 (51%), Gaps = 23/211 (11%)
 Frame = -3

Query  2127  SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYF  1948
             +RRI   VD F W  G   VH+R  +AGL+   +E+W+P S+  +  ++EDD+EVSPL++
Sbjct  428   TRRI---VDQFSWIHGEIFVHHRVVHAGLRTAIVESWYPHSNHSYVILLEDDVEVSPLFY  484

Query  1947  RFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDS-----------RTRVF  1801
              + K  ++ Y Y ASN  P ++G SL + + +  +   +   D+           R   +
Sbjct  485   AWAKMSLLRYRYGASNRQPTLFGISLYQQKQIELRPEGRRPFDAQALFDSFGVLYRNTPY  544

Query  1800  LYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMV----TTGWYKKMGERIWTPW  1633
             L Q+  +WG + FP  W+EF  +     SK   P+ D +V    +  W K      W  +
Sbjct  545   LSQIPCSWGAVYFPEHWQEFHAYLTIRLSKAWIPLRDHVVPDVRSNRWAKS-----WKKF  599

Query  1632  FIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
             FI+  + RGY  +Y N     +LS +H + G
Sbjct  600   FIELAYLRGYVMLYPNYDDFVSLSTNHLEVG  630



>ref|XP_001756912.1| predicted protein [Physcomitrella patens]
 gb|EDQ78143.1| predicted protein [Physcomitrella patens]
Length=669

 Score =   109 bits (273),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/225 (30%), Positives = 109/225 (48%), Gaps = 17/225 (8%)
 Frame = -3

Query  2157  SLDVDRNLNSS--RRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             ++D+  N++ +   R L  +D+F W  G K+V  R    GL     E+W+P+SD++F  +
Sbjct  366   TIDISFNMDVAVDSRTLYVIDSFNWPHGQKIVRRRIIRGGLIRAVSESWYPASDNDFGLL  425

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV----PGKHGNKMKIDS  1816
             +EDD+EVSP Y+ +LK   + YYYN +   P +   +L  PR V       H N     S
Sbjct  426   LEDDIEVSPYYYMWLKYATLQYYYNPNVHLPELNAIALYTPRVVEVVKERPHWNATDFFS  485

Query  1815  RTR---VFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKMG  1654
                    +L+QL  +WG L  P+ W+EF  +     T  +K     +    T GW     
Sbjct  486   AVHPNTPYLHQLPCSWGALFMPKRWREFYKYMGMRFTEDAKANPVQIPKSRTNGW-----  540

Query  1653  ERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSV  1519
             +  W  + I  ++ RGY  +Y N   + + S +H + G + G + 
Sbjct  541   QASWKKFLIDMMYLRGYVTLYPNFPNQTSFSTNHMERGAHIGAAT  585



>ref|XP_009613820.1| PREDICTED: uncharacterized protein LOC104106860 isoform X2 [Nicotiana 
tomentosiformis]
Length=683

 Score =   108 bits (271),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/245 (29%), Positives = 116/245 (47%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V++F W  G K +  R    GL     E+W+PSS
Sbjct  379   DEVPITFNMDSKVDE------ATIKLVNSFNWPHGPKTLRRRIIQGGLIRAVSESWYPSS  432

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  433   DDDFGLLLEDDIEVSPYYYLWIKYAVLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  492

Query  1842  HG-NKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             +  N  K       +L+QL  +WG + FP+ WKEF ++ +   ++  K  PV +    T 
Sbjct  493   NATNFFKQIHPNTPYLHQLPCSWGAVFFPKQWKEFYVYMNMRFTEDPKQNPVQIPKSRTN  552

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N++ 
Sbjct  553   GW-----QASWKKFLIDMMYLRGYVSLYPNFPNQSSFSTNHMEPGAH----IAAKENVIK  603

Query  1494  ENSID  1480
              N  D
Sbjct  604   HNKAD  608



>ref|XP_009613805.1| PREDICTED: uncharacterized protein LOC104106860 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613813.1| PREDICTED: uncharacterized protein LOC104106860 isoform X1 [Nicotiana 
tomentosiformis]
Length=928

 Score =   109 bits (272),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/245 (29%), Positives = 114/245 (47%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V++F W  G K +  R    GL     E+W+PSS
Sbjct  624   DEVPITFNMDSKVDE------ATIKLVNSFNWPHGPKTLRRRIIQGGLIRAVSESWYPSS  677

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPG-------  1846
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V         
Sbjct  678   DDDFGLLLEDDIEVSPYYYLWIKYAVLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  737

Query  1845  KHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
                N  K       +L+QL  +WG + FP+ WKEF ++ +   ++  K  PV +    T 
Sbjct  738   NATNFFKQIHPNTPYLHQLPCSWGAVFFPKQWKEFYVYMNMRFTEDPKQNPVQIPKSRTN  797

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N++ 
Sbjct  798   GW-----QASWKKFLIDMMYLRGYVSLYPNFPNQSSFSTNHMEPGAH----IAAKENVIK  848

Query  1494  ENSID  1480
              N  D
Sbjct  849   HNKAD  853



>gb|AES88566.2| glycosyltransferase family 2 protein [Medicago truncatula]
Length=936

 Score =   109 bits (272),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 119/246 (48%), Gaps = 27/246 (11%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G+K +  R    GL     E+W+PSS
Sbjct  631   DEIPITFNMDSRVDE------ATIKLVGSFEWPHGSKTLRRRIIQGGLIRAVSESWYPSS  684

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD F  ++EDD+EVSP Y+ ++K  ++NY+Y+     P +   SL  PR V      P  
Sbjct  685   DDNFGLLLEDDIEVSPYYYLWIKYALMNYHYDPQVSLPELSSISLYTPRIVEVVKERPKW  744

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   +I   T  +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +    T
Sbjct  745   NATEFFKQIHPNTP-YLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDPKKNPVQIPKSRT  803

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLV  1498
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V
Sbjct  804   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----ISAKDNVV  854

Query  1497  GENSID  1480
               N +D
Sbjct  855   KHNKMD  860



>ref|XP_009784117.1| PREDICTED: uncharacterized protein LOC104232581 [Nicotiana sylvestris]
 ref|XP_009784118.1| PREDICTED: uncharacterized protein LOC104232581 [Nicotiana sylvestris]
Length=929

 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 117/246 (48%), Gaps = 27/246 (11%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V++F W  G K +  R    GL     E+W+PSS
Sbjct  625   DEVPITFNMDSKVDE------ATIKLVNSFNWPHGPKSLRRRIIQGGLIRAVSESWYPSS  678

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  679   DDDFGLLLEDDIEVSPYYYLWIKYAVLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  738

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +      +I   T  +L+QL  +WG + FP+ WKEF ++ +   ++  K  PV +    T
Sbjct  739   NATDFFKQIHPNTP-YLHQLPCSWGAVFFPKQWKEFYVYMNMRFTEDPKQNPVQIPKSRT  797

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLV  1498
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V
Sbjct  798   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQTSFSTNHMEPGAH----IAAKENVV  848

Query  1497  GENSID  1480
               N  D
Sbjct  849   KHNKAD  854



>ref|XP_010322401.1| PREDICTED: uncharacterized protein LOC101258666 [Solanum lycopersicum]
 ref|XP_010322402.1| PREDICTED: uncharacterized protein LOC101258666 [Solanum lycopersicum]
 ref|XP_010322403.1| PREDICTED: uncharacterized protein LOC101258666 [Solanum lycopersicum]
 ref|XP_010322404.1| PREDICTED: uncharacterized protein LOC101258666 [Solanum lycopersicum]
Length=928

 Score =   108 bits (269),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 117/245 (48%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             +  P+  N    VD         L  V++F W  G K++  R    GL     E+W+PSS
Sbjct  624   EEVPITFNMDSKVDE------ATLKLVNSFNWPHGPKILRRRIIQGGLIRAVSESWYPSS  677

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  +++Y+Y+     P +   SL  PR V      P  
Sbjct  678   DDDFGLLLEDDIEVSPYYYLWIKYALLSYHYDPEISLPELSSISLYTPRLVEVVKERPKW  737

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +    T 
Sbjct  738   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKQNPVQIPRSRTN  797

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY  +Y N   + + S +H + G +    +    N++ 
Sbjct  798   GW-----QASWKKFLIDMMYLRGYVTLYPNFPNQTSFSTNHMEPGAH----IAAKENVIK  848

Query  1494  ENSID  1480
              N  D
Sbjct  849   HNKAD  853



>ref|XP_009770819.1| PREDICTED: uncharacterized protein LOC104221445 [Nicotiana sylvestris]
 ref|XP_009770821.1| PREDICTED: uncharacterized protein LOC104221445 [Nicotiana sylvestris]
Length=929

 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/222 (29%), Positives = 109/222 (49%), Gaps = 19/222 (9%)
 Frame = -3

Query  2115  LDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLK  1936
             +  V+ F W  G+K++  R    GL     E+W+PSSDD+F  ++EDD+EVSP Y+ ++K
Sbjct  642   IKLVNTFNWPHGSKIIRRRIIQGGLIRAVSESWYPSSDDDFGLLLEDDIEVSPYYYLWIK  701

Query  1935  NLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNK-MKIDSRTRVFLYQLVGTW  1777
               ++ Y+Y+     P +   SL  PR V      P  +     K       +L+QL  +W
Sbjct  702   YALLTYHYDPEISLPELSAISLYTPRLVEVVKERPKWNATDFFKHIHPNTPYLHQLPCSW  761

Query  1776  GQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTGWYKKMGERIWTPWFIKFIHARG  1606
             G   FP+ W+EF ++ +   ++  K  PV +    T GW     +  W  + I  ++ RG
Sbjct  762   GAAFFPKQWREFYVYMNMRFTEDAKQNPVQIPRSRTNGW-----QASWKKFLIDMMYLRG  816

Query  1605  YFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
             Y  +Y N   + + S +H + G +    +    N++  N +D
Sbjct  817   YVTLYPNFPNQTSFSTNHMEPGAH----IAAKENVIKHNKVD  854



>ref|XP_009631262.1| PREDICTED: uncharacterized protein LOC104121073 [Nicotiana tomentosiformis]
Length=932

 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/256 (27%), Positives = 122/256 (48%), Gaps = 30/256 (12%)
 Frame = -3

Query  2217  DHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQ  2038
             D H +   +FI         + ++D N++ +   L  V++F W  G K++  R    GL 
Sbjct  622   DAHYIGDEVFI---------TFNMDSNVDEA--TLKLVNSFNWPHGPKIIRRRIIQGGLI  670

Query  2037  AQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPR  1858
                 E+W+PSSD++F  ++EDD+EVSP ++ ++K  ++ Y+Y+     P +   SL  PR
Sbjct  671   RAVSESWYPSSDNDFGLLLEDDIEVSPYFYLWIKYALLTYHYDPEISLPELSSISLYTPR  730

Query  1857  FV------PGKHGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKP  1699
              V      P  +     K       +L+QL  +WG + FP+ W+EF ++ +   +K  K 
Sbjct  731   LVEVVKERPKWNATDFFKHIHPNTPYLHQLPCSWGAVFFPKQWREFYVYMNMRFTKDAKQ  790

Query  1698  ---VLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYG  1528
                 +    T GW     +  W  + I  ++ RGY  +Y N   + + S +H + G +  
Sbjct  791   NPFQIPRSRTNGW-----QASWKKFLIDMMYLRGYVTLYPNFPNQTSFSTNHMEPGAH--  843

Query  1527  KSVGPDSNLVGENSID  1480
               +    N++  N +D
Sbjct  844   --IAAKENVIKHNKVD  857



>ref|XP_010089967.1| hypothetical protein L484_008045 [Morus notabilis]
 gb|EXB38681.1| hypothetical protein L484_008045 [Morus notabilis]
Length=975

 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 114/221 (52%), Gaps = 23/221 (10%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             S ++D  ++ +   +  V +F W  GAK +  R    GL     E+W+PSSDD+F  ++E
Sbjct  675   SFNMDSKVDEA--TIRVVSSFEWPHGAKTLRRRIVQGGLIRAVSESWYPSSDDDFGLLLE  732

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRFVPGKHGNKM  1828
             DD+EVSP Y+ ++K  ++ Y+Y+           S ++P I     +RP++ P +   K+
Sbjct  733   DDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRIVEVVKERPKWNPTEFFKKI  792

Query  1827  KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKM  1657
               ++    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T GW    
Sbjct  793   HPNTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKANPVQIPKSRTNGW----  845

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  846   -QASWKKFLIDMMYLRGYVSLYPNFPSQASFSTNHMEPGAH  885



>gb|KHG05738.1| Poly (A) polymerase [Gossypium arboreum]
Length=498

 Score =   105 bits (263),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 113/230 (49%), Gaps = 27/230 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  VD+F W  G K +  R    GL     E+W+P+S
Sbjct  192   DEVPISFNMDSKVDE------ATIKLVDSFEWPHGPKTLRRRIIQGGLIRAVSESWYPTS  245

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P +     +RP++
Sbjct  246   DDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  305

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P +   ++  ++    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  306   NPTEFFKRIHPNTP---YLHQLPCSWGAVFFPKLWREFYVYMNMRFTEDAKANPVQIPKS  362

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  363   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQSSFSTNHMEPGAH  407



>gb|KHG18499.1| Anion exchange 4 [Gossypium arboreum]
Length=933

 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 111/230 (48%), Gaps = 27/230 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  VD+F W  G K +  R    GL     E+W+P+S
Sbjct  627   DEIPISFNMDSKVDEA------TIKVVDSFEWLHGPKTLRRRIIQGGLIRAVSESWYPTS  680

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV---------  1852
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V         
Sbjct  681   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPSW  740

Query  1851  -PGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P +  N++  ++    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  741   NPTEFFNRIHPNTP---YLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKANPVQIPKS  797

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  798   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  842



>ref|XP_006365756.1| PREDICTED: uncharacterized protein LOC102579416 [Solanum tuberosum]
Length=917

 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 116/245 (47%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             +  P+  N    VD         L  V++F W  G K++  R    GL     E+W+PSS
Sbjct  613   EEVPITFNMDSKVDE------ATLKLVNSFNWPHGPKILRRRIIQGGLIRAVSESWYPSS  666

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  +++Y+Y+     P +   SL  PR V      P  
Sbjct  667   DDDFGLLLEDDIEVSPYYYLWIKYALLSYHYDPEISLPELSSISLYTPRLVEVVKERPKW  726

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             +     K       +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +    T 
Sbjct  727   NATDFFKHIHPNTPYLHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKQNPVQIPRSRTN  786

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY  +Y N   + + S +H + G +    +    N++ 
Sbjct  787   GW-----QASWKKFLIDMMYLRGYVTLYPNFPNQTSFSTNHMEPGAH----IAAKENVIK  837

Query  1494  ENSID  1480
              N  D
Sbjct  838   HNKAD  842



>ref|XP_006846820.1| hypothetical protein AMTR_s00148p00087220 [Amborella trichopoda]
 gb|ERN08401.1| hypothetical protein AMTR_s00148p00087220 [Amborella trichopoda]
Length=927

 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 116/245 (47%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD +       L  V++F W  G K +  R    GL     E+W+PSS
Sbjct  622   DEVPLSFNMDSQVDES------TLRLVNSFEWPHGPKTLRRRIIQGGLIRAVSESWYPSS  675

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV----PGKHG  1837
             D++F  ++EDD+EVSP Y+ ++K  ++NY+Y+     P +   SL  PR V       H 
Sbjct  676   DNDFGLLLEDDIEVSPYYYLWIKYALLNYHYDPQVSLPELSSISLYTPRLVEVVKERPHW  735

Query  1836  NK---MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             N     K       +L+QL  +WG + FP+ W+EF  + +   ++  K  PV +    T 
Sbjct  736   NATAFFKHIHPNTPYLHQLPCSWGAVFFPKQWREFYTYMNMRFTEDAKKNPVQIPKSRTN  795

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V 
Sbjct  796   GW-----QASWKKFLIDMMYLRGYVSLYPNFPDQASFSTNHMEPGAH----ISAKDNVVK  846

Query  1494  ENSID  1480
              N  D
Sbjct  847   HNKSD  851



>ref|NP_200878.2| glycosyltransferase family protein 2 [Arabidopsis thaliana]
 dbj|BAC41962.1| unknown protein [Arabidopsis thaliana]
 gb|AED97368.1| glycosyltransferase family protein 2 [Arabidopsis thaliana]
Length=668

 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/239 (27%), Positives = 114/239 (48%), Gaps = 25/239 (10%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             SL  + +       ++ V  F W  G K +  R    GL     E+W+P+SDD+F  ++E
Sbjct  366   SLSFNMDSKVDEETINVVSTFDWPHGPKTLRRRIIQGGLIRAVSESWYPASDDDFGLLLE  425

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRFVPGKHGNKM  1828
             DD+EVSP YF ++K  ++ Y+Y+           S ++P I     +RP++ P     ++
Sbjct  426   DDIEVSPYYFLWIKYALLAYHYDPQVSFPELSSISLYTPKIVEVVKERPKWNPTDFFKQI  485

Query  1827  KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKM  1657
                +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T GW    
Sbjct  486   HPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKSRTNGW----  538

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
              +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V  N  D
Sbjct  539   -QASWKKFLIDMMYLRGYVSLYPNFPNQSSFSTNHMEPGAH----IAAKDNVVKHNKTD  592



>ref|XP_010483721.1| PREDICTED: uncharacterized protein LOC104762177 isoform X1 [Camelina 
sativa]
 ref|XP_010483722.1| PREDICTED: uncharacterized protein LOC104762177 isoform X2 [Camelina 
sativa]
Length=945

 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/263 (27%), Positives = 120/263 (46%), Gaps = 29/263 (11%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             SL  + +       +  V  F W  G K +  R    GL     E+W+P+SDD+F  ++E
Sbjct  643   SLSFNMDSKVDEETIKVVSTFDWPHGPKTLRRRIIQGGLIRAVSESWYPASDDDFGLLLE  702

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRFVPGKHGNKM  1828
             DD+EVSP YF ++K  ++ Y+Y+           S ++P I     +RP++ P     ++
Sbjct  703   DDIEVSPYYFLWIKYALLAYHYDPQVSFPELSSISLYTPKIVEVVKERPKWNPTDFFKQI  762

Query  1827  KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKM  1657
                +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T GW    
Sbjct  763   HPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKSRTNGW----  815

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDI  1477
              +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V  N  D 
Sbjct  816   -QASWKKFLIDMMYLRGYVSLYPNFPNQSSFSTNHMEPGAH----IAAKDNVVKHNKTDF  870

Query  1476  NHLEFHPLHSMKWYDFCFKQVFP  1408
                   PL    + DF   Q  P
Sbjct  871   E----VPLLMDDFRDFLPNQKLP  889



>ref|XP_002866391.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=932

 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/239 (27%), Positives = 114/239 (48%), Gaps = 25/239 (10%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             SL  + +       ++ V  F W  G K +  R    GL     E+W+P+SDD+F  ++E
Sbjct  630   SLSFNMDSKVDEETINVVSTFDWPHGPKTLRRRIIQGGLIRAVSESWYPASDDDFGLLLE  689

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRFVPGKHGNKM  1828
             DD+EVSP YF ++K  ++ Y+Y+           S ++P I     +RP++ P     ++
Sbjct  690   DDIEVSPYYFLWIKYALLAYHYDPQVSFPELSSISLYTPKIVEVVKERPKWNPTDFFKQI  749

Query  1827  KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKM  1657
                +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T GW    
Sbjct  750   HPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKSRTNGW----  802

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
              +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V  N  D
Sbjct  803   -QASWKKFLIDMMYLRGYVSLYPNFPNQSSFSTNHMEPGAH----IAAKDNVVKHNKTD  856



>gb|ELT91165.1| hypothetical protein CAPTEDRAFT_217577 [Capitella teleta]
Length=411

 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 105/219 (48%), Gaps = 18/219 (8%)
 Frame = -3

Query  2112  DFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKN  1933
             D V A  W  G K VH    + G+  QW+ +W P  + E A ++EDD+ VS   +R+LK 
Sbjct  176   DAVVAHAWNLGEKRVHVWQEHVGIYGQWIHSWRPQ-EGEIALILEDDISVSRFCYRWLK-  233

Query  1932  LIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRP  1753
                 +Y N S+ S    G +LQ       K G           FLY+++G+WG    P  
Sbjct  234   AAHRFYGNRSDIS----GYTLQSSNVKSAKGGRSFSAPKDHSAFLYRVLGSWGFSPHPDR  289

Query  1752  WKEFRLWYDTHKS-KGMKPVLDGMVTTGWYKKMGER-----IWTPWFIKFIHARGYFNIY  1591
             W EF+ W+ T ++     P +DG+V T WYK   ++     +WT W I F      F + 
Sbjct  290   WMEFQDWFKTARNDSSFHPYVDGIVMTNWYKSFEQKKSHDSMWTMWHIWFTDHHNLFCLL  349

Query  1590  TNL-----LYERALSISHRDAGVNY-GKSVGPDSNLVGE  1492
              NL     L   AL+++ ++ G++Y GK +     L+ E
Sbjct  350   HNLRKFSGLKSSALAVNRQEPGLHYHGKGIDNTKELLVE  388



>ref|XP_004515514.1| PREDICTED: uncharacterized protein LOC101506183 [Cicer arietinum]
Length=935

 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 119/246 (48%), Gaps = 27/246 (11%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD +       +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  630   DEVPITFNMDSKVDES------TIKLVGSFNWPHGPKTLRRRIIQGGLIRAVSESWYPSS  683

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             D++F  ++EDD+EVSP Y+ ++K  +++Y+Y+     P +   SL  PR V      P  
Sbjct  684   DNDFGLLLEDDIEVSPYYYLWIKYALMSYHYDPQVSLPELSSISLYTPRIVEVVKERPKW  743

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   +I   T  +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +    T
Sbjct  744   NATQFFKQIHPNTP-YLHQLPCSWGAVFFPKHWREFYVYMNMRFTENAKENPVQIPKSRT  802

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLV  1498
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V
Sbjct  803   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPQQASFSTNHMEPGAH----ISAKDNVV  853

Query  1497  GENSID  1480
               N  D
Sbjct  854   KHNKQD  859



>dbj|BAB09843.1| unnamed protein product [Arabidopsis thaliana]
Length=932

 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/239 (27%), Positives = 114/239 (48%), Gaps = 25/239 (10%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             SL  + +       ++ V  F W  G K +  R    GL     E+W+P+SDD+F  ++E
Sbjct  630   SLSFNMDSKVDEETINVVSTFDWPHGPKTLRRRIIQGGLIRAVSESWYPASDDDFGLLLE  689

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRFVPGKHGNKM  1828
             DD+EVSP YF ++K  ++ Y+Y+           S ++P I     +RP++ P     ++
Sbjct  690   DDIEVSPYYFLWIKYALLAYHYDPQVSFPELSSISLYTPKIVEVVKERPKWNPTDFFKQI  749

Query  1827  KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKM  1657
                +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T GW    
Sbjct  750   HPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKSRTNGW----  802

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
              +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V  N  D
Sbjct  803   -QASWKKFLIDMMYLRGYVSLYPNFPNQSSFSTNHMEPGAH----IAAKDNVVKHNKTD  856



>ref|XP_009023364.1| hypothetical protein HELRODRAFT_192903 [Helobdella robusta]
 gb|ESN98398.1| hypothetical protein HELRODRAFT_192903 [Helobdella robusta]
Length=370

 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/240 (28%), Positives = 106/240 (44%), Gaps = 39/240 (16%)
 Frame = -3

Query  2148  VDRNLNS--SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWP------------  2011
             +DRN  +  + +  + V  F W  G   +H +TS+AG+  QW++ W P            
Sbjct  93    IDRNAKTGINNKTYEAVSTFKWTKGPTRIHNQTSHAGIMGQWIDTWRPRVAPPFKPKNMS  152

Query  2010  --------SSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRF  1855
                         E A ++EDDL VSP  +RF+K     Y   A        G SLQ    
Sbjct  153   STMYPYRPEYGKEIALILEDDLSVSPQAYRFVKAAHRKYGGRAD-----YAGVSLQSDEA  207

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD-THKSKGMKPVLDGMVT  1678
                  G  +K  +    F+Y  +GTWG    P+ W EF+ W+    K K  +P LDG   
Sbjct  208   KAHNSGETLKAPANESAFMYVCIGTWGFAPSPQYWAEFQDWFHYARKIKDFQPYLDGTTP  267

Query  1677  TGWYKKMGER-----IWTPWFIKFIHARGYFNIYTNLLY------ERALSISHRDAGVNY  1531
               W++   +R     +W  WFI F + +  + +++NL +      +  + I+ R+ G++Y
Sbjct  268   GSWFRSFVQRGTADSMWEMWFIYFANKKNAYTVFSNLKFVNGDKADSCVGINRREVGLHY  327



>ref|XP_009120603.1| PREDICTED: uncharacterized protein LOC103845483 [Brassica rapa]
Length=948

 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/248 (27%), Positives = 116/248 (47%), Gaps = 31/248 (13%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V  F W  G K +  R    GL     E+W+P+S
Sbjct  643   DEIPISFNMDSKVDE------ETIKVVTTFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  696

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P I     +RP++
Sbjct  697   DDDFGLLLEDDIEVSPYYYLWIKYSLLAYHYDPQISFPELASISLYTPKIVEVVKERPKW  756

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P     ++   +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  757   NPTDFFKQIHPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKS  813

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSN  1504
              T GW     +  W  + I  ++ RGY ++Y N   +++ S +H + G +    +    N
Sbjct  814   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQQSFSTNHMEPGAH----IAAKDN  864

Query  1503  LVGENSID  1480
             +V  N  D
Sbjct  865   VVKHNKTD  872



>ref|XP_006384913.1| hypothetical protein POPTR_0004s22170g [Populus trichocarpa]
 gb|ERP62710.1| hypothetical protein POPTR_0004s22170g [Populus trichocarpa]
Length=923

 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/253 (27%), Positives = 114/253 (45%), Gaps = 41/253 (16%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V++F W  G K +  R  + GL     E+W+PSS
Sbjct  618   DEIPISFNMDSKVDE------ETIRLVNSFDWPHGPKTLRRRIIHGGLIRAVSESWYPSS  671

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVP--------  1849
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V         
Sbjct  672   DDDYGLLLEDDIEVSPFYYLWMKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKW  731

Query  1848  -------GKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKP  1699
                    G H N          +L+QL  +WG + FP+ W+EF ++ +   T  +K    
Sbjct  732   NATEFFKGIHPNT--------PYLHQLPCSWGAMFFPKQWREFYVYMNMRFTEDAKANPV  783

Query  1698  VLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSV  1519
              +    T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +
Sbjct  784   QIPKSRTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----I  834

Query  1518  GPDSNLVGENSID  1480
                 N+V  +  D
Sbjct  835   SAKDNVVKHDKTD  847



>ref|XP_004251147.1| PREDICTED: uncharacterized protein LOC101262484 [Solanum lycopersicum]
 ref|XP_010313415.1| PREDICTED: uncharacterized protein LOC101262484 [Solanum lycopersicum]
Length=925

 Score =   107 bits (266),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/245 (29%), Positives = 116/245 (47%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V++F W  G K +  R    GL     E+W+PSS
Sbjct  621   DEVPITFNMDSKVDE------ATIKLVNSFNWPHGTKTLRRRIIQGGLIRAVSESWYPSS  674

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  675   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPLISLPELSSISLYTPRLVEVVKERPKW  734

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             +     K       +L+QL  +WG + FP+ WKEF ++ +   ++  K  PV +    T 
Sbjct  735   NATDFFKHIHPNTPYLHQLPCSWGAVFFPKQWKEFYVYMNMRFTEDPKQNPVQIPKSRTN  794

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +   +N+V 
Sbjct  795   GW-----QASWKKFLIDMMYLRGYVSLYPNFPNQMSFSTNHMEPGAH----IAAKNNVVK  845

Query  1494  ENSID  1480
              N  D
Sbjct  846   HNKAD  850



>ref|XP_001751662.1| predicted protein [Physcomitrella patens]
 gb|EDQ83979.1| predicted protein [Physcomitrella patens]
Length=912

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 113/235 (48%), Gaps = 29/235 (12%)
 Frame = -3

Query  2106  VDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLI  1927
             + AF W  G K V  R    GL     E+W+P+SDD+F  ++EDD+EVSP Y+ +LK  +
Sbjct  628   IHAFNWPHGPKTVKRRIIQGGLIRAVSESWYPASDDDFGLLLEDDIEVSPFYYMWLKYAL  687

Query  1926  VNYYYNASNFSPMIYGASLQRPRFV------PGKHGNK-MKIDSRTRVFLYQLVGTWGQL  1768
             + Y+Y+ +   P +   +L  PR V      P  +G    K+      +L+QL  +WG L
Sbjct  688   LAYHYDPTVHLPELNAIALYTPRVVEVVKERPRWNGTDFFKMIHPNTPYLHQLPCSWGAL  747

Query  1767  LFPRPWKEFRLWYDTHKSKGMKPVLDGMV------TTGWYKKMGERIWTPWFIKFIHARG  1606
              FP+ W+EF  +     ++  K   D +V      T GW     +  W  + I  ++ RG
Sbjct  748   FFPQRWREFYKYMGMRFTENPK---DNLVQIPHSRTNGW-----QASWKKFLIDMMYLRG  799

Query  1605  YFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID----INHLEFHPL  1453
             Y  +Y N   + + S +H + G +   S     N+V  N  D    + + +F PL
Sbjct  800   YVTLYPNFPNQTSFSTNHMEPGAHINAS----DNVVKHNREDFVVPLLYEDFQPL  850



>ref|XP_007363080.1| hypothetical protein DICSQDRAFT_101090 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF64269.1| hypothetical protein DICSQDRAFT_101090 [Dichomitus squalens LYAD-421 
SS1]
Length=741

 Score =   106 bits (264),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 106/204 (52%), Gaps = 13/204 (6%)
 Frame = -3

Query  2115  LDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLK  1936
             L  V+   W+ G+   H+R ++AGL A  +E+W+P  +D +  ++EDD+EVSPL++ + K
Sbjct  437   LQLVNDHRWEHGSVFYHHRVAHAGLMAAVVESWYPKGNDTYGLLLEDDVEVSPLFYAWAK  496

Query  1935  NLIVNYYY-NASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRV-----------FLYQ  1792
               ++ Y Y  A + SP +YG SL + + +      +   ++R+             +L Q
Sbjct  497   LSLLRYRYGQAESRSPNLYGISLYQQKNIELHPDGRHLFNARSTFEAAGLVYPNTPYLSQ  556

Query  1791  LVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHA  1612
             +  +WG L FP  W+EF  +  T  +  + P LD +V  G       R W  +FI+ ++ 
Sbjct  557   IPCSWGALYFPEHWREFHEYLVTRLNASVWP-LDEVVVPGVRSNRWTRSWKKYFIELVYL  615

Query  1611  RGYFNIYTNLLYERALSISHRDAG  1540
             RGY  +Y N     +LS +H + G
Sbjct  616   RGYVMLYPNYADYMSLSTNHLEVG  639



>emb|CDY31518.1| BnaA10g13530D [Brassica napus]
Length=920

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/248 (27%), Positives = 116/248 (47%), Gaps = 31/248 (13%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V  F W  G K +  R    GL     E+W+P+S
Sbjct  615   DEIPISFNMDSKVDE------ETIKVVTTFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  668

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P I     +RP++
Sbjct  669   DDDFGLLLEDDIEVSPYYYLWIKYSLLAYHYDPQISFPELASISLYTPKIVEVVKERPKW  728

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P     ++   +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  729   NPTDFFKQIHPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKS  785

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSN  1504
              T GW     +  W  + I  ++ RGY ++Y N   +++ S +H + G +    +    N
Sbjct  786   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQQSFSTNHMEPGAH----IAAKDN  836

Query  1503  LVGENSID  1480
             +V  N  D
Sbjct  837   VVKHNKTD  844



>emb|CDY52707.1| BnaC09g54350D [Brassica napus]
Length=920

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/248 (27%), Positives = 116/248 (47%), Gaps = 31/248 (13%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V  F W  G K +  R    GL     E+W+P+S
Sbjct  615   DEIPISFNMDSKVDE------ETIKVVTTFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  668

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P I     +RP++
Sbjct  669   DDDFGLLLEDDIEVSPYYYLWIKYSLLAYHYDPQISFPELASISLYTPKIVEVVKERPKW  728

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P     ++   +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  729   NPTDFFKQIHPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKS  785

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSN  1504
              T GW     +  W  + I  ++ RGY ++Y N   +++ S +H + G +    +    N
Sbjct  786   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQQSFSTNHMEPGAH----IAAKDN  836

Query  1503  LVGENSID  1480
             +V  N  D
Sbjct  837   VVKHNKTD  844



>ref|XP_011089273.1| PREDICTED: uncharacterized protein LOC105170283 [Sesamum indicum]
 ref|XP_011089274.1| PREDICTED: uncharacterized protein LOC105170283 [Sesamum indicum]
Length=931

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/228 (30%), Positives = 113/228 (50%), Gaps = 23/228 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         L  V++F W  G K++  R    GL     E+W+PSS
Sbjct  627   DEVPITFNMDSKVDAA------TLKLVNSFDWPHGPKILRRRIIQGGLIRAVSESWYPSS  680

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  681   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKW  740

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   +I   T  +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +    T
Sbjct  741   NATEFFKRIHPNTP-YLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKQNPVQIPKSRT  799

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  800   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  842



>ref|XP_010456674.1| PREDICTED: uncharacterized protein LOC104738147 [Camelina sativa]
Length=945

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/239 (27%), Positives = 113/239 (47%), Gaps = 25/239 (10%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             SL  + +       +  V  F W  G K +  R    GL     E+W+P+SDD+F  ++E
Sbjct  643   SLSFNMDSKVDEETIKVVSTFDWPHGPKTLRRRIIQGGLIRAVSESWYPASDDDFGLLLE  702

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRFVPGKHGNKM  1828
             DD+EVSP YF ++K  ++ Y+Y+           S ++P I     +RP++ P     ++
Sbjct  703   DDIEVSPYYFLWIKYALLAYHYDPQVSFPELSSISLYTPKIVEVVKERPKWNPTDFFKQI  762

Query  1827  KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKM  1657
                +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T GW    
Sbjct  763   HPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKSRTNGW----  815

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
              +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V  N  D
Sbjct  816   -QASWKKFLIDMMYLRGYVSLYPNFPNQSSFSTNHMEPGAH----IAAKDNVVKHNKTD  869



>ref|XP_010443872.1| PREDICTED: uncharacterized protein LOC104726658 [Camelina sativa]
Length=945

 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/239 (27%), Positives = 113/239 (47%), Gaps = 25/239 (10%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             SL  + +       +  V  F W  G K +  R    GL     E+W+P+SDD+F  ++E
Sbjct  643   SLSFNMDSKVDEETIKVVSTFDWPHGPKTLRRRIIQGGLIRAVSESWYPASDDDFGLLLE  702

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRFVPGKHGNKM  1828
             DD+EVSP YF ++K  ++ Y+Y+           S ++P I     +RP++ P     ++
Sbjct  703   DDIEVSPYYFLWIKYALLAYHYDPQVSFPELSSISLYTPKIVEVVKERPKWNPTDFFKQI  762

Query  1827  KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKM  1657
                +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T GW    
Sbjct  763   HPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKSRTNGW----  815

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
              +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V  N  D
Sbjct  816   -QASWKKFLIDMMYLRGYVSLYPNFPNQSSFSTNHMEPGAH----IAAKDNVVKHNKTD  869



>ref|XP_006279968.1| hypothetical protein CARUB_v10025834mg [Capsella rubella]
 gb|EOA12866.1| hypothetical protein CARUB_v10025834mg [Capsella rubella]
Length=934

 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/239 (27%), Positives = 113/239 (47%), Gaps = 25/239 (10%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             SL  + +       +  V  F W  G K +  R    GL     E+W+P+SDD+F  ++E
Sbjct  632   SLSFNMDSKVDEETIKVVSTFDWPHGPKTLRRRIIQGGLIRAVSESWYPASDDDFGLLLE  691

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRFVPGKHGNKM  1828
             DD+EVSP YF ++K  ++ Y+Y+           S ++P I     +RP++ P     ++
Sbjct  692   DDIEVSPYYFLWIKYALLAYHYDPQVSFPELSSISLYTPKIVEVVKERPKWNPTDFFKQI  751

Query  1827  KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKM  1657
                +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T GW    
Sbjct  752   HPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKSRTNGW----  804

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
              +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V  N  D
Sbjct  805   -QASWKKFLIDMMYLRGYVSLYPNFPNQSSFSTNHMEPGAH----IAAKDNVVKHNKTD  858



>ref|XP_002454742.1| hypothetical protein SORBIDRAFT_04g036530 [Sorghum bicolor]
 gb|EES07718.1| hypothetical protein SORBIDRAFT_04g036530 [Sorghum bicolor]
Length=932

 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 123/246 (50%), Gaps = 27/246 (11%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+    S ++D  ++++   L  V++F W  GAK +  R    GL     E+W+PSS
Sbjct  628   DEVPI----SFNMDSRVDAA--TLKVVNSFDWPHGAKTLRRRIIQGGLIRAVSESWYPSS  681

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  682   DDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPGVSLPELSSISLYTPRLVEVVKERPKW  741

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   K+   T  +L+QL  +WG + FP+ W+EF  +     ++  K  PV +    T
Sbjct  742   NATEFFNKVHPNT-PYLHQLPCSWGAVFFPKHWREFYAYMGARFTEDAKQNPVQIPKSRT  800

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLV  1498
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N++
Sbjct  801   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQTSFSTNHMEPGAH----IAAKGNVL  851

Query  1497  GENSID  1480
               N +D
Sbjct  852   KHNKMD  857



>gb|EPS59719.1| hypothetical protein M569_15086, partial [Genlisea aurea]
Length=564

 Score =   105 bits (261),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 112/229 (49%), Gaps = 27/229 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         L  V +F W  G K++  R    GL     E+W+PSS
Sbjct  259   DTVPLSFNMDCQVDEP------TLQLVASFNWTHGPKLIRRRIIQGGLIRAVSESWYPSS  312

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  I+ Y+Y+           + ++P I     +RP++
Sbjct  313   DDDFGLLLEDDIEVSPYYYLWIKYAILAYHYDPQVSLPELASIALYTPRIVEVVKERPKW  372

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
              P +    +  ++    +L+QL  +WG + FP+ W+EF  + +   ++  K  PV +   
Sbjct  373   NPAEFFRNIHPNTP---YLHQLPCSWGAVFFPKHWREFYAYMNMRFTENAKENPVQIPKS  429

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGV  1537
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G 
Sbjct  430   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGA  473



>ref|XP_004291705.1| PREDICTED: uncharacterized protein LOC101294726 [Fragaria vesca 
subsp. vesca]
Length=934

 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 112/230 (49%), Gaps = 27/230 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  629   DEVPISFNMDSKVDEA------TIRLVSSFEWPHGPKTLKRRIIQGGLIRAVSESWYPSS  682

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+YN           S ++P I     +RP++
Sbjct  683   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYNPQVSLPELSSISLYTPRIVEVVKERPKW  742

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
              P +    M  ++    + +QL  +WG + FP+ W+EF ++ +   ++  K  PV +   
Sbjct  743   NPTEFFKNMHPNTP---YFHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKKNPVQIPKS  799

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  800   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  844



>ref|XP_008462712.1| PREDICTED: uncharacterized protein LOC103501011 isoform X1 [Cucumis 
melo]
 ref|XP_008462721.1| PREDICTED: uncharacterized protein LOC103501011 isoform X1 [Cucumis 
melo]
Length=952

 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 120/246 (49%), Gaps = 27/246 (11%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD       + +  V +F W  G K +  R    GL     E+W+P+S
Sbjct  648   DEIPISFNMDSKVDE------KTIKLVSSFEWPHGPKSLRRRIIQGGLIRAVSESWYPAS  701

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  702   DDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  761

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   +I   T  +L+QL  +WG + FP+ W+EF ++ ++  ++  K  PV +    T
Sbjct  762   NATEFFKRIHPNTP-YLHQLPCSWGAVFFPKHWREFYVYMNSRFTENAKENPVQIPKSRT  820

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLV  1498
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +   +N+V
Sbjct  821   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----ISAKNNVV  871

Query  1497  GENSID  1480
               N  D
Sbjct  872   KHNKED  877



>ref|XP_007016776.1| Glycosyltransferase family protein 2 [Theobroma cacao]
 gb|EOY34395.1| Glycosyltransferase family protein 2 [Theobroma cacao]
Length=932

 Score =   105 bits (263),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/261 (26%), Positives = 123/261 (47%), Gaps = 35/261 (13%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  VD+F W  G K +  R    GL     E+W+P+S
Sbjct  626   DEIPISFNMDSKVDEA------TIKLVDSFEWPHGPKTLRRRIIQGGLIRAVSESWYPTS  679

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P +     +RP++
Sbjct  680   DDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  739

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P +   ++  ++    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  740   NPTEFFKRIHPNTP---YLHQLPCSWGSVFFPKHWREFYVYMNMRFTEDAKANPVQIPKS  796

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSN  1504
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N
Sbjct  797   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----ISAKDN  847

Query  1503  LVGENSIDIN----HLEFHPL  1453
             +V  +  D        +F PL
Sbjct  848   VVRHDKADFEVPLLKEDFRPL  868



>ref|XP_008462729.1| PREDICTED: uncharacterized protein LOC103501011 isoform X2 [Cucumis 
melo]
 ref|XP_008462738.1| PREDICTED: uncharacterized protein LOC103501011 isoform X2 [Cucumis 
melo]
Length=933

 Score =   105 bits (263),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 120/246 (49%), Gaps = 27/246 (11%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD       + +  V +F W  G K +  R    GL     E+W+P+S
Sbjct  629   DEIPISFNMDSKVDE------KTIKLVSSFEWPHGPKSLRRRIIQGGLIRAVSESWYPAS  682

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  683   DDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  742

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   +I   T  +L+QL  +WG + FP+ W+EF ++ ++  ++  K  PV +    T
Sbjct  743   NATEFFKRIHPNTP-YLHQLPCSWGAVFFPKHWREFYVYMNSRFTENAKENPVQIPKSRT  801

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLV  1498
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +   +N+V
Sbjct  802   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----ISAKNNVV  852

Query  1497  GENSID  1480
               N  D
Sbjct  853   KHNKED  858



>emb|CDS14009.1| hypothetical protein LRAMOSA06180 [Absidia idahoensis var. thermophila]
Length=882

 Score =   105 bits (263),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 110/228 (48%), Gaps = 14/228 (6%)
 Frame = -3

Query  2163  NASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             N  + ++++ +   R+L  V+ F W  G K V +R    GL    +E+W+P +DD +A +
Sbjct  484   NLKVHLEQSADRVTRML--VNGFSWNHGPKTVRHRIRKGGLMPAIIESWYPVNDDNYAVL  541

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNAS---NFSPMIYGASLQRPRFVPGKHGNKMKIDSR  1813
             +EDD+EVSPL++ + K  I+ Y Y+ S   + +  +YG SL  PR +      +   D  
Sbjct  542   LEDDIEVSPLFYAWAKYSILQYRYSGSASQDNTRSMYGISLYSPRHLELLPEGRRPFDPN  601

Query  1812  TRV---------FLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKK  1660
             T +         +L Q+  +WG + FP  W+EF  +         +  L  +   G   +
Sbjct  602   TAIGDDYGAHIPYLSQVPCSWGAVYFPEHWREFHSYLTNRLEDLQQDRLLNITVPGSRSE  661

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVG  1516
               ++ W  +FI+ ++ R Y  +Y N     + S +H + G +  K  G
Sbjct  662   RWKKSWKKYFIELVYLRSYVMLYPNFQLFESFSTNHLEFGTHVKKGQG  709



>ref|XP_006591138.1| PREDICTED: uncharacterized protein LOC100813608 isoform X2 [Glycine 
max]
Length=948

 Score =   105 bits (263),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 113/245 (46%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  643   DEIPITFNMDSKVDEA------TIRLVGSFEWPHGPKTLRRRIVQGGLIRAVSESWYPSS  696

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  697   DDDFGLLLEDDIEVSPYYYLWIKYALMAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  756

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T 
Sbjct  757   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKSNPVQIPKSRTN  816

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    NLV 
Sbjct  817   GW-----QASWKKFLIDMMYLRGYVSLYPNFPQQASFSTNHMEPGAH----ISAKDNLVK  867

Query  1494  ENSID  1480
              N  D
Sbjct  868   HNKQD  872



>ref|XP_009392188.1| PREDICTED: uncharacterized protein LOC103978197 [Musa acuminata 
subsp. malaccensis]
Length=925

 Score =   105 bits (263),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 115/237 (49%), Gaps = 23/237 (10%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             S ++D  ++     L  V +F W  G K+V  R    GL     E+W+PS DDEF  ++E
Sbjct  626   SFNMDSKVD--EETLKVVGSFRWAQGPKLVRRRIIQGGLIRAVSESWYPSDDDEFGLLLE  683

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNKM--KI  1822
             DD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  +  +   +I
Sbjct  684   DDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKWNATEFFKRI  743

Query  1821  DSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKKMGE  1651
                T  +L+QL  +WG L FP+ W+EF  + +   T  +K     +    T GW     +
Sbjct  744   HPNTP-YLHQLPCSWGALFFPKHWREFYAYMNARFTDDAKNNPVQIPKSRTNGW-----Q  797

Query  1650  RIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
               W  + I  ++ RGY ++Y N   + + S +H + G +    +  + N+V  N  D
Sbjct  798   ASWKKFLIDMMYLRGYVSLYPNFPSQASFSTNHMEPGAH----ISANGNVVKHNKED  850



>ref|XP_007401187.1| hypothetical protein PHACADRAFT_178618 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM49991.1| hypothetical protein PHACADRAFT_178618 [Phanerochaete carnosa 
HHB-10118-sp]
Length=827

 Score =   105 bits (262),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 109/218 (50%), Gaps = 13/218 (6%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             +L ++    +  + L  V  F W  G   VH R  + GL    +E+W+P S+D +  ++E
Sbjct  511   ALRINVEQTAGPQTLRLVHEFEWPHGPVFVHRRVIHGGLLPAVVESWYPQSEDSYGLILE  570

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNA-SNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRV-  1804
             DD+E+SPL++ ++K  +++Y Y   ++ SP ++G SL + + +  +   + + ++RT   
Sbjct  571   DDVELSPLFYAWIKMALLHYRYGGPADRSPQMFGISLYQQKNLELRPEGRHRFNARTTFA  630

Query  1803  ----------FLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMG  1654
                       +L Q+  +WG + FP  W+ F  +     S    PV  G+V  G      
Sbjct  631   AAALPHPETPYLSQIPCSWGAVYFPEHWRAFHEYLAARLSGAALPV-GGVVAPGLRSNRW  689

Query  1653  ERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
              R W  +FI+  + RG+  +Y N +   +LS +H + G
Sbjct  690   TRSWKKYFIELAYLRGHVMLYPNYVGYASLSTNHLEVG  727



>gb|KDP44035.1| hypothetical protein JCGZ_05502 [Jatropha curcas]
Length=931

 Score =   105 bits (262),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 118/230 (51%), Gaps = 27/230 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+    S ++D  ++++   +  V++F W  G K +  R    GL     E+W+P+S
Sbjct  626   DEIPI----SFNMDSKVDAA--TIRLVNSFNWTHGPKTLRRRIIQGGLIRAVSESWYPAS  679

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P +     +RP++
Sbjct  680   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSFPELSSISLYTPKLVEVVKERPKW  739

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P +   ++  ++    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  740   NPTEFFKRIHPNTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKANPVQIPKS  796

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  797   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  841



>gb|KHN38756.1| hypothetical protein glysoja_008305 [Glycine soja]
Length=934

 Score =   105 bits (262),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 113/245 (46%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  629   DEIPITFNMDSKVDEA------TIRLVGSFEWPHGPKTLRRRIVQGGLIRAVSESWYPSS  682

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  683   DDDFGLLLEDDIEVSPYYYLWIKYALMAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  742

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T 
Sbjct  743   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKSNPVQIPKSRTN  802

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    NLV 
Sbjct  803   GW-----QASWKKFLIDMMYLRGYVSLYPNFPQQASFSTNHMEPGAH----ISAKDNLVK  853

Query  1494  ENSID  1480
              N  D
Sbjct  854   HNKQD  858



>ref|XP_003539203.1| PREDICTED: uncharacterized protein LOC100813608 isoform X1 [Glycine 
max]
Length=934

 Score =   105 bits (262),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 113/245 (46%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  629   DEIPITFNMDSKVDEA------TIRLVGSFEWPHGPKTLRRRIVQGGLIRAVSESWYPSS  682

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  683   DDDFGLLLEDDIEVSPYYYLWIKYALMAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  742

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T 
Sbjct  743   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKSNPVQIPKSRTN  802

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    NLV 
Sbjct  803   GW-----QASWKKFLIDMMYLRGYVSLYPNFPQQASFSTNHMEPGAH----ISAKDNLVK  853

Query  1494  ENSID  1480
              N  D
Sbjct  854   HNKQD  858



>ref|XP_002314281.2| hypothetical protein POPTR_0009s01610g [Populus trichocarpa]
 gb|EEE88236.2| hypothetical protein POPTR_0009s01610g [Populus trichocarpa]
Length=931

 Score =   105 bits (262),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 115/246 (47%), Gaps = 27/246 (11%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  626   DEIPISFNVDSKVDE------ETIRLVSSFNWPHGPKTLRRRIIQGGLIRAVSESWYPSS  679

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  680   DDDYGLLLEDDIEVSPFYYLWIKYALLAYHYDPQVSLPELSSISLYTPKLVEVVKERPRW  739

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVT  1678
             +  +   +I   T  +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T
Sbjct  740   NATEFFKRIHPNTP-YLHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKANPVQIPKSRT  798

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLV  1498
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V
Sbjct  799   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----ISAKDNVV  849

Query  1497  GENSID  1480
               +  D
Sbjct  850   KHDKTD  855



>ref|XP_011044401.1| PREDICTED: uncharacterized protein LOC105139601 [Populus euphratica]
 ref|XP_011044402.1| PREDICTED: uncharacterized protein LOC105139601 [Populus euphratica]
Length=931

 Score =   105 bits (262),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 115/246 (47%), Gaps = 27/246 (11%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  626   DEIPISFNVDSKVDEE------TIRLVSSFNWPHGPKTLRRRIIQGGLIRAVSESWYPSS  679

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  680   DDDYGLLLEDDIEVSPFYYLWIKYALLAYHYDPQVSLPELSSISLYTPKLVEVVKERPRW  739

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVT  1678
             +  +   +I   T  +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T
Sbjct  740   NATEFFKRIHPNTP-YLHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKANPVQIPKSRT  798

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLV  1498
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V
Sbjct  799   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----ISAKDNVV  849

Query  1497  GENSID  1480
               +  D
Sbjct  850   KHDKTD  855



>ref|XP_006340407.1| PREDICTED: uncharacterized protein LOC102579905 [Solanum tuberosum]
Length=925

 Score =   105 bits (261),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 109/227 (48%), Gaps = 21/227 (9%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V++F W  G K +  R    GL     E+W+PSS
Sbjct  618   DQVPITFNMDSKVDE------ATIKLVNSFNWPHGTKTLRRRIIQGGLIRAVSESWYPSS  671

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  672   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  731

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             +     K       +L+QL  +WG + FP+ WKEF ++ +   ++  K  PV +    T 
Sbjct  732   NATDFFKHIHPNTPYLHQLPCSWGAVFFPKQWKEFYVYMNMRFTEDPKQNPVQIPKSRTN  791

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  792   GW-----QASWKKFLIDMMYLRGYVSLYPNFPNQMSFSTNHMEPGAH  833



>gb|KDQ61549.1| hypothetical protein JAAARDRAFT_190293 [Jaapia argillacea MUCL 
33604]
Length=750

 Score =   105 bits (261),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 108/219 (49%), Gaps = 12/219 (5%)
 Frame = -3

Query  2163  NASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             N  L ++ + ++       V  F W  G   +H+R  + GL     E+W+P ++D +  +
Sbjct  429   NLQLRINMDQSADDETKRLVSEFSWTHGNIFIHHRVIHGGLLPAVAESWYPHTNDSYGLL  488

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRT--  1810
             +EDD+E+SPL++ ++K  ++ Y Y++ N SP ++G SL + + +  +   ++  ++RT  
Sbjct  489   LEDDVELSPLFYAWVKMAVLRYRYSSQNESPQLFGVSLYQQKTIELRPEGRVPFNARTLF  548

Query  1809  ---------RVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKM  1657
                        +L Q+  +WG + FP  W+EF  +     S+ +  V D  V        
Sbjct  549   SRSDLPHHHTPYLSQIPCSWGAVYFPEHWREFHAYLSARLSEALFSV-DVDVVPDLRSNR  607

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
                 W  +FI+ ++ RGY  +Y N     +LS +H + G
Sbjct  608   WSNSWKKYFIELVYLRGYVMLYPNFPDFVSLSTNHLEVG  646



>emb|CDH55045.1| glycosyl transferase family 2 protein [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=992

 Score =   105 bits (262),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 110/228 (48%), Gaps = 14/228 (6%)
 Frame = -3

Query  2163  NASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             N  + ++++ +   R+L  V+ F W  G K V +R    GL    +E+W+P +DD +A +
Sbjct  594   NLKVHLEQSADRVTRML--VNGFSWNHGPKTVRHRIRKGGLMPAIIESWYPVNDDNYAVL  651

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNAS---NFSPMIYGASLQRPRFVPGKHGNKMKIDSR  1813
             +EDD+EVSPL++ + K  I+ Y Y+ S   + +  +YG SL  PR +      +   D  
Sbjct  652   LEDDIEVSPLFYAWAKYSILQYRYSGSTSQDNTRSMYGISLYSPRHLELLPEGRRPFDPN  711

Query  1812  TRV---------FLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKK  1660
             T +         +L Q+  +WG + FP  W+EF  +         +  L  +   G   +
Sbjct  712   TAIGDDYGQHIPYLSQVPCSWGAVYFPEHWREFHSYLTNRLEDLQQDRLLNITVPGSRSE  771

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVG  1516
               ++ W  +FI+ ++ R Y  +Y N     + S +H + G +  K  G
Sbjct  772   RWKKSWKKYFIELVYLRSYVMLYPNFQLFESFSTNHLEFGTHVKKGQG  819



>ref|XP_010535609.1| PREDICTED: uncharacterized protein LOC104810862 [Tarenaya hassleriana]
Length=939

 Score =   105 bits (261),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 70/272 (26%), Positives = 125/272 (46%), Gaps = 35/272 (13%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+P+S
Sbjct  634   DEVPISFNMDSKVDEE------TIKLVGSFEWPHGPKTLRRRIIQGGLIRAVSESWYPAS  687

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P I     +RP++
Sbjct  688   DDDFGLLLEDDIEVSPYYYLWIKYSLLAYHYDPQISFPELSSISLYTPKIVEVVKERPKW  747

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P +   ++   +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  748   NPTEFFKRIHPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKANPVQIPKS  804

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSN  1504
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N
Sbjct  805   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----ISAKDN  855

Query  1503  LVGENSIDINHLEFHPLHSMKWYDFCFKQVFP  1408
             +V  +  D       PL +  + +F   Q  P
Sbjct  856   VVRHDKTDFE----VPLLAEDFRNFLPNQKLP  883



>ref|XP_009126589.1| PREDICTED: uncharacterized protein LOC103851489 [Brassica rapa]
Length=933

 Score =   105 bits (261),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/248 (27%), Positives = 119/248 (48%), Gaps = 31/248 (13%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V  F W  G K +  R    GL     E+W+P+S
Sbjct  628   DEIPLSFNMDSKVDE------ETIKVVTTFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  681

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P I     +RP++
Sbjct  682   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSFPELSSISLYTPKIVEVVKERPKW  741

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
              P +   ++   +    +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +   
Sbjct  742   NPTEFFKQIHPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKENPVQIPKS  798

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSN  1504
              T GW     +  W  + I  ++ RGY ++Y N   +++ S +H + G +    +    N
Sbjct  799   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQQSFSTNHMEPGAH----IAAKDN  849

Query  1503  LVGENSID  1480
             +V  +  D
Sbjct  850   VVKHDKTD  857



>ref|XP_002969177.1| hypothetical protein SELMODRAFT_90221 [Selaginella moellendorffii]
 gb|EFJ30293.1| hypothetical protein SELMODRAFT_90221 [Selaginella moellendorffii]
Length=663

 Score =   104 bits (259),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/254 (29%), Positives = 116/254 (46%), Gaps = 45/254 (18%)
 Frame = -3

Query  2232  AAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTS  2053
             A+A+Y    +HL   ID       +++D +         L  V +F W  G   +  R  
Sbjct  353   ASAYYVGDEIHLTFSID-------SAVDAE--------TLKIVHSFEWPHGEVTIRRRII  397

Query  2052  NAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASN---------  1900
               GL     E+W+P+SDD+F  ++EDD+EVSP YF +LK  ++ Y+Y+ +          
Sbjct  398   QGGLIRAVSESWYPASDDDFGLLLEDDIEVSPFYFMWLKYAVLVYHYSPAEVAELNSISL  457

Query  1899  FSPMIYGASLQRPR-----FVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRL  1735
             ++P +     +RPR     F    H N          +L+QL  +WG L FPR W+EF  
Sbjct  458   YTPRVVEVVKERPRWNATDFFKAIHPNT--------PYLHQLPCSWGALFFPRHWREFYH  509

Query  1734  WYDTHKSKGMK--PV-LDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERAL  1564
             +  T  +   K  PV +    T GW     +  W  + I  ++ RGY  +Y N   + + 
Sbjct  510   YMGTRYTADAKQNPVQIPRSRTNGW-----QASWKKFLIDMMYLRGYVTLYPNFPNQTSF  564

Query  1563  SISHRDAGVNYGKS  1522
             S +H + G +   S
Sbjct  565   STNHMEPGAHINSS  578



>ref|XP_006592260.1| PREDICTED: uncharacterized protein LOC100790938 isoform X2 [Glycine 
max]
Length=933

 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 113/245 (46%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  628   DEIPITFNMDSKVDEA------TIRLVGSFEWPHGTKTLRRRIVQGGLIRAVSESWYPSS  681

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  682   DDDFGLLLEDDIEVSPYYYLWIKYALMAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  741

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T 
Sbjct  742   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKANPVQIPKSRTN  801

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V 
Sbjct  802   GW-----QASWKKFLIDMMYLRGYVSLYPNFPQQASFSTNHMEPGAH----ISAKDNVVK  852

Query  1494  ENSID  1480
              N  D
Sbjct  853   HNKRD  857



>ref|XP_006592259.1| PREDICTED: uncharacterized protein LOC100790938 isoform X1 [Glycine 
max]
Length=946

 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 113/245 (46%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  641   DEIPITFNMDSKVDEA------TIRLVGSFEWPHGTKTLRRRIVQGGLIRAVSESWYPSS  694

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  695   DDDFGLLLEDDIEVSPYYYLWIKYALMAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  754

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T 
Sbjct  755   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKANPVQIPKSRTN  814

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V 
Sbjct  815   GW-----QASWKKFLIDMMYLRGYVSLYPNFPQQASFSTNHMEPGAH----ISAKDNVVK  865

Query  1494  ENSID  1480
              N  D
Sbjct  866   HNKRD  870



>gb|KHN05675.1| hypothetical protein glysoja_024641 [Glycine soja]
Length=933

 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 113/245 (46%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  628   DEIPITFNMDSKVDEA------TIRLVGSFEWPHGTKTLRRRIVQGGLIRAVSESWYPSS  681

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  682   DDDFGLLLEDDIEVSPYYYLWIKYALMAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  741

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T 
Sbjct  742   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKANPVQIPKSRTN  801

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V 
Sbjct  802   GW-----QASWKKFLIDMMYLRGYVSLYPNFPQQASFSTNHMEPGAH----ISAKDNVVK  852

Query  1494  ENSID  1480
              N  D
Sbjct  853   HNKRD  857



>gb|KHG21348.1| Poly (A) polymerase [Gossypium arboreum]
Length=932

 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/248 (26%), Positives = 119/248 (48%), Gaps = 31/248 (13%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V++F W  G K +  R    GL     E+W+P+S
Sbjct  626   DEIPISFNMDSKVDEA------TIKLVESFEWPHGPKTLRRRIIQGGLIRAVSESWYPTS  679

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P I     +RP++
Sbjct  680   DDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISLPELSSISLYTPRIVEVVKERPKW  739

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P     ++  ++    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  740   NPTDFFKRIHPNTP---YLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKSNPVQIPKS  796

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSN  1504
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +   +N
Sbjct  797   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----ISAKNN  847

Query  1503  LVGENSID  1480
             +V  +  D
Sbjct  848   VVRHDKAD  855



>ref|XP_002973886.1| hypothetical protein SELMODRAFT_100224 [Selaginella moellendorffii]
 gb|EFJ24841.1| hypothetical protein SELMODRAFT_100224 [Selaginella moellendorffii]
Length=663

 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/249 (29%), Positives = 116/249 (47%), Gaps = 35/249 (14%)
 Frame = -3

Query  2232  AAAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTS  2053
             A+A+Y    +HL   ID       +++D +         L  V +F W  G   +  R  
Sbjct  353   ASAYYVGDEIHLTFSID-------SAVDAE--------TLKIVHSFEWPHGEVTIRRRII  397

Query  2052  NAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASN---------  1900
               GL     E+W+P+SDD+F  ++EDD+EVSP YF +LK  ++ Y+Y+ +          
Sbjct  398   QGGLIRAVSESWYPASDDDFGLLLEDDIEVSPFYFMWLKYAVLVYHYSTAEVAELNSISL  457

Query  1899  FSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTH  1720
             ++P +     +RPR+      +  K       +L+QL  +WG L FPR W+EF  +  T 
Sbjct  458   YTPRVVEVVKERPRW---NATDFFKAIYPNTPYLHQLPCSWGALFFPRHWREFYHYMGTR  514

Query  1719  KSKGMK--PV-LDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHR  1549
              +   K  PV +    T GW     +  W  + I  ++ RGY  +Y N   + + S +H 
Sbjct  515   YTADAKQNPVQIPRSRTNGW-----QASWKKFLIDMMYLRGYVTLYPNFPNQTSFSTNHM  569

Query  1548  DAGVNYGKS  1522
             + G +   S
Sbjct  570   EPGAHINSS  578



>emb|CDY09190.1| BnaA02g06160D [Brassica napus]
Length=923

 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/248 (27%), Positives = 119/248 (48%), Gaps = 31/248 (13%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V  F W  G K +  R    GL     E+W+P+S
Sbjct  618   DEIPLSFNMDSKVDE------ETIKVVTTFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  671

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P I     +RP++
Sbjct  672   DDDFGLLLEDDIEVSPYYYLWIKYSLLAYHYDPQVSFPELSSISLYTPKIVEVVKERPKW  731

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
              P +   ++   +    +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +   
Sbjct  732   NPTEFFKQIHPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKENPVQIPKS  788

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSN  1504
              T GW     +  W  + I  ++ RGY ++Y N   +++ S +H + G +    +    N
Sbjct  789   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQQSFSTNHMEPGAH----IAAKDN  839

Query  1503  LVGENSID  1480
             +V  +  D
Sbjct  840   VVKHDKTD  847



>dbj|BAG70977.1| glycosyl transferase family 2 protein [Musa balbisiana]
Length=911

 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/219 (31%), Positives = 110/219 (50%), Gaps = 19/219 (9%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             S ++D  ++     L  V +F W  G K+V  R    GL     E+W+PS DDEF  ++E
Sbjct  612   SFNMDSKVD--EETLKVVGSFRWAQGPKLVRRRIIQGGLIRAVSESWYPSDDDEFGLLLE  669

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNKM--KI  1822
             DD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  +  +   +I
Sbjct  670   DDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKWNATEFFKRI  729

Query  1821  DSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTGWYKKMGE  1651
                T  +L+QL  +WG L FP+ W+EF  + +   ++  K  PV +    T GW     +
Sbjct  730   HPNTP-YLHQLPCSWGALFFPKHWREFYAYMNARFTEDAKNNPVQIPKSRTNGW-----Q  783

Query  1650  RIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
               W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  784   ASWKKFLIDMMYLRGYVSLYPNFPSQASFSTNHMEPGAH  822



>ref|XP_009382480.1| PREDICTED: uncharacterized protein LOC103970426 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382487.1| PREDICTED: uncharacterized protein LOC103970426 [Musa acuminata 
subsp. malaccensis]
Length=925

 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 108/218 (50%), Gaps = 17/218 (8%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             S ++D  ++     L  V +F W  G K +  R    GL     E+W+PSSDDEF  ++E
Sbjct  626   SFNMDSKVD--EETLKVVGSFQWAQGPKFIRRRIIQGGLIRAVSESWYPSSDDEFGLLLE  683

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNK-MKID  1819
             DD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  +  +  K  
Sbjct  684   DDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKWNATEFFKNI  743

Query  1818  SRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTGWYKKMGER  1648
                  +L+QL  +WG + FPR W+EF  + +   ++  K  PV +    T GW     + 
Sbjct  744   HPNTPYLHQLPCSWGAVFFPRQWREFYAYMNARFTEDAKQNPVQIPKSRTNGW-----QA  798

Query  1647  IWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  799   SWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  836



>ref|XP_003570333.1| PREDICTED: uncharacterized protein LOC100838904 [Brachypodium 
distachyon]
Length=924

 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 114/226 (50%), Gaps = 20/226 (9%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+    S ++D  +++S   L+ V AF W  G K +  R    GL     E+W+P++
Sbjct  621   DEVPI----SFNMDSRVDAS--TLNVVHAFDWPHGPKTLRRRIIQGGLIRAVSESWYPAN  674

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+ S   P +   SL  PR V      P  
Sbjct  675   DDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPSISLPELSSISLYTPRLVEVTKERPRW  734

Query  1842  HGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTG  1672
             +  +    +    +L+QL  +WG + FP+ W+EF  +     ++  K  PV +    T G
Sbjct  735   NATQFFHRTPNTPYLHQLPCSWGAVFFPKHWREFYAYMAARFTEDAKTNPVQIPRSRTNG  794

Query  1671  WYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             W     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  795   W-----QASWKKFLIDMMYLRGYVSLYPNFPNQTSFSTNHMEPGAH  835



>ref|XP_007132269.1| hypothetical protein PHAVU_011G080500g [Phaseolus vulgaris]
 gb|ESW04263.1| hypothetical protein PHAVU_011G080500g [Phaseolus vulgaris]
Length=931

 Score =   104 bits (259),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 114/245 (47%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  626   DEIPITFNMDSKVDD------ETIRVVGSFEWPHGPKTLRRRIIQGGLIRAVSESWYPSS  679

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+E+SP Y+ ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  680   DDDFGLLLEDDIELSPYYYLWIKYALMAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  739

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTT  1675
             +G +  K       +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T 
Sbjct  740   NGTEFFKHIHPNTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKSNPVQIPKSRTN  799

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V 
Sbjct  800   GW-----QASWKKFLIDMMYLRGYVSLYPNFPQQASFSTNHMEPGAH----ISAKDNVVK  850

Query  1494  ENSID  1480
              N  D
Sbjct  851   HNKQD  855



>ref|XP_010253707.1| PREDICTED: uncharacterized protein LOC104594876 [Nelumbo nucifera]
 ref|XP_010253708.1| PREDICTED: uncharacterized protein LOC104594876 [Nelumbo nucifera]
 ref|XP_010253709.1| PREDICTED: uncharacterized protein LOC104594876 [Nelumbo nucifera]
 ref|XP_010253710.1| PREDICTED: uncharacterized protein LOC104594876 [Nelumbo nucifera]
 ref|XP_010253711.1| PREDICTED: uncharacterized protein LOC104594876 [Nelumbo nucifera]
Length=931

 Score =   104 bits (259),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/231 (29%), Positives = 111/231 (48%), Gaps = 21/231 (9%)
 Frame = -3

Query  2196  HIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAW  2017
             H   D  P+  N    VD         +  V++F W  G K +  R    GL     E+W
Sbjct  622   HYLGDEIPISFNVDSKVDEE------TVRLVNSFQWPHGPKTLRRRIIQGGLIRAVSESW  675

Query  2016  WPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV-----  1852
             +PSSDD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V     
Sbjct  676   YPSSDDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKE  735

Query  1851  -PGKHGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDG  1687
              P  +  +  K       +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +  
Sbjct  736   RPKWNATEFFKHIHPNTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKQNPVQIPK  795

Query  1686  MVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
               T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  796   SRTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQTSFSTNHMEPGAH  841



>emb|CDO73305.1| hypothetical protein BN946_scf185008.g67 [Trametes cinnabarina]
Length=653

 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 117/229 (51%), Gaps = 19/229 (8%)
 Frame = -3

Query  2190  FIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWP  2011
             F DH     N  ++V++  +     L  VD F W  G+  +H+R  + GL    +E+W+P
Sbjct  333   FGDHL----NLRINVEQTADP--ETLRMVDDFRWTHGSMFLHHRVVHGGLLTSVVESWYP  386

Query  2010  SSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNAS-NFSPMIYGASLQRPRFVPGKHGN  1834
               +D +A ++EDD+E+SPL++ +LK  ++ Y Y  S + SP ++G SL + + +  +   
Sbjct  387   HGNDSYALILEDDVELSPLFYAYLKLSLLQYRYGKSEDRSPNLFGISLYQQKNLELRPEG  446

Query  1833  KMKIDSRT-----------RVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDG  1687
             +   ++R+             +L Q+  +WG L FP  W+EF  +     S+ + P+ + 
Sbjct  447   RHLFNARSLFEDAGIPHPNTPYLSQIPCSWGALYFPEHWREFHAYLIARMSEDVWPLRET  506

Query  1686  MVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
             +V      +   R W  +FI+ ++ RGY  +Y N     +LS +H + G
Sbjct  507   VVPDVRSNRW-TRSWKKYFIELVYLRGYVMLYPNYPDYASLSTNHLEVG  554



>gb|EJK65743.1| hypothetical protein THAOC_13369 [Thalassiosira oceanica]
Length=778

 Score =   103 bits (258),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 116/238 (49%), Gaps = 12/238 (5%)
 Frame = -3

Query  2106  VDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLI  1927
             V+   W  G+        N GL+  WLEAW P SDD+ A ++EDD+ VSPL++R++    
Sbjct  250   VENVTWPHGSISTLVANENMGLRKAWLEAWHPESDDDRAIILEDDVTVSPLWYRWVNGAY  309

Query  1926  VNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRT---RVFLYQLVGTWGQLLFPR  1756
               Y ++       I G SLQR   VP     +  +   T     FLY LVG+ G     R
Sbjct  310   DAYGHDGGR----IAGFSLQRQDLVPLASKTRTSVRVPTNDNEPFLYSLVGSIGFAPNAR  365

Query  1755  PWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGER-IWTPWFIKFIHARGYFNIYTNLL  1579
              W+ F  W +      +   +DG+VT+ W+K + +R +WT  FI +++  G   +Y    
Sbjct  366   VWRNFLDWAECAIDNDVDVSVDGLVTSAWWKDLDKRGMWTQHFIYYMNRLGLGCLYHFPK  425

Query  1578  YER-ALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFP  1408
               R AL +  R+ G ++ +S G   ++V +   DI++L F     +  YDF    + P
Sbjct  426   DARKALGVHWREKGEHFSRSEGASHDVVTDPG-DISNLVFP--DDLNGYDFGAAPIKP  480



>gb|KFK27596.1| hypothetical protein AALP_AA8G404200 [Arabis alpina]
Length=937

 Score =   103 bits (258),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 114/248 (46%), Gaps = 31/248 (13%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V  F W  G K +  R    GL     E+W+P+S
Sbjct  632   DEIPISFNMDSKVDE------ETIKVVTTFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  685

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P I     +RP++
Sbjct  686   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISFPELASISLYTPKIVEVVKERPKW  745

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P     ++   +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  746   NPTDFFKQIHPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKS  802

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSN  1504
              T GW     +  W  + I  ++ RGY  +Y N   + + S +H + G +    +    N
Sbjct  803   RTNGW-----QASWKKFLIDMMYLRGYVTLYPNFPNQSSFSTNHMEPGAH----ISAKDN  853

Query  1503  LVGENSID  1480
             +V  +  D
Sbjct  854   VVKHDKTD  861



>emb|CDP07096.1| unnamed protein product [Coffea canephora]
Length=938

 Score =   103 bits (258),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 118/245 (48%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD +       L  V++F W  G K+   R    GL     E+W+P+S
Sbjct  634   DEVPITFNMDSKVDES------TLKLVNSFNWPHGPKIFRRRIIQGGLIRAVSESWYPAS  687

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP YF ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  688   DDDYGLLLEDDIEVSPYYFLWIKYALLAYHYDPQISLPELSSISLYTPKLVEVVKERPKW  747

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             + ++  K       +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +    T 
Sbjct  748   NASEFFKHIHPYTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKQNPVQIPKSRTN  807

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V 
Sbjct  808   GW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----ISAKENVVR  858

Query  1494  ENSID  1480
              +  D
Sbjct  859   HDKTD  863



>ref|XP_011089932.1| PREDICTED: uncharacterized protein LOC105170732 [Sesamum indicum]
Length=920

 Score =   103 bits (258),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 114/245 (47%), Gaps = 25/245 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         L  V  F W  G K++  R    GL     E+W+PS+
Sbjct  616   DEVPITFNMDSKVDEE------TLQLVTTFDWPHGPKLLRRRIIQGGLIRAVSESWYPST  669

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  I+ Y+Y+     P +   SL  PR V      P  
Sbjct  670   DDDYGLLLEDDIEVSPYYYLWVKYAILAYHYDPKVSLPELSSISLYTPRLVEVVKERPKW  729

Query  1842  HGNKMKIDSRTRV-FLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             +           + +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +    T 
Sbjct  730   NATDFFKHIHPNIPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTENAKENPVQIPKSRTN  789

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V 
Sbjct  790   GW-----QASWKKFLIDMMYLRGYVSLYPNFPQQASFSTNHMEPGAH----ISAKDNVVK  840

Query  1494  ENSID  1480
              +  D
Sbjct  841   HDKTD  845



>ref|XP_002529934.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF32442.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=829

 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 111/230 (48%), Gaps = 27/230 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V  F W  G K +  R    GL     E+W+P+S
Sbjct  524   DEIPISFNMDSKVDEA------TIRLVSTFNWTHGPKTLRRRIIQGGLIRAVSESWYPAS  577

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P +     +RP++
Sbjct  578   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISFPELSSISLYTPKLVEVVKERPKW  637

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGM  1684
              P +   ++  ++    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +   
Sbjct  638   NPTEFFKRIHPNTP---YLHQLPCSWGAVFFPKLWREFYVYMNMRFTEDAKANPVQIPKS  694

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  695   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPSQASFSTNHMEPGAH  739



>ref|XP_009418335.1| PREDICTED: uncharacterized protein LOC103998566 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009418337.1| PREDICTED: uncharacterized protein LOC103998566 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009418338.1| PREDICTED: uncharacterized protein LOC103998566 [Musa acuminata 
subsp. malaccensis]
Length=909

 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 118/237 (50%), Gaps = 23/237 (10%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             S ++D  ++  +  L  V +F W  G K +  R  + GL     E+W+PS DD+F  ++E
Sbjct  610   SFNMDSKVD--QETLKVVGSFRWAQGPKFIRRRIIHGGLIRAVSESWYPSDDDDFGLLLE  667

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNKM--KI  1822
             DD+EVSP Y+ ++K  +++Y+Y+     P +   SL  PR V      P  +  +   KI
Sbjct  668   DDIEVSPYYYVWIKYALLSYHYDPQVSLPELASISLYTPRLVEVVKERPKWNATEFFKKI  727

Query  1821  DSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTGWYKKMGE  1651
                T  +L+QL  +WG + FP+ W+EF  + +   ++  K  PV +    T GW     +
Sbjct  728   HPNTP-YLHQLPCSWGAVFFPKHWREFYAYMNARFTEDAKQNPVQIPKSRTNGW-----Q  781

Query  1650  RIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
               W  + I  ++ RGY ++Y N   + + S +H + G +    +    N+V  N  D
Sbjct  782   ASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH----ISAKDNVVKHNKED  834



>gb|EMT26013.1| hypothetical protein F775_01966 [Aegilops tauschii]
Length=690

 Score =   103 bits (256),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/263 (27%), Positives = 125/263 (48%), Gaps = 37/263 (14%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+    S ++D  ++++   L+ V+AF W  G K +  R    GL     E+W+P+S
Sbjct  384   DEVPI----SFNMDSKVDAA--TLNTVNAFAWPHGGKTLRRRIIQGGLIRAVSESWYPAS  437

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPR-  1858
             DD++  ++EDD+EVSP Y+ ++K  ++ Y Y+           S ++P +   + +RPR 
Sbjct  438   DDDYGLLLEDDIEVSPYYYLWVKYALLAYRYDPTVSLPELSSISLYTPRLVEVTKERPRW  497

Query  1857  -----FVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--P  1699
                  F   KHG           +L+QL  +WG + FP+ W+EF  +     ++  K  P
Sbjct  498   NATAFFGATKHGANTP-------YLHQLPCSWGAVFFPKHWREFYAYMAARFTEDAKTNP  550

Query  1698  V-LDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKS  1522
             V +    T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +    
Sbjct  551   VQIPRSRTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQTSFSTNHMEPGAHISAK  605

Query  1521  VGPDSNLVGENSIDINHLEFHPL  1453
                  +  G+  + +   +F PL
Sbjct  606   DNKLKHDKGDFEVPLVADDFAPL  628



>ref|XP_008225913.1| PREDICTED: uncharacterized protein LOC103325510 [Prunus mume]
Length=932

 Score =   103 bits (257),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 112/230 (49%), Gaps = 27/230 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  627   DEVPISFNMDSKVDEA------TIRLVSSFEWPHGPKTLKRRIIQGGLIRAVSESWYPSS  680

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P +     +RP++
Sbjct  681   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKW  740

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
              P +   K+  ++    + +QL  +WG + FP+ W+EF ++ +   ++  K  PV +   
Sbjct  741   NPSEFFKKIHPNTP---YFHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKKNPVQIPRS  797

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY  +Y N   + + S +H + G +
Sbjct  798   RTNGW-----QASWKKFLIDMMYLRGYVTLYPNFPNQASFSTNHMEPGAH  842



>ref|XP_010264657.1| PREDICTED: uncharacterized protein LOC104602607 [Nelumbo nucifera]
Length=931

 Score =   103 bits (256),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/227 (29%), Positives = 111/227 (49%), Gaps = 21/227 (9%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         L  V++F W  G K +  R    GL     E+W+PSS
Sbjct  626   DGIPISFNMDSKVDEE------TLRLVNSFQWPHGPKTLRRRIIQGGLIRAVSESWYPSS  679

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K +++ Y+Y+     P +   SL  PR V      P  
Sbjct  680   DDDYGLLLEDDIEVSPYYYIWIKYVLLAYHYDPQVSLPELSSISLYTPRLVEVMKERPKW  739

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +    T 
Sbjct  740   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKKNPVQIPKSRTN  799

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             GW     +  W  + +  ++ RGY ++Y N   + + S +H + G +
Sbjct  800   GW-----QASWKKFLVDMMYLRGYVSLYPNFPNQTSFSTNHMEPGAH  841



>ref|XP_004160910.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101202906 
[Cucumis sativus]
Length=667

 Score =   102 bits (255),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/228 (29%), Positives = 112/228 (49%), Gaps = 23/228 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+P+S
Sbjct  363   DEIPISFNMDSKVDE------ETIKLVSSFEWPHGPKSLRRRIIQGGLIRAVSESWYPAS  416

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  417   DDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  476

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   +I   T  +L+QL  +WG + FP+ W+EF ++ ++  ++  K  PV +    T
Sbjct  477   NATEFFKRIHPNTP-YLHQLPCSWGAVFFPKHWREFYVYMNSRFTENAKENPVQIPKSRT  535

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  536   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPDQASFSTNHMEPGAH  578



>ref|XP_007206436.1| hypothetical protein PRUPE_ppa001021mg [Prunus persica]
 gb|EMJ07635.1| hypothetical protein PRUPE_ppa001021mg [Prunus persica]
Length=932

 Score =   103 bits (256),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 112/230 (49%), Gaps = 27/230 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  627   DEVPISFNMDSKVDE------ATVRLVSSFEWPHGPKTLKRRIIQGGLIRAVSESWYPSS  680

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P +     +RP++
Sbjct  681   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKW  740

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
              P +   K+  ++    + +QL  +WG + FP+ W+EF ++ +   ++  K  PV +   
Sbjct  741   NPTEFFKKIHPNTP---YFHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKKNPVQIPKS  797

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY  +Y N   + + S +H + G +
Sbjct  798   RTNGW-----QASWKKFLIDMMYLRGYVTLYPNFPNQASFSTNHMEPGAH  842



>gb|KGN64839.1| hypothetical protein Csa_1G124520 [Cucumis sativus]
Length=931

 Score =   103 bits (256),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/228 (29%), Positives = 112/228 (49%), Gaps = 23/228 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+P+S
Sbjct  627   DEIPISFNMDSKVDE------ETIKLVSSFEWPHGPKSLRRRIIQGGLIRAVSESWYPAS  680

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  681   DDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  740

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   +I   T  +L+QL  +WG + FP+ W+EF ++ ++  ++  K  PV +    T
Sbjct  741   NATEFFKRIHPNTP-YLHQLPCSWGAVFFPKHWREFYVYMNSRFTENAKENPVQIPKSRT  799

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  800   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPDQASFSTNHMEPGAH  842



>ref|XP_004139558.1| PREDICTED: uncharacterized protein LOC101202906 [Cucumis sativus]
Length=923

 Score =   103 bits (256),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/228 (29%), Positives = 112/228 (49%), Gaps = 23/228 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+P+S
Sbjct  619   DEIPISFNMDSKVDE------ETIKLVSSFEWPHGPKSLRRRIIQGGLIRAVSESWYPAS  672

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  673   DDDYGLLLEDDIEVSPYYYLWIKYALLAYHYDPQISLPELSSISLYTPRLVEVVKERPKW  732

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   +I   T  +L+QL  +WG + FP+ W+EF ++ ++  ++  K  PV +    T
Sbjct  733   NATEFFKRIHPNTP-YLHQLPCSWGAVFFPKHWREFYVYMNSRFTENAKENPVQIPKSRT  791

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  792   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPDQASFSTNHMEPGAH  834



>ref|XP_009349735.1| PREDICTED: uncharacterized protein LOC103941265 [Pyrus x bretschneideri]
Length=914

 Score =   102 bits (255),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/230 (27%), Positives = 112/230 (49%), Gaps = 27/230 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  609   DEVPISFNMDSKVDE------ATIRLVSSFDWPHGPKTLKRRIIQGGLIRAVSESWYPSS  662

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P +     +RP++
Sbjct  663   DDDFGLLLEDDIEVSPYYYLWIKYALIAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  722

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
              P +    +  ++    + +QL  +WG + FP+ W+EF ++ +   ++  K  PV +   
Sbjct  723   NPTEFFKNIHPNTP---YFHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKKNPVQIPKS  779

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  780   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  824



>ref|XP_009367054.1| PREDICTED: uncharacterized protein LOC103956752 [Pyrus x bretschneideri]
Length=914

 Score =   102 bits (255),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/230 (27%), Positives = 112/230 (49%), Gaps = 27/230 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  609   DEVPISFNMDSKVDE------ATIRLVSSFDWPHGPKTLKRRIIQGGLIRAVSESWYPSS  662

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P +     +RP++
Sbjct  663   DDDFGLLLEDDIEVSPYYYLWIKYALIAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  722

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
              P +    +  ++    + +QL  +WG + FP+ W+EF ++ +   ++  K  PV +   
Sbjct  723   NPTEFFKNIHPNTP---YFHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKKNPVQIPKS  779

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  780   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  824



>ref|XP_010689523.1| PREDICTED: uncharacterized protein LOC104903223 [Beta vulgaris 
subsp. vulgaris]
Length=935

 Score =   102 bits (255),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 110/228 (48%), Gaps = 23/228 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  +  F W  G K +  R    GL     E+W+PSS
Sbjct  628   DDVPITFNVDSRVDE------ATIKLIGTFVWPHGTKTLRRRIIQGGLIRAVSESWYPSS  681

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+   + P +   SL  PR V      P  
Sbjct  682   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVYFPELSSISLYTPRLVEVVKERPKW  741

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +      +I   T  +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +    T
Sbjct  742   NATDFFKQIHPNTP-YLHQLPCSWGAVFFPKHWREFYVYMNMRFTEDAKKNPVQIPRSRT  800

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  801   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  843



>ref|XP_006400820.1| hypothetical protein EUTSA_v10012601mg [Eutrema salsugineum]
 gb|ESQ42273.1| hypothetical protein EUTSA_v10012601mg [Eutrema salsugineum]
Length=934

 Score =   102 bits (254),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 116/240 (48%), Gaps = 27/240 (11%)
 Frame = -3

Query  2154  LDVDRNLNSS--RRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVV  1981
             + +  N++S      +  V  F W  G K +  R    GL     E+W+P++DD+F  ++
Sbjct  631   ISISFNMDSKVDEETIKVVSTFDWPHGTKTLRRRIIQGGLIRAVSESWYPATDDDFGLLL  690

Query  1980  EDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRFVPGKHGNK  1831
             EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P I     +RP++ P     +
Sbjct  691   EDDIEVSPYYYLWIKYALLAYHYDPQVSFPELASISLYTPKIVEVVKERPKWNPTDFFKQ  750

Query  1830  MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTTGWYKK  1660
             +   +    +L+QL  +WG + FP+ W+EF ++ +   T  +K     +    T GW   
Sbjct  751   IHPHTP---YLHQLPCSWGAVFFPKQWREFYVYMNMRFTENAKANPVQIPKSRTNGW---  804

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
               +  W  + I  ++ RGY ++Y N   +++ S +H + G +    +    N+V  +  D
Sbjct  805   --QASWKKFLIDMMYLRGYVSLYPNFPNQQSFSTNHMEPGAH----IAAKDNMVKHDKSD  858



>ref|XP_008355202.1| PREDICTED: uncharacterized protein LOC103418872 [Malus domestica]
Length=583

 Score =   101 bits (251),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 111/229 (48%), Gaps = 27/229 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  278   DEVPISFNMDSKVDE------ATIRLVSSFDWPHGPKTLKRRIIQGGLIRAVSESWYPSS  331

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P +     +RP++
Sbjct  332   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  391

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
              P +    +  ++    + +QL  +WG + FP+ W+EF ++ +   ++  K  PV +   
Sbjct  392   NPTEFFKNIHPNTP---YFHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKKNPVQIPKS  448

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGV  1537
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G 
Sbjct  449   RTNGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGA  492



>ref|XP_008359358.1| PREDICTED: uncharacterized protein LOC103423066 [Malus domestica]
Length=932

 Score =   102 bits (253),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/230 (27%), Positives = 112/230 (49%), Gaps = 27/230 (12%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V +F W  G K +  R    GL     E+W+PSS
Sbjct  627   DEVPISFNMDSKVDE------ATIRLVSSFDWPHGPKTLKRRIIQGGLIRAVSESWYPSS  680

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+           S ++P +     +RP++
Sbjct  681   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPKLVEVVKERPKW  740

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
              P +    +  ++    + +QL  +WG + FP+ W+EF ++ +   ++  K  PV +   
Sbjct  741   NPTEFFKNIHPNTP---YFHQLPCSWGAVFFPKQWREFYVYMNMRFTEDAKKNPVQIPKS  797

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  798   RTNGW-----QASWKKFLIDMMYXRGYVSLYPNFPNQASFSTNHMEPGAH  842



>ref|XP_010043762.1| PREDICTED: uncharacterized protein LOC104432887 [Eucalyptus grandis]
 ref|XP_010043763.1| PREDICTED: uncharacterized protein LOC104432887 [Eucalyptus grandis]
 gb|KCW85756.1| hypothetical protein EUGRSUZ_B02513 [Eucalyptus grandis]
Length=936

 Score =   101 bits (252),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 110/227 (48%), Gaps = 21/227 (9%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V++F W  G K +  R    GL     E+W+P+S
Sbjct  631   DEVPISFNMDSKVDEA------TIKLVNSFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  684

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  P+ V      P  
Sbjct  685   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVALPELSSISLYTPKLVEVVKERPKW  744

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++ +   ++  K  PV +    T 
Sbjct  745   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKHWREFYVYMNMRFTENAKENPVQIPKSRTN  804

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  805   GW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  846



>gb|EMD39225.1| hypothetical protein CERSUDRAFT_93273 [Ceriporiopsis subvermispora 
B]
Length=753

 Score =   101 bits (251),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 102/201 (51%), Gaps = 13/201 (6%)
 Frame = -3

Query  2106  VDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLI  1927
             V+AF W  G   VH+R  + GL    +E+W+P S+D +  ++EDD+EVSPL++ + K  I
Sbjct  448   VEAFRWDVGHLFVHHRIVHGGLMPAVVESWYPHSNDSYGLILEDDVEVSPLFYAWTKMSI  507

Query  1926  VNYYYNAS-NFSPMIYGASLQRPRFVPGKHGNKMKIDSR-----------TRVFLYQLVG  1783
             + Y Y    N SP ++G SL + + +  +   + + ++R           +  +L Q+  
Sbjct  508   LRYRYGPQENKSPQLFGISLYQQKHLELRPEGRHRFNARDTFTAAGLSDPSTPYLSQIPC  567

Query  1782  TWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGY  1603
             +WG + FP  W+EF  +     S+ +   L+  V          + W  +FI+ ++ RGY
Sbjct  568   SWGAVYFPEHWREFHTYLSLRLSE-LAWDLEQTVVLAVRSNKWRKSWKKYFIELVYLRGY  626

Query  1602  FNIYTNLLYERALSISHRDAG  1540
               +Y N     +LS +H + G
Sbjct  627   VMLYPNYEGYASLSTNHLEVG  647



>dbj|GAA98239.1| hypothetical protein E5Q_04922 [Mixia osmundae IAM 14324]
 gb|KEI40610.1| glycosyltransferase family 64 protein [Mixia osmundae IAM 14324]
Length=1615

 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 109/219 (50%), Gaps = 10/219 (5%)
 Frame = -3

Query  2178  FPVPANASLDVDRNLNSSRRI--LDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
              PV     +D D  ++  RR    + +++    +    +    S  GL+ Q L +W P+S
Sbjct  523   LPVAIEIHIDYDPEMSQERRAEYAELLNSLSLPWANVTLQRVASRLGLKQQVLTSWRPTS  582

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMK  1825
             ++E+A ++EDD+EVSP + ++ + +I+ Y ++       ++G SL   R+   +      
Sbjct  583   NNEYAIMIEDDIEVSPYFLQYAQKMILAYAHSQDRGDHRLFGISLYNLRY--NEATESFL  640

Query  1824  IDSRTR-VFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGER  1648
              D+R + VF +Q   +WG + FP PW+ F  +      +G+ P+   M+T  W  +    
Sbjct  641   PDTRPKGVFAFQCPVSWGAIFFPEPWRRFLTYERDISKRGIDPIAPDMLTNRWPYQAS--  698

Query  1647  IWTPWFIKF-IHARGYFNIYTNLLYERALSISHRDAGVN  1534
              W   F +F I +RGY  ++ NL  E + S +H + G N
Sbjct  699   -WKKTFYRFLIESRGYL-LFNNLPGELSFSTNHVEVGTN  735



>ref|XP_009549388.1| hypothetical protein HETIRDRAFT_323869 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW79123.1| hypothetical protein HETIRDRAFT_323869 [Heterobasidion irregulare 
TC 32-1]
Length=849

 Score =   101 bits (251),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 106/222 (48%), Gaps = 18/222 (8%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             +L V+    + +R L  V    W  GA  +H+R    GL    +E+W+P S+D +  ++E
Sbjct  532   TLRVNAEQTADKRTLQLVQNIQWNHGAVFLHHRVVRGGLLPAVVESWYPLSNDTYGLLLE  591

Query  1977  DDLEVSPLYFRFLKNLIVNYYY-NASNFSPMIYGASLQRPRFVPGKHGNKMKIDSR----  1813
             DD+EVSPL++ +LK  ++ Y Y   +N  P ++G SL + + V  +   +   ++R    
Sbjct  592   DDVEVSPLFYAWLKMSLLRYCYGQETNKVPFLFGISLYQQKSVELRPEGRRPFNARQLFT  651

Query  1812  -------TRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPV----LDGMVTTGWY  1666
                    +  +L Q+  +WG L FP  W++F  +     S+   PV    L   +     
Sbjct  652   SSGISHSSTPYLSQIPCSWGALYFPEHWRQFHAYLSARLSQ--PPVFPFSLKDSIVPDVR  709

Query  1665  KKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
                    W  +FI+ ++ RGY  +Y N     +LS +H + G
Sbjct  710   SNKWTHSWKKYFIELVYLRGYVMLYPNYAEFTSLSTNHLEVG  751



>emb|CAN61137.1| hypothetical protein VITISV_013983 [Vitis vinifera]
Length=931

 Score =   101 bits (251),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/222 (28%), Positives = 109/222 (49%), Gaps = 19/222 (9%)
 Frame = -3

Query  2115  LDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLK  1936
             +  V  F W  G K +  R    GL     E+W+P+SDD++  ++EDD+EVSP Y+ ++K
Sbjct  643   IRLVSNFDWPHGPKTLRRRIIQGGLIRAVSESWYPASDDDYGLLLEDDIEVSPYYYLWIK  702

Query  1935  NLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNKM-KIDSRTRVFLYQLVGTW  1777
               ++ Y+Y+     P +   SL  PR V      P  +  ++ K       +L+QL  +W
Sbjct  703   YALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKWNATEVFKHIHPNTPYLHQLPCSW  762

Query  1776  GQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTGWYKKMGERIWTPWFIKFIHARG  1606
             G + FP+ W+EF ++ +   ++  K  PV +    T GW     +  W  + I  ++ RG
Sbjct  763   GAVFFPKQWREFYVYMNMRFTENAKENPVQIPKSRTNGW-----QASWKKFLIDMMYLRG  817

Query  1605  YFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
             Y ++Y N   + + S +H + G +    +    N+V  +  D
Sbjct  818   YVSLYPNFPKQHSFSTNHMEPGAH----ISAKDNVVKHDKTD  855



>ref|XP_002285243.1| PREDICTED: uncharacterized protein LOC100262081 [Vitis vinifera]
Length=931

 Score =   100 bits (250),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/222 (28%), Positives = 109/222 (49%), Gaps = 19/222 (9%)
 Frame = -3

Query  2115  LDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLK  1936
             +  V  F W  G K +  R    GL     E+W+P+SDD++  ++EDD+EVSP Y+ ++K
Sbjct  643   IRLVSNFDWPHGPKTLRRRIIQGGLIRAVSESWYPASDDDYGLLLEDDIEVSPYYYLWIK  702

Query  1935  NLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNKM-KIDSRTRVFLYQLVGTW  1777
               ++ Y+Y+     P +   SL  PR V      P  +  ++ K       +L+QL  +W
Sbjct  703   YALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKWNATEVFKHIHPNTPYLHQLPCSW  762

Query  1776  GQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTGWYKKMGERIWTPWFIKFIHARG  1606
             G + FP+ W+EF ++ +   ++  K  PV +    T GW     +  W  + I  ++ RG
Sbjct  763   GAVFFPKQWREFYVYMNMRFTENAKENPVQIPKSRTNGW-----QASWKKFLIDMMYLRG  817

Query  1605  YFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
             Y ++Y N   + + S +H + G +    +    N+V  +  D
Sbjct  818   YVSLYPNFPKQHSFSTNHMEPGAH----ISAKDNVVKHDKTD  855



>ref|XP_004954285.1| PREDICTED: uncharacterized protein LOC101776528 [Setaria italica]
Length=921

 Score =   100 bits (250),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 115/228 (50%), Gaps = 23/228 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+    S ++D  +++S   L  V++F W  G K +  R    GL     E+W+P+S
Sbjct  617   DEVPI----SFNMDSRVDAS--TLKVVNSFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  670

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y Y+ +   P +   SL  PR V      P  
Sbjct  671   DDDYGLLLEDDIEVSPYYYLWVKYALLAYRYDPAVALPELSSISLYTPRLVEVVKERPKW  730

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   K+   T  +L+QL  +WG + FP+ W+EF  +     ++  K  PV +    T
Sbjct  731   NATEFFRKVHPNT-PYLHQLPCSWGAVFFPKHWREFYAYMAARFTEDAKKNPVQIPRSRT  789

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  790   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQTSFSTNHMEPGAH  832



>emb|CBI16328.3| unnamed protein product [Vitis vinifera]
Length=989

 Score =   100 bits (250),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/222 (28%), Positives = 109/222 (49%), Gaps = 19/222 (9%)
 Frame = -3

Query  2115  LDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLK  1936
             +  V  F W  G K +  R    GL     E+W+P+SDD++  ++EDD+EVSP Y+ ++K
Sbjct  643   IRLVSNFDWPHGPKTLRRRIIQGGLIRAVSESWYPASDDDYGLLLEDDIEVSPYYYLWIK  702

Query  1935  NLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNKM-KIDSRTRVFLYQLVGTW  1777
               ++ Y+Y+     P +   SL  PR V      P  +  ++ K       +L+QL  +W
Sbjct  703   YALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPKWNATEVFKHIHPNTPYLHQLPCSW  762

Query  1776  GQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTGWYKKMGERIWTPWFIKFIHARG  1606
             G + FP+ W+EF ++ +   ++  K  PV +    T GW     +  W  + I  ++ RG
Sbjct  763   GAVFFPKQWREFYVYMNMRFTENAKENPVQIPKSRTNGW-----QASWKKFLIDMMYLRG  817

Query  1605  YFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSID  1480
             Y ++Y N   + + S +H + G +    +    N+V  +  D
Sbjct  818   YVSLYPNFPKQHSFSTNHMEPGAH----ISAKDNVVKHDKTD  855



>ref|XP_010911071.1| PREDICTED: uncharacterized protein LOC105037065, partial [Elaeis 
guineensis]
Length=343

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 109/228 (48%), Gaps = 23/228 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         L  V +F W+ G K++  R    GL     E+W+PSS
Sbjct  39    DEIPLSFNMDGKVDE------ETLKVVGSFEWEQGPKLIRRRIIQGGLIRAVSESWYPSS  92

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             D +F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  93    DHDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVALPELSSISLYTPRLVEVVKERPRW  152

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +      KI   T  +L+QL  +WG + F + W+EF  +  +  ++  K  PV +    T
Sbjct  153   NATDFFKKIHPNT-PYLHQLPCSWGAVFFAKQWREFYAYMGSRFTEDAKQNPVQIPRSRT  211

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  212   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPDQMSFSTNHMEPGAH  254



>gb|EPB91970.1| hypothetical protein HMPREF1544_01264 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=893

 Score =   100 bits (249),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/314 (25%), Positives = 135/314 (43%), Gaps = 41/314 (13%)
 Frame = -3

Query  2232  AAAHYDHHAVHLHIFIDHFPVP----------------ANASLDVDRNLNSSRRILDFVD  2101
             A +H++H  + L +  D  PV                  N  L +    ++ R     V 
Sbjct  532   ALSHWNHVKIDLVVITDRRPVSLSRLLNSTNNAYYFGDENVELAIHMEQSADRETRTLVQ  591

Query  2100  AFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVN  1921
              F +K G K V +R    GL    +E+W+PS++D +  ++EDD+E+SP ++ + K  I+ 
Sbjct  592   GFEFKHGDKKVRHRVRKGGLLPAIVESWYPSNNDNYGVLLEDDIELSPFFYSWSKYNILK  651

Query  1920  YYYNASNFSPMIYGASLQRPRFVPGKHGNKMKID----------SRTRVFLYQLVGTWGQ  1771
             Y Y +      IYG SL  PR +  +   +   +          S+   +  Q+  +WG 
Sbjct  652   YRYESEKAHNHIYGVSLYSPRNLELRPEGRRPFNPEPVLEQGGYSKRAPYATQIPCSWGA  711

Query  1770  LLFPRPWKEFRLWYDTHKSKGMKPVLDG---MVTTGWYKKMGERIWTPWFIKFIHARGYF  1600
             + FP  W+EF   Y T + +  +    G   +   G   +   + W  +FI+ ++ R Y 
Sbjct  712   VYFPEHWREFHT-YITERVEKEEKYTKGYYNITVPGSRSERWSKSWKKYFIEMVYLRAYV  770

Query  1599  NIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFK  1420
              +Y N     + S +H    + YG  V   +N   ++ +D    +F  L  +   D    
Sbjct  771   MVYPNFANFESFSTNH----LEYGTHVQQKNNGRAKSKVD----QF--LVPLMQQDTILT  820

Query  1419  QVFPDRIVQHFNEL  1378
             Q+ PDR +  F+ L
Sbjct  821   QL-PDRHLPDFDHL  833



>ref|XP_008646404.1| PREDICTED: uncharacterized protein LOC103627873 [Zea mays]
 gb|AFW73941.1| hypothetical protein ZEAMMB73_108513 [Zea mays]
Length=932

 Score =   100 bits (249),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 114/228 (50%), Gaps = 23/228 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+    S ++D  ++++   L  V++F W  G K +  R    GL     E+W+PSS
Sbjct  628   DEVPI----SFNMDSRVDAA--TLKVVNSFDWPHGPKTLRRRIIQGGLIRAVSESWYPSS  681

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD++  ++EDD+EVSP Y+ ++K  ++ Y Y+     P +   SL  PR V      P  
Sbjct  682   DDDYGLLLEDDIEVSPYYYLWIKYALLAYRYDPGVSLPELSSISLYTPRLVEVVKERPKW  741

Query  1842  HGNKM--KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             +  +   K+   T  +L+QL  +WG + FP+ W+EF  +     ++  K  PV +    T
Sbjct  742   NATEFFKKVHPNT-PYLHQLPCSWGAVFFPKHWREFYAYMAARFTEDAKQNPVQIPRSRT  800

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  801   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQTSFSTNHMEPGAH  843



>ref|XP_006488643.1| PREDICTED: uncharacterized protein LOC102606698 [Citrus sinensis]
Length=932

 Score =   100 bits (249),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/227 (28%), Positives = 105/227 (46%), Gaps = 21/227 (9%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V  F W  G K +  R    GL     E+W+P+S
Sbjct  627   DEVPISFNMDSKVDEA------TIKLVSTFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  680

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP ++ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  681   DDDFGLLLEDDIEVSPYFYLWIKYALLAYHYDPQISLPELSSISLYTPRIVEVVKERPKW  740

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++     T  +K     +    T 
Sbjct  741   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKQWREFYVYMHMRFTEDAKANPVQIPKSRTN  800

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  801   GW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  842



>ref|XP_006424549.1| hypothetical protein CICLE_v10030090mg [Citrus clementina]
 gb|ESR37789.1| hypothetical protein CICLE_v10030090mg [Citrus clementina]
Length=932

 Score =   100 bits (249),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/227 (28%), Positives = 105/227 (46%), Gaps = 21/227 (9%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V  F W  G K +  R    GL     E+W+P+S
Sbjct  627   DEVPISFNMDSKVDEA------TIKLVSTFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  680

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP ++ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  681   DDDFGLLLEDDIEVSPYFYLWIKYALLAYHYDPQISLPELSSISLYTPRIVEVVKERPKW  740

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++     T  +K     +    T 
Sbjct  741   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKQWREFYVYMHMRFTEDAKANPVQIPKSRTN  800

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  801   GW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  842



>gb|KDO73334.1| hypothetical protein CISIN_1g046508mg [Citrus sinensis]
Length=932

 Score =   100 bits (249),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/227 (28%), Positives = 105/227 (46%), Gaps = 21/227 (9%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         +  V  F W  G K +  R    GL     E+W+P+S
Sbjct  627   DEVPISFNMDSKVDEA------TIKLVSTFDWPHGPKTLRRRIIQGGLIRAVSESWYPAS  680

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP ++ ++K  ++ Y+Y+     P +   SL  PR V      P  
Sbjct  681   DDDFGLLLEDDIEVSPYFYLWIKYALLAYHYDPQISLPELSSISLYTPRIVEVVKERPKW  740

Query  1842  HGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD---THKSKGMKPVLDGMVTT  1675
             +  +  K       +L+QL  +WG + FP+ W+EF ++     T  +K     +    T 
Sbjct  741   NATEFFKHIHPNTPYLHQLPCSWGAVFFPKQWREFYVYMHMRFTEDAKANPVQIPKSRTN  800

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  801   GW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  842



>ref|XP_002984703.1| hypothetical protein SELMODRAFT_120665 [Selaginella moellendorffii]
 gb|EFJ14348.1| hypothetical protein SELMODRAFT_120665 [Selaginella moellendorffii]
Length=935

 Score =   100 bits (248),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 139/282 (49%), Gaps = 40/282 (14%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASL  2152
             PI+    NK  T ++ ++  NR+ SL+R L SLA+AHY    +H+             + 
Sbjct  589   PISLQQWNK-MTIVVNIITQNRVGSLNRLLQSLASAHYLGDKIHM-------------TF  634

Query  2151  DVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD  1972
             ++D  +++    L+ V AF W  G K+V  R    GL     E+W+P+ D E+  ++EDD
Sbjct  635   NMDSKVDAP--TLELVHAFQWPHGRKIVRRRIIPGGLIRAVSESWYPAHDHEYGLLLEDD  692

Query  1971  LEVSPLYFRFLKNLIVNYYYNASN-------------FSPMIYGASLQRPRFVPGKHGNK  1831
             +EVSP Y+ +LK  ++ Y Y+ +              ++P +     +RP++    +   
Sbjct  693   IEVSPFYYMWLKYALLTYVYSTTGPTVPIPELGSIALYTPRLVEVVKERPKWNATDYFKA  752

Query  1830  MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTGWYKK  1660
             +  ++    +L+QL  +WG L FP+ W+EF  +  +  ++  K  PV +    T GW   
Sbjct  753   LHPNT---PYLHQLPCSWGALFFPKHWREFYKYMGSRYTEDAKANPVQIPRSRTNGW---  806

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
               +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  807   --QASWKKFLIDLMYLRGYVSLYPNFPNQTSFSTNHMEPGAH  846



>ref|XP_002978788.1| hypothetical protein SELMODRAFT_109643 [Selaginella moellendorffii]
 gb|EFJ20235.1| hypothetical protein SELMODRAFT_109643 [Selaginella moellendorffii]
Length=935

 Score =   100 bits (248),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 139/282 (49%), Gaps = 40/282 (14%)
 Frame = -3

Query  2331  PITTTADNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASL  2152
             PI+    NK  T ++ ++  NR+ SL+R L SLA+AHY    +H+             + 
Sbjct  589   PISLQQWNK-MTIVVNIITQNRVGSLNRLLQSLASAHYLGDKIHI-------------TF  634

Query  2151  DVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDD  1972
             ++D  +++    L+ V AF W  G K+V  R    GL     E+W+P+ D E+  ++EDD
Sbjct  635   NMDSKVDAP--TLELVHAFQWPHGRKIVRRRIIPGGLIRAVSESWYPAHDHEYGLLLEDD  692

Query  1971  LEVSPLYFRFLKNLIVNYYYNASN-------------FSPMIYGASLQRPRFVPGKHGNK  1831
             +EVSP Y+ +LK  ++ Y Y+ +              ++P +     +RP++    +   
Sbjct  693   IEVSPFYYMWLKYALLTYVYSTTGPTVPIPELGSIALYTPRLVEVVKERPKWNATDYFKA  752

Query  1830  MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTGWYKK  1660
             +  ++    +L+QL  +WG L FP+ W+EF  +  +  ++  K  PV +    T GW   
Sbjct  753   LHPNT---PYLHQLPCSWGALFFPKHWREFYKYMGSRYTEDAKANPVQIPRSRTNGW---  806

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
               +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  807   --QASWKKFLIDLMYLRGYVSLYPNFPNQTSFSTNHMEPGAH  846



>gb|KDE08140.1| hypothetical protein MVLG_01621 [Microbotryum violaceum p1A1 
Lamole]
Length=1146

 Score = 99.8 bits (247),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/238 (28%), Positives = 116/238 (49%), Gaps = 19/238 (8%)
 Frame = -3

Query  2196  HIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAW  2017
             H F D  P+  N     D   + ++R+   +D   W +G   V +R    GL    +E+W
Sbjct  605   HYFGDEVPLYLNLEQTAD---SVTQRLASDLD---WPYGPVTVRHRIVLGGLMPSIVESW  658

Query  2016  WPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNAS--NFSPMIYGASLQRPRFVPGK  1843
             +P+S+D +   +EDD+EVSP+++ +LK  I+ Y Y+ +  + S  ++G SL + +F   +
Sbjct  659   YPASNDTYGVFLEDDVEVSPMFYGWLKMAILYYRYSMAMRDRSTRLFGVSLYQQKFFELR  718

Query  1842  HGNKMKIDSR----------TRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVL  1693
                +   D+           T  +L Q+  +WG   FP  W+EF L+     S+   P+ 
Sbjct  719   PEGRQPFDAHVLFESLALDPTLPYLSQIPCSWGAAYFPEVWREFHLYLALRLSEMAIPIA  778

Query  1692  DGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSV  1519
             D +V      K  +  W  +FI+ I+ RGY  +Y N     ++S +H + G +   +V
Sbjct  779   DQIVPEIRSNKWPQS-WKKYFIELIYLRGYVMLYPNYANYSSMSTNHVEKGTHIKDAV  835



>ref|NP_001173193.1| Os02g0806500 [Oryza sativa Japonica Group]
 gb|AAK98697.1|AC069158_9 Hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD19386.1| glycosyltransferase protein 2-like [Oryza sativa Japonica Group]
 gb|EAY87928.1| hypothetical protein OsI_09353 [Oryza sativa Indica Group]
 gb|EAZ25007.1| hypothetical protein OsJ_08789 [Oryza sativa Japonica Group]
 dbj|BAH91922.1| Os02g0806500 [Oryza sativa Japonica Group]
Length=928

 Score = 99.4 bits (246),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/230 (27%), Positives = 113/230 (49%), Gaps = 24/230 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+    S ++D  ++++   L+ V+AF W  G K +  R    GL     E+W+P++
Sbjct  621   DEVPI----SFNMDSRVDAA--TLNVVNAFDWPHGGKTLRRRIIQGGLIRAVSESWYPAT  674

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNA----------SNFSPMIYGASLQRPRF  1855
             DD++  ++EDD+EVSP Y+ ++K  ++ Y Y+           S ++P +     +RPR+
Sbjct  675   DDDYGLLLEDDIEVSPYYYLWIKYALLAYRYDPQVSLPELSSISLYTPRLVEVVKERPRW  734

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGM  1684
                    + K       +L+QL  +WG + FP+ W+EF  +     ++  K  PV +   
Sbjct  735   NATAFFGRSKNHHPNTPYLHQLPCSWGAVFFPKHWREFYAYMAARFTEDAKQNPVQIPRS  794

Query  1683  VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              T GW     +  W  + I  ++ RGY  +Y N   + + S +H + G +
Sbjct  795   RTNGW-----QASWKKFLIDMMYLRGYVALYPNFPDQSSFSTNHMEPGAH  839



>emb|CEG70794.1| hypothetical protein RMATCC62417_06625 [Rhizopus microsporus]
Length=675

 Score = 98.6 bits (244),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/235 (29%), Positives = 115/235 (49%), Gaps = 18/235 (8%)
 Frame = -3

Query  2154  LDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVED  1975
             L+V    ++ R     V++F WK GAK + +R    GL    +E+W+PS DDE+A ++ED
Sbjct  237   LNVHMEQSADRVTRMLVNSFMWKQGAKQIRHRIKKGGLMPAIVESWYPSHDDEYAVLLED  296

Query  1974  DLEVSPLYFRFLKNLIVNYYYNASNFS-PMIYGASLQRPRFVPGKHGNKMKIDSRTRV--  1804
             D+EVSP ++ + K  I+ Y Y     +  ++YG SL  PR +      ++  D  + +  
Sbjct  297   DIEVSPYFYAWSKYAILKYRYGRDREAYRLMYGVSLYAPRNLELLPAGRVTFDPNSVLLP  356

Query  1803  -------FLYQLVGTWGQLLFPRPWKEF-----RLWYDTHKSKGMKPVLDGMVTTGWYKK  1660
                    +L Q+  +WG + FP  W+EF     R   D +  K     +  +   G    
Sbjct  357   RYPPQMPYLSQVPCSWGAVYFPEHWREFHGYLVRRLEDLNLPKNSTARV--ISVPGSRSD  414

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
               ++ W  +FI+ ++ R Y  +Y N     A S +H + G ++ KS G   +++G
Sbjct  415   KWKKSWKKYFIELVYLRAYVMLYPNFHQFEAFSTNHVEVGTHF-KSDGKRQSVIG  468



>ref|XP_008791567.1| PREDICTED: uncharacterized protein LOC103708423 [Phoenix dactylifera]
Length=924

 Score = 99.0 bits (245),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 107/228 (47%), Gaps = 23/228 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         L  V ++ WK G  +   R    GL     E+W+PSS
Sbjct  620   DEIPLNFNMDSKVDEE------TLKVVGSYEWKQGPTLTRRRIIQGGLIRAVSESWYPSS  673

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVP--------  1849
             D++F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR V         
Sbjct  674   DNDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLVEVVKERPRW  733

Query  1848  GKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
                G   KI   T  +L+QL  +WG + FP+ W+EF  +  +  +   K  PV +    T
Sbjct  734   NATGFFKKIHPNT-PYLHQLPCSWGAVFFPKHWREFYAYMGSRFTVDAKQNPVQIPRSRT  792

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  793   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPGQMSFSTNHMEPGAH  835



>ref|XP_006648077.1| PREDICTED: uncharacterized protein LOC102708127 [Oryza brachyantha]
Length=922

 Score = 99.0 bits (245),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 112/228 (49%), Gaps = 22/228 (10%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+    S ++D  ++++   L+ V++F W  G K +  R    GL     E+W+P+S
Sbjct  617   DEVPI----SFNMDSRVDAA--TLNVVNSFEWPHGGKTLRRRIIQGGLIRAVSESWYPAS  670

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV----PGKHG  1837
             DD++  ++EDD+EVSP Y+ ++K  ++ Y Y+     P +   SL  PR V         
Sbjct  671   DDDYGLLLEDDIEVSPYYYLWVKYALLAYRYDPQVALPELSSISLYTPRLVEVVKERPRW  730

Query  1836  NKMKIDSRTR----VFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVT  1678
             N      R+      +L+QL  +WG + FP+ W+EF  +     ++  K  PV +    T
Sbjct  731   NATAFFGRSHHPNTPYLHQLPCSWGAVFFPKHWREFYAYMAARFTEDAKQNPVQIPRSRT  790

Query  1677  TGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  791   NGW-----QASWKKFLIDMMYLRGYVSLYPNFPNQTSFSTNHMEPGAH  833



>ref|XP_009025666.1| hypothetical protein HELRODRAFT_189271 [Helobdella robusta]
 gb|ESN96511.1| hypothetical protein HELRODRAFT_189271 [Helobdella robusta]
Length=366

 Score = 95.9 bits (237),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 109/244 (45%), Gaps = 43/244 (18%)
 Frame = -3

Query  2148  VDRNLNSS--RRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAW--------------  2017
             +DRN  +         V  F W  GA  +H +TS+ G+  QW++ W              
Sbjct  93    IDRNAKTGIHNDTYRAVSEFKWTKGATRIHNQTSHVGIMGQWIDTWRPKFAPPFQPKNMT  152

Query  2016  ------WPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRF  1855
                    PS   E A ++EDDL VSP  +R+LK  +   Y   ++F+    G +L     
Sbjct  153   STMYPHQPSYKKEIALILEDDLSVSPHAYRYLK-AVYRKYNGRADFA----GVTLTSDEA  207

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK---PVLDGM  1684
                  G  ++  +    F+Y  +GTWG     + W EF+ W+  H ++G+K   P L+G 
Sbjct  208   KAHNTGKALRAPANESAFMYVCIGTWGFAPSSQYWAEFQDWF--HYARGIKNFQPYLNGT  265

Query  1683  VTTGWYKKMGER-----IWTPWFIKFIHARGYFNIYTNLLY------ERALSISHRDAGV  1537
                 W++   +      +W  WFI F   +  + +Y+NL Y      +  ++I+ R+ G+
Sbjct  266   KPDSWFRGFLQEGTHDSMWEMWFIHFASKKKAYTVYSNLKYVNGDEADSCVAINRREVGL  325

Query  1536  NYGK  1525
             +Y +
Sbjct  326   HYSQ  329



>emb|CEJ01502.1| hypothetical protein RMCBS344292_15526 [Rhizopus microsporus]
Length=531

 Score = 97.4 bits (241),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 67/235 (29%), Positives = 115/235 (49%), Gaps = 18/235 (8%)
 Frame = -3

Query  2154  LDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVED  1975
             L+V    ++ R     V++F WK GAK + +R    GL    +E+W+PS DDE+A ++ED
Sbjct  93    LNVHMEQSADRVTRMLVNSFMWKQGAKQIRHRIKKGGLMPAIVESWYPSHDDEYAVLLED  152

Query  1974  DLEVSPLYFRFLKNLIVNYYYNASNFS-PMIYGASLQRPRFVPGKHGNKMKIDSRTRV--  1804
             D+EVSP ++ + K  I+ Y Y     +  ++YG SL  PR +      ++  D  + +  
Sbjct  153   DIEVSPYFYAWSKYAILKYRYGRDREAYRLMYGVSLYAPRNLELLPAGRVTFDPNSVLLP  212

Query  1803  -------FLYQLVGTWGQLLFPRPWKEF-----RLWYDTHKSKGMKPVLDGMVTTGWYKK  1660
                    +L Q+  +WG + FP  W+EF     R   D +  K     +  +   G    
Sbjct  213   QYPPQMPYLSQVPCSWGAVYFPEHWREFHGYLVRRLEDLNLPKNSTARV--ISVPGSRSD  270

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVG  1495
               ++ W  +FI+ ++ R Y  +Y N     A S +H + G ++ KS G   +++G
Sbjct  271   KWKKSWKKYFIELVYLRAYVMLYPNFHQFEAFSTNHVEVGTHF-KSDGKRQSVIG  324



>gb|EYU18816.1| hypothetical protein MIMGU_mgv1a001032mg [Erythranthe guttata]
Length=908

 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 95/201 (47%), Gaps = 32/201 (16%)
 Frame = -3

Query  2115  LDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLK  1936
             L   ++F W  G K++  R    GL     E+W+PSSDD F  ++EDD+EVSP Y+ ++K
Sbjct  644   LKLANSFEWAHGPKILRRRIIQGGLIRAVSESWYPSSDDNFGLLLEDDIEVSPYYYLWIK  703

Query  1935  NLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNK-MKIDSRTRVFLYQLVGTW  1777
             N +++Y+Y+     P +   SL  PR V      P  +  +  K       +L+QL  +W
Sbjct  704   NALLSYHYDPQVQLPELASISLYTPRLVEVVKERPKWNATEFFKGIHPNTPYLHQLPCSW  763

Query  1776  GQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFN  1597
             G + FP+ W+E                     T GW     +  W  + I  ++ RGY +
Sbjct  764   GAVFFPKQWRE--------------------STCGW-----QASWKKFLIDMMYLRGYVS  798

Query  1596  IYTNLLYERALSISHRDAGVN  1534
             +Y N   + + S +H + G +
Sbjct  799   LYPNFPNQASFSTNHMEPGAH  819



>ref|XP_010906511.1| PREDICTED: uncharacterized protein LOC105033416 [Elaeis guineensis]
Length=923

 Score = 98.2 bits (243),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 109/231 (47%), Gaps = 21/231 (9%)
 Frame = -3

Query  2196  HIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAW  2017
             H   D  P+  N    VD         L  V++  W  G K V  R    GL     E++
Sbjct  615   HYLGDEVPLSFNMDSKVDEA------TLKIVESLEWAQGPKFVRRRIIQGGLIRAVSESF  668

Query  2016  WPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV-----  1852
             +PSSDD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR +     
Sbjct  669   YPSSDDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLIEVVKE  728

Query  1851  -PGKHGNK-MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDG  1687
              P  +  +  K       +L+QL  +WG + FP+ W+EF  +  +  ++  K  PV +  
Sbjct  729   RPKWNATEFFKSIHPNTPYLHQLPCSWGAVFFPKHWREFYAYMSSRFTQDAKQNPVQIPK  788

Query  1686  MVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
               T GW     +  W  + I  ++ RGY +++ N   + + S +H + G +
Sbjct  789   SRTNGW-----QASWKKFLIDMMYLRGYVSLFPNFPNQTSFSTNHMEPGAH  834



>ref|XP_008805206.1| PREDICTED: uncharacterized protein LOC103718255 [Phoenix dactylifera]
Length=922

 Score = 98.2 bits (243),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/217 (30%), Positives = 110/217 (51%), Gaps = 19/217 (9%)
 Frame = -3

Query  2157  SLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             SL++D  ++ +   L  V +F W  G K +  R    GL     E+++PSSDD+F  ++E
Sbjct  623   SLNMDGKVDEA--TLKVVGSFEWAQGPKFLRRRIVRGGLIRAVSESFYPSSDDDFGLLLE  680

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGKHGNKM--KI  1822
             DD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR +      P  +  +   KI
Sbjct  681   DDIEVSPYYYLWIKYALLAYHYDPHVSLPELSSISLYTPRLIEVVKERPRWNATEFFKKI  740

Query  1821  DSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTTGWYKKMGE  1651
                T  +L+QL  +WG + FP+ W+EF  +     ++  K  PV +    T GW     +
Sbjct  741   HPNT-PYLHQLPCSWGAVFFPKHWREFYAYMSARFTEDAKRNPVQIPKSRTNGW-----Q  794

Query  1650  RIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
               W  + I  ++ RGY ++Y N   + + S +H + G
Sbjct  795   ASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPG  831



>ref|XP_009023365.1| hypothetical protein HELRODRAFT_176859 [Helobdella robusta]
 gb|ESN98399.1| hypothetical protein HELRODRAFT_176859 [Helobdella robusta]
Length=354

 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 87/201 (43%), Gaps = 31/201 (15%)
 Frame = -3

Query  2106  VDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWP--------------------SSDDEFAF  1987
             V  F W+ G   +H ++ N G+  QW+  W P                    S   E A 
Sbjct  110   VSEFKWRQGQTRIHNQSRNVGIMGQWINTWRPKHAPPFQPRNMTSTIYPYHESFGKEIAL  169

Query  1986  VVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTR  1807
             ++EDDL +SP  +RFL+     Y   A        G SLQ    +       +       
Sbjct  170   ILEDDLSISPQAYRFLRAAHRKYNRRAD-----YAGVSLQSDEALALNSNKPLSAPKNES  224

Query  1806  VFLYQLVGTWGQLLFPRPWKEFRLWYDTHKS-KGMKPVLDGMVTTGWYKK---MG--ERI  1645
               +Y  +GTWG    P+ W EF+ W+   +  KG +P +DG V + W+++   MG  + +
Sbjct  225   ALMYVCIGTWGFAPSPQFWAEFQDWFHYARGVKGFQPYVDGTVVSSWFRQFVNMGTADTM  284

Query  1644  WTPWFIKFIHARGYFNIYTNL  1582
             W  WFI F   +  F +Y+NL
Sbjct  285   WEMWFIHFATKKNIFTVYSNL  305



>gb|KDR65732.1| hypothetical protein GALMADRAFT_1220405 [Galerina marginata CBS 
339.88]
Length=788

 Score = 97.4 bits (241),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/270 (26%), Positives = 125/270 (46%), Gaps = 23/270 (9%)
 Frame = -3

Query  2187  IDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPS  2008
             I +F  P +  ++V+++ +     L   + F W FG   VH+R  + GL    +E+W+P 
Sbjct  477   IRYFGDPLDLRINVEQDCD--METLQIAENFTWPFGRVFVHHRILHGGLLPAVVESWYPK  534

Query  2007  SDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYY-NASNFSPMIYGASLQRPR---------  1858
                 +  ++EDD+E+SPL + ++K  ++ Y + +A+N  P ++G SL + +         
Sbjct  535   DTSTYGLLLEDDIELSPLSYAWIKMALLRYRHGDATNRVPNMFGVSLYQQKQLELPLHVK  594

Query  1857  ----FVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLD  1690
                 F P    +K  +   T  FL Q+  +WG + FP  W+EF  +     ++    + +
Sbjct  595   GSRQFNPRSFFSKAGLAHPTTPFLSQVPCSWGAVYFPEHWREFHDYLSIRFAETSMSI-E  653

Query  1689  GMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSIS--HRDAGVNYGKSVG  1516
               V            W  +FI+ +H RGY  +Y N  YE  LS S  H + G++      
Sbjct  654   HQVVPAVRSNNWSNSWKKFFIELVHLRGYAMLYPN--YEAFLSFSTNHLEVGLHVKDRSV  711

Query  1515  PDSNLVGEN--SIDINHLEFHPLHSMKWYD  1432
               +NL  +    + +N L   P H++   D
Sbjct  712   AKTNLFSQPLMQLGMNKLLELPEHTLPRVD  741



>ref|XP_008807485.1| PREDICTED: uncharacterized protein LOC103719835 [Phoenix dactylifera]
Length=924

 Score = 97.4 bits (241),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 109/227 (48%), Gaps = 21/227 (9%)
 Frame = -3

Query  2184  DHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS  2005
             D  P+  N    VD         L  V +  W  G K +  R    GL     E+++PSS
Sbjct  620   DEVPLSFNMDGKVDEA------TLKIVGSLEWVQGPKFIRRRIIQGGLIRAVSESFYPSS  673

Query  2004  DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV------PGK  1843
             DD+F  ++EDD+EVSP Y+ ++K  ++ Y+Y+     P +   SL  PR +      P  
Sbjct  674   DDDFGLLLEDDIEVSPYYYLWIKYALLAYHYDPQVSLPELSSISLYTPRLIEVVKERPKW  733

Query  1842  HGNKMKIDSRTRV-FLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK--PV-LDGMVTT  1675
             +  +   +S     +L+QL  +WG + FP+ W+EF  + ++  ++  K  PV +    T 
Sbjct  734   NATEFFKNSHPNTPYLHQLPCSWGAVFFPKHWREFYAYMNSRFTEDAKQNPVQIPKSRTN  793

Query  1674  GWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             GW     +  W  + I  ++ RGY ++Y N   + + S +H + G +
Sbjct  794   GW-----QASWKKFLIDMMYLRGYVSLYPNFPNQASFSTNHMEPGAH  835



>gb|ELT95652.1| hypothetical protein CAPTEDRAFT_197326 [Capitella teleta]
Length=366

 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/210 (30%), Positives = 102/210 (49%), Gaps = 22/210 (10%)
 Frame = -3

Query  2073  VVHYRTSNAGLQAQWLEAWWPS-SDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNF  1897
              VH R  NAG+  QW + W P     E   +VEDD++V+P  +R+LK     Y +     
Sbjct  138   AVHIREKNAGITGQWTDTWRPQVGSKEIGLIVEDDIDVAPTVYRWLKAAHAKYDHRND--  195

Query  1896  SPMIYGASLQRPR---FVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLW-Y  1729
                + G SLQ      F+P +        + T VF++ ++GTWG    PR W+EF+ W +
Sbjct  196   ---VSGYSLQSTNVNFFLPERRKPMFGPKTDT-VFMHSVLGTWGFSPHPRSWREFQDWAH  251

Query  1728  DTHKSKGMKPVLDGMVTTGWYKKM-----GERIWTPWFIKFIHARGYFNIYTNLLYERA-  1567
             D   +  +KP +  +V T WYK          +W  W I + + +  + +Y NL      
Sbjct  252   DVRDNDKVKPYVPDVVLTKWYKTFESNNRQSSMWEMWHIYYSYVKNMYCVYCNLKAHTGK  311

Query  1566  ----LSISHRDAGVNY-GKSVGPDSNLVGE  1492
                 LS + ++ G+++ GKS+   +NL+ +
Sbjct  312   ENVLLSWNRKEHGLHFKGKSIASTNNLLSD  341



>emb|CDH51079.1| glycosyltransferase family protein 2 [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=982

 Score = 97.1 bits (240),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 105/216 (49%), Gaps = 15/216 (7%)
 Frame = -3

Query  2109  FVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNL  1930
              V+ + W +G K V +R+   GL +   E+W+PSS+D +A ++EDD+EVSPL++ + K  
Sbjct  613   MVNEYAWPYGTKTVRHRSRKGGLISAITESWYPSSNDNYAVLLEDDIEVSPLFYVWTKYT  672

Query  1929  IVNYYYNASNFSPMIYGASLQRPRFVP----GKHG-NKMKIDSRTRV--------FLYQL  1789
             ++ Y Y+  N    ++G SL  PR VP    G+H  N  +I + + +        ++  L
Sbjct  673   VLKYRYDPHNRDMSMFGVSLYTPRNVPVYMDGRHAFNPEEIITSSSLPYPGPNSPYVTTL  732

Query  1788  VGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFIHAR  1609
               +WG + FP  W+EF  +     +K  K  +  +       +     W  ++I+  + R
Sbjct  733   PCSWGAVYFPEHWREFHEYIMERVAKPKK--VYNITVPESRSETWHFSWKKFYIEMAYLR  790

Query  1608  GYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNL  1501
              Y  +Y N     + S +H + G +  +    +  L
Sbjct  791   AYVMLYPNFEDWTSFSTNHLEIGQHIKEGTRTEEEL  826



>gb|EJK57711.1| hypothetical protein THAOC_22215 [Thalassiosira oceanica]
Length=444

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 115/237 (49%), Gaps = 11/237 (5%)
 Frame = -3

Query  2106  VDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLI  1927
             V+   W  G+        N GL+  WLEAW P SDD+ A ++EDD+ VSPL++R++    
Sbjct  164   VEDVTWPHGSISTLVANENMGLRKAWLEAWHPESDDDRAIILEDDVTVSPLWYRWVNGAY  223

Query  1926  VNYYYNASNFSPMIYGASLQRPRFVP--GKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRP  1753
               Y ++       I G SLQR   V    K  +     +    FLY L+G+ G     R 
Sbjct  224   DAYGHDGGR----IAGFSLQRQHLVSLISKRTSVRVPTNDNEPFLYSLIGSIGFAPNARV  279

Query  1752  WKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGER-IWTPWFIKFIHARGYFNIYT-NLL  1579
             W+ F  W +      +   ++G+++T WYK + +R IWT  F  +++  G   +Y     
Sbjct  280   WRNFLDWAECAIDNDVDVSINGLISTVWYKTLDKRGIWTQHFRYYMNRLGLGCLYHFPKD  339

Query  1578  YERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFP  1408
               +AL +  R+ G ++ +S G   ++V +   +I++L F   H +  YDF    + P
Sbjct  340   ASKALGVHWREKGEHFRRSEGASHDVVTDPG-EISNLVFP--HDLNSYDFGAALIKP  393



>ref|XP_007386423.1| hypothetical protein PUNSTDRAFT_136755 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN05955.1| hypothetical protein PUNSTDRAFT_136755 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=692

 Score = 96.3 bits (238),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/219 (26%), Positives = 103/219 (47%), Gaps = 11/219 (5%)
 Frame = -3

Query  2163  NASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             + SL ++    +   + + +  F W  G  ++++R  + GL A  +E+W+P SD  +  +
Sbjct  378   SVSLRINVEEGADLEVHNVIKEFAWTSGPLMINHRVQHGGLLAAVVESWYPDSDHSYGLL  437

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGAS----------LQRPRFVPGKHGN  1834
             +EDD+E+SPL++ ++K  ++ Y Y        +YG S          L+  R    +H  
Sbjct  438   LEDDIELSPLFYAWVKMTVLRYRYGGHPAPEELYGISLYQQTNLELPLEGRRKFNAQHLF  497

Query  1833  KMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVL-DGMVTTGWYKKM  1657
             + +   R   +L Q+  +WG + FP  W+EF  +     S G   +  D  +        
Sbjct  498   ESEGLPRNAPYLSQIPCSWGAVYFPEHWREFHAYLSARLSTGPDWITADADIVPDVRSTR  557

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
               R W  +FI+ ++ RGY  +Y N     +LS +H + G
Sbjct  558   WTRSWKKYFIELVYMRGYVMLYPNYNDFVSLSTNHLEPG  596



>emb|CDS12682.1| hypothetical protein LRAMOSA04868 [Absidia idahoensis var. thermophila]
Length=978

 Score = 96.7 bits (239),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 100/205 (49%), Gaps = 17/205 (8%)
 Frame = -3

Query  2112  DFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKN  1933
             + V+ + W +G K V +R+   GL +   E+W+PSS+D +A ++EDD+EVSPL++ + K 
Sbjct  610   NMVNGYAWPYGTKTVRHRSRKGGLISAITESWYPSSNDNYAVLLEDDIEVSPLFYVWTKY  669

Query  1932  LIVNYYYNASNFSPMIYGASLQRPRFVP----GKHG---------NKMKIDSRTRVFLYQ  1792
              ++ Y Y+  N    ++G SL  PR VP    G+H          + +        ++  
Sbjct  670   TVLKYRYDPHNRDMSMFGVSLYTPRNVPVYMDGRHAFNPEEEITSSSLPYPGPNSPYVTT  729

Query  1791  LVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYK-KMGERIWTPWFIKFIH  1615
             L  +WG + FP  W+EF  +      +  KP +   +T    + +     W  ++I+  +
Sbjct  730   LPCSWGAVYFPEHWREFHEYI---MERVAKPKMVYNITVPESRSETWHYSWKKFYIEMAY  786

Query  1614  ARGYFNIYTNLLYERALSISHRDAG  1540
              R Y  +Y N     + S +H + G
Sbjct  787   LRAYVMLYPNFQDWTSFSTNHLEIG  811



>ref|XP_005839692.1| hypothetical protein GUITHDRAFT_101866 [Guillardia theta CCMP2712]
 gb|EKX52712.1| hypothetical protein GUITHDRAFT_101866 [Guillardia theta CCMP2712]
Length=899

 Score = 96.7 bits (239),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 117/255 (46%), Gaps = 25/255 (10%)
 Frame = -3

Query  2229  AAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSN  2050
              A Y     +LH+F D      + + D D     +++IL     F W FG+K +    + 
Sbjct  227   GADYMGRTANLHVFQDLL---VSGTADAD-----TKKILQ---DFQWPFGSKNIDVARTR  275

Query  2049  AGLQAQWLEAWWPSS---DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASN--FSPMI  1885
              GL   ++ AW PS    D++ A   EDD++VSP + ++       + Y+AS   FS M 
Sbjct  276   QGLLLSFVNAWKPSGPADDNDVAIFFEDDIQVSPFFAKWYLEAHERFRYDASVCVFSAMR  335

Query  1884  YGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYD-THKSKG  1708
                    P    G+ GN +  D    VF Y+LVGT         W EFR W++   K+  
Sbjct  336   AQLRASDPHG-EGELGNSLPGD--VNVFKYRLVGTTSLSPLASQWIEFRTWFEQASKNPN  392

Query  1707  MKPVLDGMVTTGWY---KKMG--ERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDA  1543
               PV++G+  T WY   K  G  +++W  W+IKF+  R Y+ +Y  +    AL     DA
Sbjct  393   FSPVVEGIQPTIWYLDLKNTGNEDKMWVMWYIKFMSDRNYYCVYPWIPSRHALVAKWNDA  452

Query  1542  GVNYGKSVGPDSNLV  1498
                 G  +  D+ LV
Sbjct  453   DARAGNQLFADNRLV  467



>ref|XP_004337083.1| hypothetical protein ACA1_214990 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR15070.1| hypothetical protein ACA1_214990 [Acanthamoeba castellanii str. 
Neff]
Length=713

 Score = 96.3 bits (238),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 118/264 (45%), Gaps = 61/264 (23%)
 Frame = -3

Query  2313  DNKSFTFIIKLLAYnrlsslsrclnsLAAAHYDHHAVHLHIFIDHFPVPANASLDVDRNL  2134
             D      ++K+L Y R  +L R L SL  A YD   V+L +F+D+           D   
Sbjct  398   DGSDVRIVLKVLTYKRPEALQRLLQSLVGAEYDGDEVNLDVFVDY-----------DEQQ  446

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWL-----EAWWPS-------------  2008
             N++  +L       W  G K +  +  N GL  QWL      A+ P+             
Sbjct  447   NAA--VLQAAKQLDWPHGRKRIFDQGRNVGLAFQWLGSFVDSAYGPAPATASAEGTLTPD  504

Query  2007  --------------SDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASL  1870
                            ++EFA+++EDDLE S  ++R++K  I  Y+ +  +++P   G SL
Sbjct  505   MRAFPLPPLPAKPLPNNEFAYIMEDDLEQSTQFYRWIKRAIQQYHTDKRHYTPRAPG-SL  563

Query  1869  QRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSK--GMKPV  1696
             Q P F            + +  F Y L+G+WG L FP+PW++F  W+   K+     +P 
Sbjct  564   QLPVF------------TNSTPFFYPLIGSWGTLAFPKPWEQFIHWFRQIKTADPSFQPF  611

Query  1695  LDGMVTTGWYKKMGERIWTPWFIK  1624
             +D  + + W  K    +WTPW I+
Sbjct  612   IDKTLPSKWMIKK-PMLWTPWIIR  634



>ref|XP_005821491.1| hypothetical protein GUITHDRAFT_147205 [Guillardia theta CCMP2712]
 gb|EKX34511.1| hypothetical protein GUITHDRAFT_147205 [Guillardia theta CCMP2712]
Length=439

 Score = 94.0 bits (232),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 108/238 (45%), Gaps = 14/238 (6%)
 Frame = -3

Query  2172  VPANASLDVDRNLNSS--RRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDD  1999
             +PAN  +  DRN        +   VD   W  G+K +H      G+   W+++W PS D 
Sbjct  165   LPANLHVHQDRNSKGELDPEVKKVVDELAWPHGSKELHQWPKQVGIMGNWIDSWQPSQDS  224

Query  1998  -EFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMK-  1825
              E A  +EDDLEVS  + R+    +  + + A + S   + A   + R    +    M+ 
Sbjct  225   KELAIFLEDDLEVSRFFARW---FLAAHKHFAHDESVSCFSAMRAQLRAADQRGEGLMEN  281

Query  1824  -IDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWY-DTHKSKGMKPVLDGMVTTGWY-----  1666
              +    R F Y+L+GTW      + W  FR W+    K    KP ++G++ + WY     
Sbjct  282   TVPETVRGFKYRLMGTWSFSPKAQHWFFFRQWFHKVSKISNFKPTVEGIIPSTWYEEFLR  341

Query  1665  KKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSVGPDSNLVGE  1492
             K     +W  W+I+F+  +  F +Y  + Y R L  + R+ G++Y      D  ++ E
Sbjct  342   KGTQSSMWEMWYIRFMDQKQKFCVYPWVKYRRTLVANWREPGLHYSGPATMDYPVLTE  399



>emb|CDS06903.1| hypothetical protein LRAMOSA09426 [Absidia idahoensis var. thermophila]
Length=966

 Score = 95.5 bits (236),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 115/219 (53%), Gaps = 16/219 (7%)
 Frame = -3

Query  2148  VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDL  1969
             ++++ +++ R+L  V+   W+ G K++ +R    GL    +E+W+P+SDDE+A ++EDD+
Sbjct  566   LEQSSDAATRML--VNGLKWRHGTKILRHRIRKGGLMPAIVESWYPASDDEYAVLLEDDV  623

Query  1968  EVSPLYFRFLKNLIVNYYYNAS----NFSPMIYGASLQRPRFV----PGK---HGNKMKI  1822
             EVSPL++ + K  I+ Y Y+ S    +    +YG SL  PR +     G+   H + + +
Sbjct  624   EVSPLFYVWAKYSILQYRYHQSKENDDLRQRLYGVSLYSPRNLELHPAGRRPFHPDHVLV  683

Query  1821  D--SRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYK-KMGE  1651
             +       ++ Q+  +WG + FP  W+EF  +     +   +P     +T    + +  +
Sbjct  684   NHFPPRMPYVSQVPCSWGAVYFPEHWREFHQYLTARLADLDQPPKRLNITVPDSRSERWK  743

Query  1650  RIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             + W  +FI+ ++ R Y  +Y N     + S +H + G +
Sbjct  744   KSWKKYFIELVYLRAYVMLYPNFQEFESFSTNHLETGTH  782



>emb|CCM02448.1| predicted protein [Fibroporia radiculosa]
Length=810

 Score = 95.1 bits (235),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 104/217 (48%), Gaps = 13/217 (6%)
 Frame = -3

Query  2154  LDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVED  1975
             L V+    + R     V++F W  G   +H R  + GL    +E+W+P S D +  ++ED
Sbjct  493   LRVNLEQTADRETSQIVESFKWDKGQVFLHRRVVHGGLLPAVVESWYPHSTDSYGLILED  552

Query  1974  DLEVSPLYFRFLKNLIVNYYYNAS-NFSPMIYGASLQRPRFV----PGKHG-------NK  1831
             D+E+SPL++ + K  +++Y Y  S + S  ++G SL + + +     G+H          
Sbjct  553   DVELSPLFYAWAKLALLHYRYGRSEDRSSRMFGISLYQQKNLELRPEGRHPFNARDVFTA  612

Query  1830  MKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGE  1651
               ID  +  +L Q+  +WG + FP  W+EF  +     S+      D +V  G       
Sbjct  613   AGIDDPSTPYLSQIPCSWGAVYFPEHWREFHAYLSLRLSEYAWDA-DQVVAPGVRSNKWM  671

Query  1650  RIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
             R W  +FI+  + RGY  +Y N     +LS +H + G
Sbjct  672   RSWKKYFIELAYLRGYVMLYPNFDGYVSLSTNHLEVG  708



>gb|EJK64351.1| hypothetical protein THAOC_14926 [Thalassiosira oceanica]
Length=679

 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 115/238 (48%), Gaps = 12/238 (5%)
 Frame = -3

Query  2106  VDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLI  1927
             V+   W  G+        N GL+  WLEAW P SDD+ A ++EDD+ VSPL++R++    
Sbjct  160   VEDVTWPHGSISTLVANENMGLRKAWLEAWHPESDDDRAIILEDDVTVSPLWYRWVNGAY  219

Query  1926  VNYYYNASNFSPMIYGASLQRPRFVP--GKHGNKMKIDSR-TRVFLYQLVGTWGQLLFPR  1756
               Y ++       I G SLQR   VP   K  + +++ +     FLY L+G+ G     R
Sbjct  220   DAYGHDGGR----IAGFSLQRQDLVPLQSKRNSGVRVPTNDNEPFLYSLIGSIGFAPNAR  275

Query  1755  PWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGER-IWTPWFIKFIHARGYFNIYT-NL  1582
              W+ F  W +      +   +DG+VT+ W K + +R +W   F  +++  G   +Y    
Sbjct  276   VWRNFLDWAECAIDNDVDVSVDGLVTSTWCKTLDKRGMWKQHFKYYMNRLGLGCLYHFPK  335

Query  1581  LYERALSISHRDAGVNYGKSVGPDSNLVGENSIDINHLEFHPLHSMKWYDFCFKQVFP  1408
                +AL +  R+ G ++  S G   ++V +   +I++L F     +  YDF    + P
Sbjct  336   DASKALGVHWREKGEHFATSEGASHDVVTDPG-EISNLVFP--QDLNSYDFGAAPIKP  390



>ref|XP_008038815.1| hypothetical protein TRAVEDRAFT_123656 [Trametes versicolor FP-101664 
SS1]
 gb|EIW58610.1| hypothetical protein TRAVEDRAFT_123656 [Trametes versicolor FP-101664 
SS1]
Length=747

 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 103/220 (47%), Gaps = 15/220 (7%)
 Frame = -3

Query  2157  SLDVDRNLNSSRR--ILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             +LD+  N+  +     L     + W  G   +H+R  + GL    +E+W+P  +D +  +
Sbjct  430   TLDMRINIEQTADDDTLRIASDYAWDRGNVFLHHRIVHGGLLPAVVESWYPRGNDSYGLI  489

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYN-ASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRT-  1810
             +EDD+E+SPL++ +LK  ++ Y Y    +  P ++G SL + + +  +   +   D+R  
Sbjct  490   LEDDVELSPLFYAYLKFTLLRYRYGRQEDRDPHLFGISLYQQKNLELRPEGRHLFDARVA  549

Query  1809  ----------RVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKK  1660
                         +L Q+  +WG L FP  W+EF  +     ++   P L   V  G    
Sbjct  550   FAAAGLPHAHTPYLSQIPCSWGALYFPEHWREFHAYLGARLAEHALP-LAQTVVPGVRSN  608

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
                R W  +FI+ +  RGY  +Y N     +LS +H + G
Sbjct  609   RWTRSWKRYFIELVFLRGYVMLYPNYARFASLSTNHLEVG  648



>gb|KFH70962.1| hypothetical protein MVEG_03808 [Mortierella verticillata NRRL 
6337]
Length=927

 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/235 (26%), Positives = 104/235 (44%), Gaps = 36/235 (15%)
 Frame = -3

Query  2163  NASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
               SL ++ +  + R  +    +F W FG K + +R    GL    +EAW+P  + E+A +
Sbjct  533   QVSLTLNMDAEADRVTIQMAGSFQWSFGEKFMRHRVRRGGLMLAVVEAWYPQGNHEYAVL  592

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNA-SNFSPMIYGASLQRPRFVPGKHGNKMKIDSR--  1813
             +EDD+EVSPL++ ++K  I+ Y Y+  S+    ++G S+   +FV      +   +    
Sbjct  593   LEDDVEVSPLFYTWIKYNILRYRYSPDSHLYQRMFGVSMYSQKFVETHLAGRAPFNPEDI  652

Query  1812  ---------TRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKK  1660
                         FL QL  +WG + FP  W+EF  +           V D ++   W K 
Sbjct  653   FIETPEYELRTPFLLQLPCSWGAVYFPEHWREFHEY-----------VADRLLDIEWNKT  701

Query  1659  MGERI-------------WTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
               + +             W   FI+ I+ RGY  +Y N     + S +H + G +
Sbjct  702   SLQSVQIPNSRTNRWSNSWKKLFIEMIYMRGYVMLYPNFFNFTSFSTNHLEWGTH  756



>gb|EPT00689.1| hypothetical protein FOMPIDRAFT_1030324 [Fomitopsis pinicola 
FP-58527 SS1]
Length=777

 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/222 (27%), Positives = 110/222 (50%), Gaps = 15/222 (7%)
 Frame = -3

Query  2157  SLDVDRNLNSSR--RILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             +LD+  N+  +   +    V  + W  G+  +H R  + GL    +E+W+P S+D +  +
Sbjct  456   ALDLRLNMEQTSDWKTQQIVSDYTWGHGSVFLHRRIIHGGLLPAVVESWYPQSNDSYGLI  515

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYY-NASNFSPMIYGASLQRPRF----VPGKHGNKMK--  1825
             +EDD+E+SPL++ ++K  ++ Y Y +  + S  ++G SL + +     + G+H    +  
Sbjct  516   LEDDVELSPLFYAWIKLSLLRYRYGHPDDVSSQLFGISLYQQKHLELRLEGRHSFNARST  575

Query  1824  -----IDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKK  1660
                  +D  +  +L Q+  +WG + FP  W+EF  +     S+      D +V  G    
Sbjct  576   FVSIGLDEPSTPYLSQIPCSWGAVYFPEHWREFHAYLSFRLSEYAWDA-DQVVVPGVRSN  634

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
                R W  +FI+ I+ RGY  +Y N     +LS +H + G +
Sbjct  635   KWTRSWKKYFIELIYLRGYVMLYPNYADYVSLSTNHLEVGAH  676



>gb|ELT92203.1| hypothetical protein CAPTEDRAFT_192810 [Capitella teleta]
Length=699

 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 85/170 (50%), Gaps = 11/170 (6%)
 Frame = -3

Query  2070  VHYRTSNAGLQAQWLEAWWPS-SDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFS  1894
             VH R  NAG+  QW + W P     E   +VEDD++VSPL +R+LK     Y   +    
Sbjct  472   VHVRERNAGITGQWTDTWRPQLGTKEIGLIVEDDVDVSPLAYRWLKAAHKTYDKRSDIQG  531

Query  1893  PMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLW-YDTHK  1717
                Y   +Q   F  GK        + T V++Y ++GTWG    P+ W+EF+ W +D   
Sbjct  532   ---YTLQMQNVNFFGGKMRPMFAPKNET-VYMYPVLGTWGFSPHPKTWREFQDWAHDVRD  587

Query  1716  SKGMKPVLDGMVTTGWYKKMGER-----IWTPWFIKFIHARGYFNIYTNL  1582
              + MKP + G++ T WYK   +R     +W  W I + + +  + +Y NL
Sbjct  588   KQKMKPYVPGILPTQWYKGFEKRHQEASMWEMWHIYYSYIKDLYCVYCNL  637


 Score = 92.0 bits (227),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 85/170 (50%), Gaps = 11/170 (6%)
 Frame = -3

Query  2070  VHYRTSNAGLQAQWLEAWWPS-SDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFS  1894
             VH R  NAG+  QW + W P     E   +VEDD++VSPL +R+LK     Y   +    
Sbjct  165   VHVRERNAGITGQWTDTWRPQLGTKEIGLIVEDDVDVSPLAYRWLKAAHKTYDKRSDIQG  224

Query  1893  PMIYGASLQRPRFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLW-YDTHK  1717
                Y   +Q   F  GK        + T V++Y ++GTWG    P+ W+EF+ W +D   
Sbjct  225   ---YTLQMQNVNFFGGKMRPMFAPKNET-VYMYPVLGTWGFSPHPKTWREFQDWAHDVRD  280

Query  1716  SKGMKPVLDGMVTTGWYKKMGER-----IWTPWFIKFIHARGYFNIYTNL  1582
              + +KP + G++ T WYK   +R     +W  W I + + +  + +Y NL
Sbjct  281   KQKVKPYVPGILPTQWYKGFEKRHQEASMWEMWHIYYSYIKDLYCVYCNL  330



>gb|EGU11213.1| Glycosyltransferase 2 [Rhodotorula glutinis ATCC 204091]
Length=1208

 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/222 (28%), Positives = 106/222 (48%), Gaps = 13/222 (6%)
 Frame = -3

Query  2163  NASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             + SL V+    + R     VD   W FG   + +R    GL    +E+W+P+S+D +  +
Sbjct  743   DVSLTVNLEQTADRLTHRLVDDMRWPFGTFSLRHRILLGGLMPAIVESWYPTSNDTYGVL  802

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYN--ASNFSPMIYGASLQRPRFVPGKHGNKMKIDS--  1816
             +EDD+EVSPL++ +LK  I+ Y Y       S  ++G SL + + +  +   +   D+  
Sbjct  803   LEDDVEVSPLFYGWLKFAILQYRYTLAGRRASGRLFGISLYQQKNIELRPEGRQPFDAHE  862

Query  1815  --------RTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKK  1660
                      T  +L Q+  +WG   FP  W+EF  +     S+   P+ + +V      K
Sbjct  863   LFADLSLHSTTPYLSQIPCSWGAAYFPEHWREFHTYLSLRLSELALPISEPLVPAIRSNK  922

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
                R W  +FI+ ++ RGY  +Y N     +LS +H + G +
Sbjct  923   W-PRSWKKYFIELVYLRGYSMLYPNYPDFESLSTNHLEKGTH  963



>gb|EMS21736.1| glycosyl transferase family 2 protein [Rhodosporidium toruloides 
NP11]
 emb|CDR35777.1| RHTO0S01e06876g1_1 [Rhodosporidium toruloides]
Length=1248

 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/222 (28%), Positives = 106/222 (48%), Gaps = 13/222 (6%)
 Frame = -3

Query  2163  NASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             + SL V+    + R     VD   W FG   + +R    GL    +E+W+P+S+D +  +
Sbjct  782   DVSLTVNLEQTADRLTHRLVDDMRWPFGTFSLRHRILLGGLMPAIVESWYPTSNDTYGVL  841

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYN--ASNFSPMIYGASLQRPRFVPGKHGNKMKIDS--  1816
             +EDD+EVSPL++ +LK  I+ Y Y       S  ++G SL + + +  +   +   D+  
Sbjct  842   LEDDVEVSPLFYGWLKFAILQYRYTLAGRRASGRLFGISLYQQKNIELRPEGRQPFDAHK  901

Query  1815  --------RTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKK  1660
                      T  +L Q+  +WG   FP  W+EF  +     S+   P+ + +V      K
Sbjct  902   LFADLSLHSTTPYLSQIPCSWGAAYFPEHWREFHTYLSLRLSELALPISEPLVPAIRSNK  961

Query  1659  MGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
                R W  +FI+ ++ RGY  +Y N     +LS +H + G +
Sbjct  962   W-PRSWKKYFIELVYLRGYSMLYPNYPDFESLSTNHLEKGTH  1002



>ref|XP_005703917.1| hypothetical protein Gasu_49950 [Galdieria sulphuraria]
 gb|EME27397.1| hypothetical protein Gasu_49950 [Galdieria sulphuraria]
Length=266

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 114/246 (46%), Gaps = 21/246 (9%)
 Frame = -3

Query  2205  VHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWL  2026
             V+L+I++D      +      + LN+  R+ +    F W  G K +HYRT + GLQ QWL
Sbjct  10    VNLYIYVDS---KFDEEYQSQKELNNIIRVREATQGFQWLLGRKEIHYRTVHHGLQNQWL  66

Query  2025  EAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLIV---NYYYNASNFSPMIYGASLQRPRF  1855
              AW+P+++ E +  +EDD+E+S  +  +++ +++   +   N+ +F        +     
Sbjct  67    AAWYPTNEMEASIFLEDDIEISCRFLEYIEKILLAMESSRKNSESFGEFEQCGGIVMEEL  126

Query  1854  VPGKHGNKMKIDSR-TRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVT  1678
                +H     I  +    F  +   +WG + F   WK F  WY T     ++P       
Sbjct  127   QISQHFLASNITQQFLNCFRVRFTSSWGPIYFGTFWKHFMDWYLT---VTLRPNFTPYTE  183

Query  1677  TG------WYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSI-SHRDAGVN---YG  1528
             T       W ++ G+ +W+PW  +F+    Y+ IY    ++  + + +H + GVN   Y 
Sbjct  184   TSDEKYNLWLRQ-GKDVWSPWLKRFLDETDYWFIYCKPPHKNTVWLHNHAEMGVNTHSYQ  242

Query  1527  KSVGPD  1510
             +S  P 
Sbjct  243   RSSLPQ  248



>emb|CDH60707.1| glycosyltransferase 2 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=979

 Score = 94.0 bits (232),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 111/224 (50%), Gaps = 26/224 (12%)
 Frame = -3

Query  2148  VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDL  1969
             ++++ + + R+L  V+   W+ G K++ +R    GL    +E+W+P SDDE+A ++EDD+
Sbjct  576   LEQSSDPATRML--VNGLEWRHGTKILRHRIRKGGLMPAIVESWYPGSDDEYAVLLEDDV  633

Query  1968  EVSPLYFRFLKNLIVNYYYNAS----NFSPMIYGASLQRPRFV----PGK---HGNKMKI  1822
             EVSPL++ + K  I+ Y Y+ S    +    +YG SL  PR +     G+   H + + +
Sbjct  634   EVSPLFYVWAKYSILQYRYHQSKENDDLRQRLYGVSLYSPRNLELHPAGRRPFHPDHVLV  693

Query  1821  D--SRTRVFLYQLVGTWGQLLFPRPWKEF------RLWYDTHKSKGMKPVLDGMVTTGWY  1666
             +       ++ Q+  +WG + FP  W+EF      RL       K +   +    +  W 
Sbjct  694   NHFPPRMPYVSQVPCSWGAVYFPEHWREFHQYLTARLADLDQPPKRLNITVPDSRSERWK  753

Query  1665  KKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
             K      W  +FI+ ++ R Y  +Y N     + S +H + G +
Sbjct  754   KS-----WKKYFIELVYLRAYVMLYPNFQEFESFSTNHLETGTH  792



>ref|XP_007865170.1| hypothetical protein GLOTRDRAFT_128380 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ56436.1| hypothetical protein GLOTRDRAFT_128380 [Gloeophyllum trabeum 
ATCC 11539]
Length=794

 Score = 93.6 bits (231),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 112/223 (50%), Gaps = 22/223 (10%)
 Frame = -3

Query  2157  SLDVDRNLNSSRR--ILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFV  1984
             +LD+  N++S+ +    + V  + W  G+  VH+R  + GL +  +E+W+P  +  +  +
Sbjct  473   ALDLRINMDSAAQDETRNIVAQYRWHHGSTFVHHRIIHGGLLSAVVESWYPLHNHTYGLL  532

Query  1983  VEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRT--  1810
             +EDD+E+SPL++ + K  I++Y Y  +  S  ++G SL + + V  +   +   ++R+  
Sbjct  533   LEDDVELSPLFYAWAKMAILHYRYGKTEDSSRLFGISLYQQKTVELRPEGRRPFNARSLF  592

Query  1809  ---------RVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMV----TTGW  1669
                        +L Q+  +WG + FP  W+EF+ +     S+    + D +V    +  W
Sbjct  593   AREGLPYPETPYLSQIPCSWGAVYFPEHWREFQDYLSVRLSELRLSIGDNVVPNLRSNKW  652

Query  1668  YKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
              K      W  +FI+  + RGY  +Y N     +LS +H + G
Sbjct  653   TKS-----WKKYFIELTYLRGYVMLYPNFSNFTSLSTNHLEVG  690



>ref|XP_009018463.1| hypothetical protein HELRODRAFT_173601 [Helobdella robusta]
 gb|ESO03315.1| hypothetical protein HELRODRAFT_173601 [Helobdella robusta]
Length=335

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/248 (26%), Positives = 109/248 (44%), Gaps = 40/248 (16%)
 Frame = -3

Query  2148  VDRNLNS--SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSS----------  2005
             +DRN  +  +  + + V  F W  G   VH +TS+ GL  QW++ W P            
Sbjct  61    IDRNAKNEINNDMYNAVSQFKWNKGVTRVHNQTSHVGLLGQWIDTWRPKVAPPFEKKNMS  120

Query  2004  ----------DDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRF  1855
                         E A ++EDD+ +SP  ++F+K +   Y     +  P   G SLQ    
Sbjct  121   QAMYQYHPQYSKEIALILEDDMMISPQAYKFIKAVHKKY-----SGRPDYAGVSLQSDEA  175

Query  1854  VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKS-KGMKPVLDGMVT  1678
                  G  ++      V ++  VGTWG    P+ W EF+ WY   ++ KG  P +D    
Sbjct  176   KALNSGKPLRAPINESVLMFVCVGTWGFSPSPQYWAEFQDWYHYARTVKGFWPYVDDTEP  235

Query  1677  TGWYK-----KMGERIWTPWFIKFIHARGYFNIYTNLLY------ERALSISHRDAGVNY  1531
               W++        + +W  WFI F   +  + +Y+NL Y      +  +S + R+ G+++
Sbjct  236   GKWFRGFVAQGTADNMWEMWFIYFATKKRIYTVYSNLRYVNGDKADSCVSYNRREIGLHF  295

Query  1530  GKSVGPDS  1507
               + GP++
Sbjct  296   -PTKGPEN  302



>gb|ELU16230.1| hypothetical protein CAPTEDRAFT_194714 [Capitella teleta]
Length=370

 Score = 90.5 bits (223),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/231 (28%), Positives = 104/231 (45%), Gaps = 31/231 (13%)
 Frame = -3

Query  2229  AAHYDHHAVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSN  2050
             A   D     L IFID +           +N +  +  +   D F W+ G K VH +   
Sbjct  91    ALELDGDVAILEIFIDRY-----------KNGSIHKATVQVADNFTWRKGLKRVHRQMKP  139

Query  2049  AGLQAQWLEAWWPSSD-DEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGAS  1873
              G+  QW+++W P  D DE A +VEDD+++SP  +R+L+   + +   +      I G +
Sbjct  140   VGIYGQWIDSWKPPKDSDELAIIVEDDVDLSPFAYRWLRQTHLRHGRKS-----FISGYT  194

Query  1872  LQ--RPRFVPGKHGNKM------KIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHK  1717
             LQ    R   GK+ N+        +  R   + +++ G+WG    P+ W+EF+ W+ T  
Sbjct  195   LQDLNIRIPHGKNINREVNRVNGAVLKRYPAYFFRVAGSWGFAPHPKRWREFQEWFHTDA  254

Query  1716  SKGMKP-VLDGMVTTGWYKKMGER-----IWTPWFIKFIHARGYFNIYTNL  1582
              K   P V    + T WYK    +     +WT WFI F        + +N+
Sbjct  255   EKLRHPYVPKARMNTNWYKDFERQHREDSMWTMWFIYFTDQHDLSTLVSNV  305



>ref|XP_007844178.1| glycosyltransferase 2 [Moniliophthora roreri MCA 2997]
 gb|ESK96416.1| glycosyltransferase 2 [Moniliophthora roreri MCA 2997]
Length=717

 Score = 92.0 bits (227),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 108/209 (52%), Gaps = 12/209 (6%)
 Frame = -3

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
             ++  R +  V +F W  G+  +H+R  + GL    +E+W+P ++D +  ++EDD+E+SPL
Sbjct  412   STDHRTMQTVKSFAWHHGSLFIHHRVIHGGLLPAVVESWYPHTNDSYGLLLEDDVELSPL  471

Query  1953  YFRFLKNLIVNYYYNASNFSPM-IYGASLQRPRFVP----GK---HGNKMKIDSRTRVF-  1801
             ++ ++K  ++ Y Y  ++   + I+G SL + + +     G+   + +++ ID+    F 
Sbjct  472   FYAWIKMSLLRYRYGNNHGQHLQIFGISLYQQKNIELHTDGRKPFNASQLFIDNGIPPFT  531

Query  1800  --LYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFI  1627
               L Q+  +WG + FP  W EF  +     S+   P+ D +V          + W  +FI
Sbjct  532   PYLSQIPCSWGAVYFPEHWAEFHDYLTMRFSEMAFPI-DQVVVPEVRSNRWSKSWKKYFI  590

Query  1626  KFIHARGYFNIYTNLLYERALSISHRDAG  1540
             + +  RGY  +Y N     +LS +H + G
Sbjct  591   ELVFLRGYVMLYPNFPEFVSLSTNHLEVG  619



>ref|XP_009309299.1| hypothetical protein DQ04_01681120 [Trypanosoma grayi]
 gb|KEG12482.1| hypothetical protein DQ04_01681120 [Trypanosoma grayi]
Length=374

 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 74/279 (27%), Positives = 120/279 (43%), Gaps = 24/279 (9%)
 Frame = -3

Query  2208  AVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQW  2029
             AV L +F+D+     N +L           IL  ++   W  G   +H R +N GL+   
Sbjct  93    AVDLEVFVDYRRNEDNETL------VKQDTILRMLNHVSWPHGRFTIHQRYTNVGLRYSI  146

Query  2028  LEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYY----NASNFSPMIYGASLQRP  1861
             +EAW P+S  E A   EDD+ VSP +F +L + +  Y      N +   P + G SL RP
Sbjct  147   MEAWQPTSSREVAAFFEDDVVVSPYWFSWLVDALQAYAPIGPDNKTKVDPRLVGFSLFRP  206

Query  1860  RFVPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGM-  1684
                       + +D+    FL Q   +WG +  P PW++FR ++D HK++ M+    G  
Sbjct  207   -VHDELSARDVHVDNSYAPFLLQQPCSWGAVYLPGPWQQFRKFFDEHKNQNMRVQRGGEK  265

Query  1683  ---VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKS---  1522
                 +  W        W  + I  ++  G + +Y N      LS S    G +   S   
Sbjct  266   RDPTSNSWDHLTS---WKKYLIYHMYHDGLYMMYPNFPXRLVLSTSRLLPGEHRRPSKRK  322

Query  1521  -VGP--DSNLVGENSIDINHLEFHPLHSMKWYDFCFKQV  1414
              + P    + +    ++ + L F  +  MK +D  F +V
Sbjct  323   FILPVVQKDDLANPEVNASLLGFPNMKDMKVFDILFDEV  361



>gb|ELU06378.1| hypothetical protein CAPTEDRAFT_216276 [Capitella teleta]
Length=373

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/229 (28%), Positives = 107/229 (47%), Gaps = 35/229 (15%)
 Frame = -3

Query  2217  DHHAVHLHIFIDHFPVPANASLDVDRNL-NSSRRILDFVDAFGWKFGAKVVHYRTSNAGL  2041
             D+H   L IFID          + D  L N + R+   V++F W  G + VH +  + G+
Sbjct  100   DNHTAALEIFIDR---------NKDGVLHNETVRV---VESFTWSLGQQRVHLQKEHVGI  147

Query  2040  QAQWLEAWWPS-SDDEFAFVVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQR  1864
               QW++ W PS   DE A ++EDD+++SP  +R+L+       +       ++ G  LQ 
Sbjct  148   YGQWIDTWRPSPQSDELAIILEDDVDLSPFAYRWLRR-----SHQVHGDKTLLSGYCLQD  202

Query  1863  P--RFVPGKHGNKMKIDSRTR-------VFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSK  1711
                R V GK  +K +++   R        +L+++ G+WG    P+ W +F+ W+ +    
Sbjct  203   SNVRIVQGKQIHK-EVNQVNRDLLKKYPAYLFRVAGSWGFAPHPKQWSKFQDWFHSDAKA  261

Query  1710  GMKP-VLDGMVTTGWYKKMGER-----IWTPWFIKFIHARGYFNIYTNL  1582
                P V    + + WYK    +     +WT WFI F   R    + +N+
Sbjct  262   LQHPYVARAQLNSNWYKTFERQHREDSMWTMWFIYFTDQRNLSALVSNV  310



>ref|XP_007304368.1| hypothetical protein STEHIDRAFT_168656 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM86727.1| hypothetical protein STEHIDRAFT_168656 [Stereum hirsutum FP-91666 
SS1]
Length=942

 Score = 91.3 bits (225),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 111/229 (48%), Gaps = 32/229 (14%)
 Frame = -3

Query  2133  NSSRRILDFVDAFGWKFGAKVV--HYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVS  1960
             ++    L  VD F W  GA+ V  H+R  + GL    +E+W+PSSDD +  ++EDD+E+S
Sbjct  596   SADEETLSMVDQFEWLGGAENVFAHHRVVHGGLLPAVVESWYPSSDDSYGLLLEDDVELS  655

Query  1959  PLYFRFLKNLIVNYYYN-ASNFSPMIYGASL-----------QRPRFVPGKHGNKMKIDS  1816
             PL++ + K  +++Y Y   S+ S  ++G SL            R  F P +      ++ 
Sbjct  656   PLFYAWAKMNVLHYRYGKPSDKSSSLFGISLFQQKSIELRPEGRTPFHPRQLFAHSGLEH  715

Query  1815  RTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMKP-----------VLDGMVTTGW  1669
                 +L Q+  +WG + FP  W+EF   Y + +  G+ P            LD + +  W
Sbjct  716   PNTPYLSQIPCSWGAIYFPSQWREFHA-YLSLRLSGLDPSSPHHLPSEDIALD-VRSNRW  773

Query  1668  YKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKS  1522
                  +  W  +FI+  + RGY  +Y N    ++LS +H + G +  K+
Sbjct  774   -----KHSWKKYFIELAYLRGYVMLYPNFADFKSLSTNHLEVGSHVKKT  817



>gb|EPB89374.1| hypothetical protein HMPREF1544_03743 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=982

 Score = 91.3 bits (225),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 104/208 (50%), Gaps = 18/208 (9%)
 Frame = -3

Query  2109  FVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNL  1930
              V++F W+ G K++ +R    GL    +E+W+PS++DE+A ++EDD+EVSPL++ + K  
Sbjct  563   LVNSFLWRQGQKMIRHRIRKGGLMPAIVESWYPSNNDEYAVLLEDDIEVSPLFYVWSKYA  622

Query  1929  IVNYYYNA-SNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRV----------FLYQLVG  1783
             I+ Y Y+  S    ++YG SL  PR +      ++  D  + +          +  Q+  
Sbjct  623   ILKYRYSGNSEAYRLMYGISLYAPRNLELPPAGRVTFDPNSVLLPAGYPEHIPYASQVPC  682

Query  1782  TWGQLLFPRPWKEF-----RLWYDTHKSKGMKPVLDGMVTTGWYKKMGERIWTPWFIKFI  1618
             +WG + FP  W+EF     R   D +  K  +  L  +   G      ++ W  +FI+ +
Sbjct  683   SWGGVYFPEHWREFHTYLVRRLEDLNLPKDHQQRL--ISVPGSRSDKWKKSWKKYFIELV  740

Query  1617  HARGYFNIYTNLLYERALSISHRDAGVN  1534
             + R Y  +Y N     A S +H + G +
Sbjct  741   YLRTYLMLYPNFQEFEAFSTNHVEFGTH  768



>ref|XP_002910881.1| glycosyltransferase 2 [Coprinopsis cinerea okayama7#130]
 gb|EFI27387.1| glycosyltransferase 2 [Coprinopsis cinerea okayama7#130]
Length=815

 Score = 90.5 bits (223),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/246 (26%), Positives = 115/246 (47%), Gaps = 48/246 (20%)
 Frame = -3

Query  2154  LDVDRNLNSSRRILDFVDAF--GWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVV  1981
             L+++++ +S  + ++   +F   W  G   VH RT +AGL    +E+W+PSS D +  ++
Sbjct  478   LNLEQDCDS--KTVELAHSFHRNWTQGPLFVHRRTIHAGLLPAVVESWYPSSLDNYGLLL  535

Query  1980  EDDLEVSPLYFRFLKNLIVNY------------------YYNASNFSPMIYGASLQRPRF  1855
             EDD+EVSPL++ + K +I+ Y                  Y   ++ SP ++G SL + + 
Sbjct  536   EDDVEVSPLFYAWAKQVILKYRLATFPSFHPPLTSSSFRYGEEADRSPSLFGVSLYQQKH  595

Query  1854  VPGKHGNKMKIDSR---------------TRVFLYQLVGTWGQLLFPRPWKEFRLWYDTH  1720
             +  + G ++  ++R               T  +L Q+  +WG + FP  W EF  +    
Sbjct  596   IELRKGGRVPFNARSLFSSPELKQHVQDPTTPYLSQVPCSWGAIYFPDHWSEFHSYLALR  655

Query  1719  KSKGMKP------VLDGMVTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSI  1558
              S+   P      V+  + +  W K      W  +FI+  + +GY  +Y N     +LS 
Sbjct  656   FSETWIPIDSTTTVVPNVRSNHWSKS-----WKKFFIEMTYLKGYVMLYPNFEEFESLST  710

Query  1557  SHRDAG  1540
             +H + G
Sbjct  711   NHLELG  716



>ref|XP_005777351.1| hypothetical protein EMIHUDRAFT_443743 [Emiliania huxleyi CCMP1516]
 gb|EOD24922.1| hypothetical protein EMIHUDRAFT_443743 [Emiliania huxleyi CCMP1516]
Length=1112

 Score = 90.5 bits (223),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 105/228 (46%), Gaps = 31/228 (14%)
 Frame = -3

Query  2160  ASLDVDRNLNSSRRI--LDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAF  1987
             A +D+  NL +S     + F   F W  G K V  R    GL     E+W+PSS ++F  
Sbjct  125   ARVDIVFNLEASSTTGTIAFARGFEWPHGFKHVRKRARQGGLILAVSESWYPSSTEDFGC  184

Query  1986  VVEDDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFV----PGKHGNK----  1831
             ++EDD+EVSP YFRF+  +++          P + G SL  PR      P +  N     
Sbjct  185   LLEDDIEVSPHYFRFVSEMMLALQREP---DPRVVGISLYSPRRTETTNPPEPFNSTALM  241

Query  1830  ---MKIDSRTRVFLYQLVGTWGQLLFPRPWKEF----RLWYDTHKSKGMKPVLDGMV---  1681
                M  + +   +L Q   +WG + FP  W++F    RL +D     G+K   D ++   
Sbjct  242   IEVMGAEHKESPYLLQTPCSWGAVYFPNHWEQFVDYLRLRFDL--KPGVKSPHDVLIPSS  299

Query  1680  -TTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAG  1540
              T GW        W  +  + ++ RG + +Y N   +R+LS +H + G
Sbjct  300   RTNGWKGS-----WKKFHFELLYLRGQYLVYPNYEGQRSLSTNHMEKG  342



>gb|EIE88405.1| hypothetical protein RO3G_13116 [Rhizopus delemar RA 99-880]
Length=598

 Score = 89.0 bits (219),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 112/221 (51%), Gaps = 20/221 (9%)
 Frame = -3

Query  2148  VDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDL  1969
             ++++ + + R+L  V++F WK G K + +R    GL    +E+W+PS +DE+A ++EDD+
Sbjct  170   MEQSADRATRML--VNSFVWKQGVKFLRHRVKKGGLMPAIVESWYPSHNDEYAVLLEDDI  227

Query  1968  EVSPLYFRFLKNLIVNYYYNASNFS-PMIYGASLQRPRFVPGKHGNKMKIDSRTRV----  1804
             EVSPL++ + K  I+ Y Y+ +  +  ++YG SL  PR +      ++  D  + +    
Sbjct  228   EVSPLFYVWSKYSILKYRYSGNKDAYRLMYGISLYAPRNLELVPSGRVSFDPNSVLLPAH  287

Query  1803  ------FLYQLVGTWGQLLFPRPWKEF-----RLWYDTHKSKGMKPVLDGMVTTGWYKKM  1657
                   +  Q+  +WG + FP  W+EF     R   D +  K  +  +  +   G     
Sbjct  288   YAPQTPYASQIPCSWGAVYFPEHWREFHAYLIRRLQDLNLPKHSE--VRVISVPGSRSDK  345

Query  1656  GERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVN  1534
              ++ W  +FI+ ++ R Y  +Y N     A S +H + G +
Sbjct  346   WKKSWKKYFIELVYLRAYVMLYPNFYDFEAFSTNHVEFGTH  386



>ref|XP_009022937.1| hypothetical protein HELRODRAFT_162503 [Helobdella robusta]
 gb|ESN99024.1| hypothetical protein HELRODRAFT_162503 [Helobdella robusta]
Length=426

 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 92/197 (47%), Gaps = 15/197 (8%)
 Frame = -3

Query  2154  LDVDRNLNS-SRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVE  1978
             +D D   N+   + L    +F        VH +  +AGL  QWL  + P  DDE    VE
Sbjct  137   IDRDEKKNTVDNKTLQVSKSFASSNNYTSVHVQEKHAGLYKQWLLTYKPKRDDEIVLFVE  196

Query  1977  DDLEVSPLYFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKIDSRTRVFL  1798
             DD E+S   +R+LK +   Y     +F     G +L   R +   H  K+K+     VF+
Sbjct  197   DDQELSKYGYRWLKAVHAKY-----SFYEDYLGCTL---RLLSPVHPMKIKLAGNESVFM  248

Query  1797  YQLVGTWGQLLFPRPWKEFRLWYDTH-KSKGMKPVLDGMVTTGWYKKMGER-----IWTP  1636
             +++  T      P  W++F+ W+ +H K  G KP + G+  T WYK   ++     +W+ 
Sbjct  249   HRVFSTHAFSPKPAKWRQFQNWFASHWKRNGFKPYVPGIRPTSWYKSFEKKNTTHHMWSM  308

Query  1635  WFIKFIHARGYFNIYTN  1585
             W + F +    F +Y+N
Sbjct  309   WMLYFSYVEQLFTVYSN  325



>gb|ESL11871.1| hypothetical protein TRSC58_00370 [Trypanosoma rangeli SC58]
Length=408

 Score = 87.8 bits (216),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 127/284 (45%), Gaps = 36/284 (13%)
 Frame = -3

Query  2208  AVHLHIFIDHFPVPANASLDVDRNLNSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQW  2029
             +V L +F+D+     N +  + +N ++   IL  +  F W  G   +H R  N GL+   
Sbjct  127   SVDLEVFVDY---RRNDTPQMQQNQSA---ILQLLRNFIWVHGRYKIHQRLVNVGLRLSI  180

Query  2028  LEAWWPSSDDEFAFVVEDDLEVSPLYFRFLKNLIVNY----YYNASNFSPMIYGASLQRP  1861
             +EAW P+S+ E A   EDD+ VSP +F +  + +  Y     +N     P + G +L RP
Sbjct  181   MEAWQPTSEIEVAVFFEDDVVVSPYWFSWAHDTLGQYAPVGAHNVIEADPRLVGLALFRP  240

Query  1860  RF--VPGKHGNKMKIDSRTRVFLYQLVGTWGQLLFPRPWKEFRLWYDTHKSKGMK-PVLD  1690
              F  +  KH   + +++    FL Q   +WG +  P PW+ FR +++  K K +K   L+
Sbjct  241   IFDELSKKH---VHVNNNYAPFLLQQPCSWGAVYLPGPWRRFRDFFEKEKEKDLKVRRLE  297

Query  1689  GM---VTTGWYKKMGERIWTPWFIKFIHARGYFNIYTNLLYERALSISHRDAGVNYGKSV  1519
             G     +  W  K     W  + I  ++  G + +Y NL  +  LS S     +  G+  
Sbjct  298   GARNPTSNYWNYKSS---WKKYLIYHMYRNGLYMMYPNLPEKLVLSTSL----LLPGEHP  350

Query  1518  GPDSNLVGENSIDINHL----------EFHPLHSMKWYDFCFKQ  1417
              P   L   N +   HL          +F  +  MK YD  F +
Sbjct  351   TPPKRLFVLNVVRKEHLQNELVERSLRQFTNMKDMKVYDVMFDE  394



>gb|EJK49616.1| hypothetical protein THAOC_31488 [Thalassiosira oceanica]
Length=591

 Score = 89.0 bits (219),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/246 (26%), Positives = 104/246 (42%), Gaps = 21/246 (9%)
 Frame = -3

Query  2307  KSFTFIIKLLAYnrlsslsrclnsLAAAHYDHH--AVHLHIFIDHFPVPANASLDVDRNL  2134
             K FT +I  +                   Y HH  AV++ I +D            D   
Sbjct  52    KVFTIVILTMNRLNSLQRLVGSLMNEGCQYGHHDEAVNIEIHVDR---------PKDGGT  102

Query  2133  NSSRRILDFVDAFGWKFGAKVVHYRTSNAGLQAQWLEAWWPSSDDEFAFVVEDDLEVSPL  1954
              +    + +     W +G   V     N GL+  W  AW P  D+E A ++EDD+EVS L
Sbjct  103   TAWLETISWASNLSWPYGEVDVVAAKENQGLRDSWFNAWRPEGDNERAIILEDDVEVSKL  162

Query  1953  YFRFLKNLIVNYYYNASNFSPMIYGASLQRPRFVPGKHGNKMKID---SRTRVFLYQLVG  1783
             ++ +     VN  Y++   +  + G SLQR   +P   G   K     +    FLY L+G
Sbjct  163   WYSW-----VNGAYDSYGQNSDVAGFSLQRQNVIPLTDGRIRKGGISANDNEAFLYSLLG  217

Query  1782  TWGQLLFPRPWKEFRLWYDTHKSKGMKPVLDGMVTTGWYKKMGER--IWTPWFIKFIHAR  1609
             + G     R W+EF  W D      +   +DG++T+ W++K   +  +W    + +++ +
Sbjct  218   SIGFAPTARIWREFLEWTDCALEHDVDVYVDGLITSRWWRKPKNKRSMWEQHLVYYMYHQ  277

Query  1608  GYFNIY  1591
               F +Y
Sbjct  278   NMFCLY  283



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7423706613760