BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82180_g1_i1 len=1413 path=[1391:0-1412]

Length=1413
                                                                      Score     E

ref|XP_006363187.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    662   0.0      
ref|XP_004232642.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    658   0.0      
ref|XP_009628301.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    654   0.0      
ref|XP_009789683.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    641   0.0      
ref|XP_006448611.1|  hypothetical protein CICLE_v10018337mg             561   0.0      
ref|XP_008225915.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    556   0.0      
ref|XP_006468565.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    552   0.0      
ref|XP_007211849.1|  hypothetical protein PRUPE_ppa004725mg             549   0.0      
ref|XP_006468464.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    545   0.0      
ref|XP_006448715.1|  hypothetical protein CICLE_v10014993mg             536   0.0      
ref|XP_007041010.1|  UDP-glucosyltransferase, putative                  527   2e-180   
ref|XP_010098468.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 6    523   4e-179   
ref|XP_004295514.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    519   1e-177   
gb|KEH37752.1|  UDP-glucose flavonoid 3-O-glucosyltransferase           518   3e-177   
ref|XP_002528155.1|  UDP-glucosyltransferase, putative                  517   6e-177   Ricinus communis
gb|KEH37502.1|  UDP-glucosyltransferase family protein                  516   1e-176   
gb|ADV71363.1|  glycosyltransferase GT03H24                             516   2e-176   
ref|XP_007138551.1|  hypothetical protein PHAVU_009G218800g             514   1e-175   
ref|XP_009363261.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    513   4e-175   
ref|XP_003533826.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    511   2e-174   
ref|XP_004488213.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    509   1e-173   
gb|KDO77391.1|  hypothetical protein CISIN_1g047945mg                   507   6e-173   
gb|KEH37757.1|  UDP-glucose flavonoid 3-O-glucosyltransferase           496   5e-169   
ref|XP_007041009.1|  UDP-glucosyltransferase, putative                  496   1e-168   
ref|XP_004488204.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    494   8e-168   
ref|XP_010098469.1|  Putative UDP-glucose flavonoid 3-O-glucosylt...    488   1e-165   
gb|KCW75564.1|  hypothetical protein EUGRSUZ_E04315                     488   3e-165   
ref|XP_010058058.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    488   3e-165   
gb|AGU14122.1|  UDP-glycosyltransferase                                 485   1e-164   
gb|AGU14121.1|  UDP-glycosyltransferase                                 479   3e-162   
gb|KGN64458.1|  hypothetical protein Csa_1G056940                       475   2e-160   
gb|KDO77236.1|  hypothetical protein CISIN_1g039408mg                   474   3e-160   
ref|XP_010058060.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    474   7e-160   
ref|XP_010260710.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    472   3e-159   
ref|XP_008440340.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    471   7e-159   
ref|XP_010260884.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    459   6e-154   
ref|XP_004161972.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    453   5e-152   
ref|XP_004145207.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    452   4e-151   
ref|XP_010260883.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    448   7e-150   
ref|XP_002279427.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    430   7e-143   Vitis vinifera
ref|XP_007217386.1|  hypothetical protein PRUPE_ppa025943mg             429   2e-142   
ref|XP_008229635.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    428   3e-142   
gb|KCW75565.1|  hypothetical protein EUGRSUZ_E04316                     424   2e-141   
emb|CDP04202.1|  unnamed protein product                                422   1e-139   
ref|XP_002279387.2|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    420   1e-138   Vitis vinifera
ref|XP_008220630.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    419   1e-138   
ref|XP_008220642.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    418   5e-138   
ref|XP_008229636.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    417   1e-137   
ref|XP_010104648.1|  UDP-glycosyltransferase 71C3                       415   4e-137   
emb|CDP06220.1|  unnamed protein product                                414   8e-137   
ref|XP_008229632.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    413   4e-136   
ref|XP_002520576.1|  UDP-glucosyltransferase, putative                  412   5e-136   Ricinus communis
ref|XP_002323168.1|  hypothetical protein POPTR_0016s01740g             411   1e-135   Populus trichocarpa [western balsam poplar]
ref|XP_002264329.2|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    411   3e-135   Vitis vinifera
ref|XP_002264213.2|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    410   3e-135   Vitis vinifera
ref|XP_002279475.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    410   3e-135   Vitis vinifera
ref|XP_011001023.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    410   3e-135   
ref|XP_008229727.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    410   5e-135   
emb|CAN76057.1|  hypothetical protein VITISV_032000                     410   5e-135   Vitis vinifera
ref|XP_004309300.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    409   1e-134   
ref|XP_010260709.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    409   1e-134   
ref|XP_002265388.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    409   2e-134   Vitis vinifera
ref|XP_007217855.1|  hypothetical protein PRUPE_ppa024083mg             407   4e-134   
ref|XP_004490589.1|  PREDICTED: UDP-glycosyltransferase 71D1-like       406   1e-133   
emb|CAN67919.1|  hypothetical protein VITISV_030046                     406   1e-133   Vitis vinifera
gb|KDP42778.1|  hypothetical protein JCGZ_00477                         405   2e-133   
ref|XP_002279444.3|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    407   2e-133   Vitis vinifera
ref|XP_002314111.2|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    405   2e-133   Populus trichocarpa [western balsam poplar]
emb|CAN72668.1|  hypothetical protein VITISV_022183                     406   2e-133   Vitis vinifera
emb|CAN79975.1|  hypothetical protein VITISV_033140                     404   4e-133   Vitis vinifera
ref|XP_006373634.1|  hypothetical protein POPTR_0016s01750g             404   5e-133   
ref|XP_002263661.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    405   5e-133   Vitis vinifera
ref|XP_010657837.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    405   6e-133   
ref|XP_007207423.1|  hypothetical protein PRUPE_ppa004906mg             405   7e-133   
ref|XP_008229638.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    404   8e-133   
emb|CDP19014.1|  unnamed protein product                                404   1e-132   
ref|XP_007215289.1|  hypothetical protein PRUPE_ppa004957mg             404   1e-132   
ref|XP_002264548.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    403   2e-132   Vitis vinifera
dbj|BAB60721.1|  glucosyltransferase                                    403   2e-132   Nicotiana tabacum [American tobacco]
emb|CDP09590.1|  unnamed protein product                                403   2e-132   
ref|XP_002264883.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    403   3e-132   Vitis vinifera
sp|Q66PF3.1|UFOG3_FRAAN  RecName: Full=Putative UDP-glucose flavo...    403   3e-132   Fragaria x ananassa
gb|ACZ44837.1|  glycosyltransferase                                     403   4e-132   Pyrus communis
ref|XP_003633360.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    403   4e-132   
ref|XP_009609116.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    403   4e-132   
ref|XP_007016124.1|  Glycosyltransferase, putative                      402   6e-132   
ref|XP_002265306.2|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    402   6e-132   Vitis vinifera
ref|XP_002265387.2|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    402   7e-132   Vitis vinifera
ref|XP_002265585.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    402   7e-132   Vitis vinifera
ref|XP_010036083.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    402   8e-132   
ref|XP_009790789.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    402   1e-131   
ref|XP_009350669.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    402   1e-131   
ref|XP_009371510.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    401   2e-131   
ref|XP_004303955.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    401   2e-131   
gb|KDO64387.1|  hypothetical protein CISIN_1g011311mg                   401   2e-131   
ref|XP_010657554.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    400   2e-131   
ref|XP_008229637.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    402   2e-131   
ref|XP_007216098.1|  hypothetical protein PRUPE_ppa018557mg             400   2e-131   
ref|XP_011001024.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    400   4e-131   
dbj|BAB60720.1|  glucosyltransferase                                    400   4e-131   Nicotiana tabacum [American tobacco]
ref|XP_011032131.1|  PREDICTED: UDP-glycosyltransferase 71D1-like       399   1e-130   
ref|XP_008365188.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    399   1e-130   
emb|CDP09593.1|  unnamed protein product                                399   1e-130   
ref|XP_004303953.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    398   2e-130   
ref|XP_006481382.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    398   3e-130   
ref|XP_002265234.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    397   3e-130   Vitis vinifera
ref|XP_004294260.1|  PREDICTED: UDP-glycosyltransferase 71C3-like       398   3e-130   
ref|XP_002322547.2|  hypothetical protein POPTR_0016s01880g             397   4e-130   Populus trichocarpa [western balsam poplar]
ref|XP_010648210.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    397   7e-130   
ref|XP_009774030.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    397   9e-130   
ref|XP_002264998.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    396   1e-129   Vitis vinifera
ref|XP_008229641.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    396   1e-129   
ref|XP_007215298.1|  hypothetical protein PRUPE_ppa005052mg             396   1e-129   
emb|CAN64610.1|  hypothetical protein VITISV_019066                     396   1e-129   Vitis vinifera
gb|AAZ80472.1|  glycosyltransferase                                     396   1e-129   Malus domestica [apple tree]
ref|XP_008229639.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    395   2e-129   
ref|XP_002265264.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    396   2e-129   Vitis vinifera
ref|XP_009794931.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    396   2e-129   
ref|XP_002264463.3|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    396   2e-129   Vitis vinifera
ref|XP_007215334.1|  hypothetical protein PRUPE_ppa005290mg             395   2e-129   
ref|XP_009347572.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    395   2e-129   
gb|ACZ44836.1|  glycosyltransferase                                     395   2e-129   Pyrus communis
emb|CDP21709.1|  unnamed protein product                                395   2e-129   
ref|XP_009371509.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    395   3e-129   
ref|XP_004303956.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    395   5e-129   
ref|XP_010044998.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    395   5e-129   
emb|CDP09591.1|  unnamed protein product                                394   6e-129   
ref|XP_010093120.1|  Putative UDP-glucose flavonoid 3-O-glucosylt...    394   8e-129   
ref|XP_010045027.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    394   8e-129   
dbj|BAG71126.1|  glucosyltransferase                                    395   8e-129   Phytolacca americana [common pokeberry]
gb|KCW88560.1|  hypothetical protein EUGRSUZ_A00938                     394   8e-129   
sp|Q2V6K0.1|UFOG6_FRAAN  RecName: Full=UDP-glucose flavonoid 3-O-...    394   1e-128   Fragaria x ananassa
ref|XP_008384817.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    394   1e-128   
ref|XP_006429782.1|  hypothetical protein CICLE_v10011544mg             394   2e-128   
gb|KDP27744.1|  hypothetical protein JCGZ_19773                         394   2e-128   
ref|XP_004303954.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    393   2e-128   
ref|XP_008378326.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    393   3e-128   
ref|XP_002520574.1|  UDP-glucosyltransferase, putative                  392   3e-128   Ricinus communis
ref|XP_004304513.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    393   3e-128   
ref|XP_002273538.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    392   3e-128   Vitis vinifera
ref|XP_009371513.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    393   3e-128   
ref|XP_006373643.1|  hypothetical protein POPTR_0016s01870g             392   4e-128   
ref|XP_007215333.1|  hypothetical protein PRUPE_ppa005277mg             392   5e-128   
ref|XP_002265389.2|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    392   6e-128   Vitis vinifera
ref|XP_002266044.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    392   6e-128   Vitis vinifera
ref|XP_008365187.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    392   6e-128   
gb|KCW88565.1|  hypothetical protein EUGRSUZ_A00945                     392   6e-128   
ref|XP_010657838.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    392   6e-128   
ref|XP_004304514.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    392   6e-128   
ref|XP_006429785.1|  hypothetical protein CICLE_v10013653mg             392   7e-128   
ref|XP_007016125.1|  Glycosyltransferase, putative                      392   7e-128   
ref|XP_006481379.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    392   8e-128   
gb|KDO64385.1|  hypothetical protein CISIN_1g045029mg                   392   9e-128   
ref|XP_008393866.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    391   1e-127   
ref|XP_009371511.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    391   1e-127   
ref|XP_010045071.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    391   1e-127   
ref|XP_009350668.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    391   1e-127   
emb|CDP19044.1|  unnamed protein product                                390   2e-127   
dbj|BAI65912.1|  UDP-sugar:glycosyltransferase                          390   3e-127   Forsythia x intermedia [cultivated forsythia]
ref|XP_011001031.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    390   3e-127   
ref|XP_011008629.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    390   3e-127   
ref|XP_010045032.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    390   3e-127   
ref|XP_002265548.2|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    390   3e-127   Vitis vinifera
ref|XP_006373642.1|  hypothetical protein POPTR_0016s01860g             389   7e-127   
ref|XP_002308778.1|  hypothetical protein POPTR_0006s01160g             389   7e-127   Populus trichocarpa [western balsam poplar]
ref|XP_009782109.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    389   8e-127   
ref|XP_009350667.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    389   1e-126   
gb|AFD61601.1|  anthocyanidin 3-O-glucosyltransferase                   388   1e-126   
emb|CBI19996.3|  unnamed protein product                                390   1e-126   
ref|XP_008229642.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    388   2e-126   
ref|XP_008229643.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    388   2e-126   
ref|XP_004243652.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    388   2e-126   
emb|CAN65223.1|  hypothetical protein VITISV_011151                     387   3e-126   Vitis vinifera
ref|XP_010045082.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    387   5e-126   
ref|XP_010045093.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    387   6e-126   
ref|XP_011001028.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    387   7e-126   
ref|XP_009613935.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    386   1e-125   
dbj|BAB88934.1|  glucosyltransferase                                    386   1e-125   Nicotiana tabacum [American tobacco]
dbj|BAI65911.1|  UDP-sugar:glycosyltransferase                          385   2e-125   Forsythia x intermedia [cultivated forsythia]
ref|XP_010045044.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    385   2e-125   
ref|XP_009587669.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    385   2e-125   
ref|XP_007216849.1|  hypothetical protein PRUPE_ppa021727mg             384   3e-125   
ref|XP_006373644.1|  hypothetical protein POPTR_0016s01890g             385   3e-125   
ref|XP_004248013.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    384   4e-125   
ref|XP_010657555.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    383   5e-125   
ref|XP_007202984.1|  hypothetical protein PRUPE_ppa018805mg             384   7e-125   
ref|XP_011001030.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    384   7e-125   
ref|XP_011001032.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    384   8e-125   
ref|XP_008362332.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    384   1e-124   
ref|XP_008378329.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    384   1e-124   
gb|ABL85473.1|  gylcosyltransferase UGT71A13                            384   1e-124   Maclura pomifera
ref|XP_002265067.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    383   1e-124   Vitis vinifera
ref|XP_007049129.1|  UDP-glucosyl transferase 71B6, putative            384   2e-124   
ref|XP_011001004.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    383   2e-124   
ref|XP_008342308.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    382   3e-124   
ref|XP_010645106.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    382   3e-124   
ref|XP_010657882.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    380   4e-124   
gb|KCW88568.1|  hypothetical protein EUGRSUZ_A00948                     382   5e-124   
ref|XP_006374910.1|  hypothetical protein POPTR_0014s02620g             382   5e-124   
gb|KCW88556.1|  hypothetical protein EUGRSUZ_A00934                     381   7e-124   
ref|XP_004490590.1|  PREDICTED: UDP-glycosyltransferase 71D1-like       382   8e-124   
gb|AGU14088.1|  UDP-glycosyltransferase                                 381   1e-123   
ref|XP_010104646.1|  UDP-glycosyltransferase 71C5                       381   1e-123   
emb|CDP05660.1|  unnamed protein product                                381   1e-123   
gb|KDO51068.1|  hypothetical protein CISIN_1g045570mg                   380   2e-123   
ref|XP_010044978.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    380   2e-123   
ref|XP_010048136.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    380   2e-123   
ref|XP_009371512.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    380   2e-123   
emb|CDP18046.1|  unnamed protein product                                380   3e-123   
ref|XP_002322535.1|  hypothetical protein POPTR_0016s01620g             380   3e-123   Populus trichocarpa [western balsam poplar]
dbj|BAF96585.1|  glucosyltransferase homolog                            379   3e-123   Lycium chinense [Chinese boxthorn]
dbj|BAK55748.1|  UDP-glucose glucosyltransferase                        380   3e-123   
emb|CDP16611.1|  unnamed protein product                                380   3e-123   
ref|XP_007016126.1|  Glycosyltransferase, putative                      379   4e-123   
ref|XP_008393867.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    380   5e-123   
emb|CDP11256.1|  unnamed protein product                                379   5e-123   
ref|XP_009365674.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    379   7e-123   
ref|XP_009799026.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucose ...    379   7e-123   
ref|XP_008384820.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    379   7e-123   
ref|XP_004304512.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    379   8e-123   
ref|XP_010104647.1|  UDP-glycosyltransferase 71C3                       379   8e-123   
ref|XP_007142218.1|  hypothetical protein PHAVU_008G262100g             379   9e-123   
ref|XP_003519247.1|  PREDICTED: UDP-glycosyltransferase 71C3-like       378   1e-122   
ref|XP_010033014.1|  PREDICTED: UDP-glycosyltransferase 71D2-like       378   1e-122   
dbj|BAD29721.1|  UDP-glucose glucosyltransferase                        378   1e-122   Catharanthus roseus [chatas]
emb|CDP11878.1|  unnamed protein product                                378   1e-122   
dbj|BAI65915.1|  UDP-sugar:glycosyltransferase                          378   1e-122   Anthriscus sylvestris
ref|XP_006428807.1|  hypothetical protein CICLE_v10011659mg             377   2e-122   
ref|NP_001280899.1|  anthocyanidin 3-O-glucosyltransferase 2-like       378   2e-122   
ref|XP_011002388.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    379   2e-122   
gb|ACU21214.1|  unknown                                                 377   2e-122   Glycine max [soybeans]
ref|NP_001240903.1|  UDP-glycosyltransferase 71D1-like                  377   2e-122   
ref|XP_009347883.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    377   3e-122   
ref|XP_010044907.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    377   3e-122   
dbj|BAF75895.1|  tetrahydroxychalcone 2'-glucosyltransferase            377   4e-122   Cyclamen persicum
gb|KDP38835.1|  hypothetical protein JCGZ_04992                         376   5e-122   
ref|XP_010648215.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    377   7e-122   
ref|XP_006353731.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    376   7e-122   
ref|XP_006373628.1|  hypothetical protein POPTR_0016s01600g             376   8e-122   
emb|CDP16155.1|  unnamed protein product                                376   9e-122   
ref|XP_008384818.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    376   1e-121   
ref|XP_009788068.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    375   1e-121   
ref|XP_009804833.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    375   2e-121   
ref|XP_006353732.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    375   2e-121   
ref|XP_006429783.1|  hypothetical protein CICLE_v10011522mg             376   2e-121   
ref|XP_011001000.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    375   3e-121   
emb|CDP19043.1|  unnamed protein product                                375   4e-121   
ref|XP_009609115.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    374   4e-121   
ref|XP_006358963.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    374   5e-121   
emb|CAN67922.1|  hypothetical protein VITISV_030049                     374   5e-121   Vitis vinifera
ref|XP_006373629.1|  hypothetical protein POPTR_0016s01610g             374   8e-121   
gb|AFJ52911.1|  UDP-glycosyltransferase 1                               374   8e-121   
ref|XP_010093123.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 6    374   8e-121   
ref|XP_011014965.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    374   8e-121   
ref|XP_006481380.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    374   8e-121   
gb|AHX74090.1|  glucosyltransferase                                     374   9e-121   
ref|XP_009604186.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    373   9e-121   
dbj|BAF75901.1|  tetrahydroxychalcone 2'-glucosyltransferase            373   1e-120   Catharanthus roseus [chatas]
ref|XP_003615613.1|  Anthocyanidin 3-O-glucosyltransferase              373   1e-120   
ref|XP_008464636.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    374   1e-120   
ref|XP_006373641.1|  hypothetical protein POPTR_0016s01850g             374   1e-120   
gb|KHN40061.1|  UDP-glycosyltransferase 71C4                            372   2e-120   
pdb|2ACV|A  Chain A, Crystal Structure Of Medicago Truncatula Ugt...    372   2e-120   
ref|XP_003544878.1|  PREDICTED: UDP-glycosyltransferase 71C3-like       372   2e-120   
ref|XP_010045017.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    373   2e-120   
ref|XP_007142217.1|  hypothetical protein PHAVU_008G262000g             372   3e-120   
ref|XP_006353726.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    372   4e-120   
ref|XP_002308768.2|  hypothetical protein POPTR_0006s00880g             372   4e-120   Populus trichocarpa [western balsam poplar]
gb|KGN54996.1|  hypothetical protein Csa_4G620600                       372   5e-120   
ref|XP_008347721.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    372   7e-120   
emb|CAN66344.1|  hypothetical protein VITISV_005101                     371   7e-120   Vitis vinifera
ref|XP_008361032.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    371   8e-120   
ref|XP_006373627.1|  hypothetical protein POPTR_0016s01590g             371   8e-120   
ref|XP_006353727.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    370   1e-119   
gb|AEM43004.1|  UDP-glucosyltransferase                                 371   1e-119   
ref|XP_003615609.1|  Anthocyanidin 3-O-glucosyltransferase              370   1e-119   
ref|XP_010044884.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    370   3e-119   
ref|XP_010044985.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    370   3e-119   
ref|XP_004251871.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    370   3e-119   
ref|XP_003617350.1|  UDP-glucose glucosyltransferase                    369   3e-119   
ref|XP_009790790.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    370   3e-119   
ref|XP_002323160.2|  hypothetical protein POPTR_0016s01570g             369   3e-119   
emb|CDP20778.1|  unnamed protein product                                369   4e-119   
ref|XP_008384822.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    370   5e-119   
ref|XP_007049054.1|  UDP-Glycosyltransferase superfamily protein,...    369   5e-119   
ref|XP_003518582.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    369   5e-119   
gb|AFJ52910.1|  UDP-glycosyltransferase 1                               369   6e-119   
gb|AAR06914.1|  UDP-glycosyltransferase 71E1                            369   7e-119   
dbj|BAF96581.1|  lignan glucosyltransferase                             369   8e-119   
dbj|BAI65914.1|  UDP-sugar:glycosyltransferase                          369   9e-119   
dbj|BAF96582.1|  lignan glucosyltransferase                             368   1e-118   
ref|XP_008464641.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    368   2e-118   
ref|XP_011100459.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    367   2e-118   
ref|XP_011002387.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    367   3e-118   
gb|AET00316.2|  UDP-glucose flavonoid 3-O-glucosyltransferase           367   3e-118   
ref|XP_010044918.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    367   3e-118   
ref|XP_003617357.1|  Glucosyltransferase                                367   3e-118   
ref|XP_009610764.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    367   3e-118   
ref|XP_004146065.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    367   4e-118   
ref|XP_011100453.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    367   4e-118   
gb|KDP38845.1|  hypothetical protein JCGZ_05002                         366   5e-118   
ref|XP_010680970.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    367   6e-118   
ref|XP_011001001.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    366   8e-118   
ref|XP_006380870.1|  hypothetical protein POPTR_0006s00920g             366   9e-118   
gb|KDP38846.1|  hypothetical protein JCGZ_05003                         364   1e-117   
dbj|BAF96583.1|  lignan glucosyltransferase                             365   1e-117   
ref|XP_010044970.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    365   1e-117   
ref|XP_011085653.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    366   1e-117   
gb|AAL57240.1|AF374004_1  betanidin 6-O-glucosyltransferase             365   2e-117   
ref|XP_010044937.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    365   2e-117   
ref|XP_008464633.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    365   3e-117   
ref|XP_004146063.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    365   4e-117   
ref|XP_004243656.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    364   4e-117   
gb|AFJ52909.1|  UDP-glycosyltransferase 1                               364   4e-117   
gb|AEI70831.1|  UDP-glucose glucosyltransferase                         364   4e-117   
dbj|BAF75900.1|  glucosyltransferase                                    363   7e-117   
ref|XP_010323953.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    363   7e-117   
gb|KFK23128.1|  hypothetical protein AALP_AAs61551U000200               363   1e-116   
ref|XP_004491632.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    362   1e-116   
ref|XP_011100448.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    362   2e-116   
ref|XP_006358838.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    360   3e-116   
ref|XP_006353724.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    362   3e-116   
ref|XP_010044959.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    362   3e-116   
ref|XP_006380871.1|  hypothetical protein POPTR_0006s00940g             362   4e-116   
ref|XP_010044896.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    361   4e-116   
ref|XP_002322542.2|  hypothetical protein POPTR_0016s01770g             362   5e-116   
ref|XP_011002391.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    361   6e-116   
emb|CDP00732.1|  unnamed protein product                                361   6e-116   
ref|XP_011002392.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    361   8e-116   
emb|CDP11881.1|  unnamed protein product                                360   8e-116   
emb|CAN74961.1|  hypothetical protein VITISV_014252                     359   1e-115   
dbj|BAK55746.1|  UDP-glucose glucosyltransferase                        360   1e-115   
ref|XP_011100452.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    360   2e-115   
ref|XP_008380321.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    358   2e-115   
gb|KFK39498.1|  hypothetical protein AALP_AA3G251600                    359   3e-115   
ref|XP_002525629.1|  UDP-glucosyltransferase, putative                  359   3e-115   
emb|CDY24262.1|  BnaC03g42350D                                          359   4e-115   
ref|XP_004243651.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    359   5e-115   
ref|XP_002308771.2|  hypothetical protein POPTR_0006s00930g             359   5e-115   
dbj|BAI65913.1|  UDP-sugar:glycosyltransferase                          358   6e-115   
gb|AIZ00429.1|  UDP-glycosyltransferase                                 358   7e-115   
ref|XP_002308770.2|  hypothetical protein POPTR_0006s00910g             358   8e-115   
emb|CDP11887.1|  unnamed protein product                                358   1e-114   
ref|XP_006353725.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    358   1e-114   
ref|XP_010449952.1|  PREDICTED: UDP-glycosyltransferase 71B5-like       357   2e-114   
ref|XP_002322543.2|  hypothetical protein POPTR_0016s01790g             357   3e-114   
ref|XP_006373638.1|  hypothetical protein POPTR_0016s01810g             355   3e-114   
ref|XP_002525628.1|  UDP-glucosyltransferase, putative                  357   3e-114   
ref|XP_011100449.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    356   4e-114   
ref|XP_009766439.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    357   4e-114   
dbj|BAF96584.1|  glucosyltransferase homolog                            356   5e-114   
sp|Q40284.1|UFOG1_MANES  RecName: Full=Anthocyanidin 3-O-glucosyl...    355   6e-114   
ref|XP_002870248.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    355   1e-113   
ref|XP_009610762.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    355   2e-113   
emb|CDP00735.1|  unnamed protein product                                354   2e-113   
gb|AIE12479.1|  UGT1                                                    354   2e-113   
gb|AFJ52912.1|  UDP-glycosyltransferase 1                               355   3e-113   
ref|XP_009145452.1|  PREDICTED: UDP-glycosyltransferase 71B2            355   3e-113   
ref|XP_010680972.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    354   3e-113   
ref|XP_010648211.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    354   3e-113   
ref|XP_010524489.1|  PREDICTED: UDP-glycosyltransferase 71B2-like       355   3e-113   
ref|XP_002885467.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    354   4e-113   
ref|XP_011002395.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    354   6e-113   
ref|NP_193263.1|  UDP-glucosyl transferase 71B5                         353   6e-113   
ref|XP_011001034.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    354   7e-113   
gb|AED99883.1|  glycosyltransferase                                     353   7e-113   
ref|XP_008464637.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    353   8e-113   
gb|KFK39494.1|  hypothetical protein AALP_AA3G251200                    353   8e-113   
ref|XP_011100454.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    353   8e-113   
emb|CDX92922.1|  BnaA03g36440D                                          353   9e-113   
gb|AET00307.2|  UDP-glucose flavonoid 3-O-glucosyltransferase           352   9e-113   
ref|XP_011100451.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    353   1e-112   
gb|KDO36100.1|  hypothetical protein CISIN_1g043290mg                   351   1e-112   
ref|XP_006283673.1|  hypothetical protein CARUB_v10004730mg             352   1e-112   
dbj|BAG80554.1|  UDP-glucose:glucosyltransferase                        351   2e-112   
ref|XP_006387818.1|  hypothetical protein POPTR_0545s00210g             352   2e-112   
ref|XP_011100456.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    352   2e-112   
ref|XP_002863272.1|  hypothetical protein ARALYDRAFT_333019             351   2e-112   
ref|XP_003617354.1|  Anthocyanidin 3-O-glucosyltransferase              352   3e-112   
ref|XP_006406237.1|  hypothetical protein EUTSA_v10020628mg             352   3e-112   
dbj|BAF75886.1|  tetrahydroxychalcone 2'-glucosyltransferase            352   4e-112   
ref|XP_006373640.1|  hypothetical protein POPTR_0016s01830g             352   4e-112   
ref|XP_011001071.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    347   4e-112   
gb|KHN29779.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 6         351   4e-112   
ref|XP_007205450.1|  hypothetical protein PRUPE_ppa007869mg             347   4e-112   
emb|CDY57232.1|  BnaC01g42100D                                          351   5e-112   
emb|CAN68053.1|  hypothetical protein VITISV_040202                     349   5e-112   
ref|XP_009109339.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    351   6e-112   
ref|XP_003618094.1|  Glucosyltransferase                                350   6e-112   
ref|XP_011100450.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    351   6e-112   
emb|CDY55650.1|  BnaA01g36530D                                          351   7e-112   
ref|XP_011100458.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    352   7e-112   
ref|XP_010557208.1|  PREDICTED: UDP-glycosyltransferase 71C5            350   7e-112   
ref|XP_006417821.1|  hypothetical protein EUTSA_v10007440mg             351   8e-112   
dbj|BAP90369.1|  UDP-glycose: glycosyltransferase UGT71U1               350   8e-112   
ref|XP_002308769.2|  hypothetical protein POPTR_0006s00900g             352   8e-112   
gb|KFK39499.1|  hypothetical protein AALP_AA3G251700                    350   2e-111   
ref|XP_002264727.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    349   2e-111   
ref|XP_006414549.1|  hypothetical protein EUTSA_v10025075mg             349   4e-111   
ref|XP_006307414.1|  hypothetical protein CARUB_v10009037mg             348   4e-111   
ref|XP_003617353.1|  Anthocyanidin 3-O-glucosyltransferase              350   4e-111   
ref|XP_002322544.2|  hypothetical protein POPTR_0016s01840g             349   5e-111   
ref|XP_009147461.1|  PREDICTED: UDP-glycosyltransferase 71B5-like       348   5e-111   
ref|XP_003617349.1|  UDP-glucuronosyltransferase 1-6                    348   5e-111   
ref|XP_010533269.1|  PREDICTED: UDP-glycosyltransferase 71B2-like       348   6e-111   
ref|XP_006286210.1|  hypothetical protein CARUB_v10007776mg             348   6e-111   
gb|AET00312.2|  UDP-glucose flavonoid 3-O-glucosyltransferase           351   7e-111   
ref|NP_188817.1|  UDP-glucosyl transferase 71B8                         347   1e-110   
emb|CDX92924.1|  BnaA03g36460D                                          347   1e-110   
ref|XP_004243654.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    348   1e-110   
ref|XP_010557207.1|  PREDICTED: UDP-glycosyltransferase 71C4-like       347   2e-110   
gb|EYU43153.1|  hypothetical protein MIMGU_mgv1a004831mg                348   2e-110   
ref|NP_188816.1|  UDP-glycosyltransferase 71B7                          347   2e-110   
emb|CDP00731.1|  unnamed protein product                                346   2e-110   
ref|XP_003617348.1|  Glucosyltransferase                                346   3e-110   
ref|XP_010435045.1|  PREDICTED: UDP-glycosyltransferase 71B5-like       347   3e-110   
ref|XP_006297534.1|  hypothetical protein CARUB_v10013556mg             347   3e-110   
dbj|BAF75878.1|  glucosyltransferase                                    347   3e-110   
emb|CDP11888.1|  unnamed protein product                                360   4e-110   
sp|Q40288.1|UFOG6_MANES  RecName: Full=Anthocyanidin 3-O-glucosyl...    343   4e-110   
ref|XP_009135770.1|  PREDICTED: UDP-glycosyltransferase 71B2-like       346   4e-110   
gb|EPS68210.1|  hypothetical protein M569_06561                         346   5e-110   
ref|XP_002885466.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    346   6e-110   
ref|XP_010487258.1|  PREDICTED: UDP-glycosyltransferase 71C4-like...    345   6e-110   
ref|XP_006406235.1|  hypothetical protein EUTSA_v10021907mg             346   6e-110   
emb|CDY33142.1|  BnaCnng07130D                                          346   7e-110   
ref|XP_006307401.1|  hypothetical protein CARUB_v10009025mg             345   9e-110   
dbj|BAB02841.1|  UTP-glucose glucosyltransferase                        348   9e-110   
ref|XP_010680966.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    345   1e-109   
ref|XP_010457891.1|  PREDICTED: UDP-glycosyltransferase 71C4-like       345   1e-109   
gb|KDP38847.1|  hypothetical protein JCGZ_05004                         360   1e-109   
ref|NP_188815.2|  UDP-glucosyl transferase 71B6                         345   1e-109   
ref|XP_009135772.1|  PREDICTED: UDP-glycosyltransferase 71B7-like       344   2e-109   
dbj|BAF75898.1|  glucosyltransferase                                    345   2e-109   
emb|CDY24268.1|  BnaC03g42410D                                          343   3e-109   
ref|XP_004146066.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    344   4e-109   
gb|AAS94330.1|  UDP-glucose:flavonoid-O-glucosyltransferase             344   5e-109   
ref|XP_002889638.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    343   7e-109   
gb|AGU14074.1|  UDP-glycosyltransferase                                 343   7e-109   
ref|XP_010457892.1|  PREDICTED: UDP-glycosyltransferase 71C3-like...    343   8e-109   
ref|XP_011001035.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    343   9e-109   
ref|XP_010510647.1|  PREDICTED: UDP-glycosyltransferase 71B8-like       342   1e-108   
ref|XP_009136685.1|  PREDICTED: UDP-glycosyltransferase 71B5-like       342   1e-108   
ref|XP_004167804.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    338   2e-108   
gb|KFK39500.1|  hypothetical protein AALP_AA3G251800                    342   2e-108   
ref|XP_002889637.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    342   2e-108   
ref|XP_011100521.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    342   2e-108   
ref|XP_010488197.1|  PREDICTED: UDP-glycosyltransferase 71B2-like       341   3e-108   
ref|XP_010680969.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    342   3e-108   
ref|NP_563784.2|  UDP-glucosyl transferase 71C4                         341   3e-108   
dbj|BAK55745.1|  UDP-glucose glucosyltransferase                        341   3e-108   
ref|XP_011001033.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    341   3e-108   
gb|KFK43055.1|  hypothetical protein AALP_AA1G072400                    340   4e-108   
gb|AFN88217.1|  anthocyanidin 3-O-glucosyltransferase 1-like protein    340   5e-108   
gb|AHC55309.1|  UDP-glucosyltransferase                                 340   6e-108   
emb|CAN61933.1|  hypothetical protein VITISV_001639                     338   8e-108   
ref|XP_010488204.1|  PREDICTED: UDP-glycosyltransferase 71B8-like       340   8e-108   
gb|EPS62890.1|  hypothetical protein M569_11899                         340   8e-108   
ref|XP_010680971.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    340   9e-108   
gb|EYU24822.1|  hypothetical protein MIMGU_mgv1a025629mg                339   9e-108   
ref|XP_007142549.1|  hypothetical protein PHAVU_008G290200g             339   1e-107   
ref|XP_010488199.1|  PREDICTED: UDP-glycosyltransferase 71B6-like       340   1e-107   
ref|XP_010495993.1|  PREDICTED: UDP-glycosyltransferase 71B5-like       339   1e-107   
ref|XP_010510572.1|  PREDICTED: UDP-glycosyltransferase 71B2-like       339   2e-107   
ref|XP_009145450.1|  PREDICTED: UDP-glycosyltransferase 71B6 isof...    339   2e-107   
emb|CDY19298.1|  BnaC01g31820D                                          339   2e-107   
ref|XP_004243903.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    338   3e-107   
ref|XP_009109358.1|  PREDICTED: UDP-glycosyltransferase 71B2-like       339   3e-107   
ref|XP_008789763.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    338   3e-107   
ref|XP_006353729.1|  PREDICTED: putative UDP-glucose flavonoid 3-...    339   3e-107   
dbj|BAM63145.1|  coumarin glucosyltransferase 1                         338   3e-107   
gb|KGN54989.1|  hypothetical protein Csa_4G618540                       340   3e-107   
dbj|BAJ11650.1|  glucosyltransferase                                    338   4e-107   
gb|KFK40199.1|  hypothetical protein AALP_AA3G342800                    338   5e-107   
ref|XP_004172752.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    344   6e-107   
ref|XP_004491286.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    338   7e-107   
ref|XP_010501351.1|  PREDICTED: UDP-glycosyltransferase 71C3            338   7e-107   
gb|KFK23127.1|  hypothetical protein AALP_AAs61551U000100               337   1e-106   
gb|AFJ52915.1|  UDP-glycosyltransferase 1                               337   1e-106   
ref|XP_009118976.1|  PREDICTED: UDP-glycosyltransferase 71C3            337   1e-106   
ref|XP_010430963.1|  PREDICTED: UDP-glycosyltransferase 71B8            337   1e-106   
ref|XP_011001036.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    338   2e-106   
ref|XP_010466433.1|  PREDICTED: UDP-glycosyltransferase 71B2-like       337   2e-106   
ref|XP_009397191.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    336   3e-106   
emb|CDP20779.1|  unnamed protein product                                333   4e-106   
ref|XP_006417822.1|  hypothetical protein EUTSA_v10007519mg             335   5e-106   
ref|XP_010475477.1|  PREDICTED: UDP-glycosyltransferase 71C4            335   5e-106   
emb|CDP17877.1|  unnamed protein product                                335   5e-106   
ref|XP_009145449.1|  PREDICTED: UDP-glycosyltransferase 71B6 isof...    335   5e-106   
ref|XP_002879232.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    335   6e-106   
ref|XP_010455421.1|  PREDICTED: UDP-glycosyltransferase 71B8-like       335   6e-106   
dbj|BAF75917.1|  UDP-glucosyltransferase                                335   7e-106   
ref|XP_003617345.1|  Glucosyltransferase                                335   8e-106   
gb|KCW88553.1|  hypothetical protein EUGRSUZ_A00930                     334   8e-106   
ref|XP_002883317.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    335   9e-106   
gb|EPS62889.1|  hypothetical protein M569_11898                         335   9e-106   
ref|NP_180534.1|  UDP-glucosyl transferase 71D1                         334   1e-105   
ref|NP_180535.1|  UDP-glucosyl transferase 71C2                         334   1e-105   
gb|KFK40194.1|  hypothetical protein AALP_AA3G342300                    334   1e-105   
ref|XP_010521940.1|  PREDICTED: UDP-glycosyltransferase 71C3-like       334   1e-105   



>ref|XP_006363187.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Solanum tuberosum]
Length=484

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/479 (66%), Positives = 386/479 (81%), Gaps = 11/479 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA---  180
             MK+AKVVF+STP +GN+VP++EF+KL + +N+N S T+LLIN+PQRPL+QSYIDSL    
Sbjct  1     MKRAKVVFISTPALGNIVPIIEFAKLFTQKNKNFSATILLINIPQRPLVQSYIDSLTTTT  60

Query  181   ---SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV---RI  342
                + GN+ FLSLP A+PPS DQ  +TI FLS+ I+NH   V+ AL  L SD D+   ++
Sbjct  61    TTNATGNIHFLSLPVADPPSLDQFEATIGFLSLLIQNHTLQVKNALIDLISDSDLDSGQV  120

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEY  522
              GFF+DMFCTSFIDVA+EL+IPCYLYFASPA+FLSFMLH+P LDAQV  N E+ D+A ++
Sbjct  121   VGFFIDMFCTSFIDVAKELNIPCYLYFASPATFLSFMLHLPILDAQVSTNIEYKDSANDF  180

Query  523   VIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG  702
              I GF NPVP++ FP FM KRH D Y  FL HAKRY+ET+G++VNTF+ELE +CL S+  
Sbjct  181   NILGFSNPVPIKCFPSFMLKRHIDGYSWFLHHAKRYKETKGIIVNTFQELEPFCLNSLVH  240

Query  703   GND--VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
                  V P+YPIGPVVD  GPA+WH DSW HE VMKWLDNQ  SSV+FL+ GSMGSL  +
Sbjct  241   TTSHVVPPIYPIGPVVDHNGPAQWHQDSWGHENVMKWLDNQEPSSVIFLSFGSMGSLKDS  300

Query  877   QIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             Q++EIA GLE+AG+ FLW+IRE PK K +LPNDYT+L+ +LP GF + TKGKG+VCG VP
Sbjct  301   QVKEIAKGLEKAGHPFLWAIREAPKDKRELPNDYTNLEEILPNGFLESTKGKGLVCGLVP  360

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QVTILAHKAIGGFVSHCGWNSILE+L +GVPIGTWPIYAEQHLNAF++VKEL LAVEIT 
Sbjct  361   QVTILAHKAIGGFVSHCGWNSILESLYYGVPIGTWPIYAEQHLNAFELVKELDLAVEITM  420

Query  1237  DYKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DY+DG TLVS+E+V +GV+K+MDGD EVR+K K+ SE CK VW +NGSS+  LG LI+E
Sbjct  421   DYRDGTTLVSSEEVAKGVKKIMDGDGEVRQKFKKMSEKCKDVWKENGSSSNFLGHLIDE  479



>ref|XP_004232642.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Solanum 
lycopersicum]
Length=481

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/476 (66%), Positives = 386/476 (81%), Gaps = 8/476 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL--AS  183
             MK+ KVVF+STP +GN+VP++EF+K+ + +N+N+S T+LLIN+PQRPL+QSYIDSL  A+
Sbjct  1     MKRGKVVFISTPALGNIVPIIEFAKVFTQKNKNISATILLINIPQRPLVQSYIDSLTTAA  60

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV-RIAGFFVD  360
              GN+ FLSLP A+PPS DQ  +TI FLS+ I+NH   V+ AL  L SD D  ++ GFF+D
Sbjct  61    TGNIHFLSLPVADPPSLDQFDATIGFLSLLIQNHTLQVKNALIDLISDSDSGQVVGFFID  120

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFE  540
             MFCTSFIDVA+EL+IPCYLYFASPA+FLSFMLH+P LDAQV  N E+ D+A ++ I GF 
Sbjct  121   MFCTSFIDVAKELNIPCYLYFASPATFLSFMLHLPILDAQVSTNIEYKDSANDFNILGFS  180

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF---GGND  711
             NPVP++ FP FM KRH D Y  FL HAKRY+ET+G++VNTF+ELE YCL S+      + 
Sbjct  181   NPVPIKCFPSFMLKRHIDGYSWFLHHAKRYKETKGIIVNTFQELEPYCLNSLVHTTTSHV  240

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
             V P+YPIGPVVD  GPA+WH DSW HE VMKWLDNQ  SSV+FL+ GSMGSL  +Q+ EI
Sbjct  241   VPPIYPIGPVVDHNGPAQWHQDSWGHENVMKWLDNQEPSSVIFLSFGSMGSLKDSQVMEI  300

Query  892   ATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
             A GLE+AG+ FLW+IRE PK K +LPNDYT+L+ +LP GF + TKG+G+VCG VPQVTIL
Sbjct  301   AKGLEKAGHPFLWAIREAPKDKRELPNDYTNLEEILPNGFLESTKGRGLVCGLVPQVTIL  360

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AHKAIGGFVSHCGWNSILE+L +GVPIGTWPIYAEQHLNAF++VKEL LAVEIT DY+DG
Sbjct  361   AHKAIGGFVSHCGWNSILESLYYGVPIGTWPIYAEQHLNAFELVKELDLAVEITMDYRDG  420

Query  1252  ITLVSAEDVERGVRKLM--DGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              TLVS+E+V +GV+KLM  DGD EVR+K K+ SE CK VW +NGSS+  LG LI+E
Sbjct  421   TTLVSSEEVAKGVKKLMDGDGDGEVRQKFKKMSEKCKDVWKENGSSSNFLGHLIDE  476



>ref|XP_009628301.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=481

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/476 (66%), Positives = 379/476 (80%), Gaps = 8/476 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA---  180
             MK+AKVVF+STP +GNLVP +EF+K L+  NQN S T+LLIN+PQRPL+QSY D LA   
Sbjct  1     MKKAKVVFISTPALGNLVPTIEFAKHLTQTNQNFSATILLINIPQRPLVQSYNDFLAATA  60

Query  181   SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV---RIAGF  351
             + GN+ FLSLP A+PPS DQ  +TI FLS+ I+NH   V+ AL  L SD D    ++ GF
Sbjct  61    TTGNVHFLSLPTADPPSLDQFDATIGFLSLLIQNHTSQVKDALVNLISDSDSDSGQVVGF  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
             F+DMFCT FIDVA+EL+IPCYLYFASPA+FLSFM H+ +LDAQV  N+EF D+A  + I 
Sbjct  121   FIDMFCTPFIDVAKELNIPCYLYFASPATFLSFMCHLSSLDAQVSVNTEFKDSATHFNIL  180

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG--  705
             GF NPVPV  FP FM KR  D Y  FL HA+RY+ET+G+VVNTF+ELESYCL S+     
Sbjct  181   GFSNPVPVNCFPSFMLKRKIDGYSWFLHHARRYKETKGIVVNTFQELESYCLNSLASAVA  240

Query  706   NDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
             + V PVYPIGPV+D  GPA+WH D W HE VMKWLDNQ  SSV+FL+ GSMGSLN +Q++
Sbjct  241   DVVPPVYPIGPVLDHNGPAQWHQDLWGHENVMKWLDNQAPSSVLFLSFGSMGSLNISQVK  300

Query  886   EIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             EIA GLE++GY FLW+IRE PK K +LPNDYT+L+ +LP GF + TKGKG++CG VPQVT
Sbjct  301   EIAKGLEKSGYPFLWAIREAPKDKRELPNDYTNLEEILPYGFLEATKGKGLICGLVPQVT  360

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             ILAHKAIGGFVSHCGWNSILE+L +GVPIGTWP+YAEQHLNAF+MVKEL LAVEIT DY+
Sbjct  361   ILAHKAIGGFVSHCGWNSILESLYYGVPIGTWPVYAEQHLNAFEMVKELNLAVEITMDYR  420

Query  1246  DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DG TLVS+E V  GV+ LMDG+ EVR++ K+ SE CK VW +NGSS+V LG+LI++
Sbjct  421   DGTTLVSSEKVANGVKNLMDGEGEVRQRFKKMSEKCKEVWKENGSSSVFLGQLIDK  476



>ref|XP_009789683.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nicotiana 
sylvestris]
Length=479

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/474 (65%), Positives = 375/474 (79%), Gaps = 6/474 (1%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS--  183
             MK+AKVVF+STP +GNLVP +EF+K L+  NQN S T+LLI++PQRPL+QSY D LA+  
Sbjct  1     MKKAKVVFISTPALGNLVPTIEFAKHLTQTNQNFSATILLISIPQRPLVQSYNDFLAAAA  60

Query  184   -DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV-RIAGFFV  357
               GN+ FLSLP A+PPS DQ  +TI FLS+ I+NH   V+ AL  L SD    ++ GFF+
Sbjct  61    ATGNVHFLSLPTADPPSLDQFDATIGFLSLLIQNHTSQVKDALVNLISDSGSGQVVGFFI  120

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGF  537
             DMFCT FID A+EL+IPCYLYFASPA+FLSFM H+PTLDAQV  N+EF D+A  + I GF
Sbjct  121   DMFCTPFIDAAKELNIPCYLYFASPATFLSFMCHLPTLDAQVSINTEFKDSATHFNILGF  180

Query  538   ENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF--GGND  711
              NPVPV  FP FM  R  D Y  FL HA+RY+ET+G+VVNTF++LE YCL S+     + 
Sbjct  181   SNPVPVNIFPSFMLNRKIDGYSWFLHHARRYKETKGIVVNTFQDLEPYCLNSLVKAAADV  240

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
             V PVYPIGPV+D  GPA+WH D W HE VMKWLDNQ  SSVVFL+ GSMGSLN +Q++EI
Sbjct  241   VPPVYPIGPVLDHNGPAQWHQDLWGHENVMKWLDNQDPSSVVFLSFGSMGSLNISQVKEI  300

Query  892   ATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
             A GLE++G+ FLW+IRE PK K +LPNDYT+L+ +LP GF + TKG+G++CG VPQVTIL
Sbjct  301   AKGLEKSGHPFLWAIREAPKDKRELPNDYTNLEEILPYGFLEATKGRGLICGLVPQVTIL  360

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AHKAIGGFVSHCGWNSILE+L +GVPIGTWPIYAEQHLNAF+MVKEL LAVEIT DY+DG
Sbjct  361   AHKAIGGFVSHCGWNSILESLYYGVPIGTWPIYAEQHLNAFEMVKELKLAVEITMDYRDG  420

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              TLV +E+V  GV+ LMDGD EVR++ K  SE CK VW +NGSS+V LG+LI++
Sbjct  421   NTLVLSEEVANGVKNLMDGDGEVRQRFKTMSEKCKEVWKENGSSSVFLGQLIDK  474



>ref|XP_006448611.1| hypothetical protein CICLE_v10018337mg [Citrus clementina]
 gb|ESR61851.1| hypothetical protein CICLE_v10018337mg [Citrus clementina]
Length=510

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/491 (57%), Positives = 363/491 (74%), Gaps = 24/491 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYI---DSLA  180
             MK+ +VV + TP +GNLVP+VEF+  L+++++    TVL++ +P+RP++ +Y+   D+LA
Sbjct  1     MKKFRVVLICTPEMGNLVPLVEFAHQLTNRDRRFCATVLIMTVPERPIVNAYVKSRDALA  60

Query  181   S--DGN-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDV  336
             +  D N + F+ LP+ +PPSPDQ +ST+ +LS++IE H+PHV+  +TKL      S+D  
Sbjct  61    TTTDANTINFVYLPSVDPPSPDQYKSTLGYLSLFIERHKPHVKNEITKLMETESDSEDSD  120

Query  337   RIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQ-----VPKNSEF  501
             R+AG F+DMFCTS IDVA +L IPCYLYFASPASFL FMLH P +DAQ     V  N++F
Sbjct  121   RVAGLFIDMFCTSMIDVANQLGIPCYLYFASPASFLGFMLHFPNIDAQLANEFVESNTDF  180

Query  502   ---GDAAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKEL  672
                 D+  E VIP F NP+P    P  + KR  D Y+ +L+HA RY ET G+VVNTF+EL
Sbjct  181   FVPKDSTTELVIPSFANPLPPSVLPSTVLKRKRDGYVWYLRHATRYMETEGIVVNTFQEL  240

Query  673   ESYCLGSMFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTG  852
             E Y + S    N + PVYPIGPV+D  GPA+WHPD  +HE +MKWLD+Q  SSVVFL  G
Sbjct  241   EPYAIESN-SVNGMPPVYPIGPVLDLNGPAQWHPDRVHHESIMKWLDDQPPSSVVFLCFG  299

Query  853   SMGSLNPAQIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLD--HVLPPGFSDRTK  1026
             SMGS    Q+REIA GL+R G+RFLWSIREP KSK+ LP +YT+L    +LP GF +RT 
Sbjct  300   SMGSFVGPQLREIAIGLQRVGFRFLWSIREPSKSKIYLPGEYTNLKVKEMLPEGFLNRTA  359

Query  1027  GKGMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVK  1206
             G G+VCGWVPQVTIL+H+AIGGFVSHCGWNS+LE+L +GVPI TWP+YAEQ +NAF++VK
Sbjct  360   GVGLVCGWVPQVTILSHQAIGGFVSHCGWNSVLESLWYGVPIATWPLYAEQQMNAFELVK  419

Query  1207  ELGLAVEITFDYKD--GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGS  1380
             EL LAVEI  DY+D  G  LVSAE++ERG+R+LMDGDDEVR+KVKE  E  +   M+ GS
Sbjct  420   ELRLAVEIRLDYRDGRGSDLVSAEEIERGLRRLMDGDDEVRKKVKEMREKSRTAVMEEGS  479

Query  1381  SAVSLGKLIEE  1413
             S  SLG LI++
Sbjct  480   SNKSLGSLIKK  490



>ref|XP_008225915.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Prunus 
mume]
Length=494

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/474 (58%), Positives = 356/474 (75%), Gaps = 10/474 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             M +  VVF+STP IGNLVP+VEF++LL + ++    T+L+INM QRP++++YI S A+  
Sbjct  20    MTKFHVVFISTPGIGNLVPLVEFAQLLGNHDRRFHATILIINMSQRPIVKTYIQSRAATC  79

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDD-----VRIAGF  351
              N+ FL LPA +PPSPDQ RS++ ++S+ I+NH+ HV+ ALT L S +       R+AG 
Sbjct  80    TNISFLHLPAVDPPSPDQYRSSMGYISLLIQNHKTHVKNALTNLVSPESDEFNPGRVAGL  139

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
             FVDMFCTS IDVA ELDIPCYL+FASPA+FLSFMLH+PTLDAQ+P  +EFGD+  E  IP
Sbjct  140   FVDMFCTSMIDVANELDIPCYLFFASPATFLSFMLHLPTLDAQIP--TEFGDSDTELSIP  197

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
             GF N VP    P  +  +  D Y  +L HA+RY ET+G+VVNTF+ELE + L S+   + 
Sbjct  198   GFANSVPPLVLPTAVLNKKGDAYYWYLSHARRYTETKGIVVNTFEELEPHALSSL-AMSP  256

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
             +  VYPIGPV+D  GPA+WH D   +E+VM+WLD+Q +SSVV L+ GSMGSL+  Q+REI
Sbjct  257   MPRVYPIGPVLDLNGPAQWH-DPTRYEIVMRWLDDQPTSSVVLLSFGSMGSLSGPQVREI  315

Query  892   ATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
             A GLERAG+RF+W++R+PPKS+LDLP+D   +D VLP GF +RT   G+V G VPQ  IL
Sbjct  316   AFGLERAGFRFIWALRDPPKSQLDLPSDPASVDDVLPNGFLERTCKLGLVFGLVPQAKIL  375

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AH AIGGFVSHCGWNSILE+L +GVPI TWPIYAEQ +NAF+MVKELGLA+EI  DY++G
Sbjct  376   AHPAIGGFVSHCGWNSILESLWYGVPIATWPIYAEQQMNAFEMVKELGLAIEIRLDYREG  435

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               LV AE+VER ++ LM+G D VR +VKE  E  + V ++NGSS  +LG L E+
Sbjct  436   SDLVLAEEVERSIKHLMNGGDVVRARVKEMREKSRMVLLENGSSYQALGALTEK  489



>ref|XP_006468565.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Citrus sinensis]
Length=532

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/488 (56%), Positives = 357/488 (73%), Gaps = 24/488 (5%)
 Frame = +1

Query  4     AIMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYI---DS  174
             A MK+ +VV + TP +GNLVP+VEF+ LL+++++    TVL++ +P+RP++ +Y+   D+
Sbjct  45    AAMKKFRVVLICTPEMGNLVPLVEFAHLLTNRDRRFCATVLIMTVPERPIVNAYVKSRDA  104

Query  175   LASDG---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDD  330
             LA+     N+ F+ LP+ +PPSPDQ +ST+ +LS++IE H+PHV+  +T L      S+D
Sbjct  105   LATTTDAHNINFVYLPSVDPPSPDQYKSTLGYLSLFIEKHKPHVKNEITNLIQTESDSED  164

Query  331   DVRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQ-----VPKNS  495
               R+AG F+DMFCTS  DVA +L IPCYLYFASPASFL FMLH P +DAQ     V  N+
Sbjct  165   SDRVAGLFIDMFCTSMTDVANQLGIPCYLYFASPASFLGFMLHFPNIDAQIANEFVESNT  224

Query  496   EF---GDAAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFK  666
             +F    D+  E VIP F NP+P    P  + KR  D Y+ +L+HA RY ET G+VVNTF+
Sbjct  225   DFFVPKDSTTELVIPSFANPLPPSVLPSTVLKRKRDGYVWYLRHAARYMETEGIVVNTFQ  284

Query  667   ELESYCLGSMFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLT  846
             ELE Y + S+   N + PVYPIGPV+D  GPA+WHPD  +HE +MKW D+Q  SSVVFL 
Sbjct  285   ELEPYAIESI-SVNGMPPVYPIGPVLDLNGPAQWHPDRVHHESIMKWPDDQPPSSVVFLC  343

Query  847   TGSMGSLNPAQIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLD--HVLPPGFSDR  1020
              GSMGS    Q+REIA GL+R G+RFLWSIREP KSK+ LP +YT+L    +LP GF +R
Sbjct  344   FGSMGSFVGPQLREIAIGLQRVGFRFLWSIREPSKSKIYLPGEYTNLKVKEMLPEGFLNR  403

Query  1021  TKGKGMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQM  1200
             T G G+VCGWVPQVTIL+H+AIGGFVSHCGWNS+LE+L +GVPI TWP+YAEQ +NAF++
Sbjct  404   TAGVGLVCGWVPQVTILSHQAIGGFVSHCGWNSVLESLWYGVPIATWPLYAEQQMNAFEL  463

Query  1201  VKELGLAVEITFDYKD--GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKN  1374
             VKEL LAVEI  DY+D  G  LVSAE++E G+R+LMDGDDEVR+KVKE  E  +   M+ 
Sbjct  464   VKELRLAVEIRLDYRDGRGSDLVSAEEIEWGLRRLMDGDDEVRKKVKEMREKSRTAVMEE  523

Query  1375  GSSAVSLG  1398
             GSS  SLG
Sbjct  524   GSSNKSLG  531



>ref|XP_007211849.1| hypothetical protein PRUPE_ppa004725mg [Prunus persica]
 gb|EMJ13048.1| hypothetical protein PRUPE_ppa004725mg [Prunus persica]
Length=494

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/474 (57%), Positives = 352/474 (74%), Gaps = 10/474 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             M +  VVF+STP IGNLVP+VEF++LL + ++    T+L+INM QRP++ +YI S A+  
Sbjct  20    MTKFHVVFISTPGIGNLVPLVEFAQLLGNHDRRFHSTILIINMSQRPIVNTYIQSRAATC  79

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD-----DDVRIAGF  351
              N+ FL LPA +PPSPDQ +S++ ++S+ I+NH+ HV+ ALT L S      +  R+AG 
Sbjct  80    TNIRFLHLPAVDPPSPDQYQSSMGYISLLIQNHKTHVKSALTNLMSSESDEFNSGRVAGL  139

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
             FVDMFCTS IDVA ELDIPCYL+FASPA+FLSFMLH+PTLDAQ+P   EFGD+  E  IP
Sbjct  140   FVDMFCTSMIDVANELDIPCYLFFASPATFLSFMLHLPTLDAQIPI--EFGDSDTELSIP  197

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
             GF N VP    P  +  +  D Y  +L HA+RY ET+G+VVNTF+ELE + L S+   + 
Sbjct  198   GFANSVPPLVLPTAVLNKKGDAYSWYLSHARRYTETKGIVVNTFEELEPHALSSL-AMSL  256

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
             +  VYPIGPV+D  GPA+WH D   +E VM+WLDNQ +SSVV L  GSMGSL+  Q+REI
Sbjct  257   LPRVYPIGPVLDLNGPAQWH-DPNRYESVMRWLDNQPTSSVVLLCFGSMGSLSGPQVREI  315

Query  892   ATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
             A GLERAG++F+W++R+PPKS+LDLP+D   +D +LP GF +RT   G++ G VPQ  IL
Sbjct  316   AFGLERAGFQFIWALRDPPKSQLDLPSDPASVDDILPNGFLERTCKLGLIFGLVPQAKIL  375

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AH AIGGFVSHCGWNSILE+L +GVPI TWPIYAEQ +NAF+MVKELGLA+EI  DY++G
Sbjct  376   AHPAIGGFVSHCGWNSILESLWYGVPIATWPIYAEQQMNAFEMVKELGLAIEIRLDYREG  435

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               LV AE+VER ++ LM+ DD VR +VKE  E  + V ++NGSS  +LG L E+
Sbjct  436   SDLVLAEEVERSIKHLMNSDDVVRARVKEMREKSRMVLLENGSSYQALGALTEK  489



>ref|XP_006468464.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Citrus sinensis]
Length=496

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/492 (54%), Positives = 352/492 (72%), Gaps = 27/492 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYID------  171
             M++  +VF S P IGNLVPVVEF++LL+++++  S TVL+I +P+RP++ SYI       
Sbjct  3     MRKLNLVFTSIPGIGNLVPVVEFARLLTNRDRRFSATVLIITIPERPIVNSYIQTRGTAL  62

Query  172   SLASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDD------  333
             S+  + ++ FL LP  +P SPD+ +S++ +L   IE H+PHV+ A+  L + +       
Sbjct  63    SVHDNDDVNFLHLPTVDPLSPDEYQSSLGYLCTLIEKHKPHVKHAIANLMATESGSDNAV  122

Query  334   -VRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDA  510
              VR+AG FVDMFCTS IDVA EL IP YLYFASPASFL F+L+ PTLDAQ+   +EF D+
Sbjct  123   SVRVAGLFVDMFCTSMIDVANELGIPSYLYFASPASFLGFLLYFPTLDAQLA--TEFVDS  180

Query  511   AKEYV-----------IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVN  657
               E +           IP F NP+P    P    KR +D Y+ +L H +RY ET+G++VN
Sbjct  181   DTELIVPKDSSITELKIPSFANPLPPLVLPTTALKRKQDGYMWYLYHGRRYLETKGMIVN  240

Query  658   TFKELESYCLGSMFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVV  837
             TF+ELE Y + S+    ++ PVYPIGPV+D  G A+WHPD  + E +M+WLD+Q  SSVV
Sbjct  241   TFQELEPYAIDSL-RVTEMPPVYPIGPVLDLHGLAQWHPDRASQEKIMRWLDDQPPSSVV  299

Query  838   FLTTGSMGSLNPAQIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSD  1017
             FL  GSMGSL+ AQ+REIA GLER G+RFLWSIREP K  + LP +YT+L+ +LP GF  
Sbjct  300   FLCFGSMGSLSEAQLREIAVGLERTGFRFLWSIREPSKGTIYLPGEYTNLEEILPEGFFH  359

Query  1018  RTKGKGMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQ  1197
             RT   G+VCGWVPQVTILAH+A+GGFVSHCGWNSILE+L  GVP+ TWP+YAEQ +NAFQ
Sbjct  360   RTAKIGLVCGWVPQVTILAHQAVGGFVSHCGWNSILESLWFGVPMATWPVYAEQQMNAFQ  419

Query  1198  MVKELGLAVEITFDYKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNG  1377
             +VKE GLAVEI  DY++G  LV AE++E+G+++LMDGDD+VR KVK+  E  +   M++G
Sbjct  420   LVKEFGLAVEIRLDYREGSDLVLAEELEKGLQQLMDGDDQVRRKVKQMKEKSRTAMMEDG  479

Query  1378  SSAVSLGKLIEE  1413
             SS  SLG LIEE
Sbjct  480   SSYKSLGSLIEE  491



>ref|XP_006448715.1| hypothetical protein CICLE_v10014993mg [Citrus clementina]
 gb|ESR61955.1| hypothetical protein CICLE_v10014993mg [Citrus clementina]
Length=498

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/492 (53%), Positives = 351/492 (71%), Gaps = 27/492 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYID------  171
             M++  +VF STP IGNLVPVVEF++LL+++++  S TVL+I +P+RP++ SYI       
Sbjct  3     MRKLNLVFTSTPGIGNLVPVVEFARLLTNRDRRFSATVLIITIPERPIVNSYILTRGTAL  62

Query  172   SLASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDD------  333
             S+  + ++ FL LP  +P SPD+ +S++ +L   IE H+PHV+ A+  L + +       
Sbjct  63    SVHDNDDVNFLHLPTVDPLSPDEYQSSLGYLCTLIEKHKPHVKHAIANLMATESGSDNAV  122

Query  334   -VRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDA  510
              VR+AG FVDMFCTS IDVA EL IP YLYFASPASFL F+L+ PTLD Q+   +EF D+
Sbjct  123   SVRVAGLFVDMFCTSMIDVANELGIPSYLYFASPASFLGFLLYFPTLDTQLA--TEFVDS  180

Query  511   AKEYV-----------IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVN  657
               E++           IP F NP+P    P    KR +D Y+ +L H +RY ET+G++VN
Sbjct  181   DTEFIVPKDSSITELKIPSFANPLPPLVLPTTALKRKQDGYMWYLYHGRRYLETKGMIVN  240

Query  658   TFKELESYCLGSMFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVV  837
             TF+ELE Y + S+    ++ PVYPIGPV+D  G A+WHPD  + E +M+WLD+Q  SSVV
Sbjct  241   TFQELEPYAIDSL-RVTEMPPVYPIGPVLDLHGLAQWHPDRASQEKIMRWLDDQPPSSVV  299

Query  838   FLTTGSMGSLNPAQIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSD  1017
             FL  GSMGSL+ AQ+REIA GLER G+RFLWSIREP K  + LP +YT+L+ +LP GF  
Sbjct  300   FLCFGSMGSLSEAQLREIAVGLERTGFRFLWSIREPSKGTIYLPGEYTNLEEILPEGFFH  359

Query  1018  RTKGKGMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQ  1197
             RT   G+VCGWVPQV ILAH+A+GGFVSHCGWNS+LE+L   VP+ TWP+YAEQ +NAFQ
Sbjct  360   RTAKIGLVCGWVPQVAILAHQAVGGFVSHCGWNSVLESLWFSVPMATWPVYAEQQMNAFQ  419

Query  1198  MVKELGLAVEITFDYKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNG  1377
             +VKE GLAVEI  D+++G  +V AE++E+G+++LMDGDDEVR KVK+  E  +   M++G
Sbjct  420   LVKEFGLAVEIRLDFREGSDVVLAEELEKGLQQLMDGDDEVRRKVKQMKEKSRTAMMEDG  479

Query  1378  SSAVSLGKLIEE  1413
             SS  SLG LIE+
Sbjct  480   SSYNSLGSLIED  491



>ref|XP_007041010.1| UDP-glucosyltransferase, putative [Theobroma cacao]
 gb|EOX96841.1| UDP-glucosyltransferase, putative [Theobroma cacao]
Length=499

 Score =   527 bits (1357),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 261/495 (53%), Positives = 349/495 (71%), Gaps = 28/495 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS-LASD  186
             M +  VVF+S P IGN VP VEF++ L++ +    VT+L+I + +RP++ +YI S +A+ 
Sbjct  1     MNKFHVVFISAPGIGNFVPTVEFARHLNNHDPRFIVTILMIEIAERPIVNAYIQSCVATH  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDD--------DVRI  342
              ++ F++LP  +PPSPD+ ++++ ++ + I  H+ HV+ A+  L S +        DVR+
Sbjct  61    TSINFINLPPVDPPSPDEYQTSLGYICLLIAKHKLHVKNAIEDLMSTESPSDSDMVDVRV  120

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDA-------------QV  483
             AG  VDMFCTS IDVA+EL IPCYLYF SP SFL FML+ PTLD               V
Sbjct  121   AGLVVDMFCTSMIDVAKELGIPCYLYFTSPVSFLGFMLYFPTLDGIFTTEFVDSDSGLMV  180

Query  484   PKNSEFGDAAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTF  663
             PK+S   + + E  IPGF NP+P    P  +  R ++ Y  FL HA+RY+ET+G+VVNTF
Sbjct  181   PKDSAAANTS-ELTIPGFANPLPHLMLPNRVLYRKQEGYFWFLHHARRYKETKGMVVNTF  239

Query  664   KELESYCLGSMFGGN-DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVF  840
             +ELE Y + S+  GN D  P+YPIGPV+D  GPA+WHP+   H+ +++WLDNQ  SSVVF
Sbjct  240   RELEPYAIDSVSNGNGDWPPIYPIGPVLDLVGPAQWHPERAQHDSIVQWLDNQPPSSVVF  299

Query  841   LTTGSMGSLNPAQIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHV--LPPGFS  1014
             L  GSMGSL+ AQ+REIA GLER+G+RFLWSIREPPK +LDLP +Y + + +  LP GF 
Sbjct  300   LCFGSMGSLSGAQLREIAVGLERSGFRFLWSIREPPKRELDLPGEYKNGEEIEMLPQGFV  359

Query  1015  DRTK--GKGMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLN  1188
             DR++  G G+VCGWVPQ  IL H+AIGGFVSHCGWNSILE++ +GVPI TWP+YAEQ +N
Sbjct  360   DRSRSAGIGLVCGWVPQAVILGHQAIGGFVSHCGWNSILESIWYGVPIATWPLYAEQQMN  419

Query  1189  AFQMVKELGLAVEITFDYKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWM  1368
             AFQ+VKEL LAVEI  DY++G  LVS E++ER +R+LM G+DEVR K++E  +  +   M
Sbjct  420   AFQLVKELELAVEIRLDYREGSDLVSPEELERALRRLMKGNDEVRRKMREMKQKSRAALM  479

Query  1369  KNGSSAVSLGKLIEE  1413
              NGSS  SL  LIEE
Sbjct  480   PNGSSYKSLASLIEE  494



>ref|XP_010098468.1| UDP-glucose flavonoid 3-O-glucosyltransferase 6 [Morus notabilis]
 ref|XP_010105323.1| UDP-glucose flavonoid 3-O-glucosyltransferase 6 [Morus notabilis]
 gb|EXB75128.1| UDP-glucose flavonoid 3-O-glucosyltransferase 6 [Morus notabilis]
 gb|EXC50818.1| UDP-glucose flavonoid 3-O-glucosyltransferase 6 [Morus notabilis]
Length=484

 Score =   523 bits (1347),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 263/468 (56%), Positives = 339/468 (72%), Gaps = 11/468 (2%)
 Frame = +1

Query  16    QAKVVFVSTPTIGNLVPVVEFSKLLSHQNQN-LSVTVLLINMPQRPLIQSYIDSL--ASD  186
             Q +VVF+STP IG L P VEF++ L H+N + LS TVLLI +P  P I SY  SL   S 
Sbjct  13    QKEVVFISTPAIGMLTPTVEFARRLVHRNPDRLSATVLLIPVPHWPTIHSYTQSLPATSS  72

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-KSDDDVRIAGFFVDM  363
              NL FL LP   PPSPD   S ++ LS  ++ H+P V++A+++L  S+   ++ G FVDM
Sbjct  73    PNLRFLLLPTLHPPSPDNFHSYVAHLSSLVDQHKPSVKQAISELLVSESKRQVVGLFVDM  132

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFEN  543
             FCTS IDVA++L +P YL+FASPASFLSFML IP LD+Q+       D+  E  + GF N
Sbjct  133   FCTSMIDVADDLGLPSYLFFASPASFLSFMLDIPILDSQLAS-----DSVAELSVRGFAN  187

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP    P  + KR  D Y   L+HA+RY+ET+G++VN+ +ELE   L S+   + +  V
Sbjct  188   SVPRRVLPTTVLKR-GDEYSWCLRHARRYKETKGIIVNSLRELEPVVLHSL-SVSGIPKV  245

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             Y +GP+VD  GPA+WHPD   +E VM+WLDNQ SSSV+FL  GS+GSL+  Q++E+A G+
Sbjct  246   YLVGPIVDLSGPAQWHPDRAQYETVMRWLDNQPSSSVLFLCFGSLGSLSGPQVKELALGI  305

Query  904   ERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKA  1083
             ER+G+RF+WS R  PKSKL LP++YT+ D VLP GF +RT G G+VCGWVPQVTILAH+A
Sbjct  306   ERSGFRFVWSCRGSPKSKLGLPSEYTNFDEVLPNGFLERTAGMGLVCGWVPQVTILAHRA  365

Query  1084  IGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLV  1263
             +GGFVSHCGWNSILE+L HGVPI TWPIYAEQ +NAF+MVKELGLAVEIT DY++G  LV
Sbjct  366   VGGFVSHCGWNSILESLWHGVPIATWPIYAEQQMNAFEMVKELGLAVEITLDYREGSDLV  425

Query  1264  SAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
             SAE+VERG+ +LM+ D EVR KVK   E C+   +++GSS  SLG L+
Sbjct  426   SAEEVERGITRLMESDGEVRAKVKSMREKCRMALVQDGSSHESLGALV  473



>ref|XP_004295514.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Fragaria vesca subsp. vesca]
Length=473

 Score =   519 bits (1336),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 262/473 (55%), Positives = 344/473 (73%), Gaps = 10/473 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTP-TIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS--LA  180
             M +++VVF+STP +IGNLVP+VEF++ L + +  L  T+L+I MPQRP I +YI S   A
Sbjct  1     MSKSEVVFISTPGSIGNLVPLVEFAQFLVNHDPRLHATILIITMPQRPTINTYIQSRAAA  60

Query  181   SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVR-IAGFFV  357
             S   + FL LP  +P + D+ +S+I++LS+ I+ ++ HV+ ALT+L S  +   +  FFV
Sbjct  61    SATTINFLHLPIVDPLTEDEYQSSIAYLSLLIQKNKLHVKHALTELISSTESNPVVAFFV  120

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGF  537
             DMFCTS IDVA ELD+PCY++FASPA+FL+FM HIP LDA++  + +F D   E  IPGF
Sbjct  121   DMFCTSMIDVANELDVPCYMFFASPATFLNFMFHIPVLDAEI--SDDFVDLDTELTIPGF  178

Query  538   ENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVG  717
              N VP    P  +  +  D Y  +L H  RY+E +G+VVNTFKELE + L ++   +D+ 
Sbjct  179   ANSVPPMVLPTALLNKKGDAYACYLAHTARYKEPKGIVVNTFKELEPHALYTL-ATSDLP  237

Query  718   PVYPIGPVVDREGPARW-HPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              V+ IGPVVD  G A+W +PD +  E V+KWLD+Q  SSVV L  GSMGSLN  Q+REIA
Sbjct  238   RVHAIGPVVDLNGVAQWQNPDRY--ESVVKWLDDQPPSSVVLLCFGSMGSLNGPQVREIA  295

Query  895   TGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
              GLERAG+RFLW++REPPKS + LP D T++D VLP GF +RT   G+VCGWVPQV ILA
Sbjct  296   FGLERAGFRFLWALREPPKSNVYLPTDPTNVDEVLPDGFLERTCKLGLVCGWVPQVKILA  355

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGI  1254
             H+AIGGFVSHCGWNSILE+L +GVPI TWPIYAEQ +NAF+MVKELGLAVEI  DY++G 
Sbjct  356   HQAIGGFVSHCGWNSILESLWYGVPIATWPIYAEQQMNAFEMVKELGLAVEIRVDYREGS  415

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +V AE+VER +++LMDGD  VR +VK+  E  +   M+NGS+  +L  LIEE
Sbjct  416   KIVMAEEVERSIKRLMDGDHGVRTRVKDMREKSRMALMENGSAYQALEDLIEE  468



>gb|KEH37752.1| UDP-glucose flavonoid 3-O-glucosyltransferase [Medicago truncatula]
Length=467

 Score =   518 bits (1333),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 249/474 (53%), Positives = 333/474 (70%), Gaps = 16/474 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M + +VVFVSTP IGN+VP+VEF+ L++  N   S T+L+I MPQRPL+ +YI S  S  
Sbjct  1     MTKFEVVFVSTPAIGNIVPIVEFANLITKLNPQFSATILIITMPQRPLVNTYIQSRPSSA  60

Query  190   -NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKS-----DDDVRIAGF  351
              N+ FL LP  +PP+PDQ +S+I+F+S+ I+NH+ +++ AL  + S      D V++   
Sbjct  61    TNIRFLHLPTVDPPTPDQYQSSIAFISLLIQNHKNNIKDALRNITSTESEGSDSVKLVAL  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
             FVDMF T+ IDVA E+ +PCYL+FASPASFL FMLH+P +++         ++  E+ IP
Sbjct  121   FVDMFSTTIIDVAAEISVPCYLFFASPASFLGFMLHLPRVESV--------ESEMEFEIP  172

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
              F+NP+P    P F+SK  ED Y     HA+RY+ET+G++VNT KELE Y L S+     
Sbjct  173   CFKNPLPKLVLPNFLSK--EDAYFWVSYHARRYKETKGIIVNTLKELEPYALESLHNDLQ  230

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
             + PVYPIGPV+D  GP +W P+   +  +++WLD Q   SVVFL  GS+GSL   Q+ +I
Sbjct  231   LPPVYPIGPVLDLVGPVQWDPNPVQYNYIVEWLDLQPVKSVVFLCFGSLGSLEAKQVEQI  290

Query  892   ATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
             A GLE+AG RFLW+IREPPK++L+ P D+   ++VLP GF  RT G G+VCGW+PQ  +L
Sbjct  291   AIGLEQAGIRFLWAIREPPKAQLEDPRDFMSYENVLPDGFLRRTMGMGIVCGWIPQAKVL  350

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AHKA+GGFVSHCGWNSILE+L +GVPI TWP+YAEQ +NAF+MV+E GLAVEI  DY+ G
Sbjct  351   AHKAVGGFVSHCGWNSILESLWYGVPIATWPVYAEQQMNAFEMVRESGLAVEIRLDYRVG  410

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               LV AE+V+ GV  LM+   E+R KVKE SE C+   M NGSS  +L  LI+E
Sbjct  411   GDLVQAEEVKNGVTTLMNNSHEIRRKVKEMSEKCRFALMDNGSSYTNLVSLIQE  464



>ref|XP_002528155.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF34246.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=485

 Score =   517 bits (1332),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 257/487 (53%), Positives = 348/487 (71%), Gaps = 26/487 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M++ +V+F+STP +GNLVP VEF++ L+  +   S TVL+I+M QRP++ +YI S  S  
Sbjct  1     MRKLQVLFISTPAVGNLVPTVEFAQRLTDHDPRFSSTVLIISMAQRPIVNAYIQSCCSTA  60

Query  190   N----LEFLSLPAAEPPSPD-QNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFF  354
             +    + F+ LP+ E P    Q +S+  ++ + I+ H+ HV+ A+++L   ++V+++G F
Sbjct  61    SSATAINFIHLPSPEDPPSPDQYQSSFGYMCLLIDRHKVHVKHAISQLL-HNEVQVSGLF  119

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQ-------------VPKNS  495
             VDMF TS +DVA+EL+IPCYLYFASPASFL FMLH+P LD Q             VPK  
Sbjct  120   VDMFSTSMVDVADELNIPCYLYFASPASFLGFMLHLPILDTQLATDFIDSDNDSIVPK--  177

Query  496   EFGDAAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELE  675
                D + + +IPGF NP+P +  P ++ +R +D Y  FL HA RY+ET+G+VVNTF+ LE
Sbjct  178   ---DPSTKLIIPGFANPLPPQVLPTYVLRRKQDGYSWFLYHASRYKETKGMVVNTFQALE  234

Query  676   SYCLGSMFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGS  855
              + + S+   + + P+YPIGPV+D  GP +WHP+   H  ++KWLD+Q  SSVVFL  GS
Sbjct  235   QHAINSL-SASGLPPIYPIGPVLDLGGPIQWHPNRGQHHTILKWLDDQPMSSVVFLCFGS  293

Query  856   MGSLNPAQIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKG  1035
             MGSL  +Q+REIA  LER G+RFLWSIREP K KLD+P DY +   +LP GF DRT G G
Sbjct  294   MGSLGSSQLREIAIALERTGFRFLWSIREPGKGKLDVPADYANAKEILPEGFLDRTAGIG  353

Query  1036  MVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELG  1215
             +VCGWVPQVTILAH+AIGGF+SHCGWNSILE+L  GVPI TWPIYAEQ +NAFQ+VKELG
Sbjct  354   LVCGWVPQVTILAHQAIGGFISHCGWNSILESLWRGVPIATWPIYAEQQMNAFQLVKELG  413

Query  1216  LAVEITFDYKD-GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVS  1392
             LAVEI  DY++ G  LV +E+VERG++ LM+GD+EVR++VKE S+  +   ++NGSS  S
Sbjct  414   LAVEIRLDYRNEGNDLVPSEEVERGIKCLMEGDNEVRKRVKEMSQKSRIAAVENGSSYAS  473

Query  1393  LGKLIEE  1413
             L  L + 
Sbjct  474   LTSLTDR  480



>gb|KEH37502.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   516 bits (1329),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 248/471 (53%), Positives = 329/471 (70%), Gaps = 11/471 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M + +VVF+STPTIGN+VP VEF+  L+  +  LS T+L+I +P+ PL+ +Y+ S +S  
Sbjct  1     MTKYEVVFISTPTIGNMVPTVEFANHLTKHHPQLSATILVITIPKLPLVNTYLQSRSSSS  60

Query  190   -NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
              NL F+ LP  +PP+PDQ +S I+++S+ I+ H+ +++  L  L   D V++A  FVDMF
Sbjct  61    TNLHFIHLPTVDPPAPDQYQSFIAYISLLIQKHKTNIKNTLLDLIKTDSVKLAALFVDMF  120

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENP  546
              T+ IDVA E+ +PCYL+FASPASFL F LH+P L++         ++  E+ IP F NP
Sbjct  121   STTIIDVANEVSVPCYLFFASPASFLGFTLHLPKLESV--------ESETEFEIPSFRNP  172

Query  547   VPVESFPPFMSK--RHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             +P +  P  + K    ED Y   L HA RYRET+G+VVNT +ELE Y L S++  + + P
Sbjct  173   IPKQVLPNMVLKWKSEEDAYSWILYHAGRYRETKGIVVNTLQELEPYALQSLYDDSQLPP  232

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VY IGPV+D  GPA W P+   +  +M+WLD Q  +SVVFL  GS+GSL   Q+ +IA G
Sbjct  233   VYTIGPVIDLVGPAEWDPNPVQYNYIMEWLDLQPLASVVFLCFGSLGSLEVKQVEKIAIG  292

Query  901   LERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             LERAG RFLW++R PPK++   P DYT  D+VLP GF  R  G G+VCGWVPQ  +LAHK
Sbjct  293   LERAGVRFLWALRGPPKAQSADPRDYTSYDNVLPDGFLTRAAGMGIVCGWVPQAKVLAHK  352

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITL  1260
             A+GGFVSHCGWNSILE+L +GVPI TWP+YAEQ +NAFQMV+ELGLAVEI  DY+ G  L
Sbjct  353   AVGGFVSHCGWNSILESLWYGVPIATWPVYAEQQMNAFQMVRELGLAVEIRLDYRVGGDL  412

Query  1261  VSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             V AE+VE GVR LM+  DE+R KVK+  E C+   M+NGSS  +L  LI+E
Sbjct  413   VQAEEVENGVRTLMNLSDEIRRKVKDMREKCRVALMENGSSYTNLMSLIQE  463



>gb|ADV71363.1| glycosyltransferase GT03H24 [Pueraria montana var. lobata]
Length=468

 Score =   516 bits (1328),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 253/475 (53%), Positives = 334/475 (70%), Gaps = 17/475 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M + +VVF++TP +GNLVP+VEF+ LL+  +   S TVL I MPQRPL+ +Y+ + AS  
Sbjct  1     MTRYEVVFIATPALGNLVPLVEFANLLTKHDPRFSATVLTICMPQRPLVNTYVQARASSA  60

Query  190   -NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRAL-----TKLKSDDDVRIAGF  351
              NL+ L LP  +PP+PDQ +S+++FLS+ I+NH+ HV+ AL     TK  S D VR+A  
Sbjct  61    TNLKLLHLPTVDPPAPDQYQSSVAFLSLHIQNHKHHVKNALLNLIPTKSNSSDSVRLAAL  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
             FVDMF T+ IDVA EL +PCYL+FASPAS+L   LH+P +D          ++  E+ +P
Sbjct  121   FVDMFGTTLIDVAAELAVPCYLFFASPASYLGLTLHLPRVDP--------AESKSEFAVP  172

Query  532   GFENPVPVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
              FE P+P    P   +      ++L +  HA RY+ET+G+VVNT +ELE + L S++  +
Sbjct  173   SFEKPLPRPVLPNTVLDANDGSSWLSY--HAGRYKETKGIVVNTLQELEPHALQSLYNDS  230

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
             ++  VYPIGPVVD  G A+W P+    + +M+WLD Q +SSVVFL  GSMGSL   Q+ E
Sbjct  231   ELPRVYPIGPVVDLAGSAQWDPNPAQCKRIMEWLDQQPASSVVFLCFGSMGSLKANQVEE  290

Query  889   IATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             IA GLERAG RFLW++REPPK+KL+ P DY +  +VLP GF +R    G+VCGWVPQ  +
Sbjct  291   IAIGLERAGIRFLWALREPPKAKLEDPRDYANEVNVLPDGFLERMAEMGLVCGWVPQAKV  350

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD  1248
             LAH A+GGFVSHCGWNSILE+L HGVP+ TWP+YAEQ +NAFQMV+ELGLAVEI  DY+ 
Sbjct  351   LAHDAVGGFVSHCGWNSILESLWHGVPVATWPLYAEQQMNAFQMVRELGLAVEIRVDYRV  410

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             G  LV AE+VE GVR LM G DE+R KVKE S+ C+   ++NGSS  +L  LI+E
Sbjct  411   GGDLVLAEEVENGVRSLMKGCDEIRRKVKEMSDKCRDASIENGSSYNNLMSLIQE  465



>ref|XP_007138551.1| hypothetical protein PHAVU_009G218800g [Phaseolus vulgaris]
 gb|ESW10545.1| hypothetical protein PHAVU_009G218800g [Phaseolus vulgaris]
Length=467

 Score =   514 bits (1323),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 255/474 (54%), Positives = 332/474 (70%), Gaps = 16/474 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             M + +VVF++TP +GNLVP+V+F+ LL+  +   S TVL I MPQRP I +Y+ + AS  
Sbjct  1     MTRYEVVFIATPALGNLVPLVQFANLLTKHDPRFSATVLTIFMPQRPRINAYVQARASSP  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAGF  351
              NL  L LP  +PP PDQ +S+I+FLS+ I+NH+ HV+ A+  L      S D VR+A  
Sbjct  61    SNLRILHLPTVDPPPPDQYQSSIAFLSLHIQNHKHHVKNAILSLLPSDSNSTDSVRLAAV  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
             FVDMFCT+ IDVA EL +PCYLYFASPASFL   LH+P  D+           ++E+ IP
Sbjct  121   FVDMFCTTLIDVAAELAVPCYLYFASPASFLGLTLHLPRADSL---------DSEEFSIP  171

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
              FENP+P  + P  +   ++ +   F  HA+RYRET+G+VVNT  ELE + L S+   + 
Sbjct  172   CFENPLPRSALPNLVLDANDASSW-FSYHARRYRETKGIVVNTLGELEPHALQSLHDDSL  230

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
             +  VYPIGPV+D  G A+W P+   ++ +M+WLD Q + SVV L  GSMGS+   Q+ EI
Sbjct  231   LPRVYPIGPVLDLAGSAQWDPNPVQYKRIMEWLDRQPAGSVVLLCFGSMGSMRANQVEEI  290

Query  892   ATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
             A GLERAG+RFLW +REPPK++L+ P DY +   VLP GF  RT G G+VCGWVPQ  +L
Sbjct  291   AIGLERAGFRFLWVLREPPKAQLEDPTDYLNEVDVLPDGFLKRTAGMGLVCGWVPQAKVL  350

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             +H+AIGGFVSHCGWNSILE+L HGV I TWP+YAEQHLNAFQM+KELGLAVEI+ D + G
Sbjct  351   SHEAIGGFVSHCGWNSILESLWHGVVIATWPVYAEQHLNAFQMIKELGLAVEISTDCRVG  410

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               LV AE VE+GVR LM+G DE+R KVKE SE CK   +++GSS  +L  L++E
Sbjct  411   GDLVRAEAVEKGVRSLMEGSDEIRRKVKEMSEKCKSALIEDGSSYKNLVSLVQE  464



>ref|XP_009363261.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=481

 Score =   513 bits (1320),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 268/476 (56%), Positives = 350/476 (74%), Gaps = 13/476 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS-LASD  186
             M ++ VVF+STP IGNLVP+VEF++LL + ++ L  T+L+I M QRP++ +YI S +A+ 
Sbjct  1     MAKSHVVFISTPGIGNLVPLVEFAQLLVNHDRRLHATILIITMSQRPIVNAYIQSRVATS  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--------KSDDDVRI  342
              ++ FL LP  +PPSPDQ RST+ ++S+ I+NH+ HV+ A+TKL        KS +  ++
Sbjct  61    TSITFLPLPPVDPPSPDQYRSTMGYISLLIQNHKWHVKNAITKLMSSDSAESKSSNSDQV  120

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEY  522
              GFFVDMFCTS IDVA EL IPCYLYFASPA+FLSFMLH+P LDAQ P  +EF D   E 
Sbjct  121   VGFFVDMFCTSMIDVANELGIPCYLYFASPATFLSFMLHLPFLDAQNP--AEFVDMGTEL  178

Query  523   VIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG  702
              IPGF N VP    P  +  +  D Y  +L HA RY ET+G+VVNTF+ELES+ L S+  
Sbjct  179   SIPGFVNSVPPLVLPTAVLNKKGDAYSWYLSHALRYTETKGIVVNTFRELESHALDSL-D  237

Query  703   GNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
              + V  VYPIGPV+D   P +   D   +E V++WLD+Q SSSV+ L  GSMGSL+  Q+
Sbjct  238   TSQVPQVYPIGPVLDLYEPTQ-KRDLNQYESVIRWLDDQPSSSVMLLCFGSMGSLSGPQV  296

Query  883   REIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             REIA GLERAG RFLW++REPPKS+LDLP+D+ ++  VLP GF +RT+  GMVCGW+PQ 
Sbjct  297   REIAYGLERAGVRFLWALREPPKSQLDLPSDHANVKDVLPNGFLERTRELGMVCGWIPQA  356

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              ILAH++IGGF+SHCGWNSILE+L +GVPI TWPIYAEQ +NAF+MVKELGLA+EI  DY
Sbjct  357   KILAHQSIGGFISHCGWNSILESLWYGVPIATWPIYAEQQMNAFEMVKELGLAIEIRLDY  416

Query  1243  KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             ++G  LV+ E+V+R +++LM+G D VR +VKE  E  +   M+NGSS  +LG LI 
Sbjct  417   REGSDLVTGEEVDRSIKRLMNGGDVVRGRVKEMREKSRIALMENGSSYQALGVLIR  472



>ref|XP_003533826.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Glycine max]
Length=492

 Score =   511 bits (1317),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 255/475 (54%), Positives = 332/475 (70%), Gaps = 15/475 (3%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD  186
             IM + +VVF++TP +GNLVP+VEF+ LL+  N  LS TVL +  PQRPLI +Y+ S AS 
Sbjct  24    IMTRFEVVFIATPALGNLVPIVEFADLLTKHNPQLSATVLTVTTPQRPLISTYVQSRASS  83

Query  187   G-NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD-----DDVRIAG  348
               NL+ L LP  +PP+PDQ +S I+F+S+ I+NH+  V+ AL  LK +     D VR+  
Sbjct  84    ATNLKLLHLPTVDPPTPDQYQSFIAFVSLHIQNHKHQVKNALLNLKKNESNSFDSVRLVA  143

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
              FVDMF T+ IDVA EL +PCYL+FASPASFL F LH+  +D   P  SE      E  +
Sbjct  144   LFVDMFSTTLIDVAAELAVPCYLFFASPASFLGFTLHLDRVD---PVESE-----SELAV  195

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P FENP+P  S  P +     D +     HA+RYRET+G+ VNT +ELE + L S++  +
Sbjct  196   PSFENPLP-RSVLPNLVLDANDAFSWVAYHARRYRETKGIFVNTVQELEPHALQSLYNDS  254

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
             ++  VYPIGPV+D  G  +W P+   ++ +M+WLD Q  SSVVF+  GSMGSL   Q+ E
Sbjct  255   ELPRVYPIGPVLDLVGSNQWDPNPAQYKRIMEWLDQQPVSSVVFVCFGSMGSLKANQVEE  314

Query  889   IATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             IATGLE A  RFLW++REPPK++L+ P DYT+   VLP GF +RT   G+VCGWVPQ  +
Sbjct  315   IATGLEMANVRFLWALREPPKAQLEDPRDYTNPKDVLPDGFLERTAEMGLVCGWVPQAVV  374

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD  1248
             LAHKA+GGFVSHCGWNSILE+L HGVPI TWP+YAEQ +NAFQMV+ELGLAVEI  DY+ 
Sbjct  375   LAHKAVGGFVSHCGWNSILESLWHGVPIATWPVYAEQQMNAFQMVRELGLAVEIRVDYRV  434

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             G  LV AE+V  GVR LM G DE+++KVKE S++C+   M+N SS  +L  LI++
Sbjct  435   GGDLVRAEEVLNGVRSLMKGADEIQKKVKEMSDICRSALMENRSSYNNLVFLIQQ  489



>ref|XP_004488213.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Cicer arietinum]
Length=474

 Score =   509 bits (1310),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 254/479 (53%), Positives = 325/479 (68%), Gaps = 19/479 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M + +VVFVSTPTIGN+VP VEF+  L+  N   S T+L I MP RPL+ +Y  S AS  
Sbjct  1     MTRFEVVFVSTPTIGNMVPTVEFANHLTKHNPQFSATILFITMPHRPLVNTYAQSRASTA  60

Query  190   -NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKS--------DDDVRI  342
              NL F+ LP  +PP+PDQ +S+I +L + I+N + +++ AL  L +         D V +
Sbjct  61    TNLRFIYLPTVDPPTPDQYQSSIGYLCLLIQNQKNNIKNALQNLTTTESTSESPSDSVEL  120

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEY  522
             AG F+DMF T+ IDVA EL IPCYL+FASPASFL FMLH+P +        E  ++  E+
Sbjct  121   AGLFIDMFSTTIIDVAVELAIPCYLFFASPASFLGFMLHLPRV--------ELIESETEF  172

Query  523   VIPGFENPVPVESFPPFMS--KRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSM  696
              IP F+NP+P    P  +   K  ED Y     HA+RYRE +G+VVNT +ELE Y L S+
Sbjct  173   EIPCFKNPLPRLVLPNMVLNWKTEEDGYSWVSYHARRYREAKGIVVNTLEELEPYALQSL  232

Query  697   FGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
                  + PVYPIGP++D  GP +W+P+   +  +M+WLD Q  +SVVFL  GSMGSL   
Sbjct  233   NNDLQLPPVYPIGPILDLVGPVQWNPNPVQYNYIMEWLDMQPVASVVFLCFGSMGSLEVK  292

Query  877   QIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             Q+ +IA GLE+AG RFLW++REPPK++L+ P DY   + VLP GF  RT   G+VCGW P
Sbjct  293   QVEQIAFGLEQAGVRFLWALREPPKAQLEDPRDYVSHEDVLPDGFLKRTVEVGIVCGWAP  352

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             Q  +LAHKAIGGFVSHCGWNSILE+L +GVPI TWP+YAEQ +NAFQMV+ELGLAVEI  
Sbjct  353   QAKVLAHKAIGGFVSHCGWNSILESLWYGVPIATWPVYAEQQMNAFQMVRELGLAVEIRV  412

Query  1237  DYKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DY  G  LV AE+VE GV  LM+G DE+R+KVK+ SE C+   M+NGSS   L  LI E
Sbjct  413   DYSKGRDLVRAEEVENGVSTLMNGSDEIRKKVKDMSEKCRVALMENGSSYTDLLSLIHE  471



>gb|KDO77391.1| hypothetical protein CISIN_1g047945mg [Citrus sinensis]
Length=482

 Score =   507 bits (1306),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 255/492 (52%), Positives = 339/492 (69%), Gaps = 41/492 (8%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYID------  171
             M++  +VF STP IGNLVPVVEF++LL+++++  S TVL+I +P+RP++ SYI       
Sbjct  3     MRKLNLVFTSTPGIGNLVPVVEFARLLTNRDRRFSATVLIITIPERPIVNSYIQTRGTAL  62

Query  172   SLASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDD------  333
             S+  + ++ FL LP  +P SPD+ +S++ +L   IE H+PHV+ A+  L + +       
Sbjct  63    SVHDNDDVNFLHLPTVDPLSPDEYQSSLGYLCTLIEKHKPHVKHAIANLMATESGSDNAV  122

Query  334   -VRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDA  510
              VR+AG FVDMFCTS IDVA EL IP YLYFASPASFL F+L+ PTLDAQ+   +EF D+
Sbjct  123   SVRVAGLFVDMFCTSMIDVANELGIPSYLYFASPASFLGFLLYFPTLDAQLA--TEFVDS  180

Query  511   AKEYV-----------IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVN  657
               E +           IP F NP+P    P    KR +D Y+ +L H +RY ET+G++VN
Sbjct  181   DTELIVPKDSSITELKIPSFANPLPPLVLPTTALKRKQDGYMWYLYHGRRYLETKGMIVN  240

Query  658   TFKELESYCLGSMFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVV  837
             TF+ELE Y + S+    ++ PVYPIGPV+D  G A+WHPD  + E +M+WLD+Q  SSVV
Sbjct  241   TFQELEPYAIDSL-RVTEMPPVYPIGPVLDLHGLAQWHPDRASQEKIMRWLDDQPPSSVV  299

Query  838   FLTTGSMGSLNPAQIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSD  1017
             FL  GSMGSL+ AQ+REIA GLER G+RFLWSIREP K  + LP +YT+L+ +LP GF  
Sbjct  300   FLCFGSMGSLSEAQLREIAVGLERTGFRFLWSIREPSKGTIYLPGEYTNLEEILPEGFFH  359

Query  1018  RTKGKGMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQ  1197
             RT   G+              A+GGFVSHCGWNSILE+L  GVP+ TWP+YAEQ +NAFQ
Sbjct  360   RTAKIGL--------------AVGGFVSHCGWNSILESLWFGVPMATWPVYAEQQMNAFQ  405

Query  1198  MVKELGLAVEITFDYKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNG  1377
             +VKE GLAVEI  DY++G  LV AE++E+G+++LMDGDD+VR KVK+  E  +   M++G
Sbjct  406   LVKEFGLAVEIRLDYREGSDLVLAEELEKGLQQLMDGDDQVRRKVKQMKEKSRTAMMEDG  465

Query  1378  SSAVSLGKLIEE  1413
             SS  SLG LIEE
Sbjct  466   SSYKSLGSLIEE  477



>gb|KEH37757.1| UDP-glucose flavonoid 3-O-glucosyltransferase [Medicago truncatula]
Length=464

 Score =   496 bits (1278),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 246/471 (52%), Positives = 324/471 (69%), Gaps = 13/471 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             M + +VVF+STPTIGN+VP VEF+  L+     LS T+L+I +P+ PL+ +Y+ S  +S 
Sbjct  1     MTKFEVVFISTPTIGNMVPTVEFANHLTKHYPQLSPTILIITIPKLPLVNTYLQSRPSSA  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
              NL F+ LP  +PP+PDQ +S I+++S+ I+ H+ +++  L  L   +   +   FVDMF
Sbjct  61    ANLRFIHLPTIDPPTPDQYQSLIAYISLLIQKHKNNIKNTLLNLTKTNS--LVALFVDMF  118

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENP  546
              T+ IDVA E+ +PCYL+FASPASFL F LHIP L +   +N        E+ IP F+N 
Sbjct  119   STTIIDVANEIFVPCYLFFASPASFLGFTLHIPRLKSVELEN--------EFEIPTFQNL  170

Query  547   VPVESFPPFM--SKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             +P    P  +  +K  ED Y     HA+RYRET+G+VVNT +ELE Y L S++    + P
Sbjct  171   LPKLVLPDLVLDTKTEEDGYSWVSYHARRYRETKGIVVNTLQELEPYALQSLYKDLQLPP  230

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VYPIGPV+D  GP +W P+   +  +M+WLD Q   SVVFL  GS+GSL   Q++EIA G
Sbjct  231   VYPIGPVLDLVGPVQWDPNPVQYNYIMEWLDLQSVGSVVFLCFGSLGSLKVKQVQEIAIG  290

Query  901   LERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             LER G RFLW++R PPK++L  P DY   ++VLP GF +RT G G+VCGWVPQ  +LAHK
Sbjct  291   LERVGIRFLWALRGPPKAQLADPRDYASYENVLPDGFLERTVGMGIVCGWVPQAKVLAHK  350

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITL  1260
             A+GGFVSHCGWNSILE+L  GVPI TWP+YAEQ +NAFQMV+ELGLAVEI  DY+ G  L
Sbjct  351   AVGGFVSHCGWNSILESLWFGVPIATWPVYAEQQMNAFQMVRELGLAVEIRLDYRVGGDL  410

Query  1261  VSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             V AE+V+ GV  LM+  DE+R KVKE SE CK   M+NGSS  +L  LI+E
Sbjct  411   VLAEEVKNGVSTLMNNSDEIRRKVKEMSEKCKVSLMENGSSYTNLMSLIQE  461



>ref|XP_007041009.1| UDP-glucosyltransferase, putative [Theobroma cacao]
 gb|EOX96840.1| UDP-glucosyltransferase, putative [Theobroma cacao]
Length=469

 Score =   496 bits (1277),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 246/456 (54%), Positives = 322/456 (71%), Gaps = 28/456 (6%)
 Frame = +1

Query  127   LINMPQRPLIQSYIDS-LASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRR  303
             +I++ +RP++ +YI S +A+  ++ F++LP  +PPS D+ ++ + ++ + I  H+ HV+ 
Sbjct  1     MIDIAERPIVNAYIRSCVATATDINFINLPPVDPPSTDEYQTYLGYICLLIAMHKLHVKN  60

Query  304   ALTKL--------KSDDDVRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLH  459
             A+  L           + VR+AG FVDMFCTS IDVA EL IPCYLYFASP SFL  ML+
Sbjct  61    AIAHLISTESTSDSDSNTVRVAGLFVDMFCTSMIDVANELGIPCYLYFASPVSFLGLMLY  120

Query  460   IPTLDAQ-------------VPKNSEFGDAAKEYVIPGFENPVPVESFPPFMSKRHEDTY  600
             +PTLDA+             VPK+     A+    IPGF NPVP    P  +  R +D Y
Sbjct  121   LPTLDAKFATEFVALDSGLMVPKDPAAASASG-LTIPGFANPVPYRVLPNSVLYRKQDGY  179

Query  601   LPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND-VGPVYPIGPVVDREGPARWHPD  777
               +L HA+RY+ET+G+VVNTF+ELESY + S+  GND   P+YPIGPV+D  GPA+WHP 
Sbjct  180   FWYLHHARRYKETKGIVVNTFRELESYAIDSVSNGNDDWPPIYPIGPVLDLVGPAQWHPQ  239

Query  778   SWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAGYRFLWSIREPPKSK  957
                H  +M+WLDNQ  SSVVFL  GSMGSL+ AQ+REIA GLER+G+RFLWSIREPPK K
Sbjct  240   QAQHGSIMQWLDNQPPSSVVFLCFGSMGSLSEAQLREIAVGLERSGFRFLWSIREPPKMK  299

Query  958   LDLPNDYTDLDHV--LPPGFSDRTK--GKGMVCGWVPQVTILAHKAIGGFVSHCGWNSIL  1125
             LDLP +YT+++ +  LPPGF DR++  G G+VCGWVPQ  IL+H+AIGGFVSHCGWNSIL
Sbjct  300   LDLPGEYTNVEEIEMLPPGFVDRSRRAGTGLVCGWVPQALILSHQAIGGFVSHCGWNSIL  359

Query  1126  EALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLVSAEDVERGVRKLMD  1305
             E++ +GVPI TWP+YAEQ LNAF++V EL LAVEI  DY+ G  LVS E++ER +R+LM 
Sbjct  360   ESIWYGVPIATWPLYAEQQLNAFELVTELELAVEIRADYRKGSDLVSPEELERALRRLMK  419

Query  1306  GDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             G+DEVR K++E  +  +   M NGSS  SL  LIEE
Sbjct  420   GNDEVRRKMREMKQKSRVALMPNGSSYKSLASLIEE  455



>ref|XP_004488204.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Cicer arietinum]
Length=470

 Score =   494 bits (1271),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 242/475 (51%), Positives = 327/475 (69%), Gaps = 15/475 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-D  186
             M + +VVFVSTP +G++V  VEF+  ++  +  +S T+L+I MP   L+ +Y  S AS D
Sbjct  1     MTRFEVVFVSTPAMGHIVSTVEFANYITKNHPEISTTILIITMPHTSLVNTYTQSRASTD  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL----KSDDDVRIAGFF  354
              NL F+ LP  +PP+PDQ +S   FLS+ I+NH+ +++ AL  +     + + V++A  F
Sbjct  61    TNLRFIYLPTVDPPTPDQYQSLNGFLSLLIQNHKNNIKNALLDIMITESTSESVKLAALF  120

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             +D+F T+ IDVAEEL +PCYL FASPASFL FMLH+P +++         ++  E+ IP 
Sbjct  121   IDLFSTTIIDVAEELSVPCYLLFASPASFLGFMLHLPQVESI--------ESDTEFEIPS  172

Query  535   FENPVPVESFPPF-MSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
             F+N +P    P   ++ + ED Y  F  H +RYRET+G++VNT +ELE + L S+     
Sbjct  173   FKNKLPRLVLPNLALNWKTEDGYSWFSYHGRRYRETKGIIVNTLQELEPHALQSLHNDLQ  232

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
             + PVY IGP+VD  GP +W P+   ++ +MKWLD Q  +SVVFL  GSMGSL   Q+ +I
Sbjct  233   LPPVYSIGPIVDHVGPVQWDPNPAQYDYIMKWLDMQPLASVVFLCFGSMGSLEAKQVEQI  292

Query  892   ATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
             A GLER G RFLW++REPPK++L+ P +YT  + VLP GF  RT   G+VCGWVPQV +L
Sbjct  293   AIGLERVGVRFLWALREPPKTRLEGPRNYTSHEDVLPVGFLKRTAEMGIVCGWVPQVKVL  352

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AHKA+GGFVSHCGWNSILE+L +GVPI TWPIYAEQ +NAFQMVKELGLAVEI  DY+ G
Sbjct  353   AHKAVGGFVSHCGWNSILESLWYGVPIATWPIYAEQQMNAFQMVKELGLAVEIRMDYRRG  412

Query  1252  ITL-VSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               L V AE+VE G+  LM+G DE+R KVK+ SE C+   M+NGSS  +L   I +
Sbjct  413   GDLVVQAEEVENGISTLMNGSDEIRRKVKDMSEKCRVALMENGSSYTNLLSFIHQ  467



>ref|XP_010098469.1| Putative UDP-glucose flavonoid 3-O-glucosyltransferase 3 [Morus 
notabilis]
 gb|EXB75129.1| Putative UDP-glucose flavonoid 3-O-glucosyltransferase 3 [Morus 
notabilis]
Length=477

 Score =   488 bits (1257),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 244/471 (52%), Positives = 324/471 (69%), Gaps = 14/471 (3%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQN-QNLSVTVLLINMPQRPLIQSYIDSL--AS  183
             K  +V  ++TP +G L P VEF++ L  +    LS TVLLI++P  P I SY  SL   S
Sbjct  12    KNDQVFLIATPAMGMLTPAVEFARRLVRRCPGRLSATVLLISVPHWPTIHSYTQSLLATS  71

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDM  363
               +L F+ LP  +PPSPD   S ++     I+ H+PHV+ A+ + K     R+ G FVD+
Sbjct  72    SPDLNFVLLPNMDPPSPDHFNSYVAHTFALIDQHKPHVKNAIAESKQ----RVVGLFVDL  127

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFEN  543
             FCTS IDVA++L +P YL+F SPA FLSF+L +P LD+Q+   S       E+ I GF N
Sbjct  128   FCTSMIDVADDLGVPSYLFFTSPAGFLSFVLDLPILDSQLASES-----VAEFRIRGFAN  182

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
             PVP       +  R  D Y  +L HA+ YR+T+G+V+NT +ELES+ L S+     V  V
Sbjct  183   PVPRRVLHKTILDRG-DGYSRYLYHARMYRKTKGIVINTLRELESFVLDSLSTSGSVPKV  241

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             YP+GP++D  G A+WHPD   +E V +WLD Q  SSVVFL  GSMGSL+  Q++E+A G+
Sbjct  242   YPVGPILDLNGSAQWHPDRAQYEKVKRWLDKQPESSVVFLCFGSMGSLSGPQVKELAFGI  301

Query  904   ERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKA  1083
             ERAG+RF+WS REPPK+KL LP +Y + D  LP GF +RT   G++C WVPQVTILAH+A
Sbjct  302   ERAGFRFIWSCREPPKTKLGLPTEYPNFDEALPNGFLERTATIGLMCRWVPQVTILAHRA  361

Query  1084  IGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGIT-L  1260
             +GGFVSHCGWNS LE++ HG+PI TWPIYAEQ++NAF+MVKELGLAVEI+ DY+ G + +
Sbjct  362   VGGFVSHCGWNSTLESMWHGIPIATWPIYAEQNMNAFEMVKELGLAVEISLDYRQGGSEV  421

Query  1261  VSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +SAE++E+ +R LM+GD EVR KVKE  E C+   M+NGSS  SL  L+EE
Sbjct  422   ISAEEIEKRIRILMEGDVEVRAKVKEMKEKCRMALMENGSSYGSLSDLVEE  472



>gb|KCW75564.1| hypothetical protein EUGRSUZ_E04315, partial [Eucalyptus grandis]
Length=485

 Score =   488 bits (1255),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 242/473 (51%), Positives = 319/473 (67%), Gaps = 12/473 (3%)
 Frame = +1

Query  16    QAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS-------  174
             + +VVFV+TP IGNLVP VEF++ L+  +     T+L+I  P RPL+ SY+ S       
Sbjct  5     EVEVVFVATPAIGNLVPAVEFAQRLADHDPQFRSTILVITDPHRPLVSSYVHSRAASAAA  64

Query  175   LASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFF  354
              + DGNL F+ LP A+ P+P + +S  +++S+ + NH P +++A+  L+S    R+A  F
Sbjct  65    ASGDGNLRFVHLPQADLPNPSEYQSAFAYISLHMANHAPLIKQAIVNLRSAG-TRVAALF  123

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             +DMF     DVA EL +P YL+FASPASFL F  +I  LD +  +  E  D + E  IP 
Sbjct  124   LDMFTIPMADVALELGMPHYLFFASPASFLGFTFYI--LDPEAREAIESEDMSIELPIPS  181

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F N VP    P  + K  +D +  FL HA RY  T+G+ +NTF ELE + L S+   + V
Sbjct  182   FANSVPKRVLPSLVLK-WKDAFTMFLAHAGRYGGTKGIAINTFDELEGHALQSL-STSAV  239

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              PVY +GP++D +GP +WHP     E +++WLD Q  SSVVFL  GSMGSL   Q+REIA
Sbjct  240   PPVYSVGPIIDLDGPVKWHPQRAEQEAIVQWLDKQPPSSVVFLCFGSMGSLGAPQVREIA  299

Query  895   TGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
              GLER+G+RFLWS+REPP+ KLD P +Y  +D  LP GF DRT   G+VCGWVPQVTILA
Sbjct  300   NGLERSGFRFLWSLREPPRGKLDFPGEYEKIDQPLPEGFLDRTAETGLVCGWVPQVTILA  359

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGI  1254
             HKAIGGFVSHCGWNSILE+L  GVP  TWPIYAEQ +NAFQMV ELGLAVE+  DY++G 
Sbjct  360   HKAIGGFVSHCGWNSILESLWSGVPTATWPIYAEQQMNAFQMVAELGLAVEVRLDYREGS  419

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              LVSAE++ERG+R LMDG  E R KVKE  +  +    ++GSS  S+ +L+++
Sbjct  420   ALVSAEELERGLRCLMDGGGEARSKVKEMRDKSRAAVAEHGSSYASMRRLVQQ  472



>ref|XP_010058058.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
Length=491

 Score =   488 bits (1255),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 242/473 (51%), Positives = 319/473 (67%), Gaps = 12/473 (3%)
 Frame = +1

Query  16    QAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS-------  174
             + +VVFV+TP IGNLVP VEF++ L+  +     T+L+I  P RPL+ SY+ S       
Sbjct  5     EVEVVFVATPAIGNLVPAVEFAQRLADHDPQFRSTILVITDPHRPLVSSYVHSRAASAAA  64

Query  175   LASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFF  354
              + DGNL F+ LP A+ P+P + +S  +++S+ + NH P +++A+  L+S    R+A  F
Sbjct  65    ASGDGNLRFVHLPQADLPNPSEYQSAFAYISLHMANHAPLIKQAIVNLRSAG-TRVAALF  123

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             +DMF     DVA EL +P YL+FASPASFL F  +I  LD +  +  E  D + E  IP 
Sbjct  124   LDMFTIPMADVALELGMPHYLFFASPASFLGFTFYI--LDPEAREAIESEDMSIELPIPS  181

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F N VP    P  + K  +D +  FL HA RY  T+G+ +NTF ELE + L S+   + V
Sbjct  182   FANSVPKRVLPSLVLK-WKDAFTMFLAHAGRYGGTKGIAINTFDELEGHALQSL-STSAV  239

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              PVY +GP++D +GP +WHP     E +++WLD Q  SSVVFL  GSMGSL   Q+REIA
Sbjct  240   PPVYSVGPIIDLDGPVKWHPQRAEQEAIVQWLDKQPPSSVVFLCFGSMGSLGAPQVREIA  299

Query  895   TGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
              GLER+G+RFLWS+REPP+ KLD P +Y  +D  LP GF DRT   G+VCGWVPQVTILA
Sbjct  300   NGLERSGFRFLWSLREPPRGKLDFPGEYEKIDQPLPEGFLDRTAETGLVCGWVPQVTILA  359

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGI  1254
             HKAIGGFVSHCGWNSILE+L  GVP  TWPIYAEQ +NAFQMV ELGLAVE+  DY++G 
Sbjct  360   HKAIGGFVSHCGWNSILESLWSGVPTATWPIYAEQQMNAFQMVAELGLAVEVRLDYREGS  419

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              LVSAE++ERG+R LMDG  E R KVKE  +  +    ++GSS  S+ +L+++
Sbjct  420   ALVSAEELERGLRCLMDGGGEARSKVKEMRDKSRAAVAEHGSSYASMRRLVQQ  472



>gb|AGU14122.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   485 bits (1249),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 242/463 (52%), Positives = 311/463 (67%), Gaps = 19/463 (4%)
 Frame = +1

Query  58    LVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG-NLEFLSLPAAEPPSP  234
             +VP VEF+  L+  N   S T+L I MP RPL+ +Y  S AS   NL F+ LP  +PP+P
Sbjct  1     MVPTVEFANHLTKHNPQFSATILFITMPHRPLVNTYAQSRASTATNLRFIYLPTVDPPTP  60

Query  235   DQNRSTISFLSIWIENHEPHVRRALTKLKS--------DDDVRIAGFFVDMFCTSFIDVA  390
             DQ +S+I +L + I+N + +++ AL  L +         D V +AG F+DMF T+ IDVA
Sbjct  61    DQYQSSIGYLCLLIQNQKNNIKNALQNLTTTESTSESPSDSVELAGLFIDMFSTTIIDVA  120

Query  391   EELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPVPVESFPP  570
              EL IPCYL+FASPASFL FMLH+P +        E  ++  E+ IP F+NP+P    P 
Sbjct  121   VELAIPCYLFFASPASFLGFMLHLPRV--------ELIESETEFEIPCFKNPLPRLVLPN  172

Query  571   FMS--KRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYPIGPVV  744
              +   K  ED Y     HA+RYRE +G+VVNT +ELE Y L S+     + PVYPIGP++
Sbjct  173   MVLNWKTEEDGYSWVSYHARRYREAKGIVVNTLEELEPYALQSLNNDLQLPPVYPIGPIL  232

Query  745   DREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAGYRF  924
             D  GP +W+P+   +  +M+WLD Q  +SVVFL  GSMGSL   Q+ +IA GLE+AG RF
Sbjct  233   DLVGPVQWNPNPVQYNYIMEWLDMQPVASVVFLCFGSMGSLEVKQVEQIAFGLEQAGVRF  292

Query  925   LWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIGGFVSH  1104
             LW++REPPK++L+ P DY   + VLP GF  RT   G+VCGW PQ  +LAHKAIGGFVSH
Sbjct  293   LWALREPPKAQLEDPRDYVSHEDVLPDGFLKRTVEVGIVCGWAPQAKVLAHKAIGGFVSH  352

Query  1105  CGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLVSAEDVER  1284
             CGWNSILE+L +GVPI TWP+YAEQ +NAFQMV+ELGLAVEI  DY  G  LV AE+VE 
Sbjct  353   CGWNSILESLWYGVPIATWPVYAEQQMNAFQMVRELGLAVEIRVDYSKGRDLVRAEEVEN  412

Query  1285  GVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             GV  LM+G DE+R+KVK+ SE C+   M+NGSS   L  LI E
Sbjct  413   GVSTLMNGSDEIRKKVKDMSEKCRVALMENGSSYTDLLSLIHE  455



>gb|AGU14121.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   479 bits (1232),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 234/462 (51%), Positives = 317/462 (69%), Gaps = 15/462 (3%)
 Frame = +1

Query  49    IGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-DGNLEFLSLPAAEP  225
             +G++V  VEF+  ++  +  +S T+L+I MP   L+ +Y  S AS D NL F+ LP  +P
Sbjct  1     MGHIVSTVEFANYITKNHPEISTTILIITMPHTSLVNTYTQSRASTDTNLRFIYLPTVDP  60

Query  226   PSPDQNRSTISFLSIWIENHEPHVRRALTKL----KSDDDVRIAGFFVDMFCTSFIDVAE  393
             P+PDQ +S   FLS+ I+NH+ +++ AL  +     + + V++A  F+D+F T+ IDVAE
Sbjct  61    PTPDQYQSLNGFLSLLIQNHKNNIKNALLDIMITESTSESVKLAALFIDLFSTTIIDVAE  120

Query  394   ELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPVPVESFPPF  573
             EL +PCYL FASPASFL FMLH+P +++         ++  E+ IP F+N +P    P  
Sbjct  121   ELSVPCYLLFASPASFLGFMLHLPQVESI--------ESDTEFEIPSFKNKLPRLVLPNL  172

Query  574   -MSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYPIGPVVDR  750
              ++ + ED Y  F  H +RYRET+G++VNT +ELE + L S+     + PVY IGP+VD 
Sbjct  173   ALNWKTEDGYSWFSYHGRRYRETKGIIVNTLQELEPHALQSLHNDLQLPPVYSIGPIVDH  232

Query  751   EGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAGYRFLW  930
              GP +W P+   ++ +MKWLD Q  +SVVFL  GSMGSL   Q+ +IA GLER G RFLW
Sbjct  233   VGPVQWDPNPAQYDYIMKWLDMQPLASVVFLCFGSMGSLEAKQVEQIAIGLERVGVRFLW  292

Query  931   SIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIGGFVSHCG  1110
             ++REPPK++L+ P +YT  + VLP GF  RT   G+VCGWVPQV +LAHKA+GGFVSHCG
Sbjct  293   ALREPPKTRLEGPRNYTSHEDVLPVGFLKRTAEMGIVCGWVPQVKVLAHKAVGGFVSHCG  352

Query  1111  WNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITL-VSAEDVERG  1287
             WNSILE+L +GVPI TWPIYAEQ +NAFQMVKELGLAVEI  DY+ G  L V AE+VE G
Sbjct  353   WNSILESLWYGVPIATWPIYAEQQMNAFQMVKELGLAVEIRMDYRRGGDLVVQAEEVENG  412

Query  1288  VRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +  LM+G DE+R KVK+ SE C+   M+NGSS  +L   I +
Sbjct  413   ISTLMNGSDEIRRKVKDMSEKCRVALMENGSSYTNLLSFIHQ  454



>gb|KGN64458.1| hypothetical protein Csa_1G056940 [Cucumis sativus]
Length=475

 Score =   475 bits (1223),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 236/468 (50%), Positives = 325/468 (69%), Gaps = 8/468 (2%)
 Frame = +1

Query  25    VVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS---LASDGNL  195
             +VF+ TP IGNLVP VEF+  L + +    VT L I++P R L+ +Y  S   L+   NL
Sbjct  8     LVFICTPAIGNLVPAVEFAIRLINHDSRFFVTFLAIDIPGRSLVNAYTQSRSSLSPSPNL  67

Query  196   EFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD--DDVRIAGFFVDMFC  369
             +F+ LP+ +PPSP+   S  ++LS+   +H+P+V+  L+ L+    +  RI G FVDMF 
Sbjct  68    QFIHLPSLQPPSPNLYHSHTAYLSLIFNSHKPNVKHTLSDLQKKLPNSARIVGMFVDMFT  127

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
             T+FIDVA +L IP YL+FASPA+FLS M+ +   D     NS   ++  E+V+P + +P+
Sbjct  128   TTFIDVANDLQIPPYLFFASPATFLSLMVQVSKTDHD-RFNSLIRNSEAEFVLPSYVHPL  186

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYP  729
              V   P  +SK  ED    +  H +R+ ET+G+V+NTF+ELE + L S+   ++V PVY 
Sbjct  187   TVSMLPLTLSKT-EDGLFWYGYHGRRFGETKGIVINTFEELEPHALRSL-ELDEVPPVYA  244

Query  730   IGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLER  909
             IGP+VD  GPA+W       E V+KWLD Q   SVV L+ GSMGSL+  Q+REIA GLER
Sbjct  245   IGPMVDLGGPAQWQGGEGRVERVVKWLDGQEEGSVVLLSFGSMGSLDEGQVREIAFGLER  304

Query  910   AGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIG  1089
              G+RF+W +R+PPK+KL+ P+DY+DL  VLP GF  RT G+G+VCGWVPQVTIL+H+AIG
Sbjct  305   GGFRFVWVVRQPPKAKLEQPDDYSDLSDVLPEGFLSRTAGRGLVCGWVPQVTILSHRAIG  364

Query  1090  GFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLVSA  1269
             GFVSHCGWNSILE+L  GVPI TWP+YAEQ +NAF+MVKEL LAVE+  DY +G  +V+ 
Sbjct  365   GFVSHCGWNSILESLWFGVPIATWPLYAEQQMNAFEMVKELELAVEVRLDYMEGSKVVTG  424

Query  1270  EDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             E++ER +R+LMD +++V+ +V    E CK V M+NGS+ V+   LIE+
Sbjct  425   EELERALRRLMDDNNKVKSRVNRMREKCKMVLMENGSAYVAFNSLIEK  472



>gb|KDO77236.1| hypothetical protein CISIN_1g039408mg [Citrus sinensis]
Length=456

 Score =   474 bits (1220),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 248/486 (51%), Positives = 327/486 (67%), Gaps = 54/486 (11%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYI---DSLA  180
             MK+ +VV + TP +GNLVP+VEF+ LL+++++    TVL++ +P+RP++ +Y+   D+LA
Sbjct  1     MKKFRVVLICTPEMGNLVPLVEFAHLLTNRDRRFCATVLIMTVPERPIVNAYVKSRDALA  60

Query  181   SDG---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDV  336
             +     N+ F+ LP+ +PPSPDQ +ST+ +LS++IE H+PHV+  +T L      S+D  
Sbjct  61    TTTDAHNINFVYLPSVDPPSPDQYKSTLGYLSLFIEKHKPHVKNEITNLIETESDSEDSD  120

Query  337   RIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQ-----VPKNSEF  501
             R+AG F+DMFCTS  DVA +L IPCYLYFASPASFL FMLH P +DAQ     V  N++F
Sbjct  121   RVAGLFIDMFCTSMTDVANQLGIPCYLYFASPASFLGFMLHFPNIDAQIANEFVESNTDF  180

Query  502   ---GDAAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKEL  672
                 D+  E VIP F NP+P    P  + KR  D Y+ +L+HA RY ET G+VVNTF+EL
Sbjct  181   FVPKDSTTELVIPSFANPLPPSVLPSTVLKRKRDGYVWYLRHAARYMETEGIVVNTFQEL  240

Query  673   ESYCLGSMFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTG  852
             E Y + S+   N + PVYPIGPV+D  GPA+WHPD  +HE +MKWLD+Q  SSVVFL  G
Sbjct  241   EPYAIESI-SVNGMPPVYPIGPVLDLNGPAQWHPDRVHHESIMKWLDDQPPSSVVFLCFG  299

Query  853   SMGSLNPAQIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLD--HVLPPGFSDRTK  1026
             SMGS    Q+REIA GL+R G+RFLWSIREP KSK+ LP +YT+L    +LP GF +RT 
Sbjct  300   SMGSFVGPQLREIAIGLQRVGFRFLWSIREPSKSKIYLPGEYTNLKVKEMLPEGFLNRTA  359

Query  1027  GKGMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVK  1206
             G G+                              +L +GVPI TWP+YAEQ +NAF++VK
Sbjct  360   GVGL------------------------------SLWYGVPIATWPLYAEQQMNAFELVK  389

Query  1207  ELGLAVEITFDYKD--GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGS  1380
             EL LAVEI  DY+D  G  LVSAE++E G+R+LMDGDDEVR+KVKE  E  +   M+ GS
Sbjct  390   ELRLAVEIRLDYRDGRGSDLVSAEEIEWGLRRLMDGDDEVRKKVKEMREKSRTAVMEEGS  449

Query  1381  SAVSLG  1398
             S  SLG
Sbjct  450   SNKSLG  455



>ref|XP_010058060.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
Length=487

 Score =   474 bits (1220),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 242/471 (51%), Positives = 322/471 (68%), Gaps = 9/471 (2%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             +Q +V FV+ P IGNLVP VEF++ L++ +     TVL+I  P +P++ SY+DSL+S  +
Sbjct  4     RQVEVAFVAKPGIGNLVPAVEFARRLANHDPRFRSTVLVITDPHQPIVSSYVDSLSSSSS  63

Query  193   L----EFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVD  360
                   F+ LP A+ P P + +ST++ +S+ I NH P V+ AL +L+S   VR+A  F+D
Sbjct  64    GGGGLRFVHLPMADLPRPGEYQSTLAHISLHIANHAPLVKEALLELRSTG-VRVAALFLD  122

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFE  540
             MF     DVA EL IP YL+FASPASFL F L++  LD +  +  E  D   +  +P F 
Sbjct  123   MFTVPMADVASELGIPHYLFFASPASFLGFTLYL--LDPEAREAIESEDMTIDLPVPSFV  180

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             + +P    P  +    ED    +L HA RY  T G+VVNTF+ELE + L ++       P
Sbjct  181   SSLPKRVLPSSVLN-GEDALAWWLAHAGRYGGTEGIVVNTFEELEVHALRALRASVS-SP  238

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VYP+GPV+D +GP +WHP     E +++WLD Q  +SVVFL  GSMGSL+  Q++EIA G
Sbjct  239   VYPVGPVIDLDGPVKWHPQRAEQEALVQWLDKQPPASVVFLCFGSMGSLSTPQVKEIADG  298

Query  901   LERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             LERAG+RFLWS+REPP+ KL+ P DY ++D  LP GF DRT   G+VCGWVPQVTILAHK
Sbjct  299   LERAGFRFLWSLREPPRGKLENPTDYANVDQALPEGFLDRTAETGLVCGWVPQVTILAHK  358

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITL  1260
             AIGGFVSHCGWNSILE+L +GVP  TWP+Y+EQ +NAFQMV ELGLAVE+  DY+ G TL
Sbjct  359   AIGGFVSHCGWNSILESLWYGVPTATWPVYSEQQMNAFQMVAELGLAVEVRLDYRVGSTL  418

Query  1261  VSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             VSAE++ERG+R LMD D EVR KVKE  +  +    ++GSS  S+ +L++E
Sbjct  419   VSAEELERGLRHLMDSDGEVRSKVKEMRDKSRMAVTEHGSSHASMRRLVQE  469



>ref|XP_010260710.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nelumbo 
nucifera]
 ref|XP_010260711.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nelumbo 
nucifera]
Length=478

 Score =   472 bits (1215),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 235/475 (49%), Positives = 322/475 (68%), Gaps = 9/475 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             M++ +VVFV    +G+L   VE +K L H++  LS+TVL +  P    +  Y++SLA S+
Sbjct  1     MEKTEVVFVPIYGVGHLFSSVELAKRLIHRDDRLSITVLCMRPPSFYGVDPYVESLAASN  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDD----VRIAGFF  354
              ++ F+ LP  +PPSP+       F+S+++E+++PHVR ALT+L S       VR+AG  
Sbjct  61    PSIRFIGLPQVDPPSPEVYNGPEGFISLFVESYKPHVRHALTQLMSPGSGAHTVRVAGMV  120

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             +D+FCTS IDVA E  IP YL+F S A  L  MLH+PTLD Q+P  +E  DA  E   P 
Sbjct  121   IDLFCTSMIDVANEFGIPSYLFFTSGAGLLGLMLHLPTLDTQIPTGTELKDAETELKFPN  180

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F NPVP  S P  +  R E  Y  F+ H +R++E +G+++NTF E ES+ + S+  G   
Sbjct  181   FVNPVPPFSLPKPLWNRKEHGYTWFVYHGRRFKEVKGIIINTFAEFESHAVNSLSDGQTP  240

Query  715   GPVYPIGPVVDREGPARWHPDSWNHEL--VMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
               +YP+GP+V  EG +    D    +   +MKWLD+Q  SSVV L  GSMG  + AQ++E
Sbjct  241   A-IYPVGPLVQLEGLSHSLSDHTRTQYSEIMKWLDDQPPSSVVLLCFGSMGGFDEAQVKE  299

Query  889   IATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             IA GLER+GYRFLWS+R+  +  + +PN Y +   VLP GF +RT+G+G +CGWVPQV +
Sbjct  300   IAIGLERSGYRFLWSLRQA-RVGMPMPNAYPNPKEVLPDGFLERTEGRGFICGWVPQVKV  358

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD  1248
             LAH AIGGFVSHCGWNS LE+L +GVP+ TWP+YAEQHLNAFQ+VKELGLAVE+  +Y++
Sbjct  359   LAHPAIGGFVSHCGWNSTLESLWYGVPLATWPLYAEQHLNAFQLVKELGLAVELRLEYRN  418

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             G+ L SAE+VERG+R LM  D EVR +V+E  E  + V ++ GSS VSLG+LIE+
Sbjct  419   GVDLASAEEVERGMRSLMAADSEVRTRVREMGEKSRAVLVEGGSSFVSLGRLIED  473



>ref|XP_008440340.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Cucumis 
melo]
Length=478

 Score =   471 bits (1212),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 233/468 (50%), Positives = 322/468 (69%), Gaps = 8/468 (2%)
 Frame = +1

Query  25    VVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS---LASDGNL  195
             +VF+ TP IGNLVP VEF+  L + +    VT L I++P   L+ +Y  S   L+   NL
Sbjct  8     LVFICTPAIGNLVPAVEFATRLINHDSRFFVTFLSIDIPGTSLVTAYTQSRSSLSPSPNL  67

Query  196   EFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFFVDMFC  369
             +F+ LP+ +PPSP+   S +++LS+   +H+P+V+ A++ L  K  D  RI G FVDMF 
Sbjct  68    QFIHLPSLQPPSPNLYHSYVAYLSLIFNSHKPNVKHAISDLQKKLHDSSRIVGIFVDMFT  127

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
             T+FIDVA +L IP YL+FASPA+FL  M+H+   D     N+   ++  E+V+P +   +
Sbjct  128   TTFIDVANDLQIPSYLFFASPATFLGLMIHLSKTDHD-RFNALIRNSEAEFVLPSYVQSL  186

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYP  729
              V   PP +    ED    +  H +RY ET+G+V+NTF+ELE + L S+   ++V PVY 
Sbjct  187   TVSMLPPTLLTT-EDGLFWYGYHGRRYGETKGIVINTFEELEPHALRSL-DLDEVPPVYA  244

Query  730   IGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLER  909
             +GPVVD  GP +W       E V+KWLD Q   SVV L+ GSMGSL+  Q+REIA GLER
Sbjct  245   VGPVVDLGGPGQWQAGEGRLERVVKWLDGQEEGSVVLLSFGSMGSLDEDQVREIAFGLER  304

Query  910   AGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIG  1089
             AG+RF+W +R+PPK+ ++ P+DY+DL  VLP GF  RT G+G+VCGW PQVTIL+H+AIG
Sbjct  305   AGFRFVWVVRQPPKTTIEQPDDYSDLSDVLPEGFLSRTAGQGLVCGWAPQVTILSHRAIG  364

Query  1090  GFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLVSA  1269
             GFVSHCGWNSILE+L  GVPI TWP+YAEQ +NAF+MVKEL LAVEI  DY+ G  +V+ 
Sbjct  365   GFVSHCGWNSILESLWFGVPIATWPLYAEQQMNAFEMVKELELAVEIRLDYRKGSKVVTG  424

Query  1270  EDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             E++ER +R+LMD ++EV+ +VK   E C+ V ++NGS+  +L  LIE+
Sbjct  425   EELERALRRLMDDNNEVKSRVKRMREKCRVVLVENGSAYNALNSLIEK  472



>ref|XP_010260884.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nelumbo 
nucifera]
Length=493

 Score =   459 bits (1181),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 234/477 (49%), Positives = 320/477 (67%), Gaps = 12/477 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             M++ ++VF      G+L   VE +K +  ++  LS+TVL +  P    I  Y++SLA+  
Sbjct  16    MEKIELVFFPVCGAGHLFSTVELAKRIIDRDDRLSITVLCMQPPSSCGIDPYVESLAASI  75

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD----DDVRIAGFF  354
               + F++LP  +PPSP+   S   F S++I++H+PHVR ALT+L S       VR+AG  
Sbjct  76    PAIRFIALPQVDPPSPEVYTSPEGFASLFIQSHKPHVRNALTQLISSCSGAGTVRVAGLV  135

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             +D FCTS IDVA E  IP YL+F+S A  L  MLH+PTLD Q+P  +EF DA  E   P 
Sbjct  136   IDFFCTSMIDVANEFGIPSYLFFSSTAGLLGLMLHLPTLDTQIPTATEFKDADTELKFPT  195

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F NPV   S P  +   +ED Y  FL H +R++ET+G+++NTF ELES+ + S+  G   
Sbjct  196   FVNPVSPFSLPKPIWNGNEDGYKWFLYHCRRFKETKGIIINTFDELESHAINSLSDGQ-T  254

Query  715   GPVYPIGPVVDREGPARW---HPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
               VYP+GP++D EG +     HP  +    +MKWLD Q   SVV L  GS+G  + AQ++
Sbjct  255   PKVYPVGPLLDLEGRSSHSLSHPTQYKE--IMKWLDEQPPLSVVLLCFGSLGGFDKAQVK  312

Query  886   EIATGLERAGYRFLWSIREPPKSK-LDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             EIA GLER+G+RFLWS+R+  K K + +   Y + + VLP GF +RT+G+GM+ GWVPQV
Sbjct  313   EIAIGLERSGHRFLWSLRQASKEKGMIMSGAYPNPEEVLPDGFLERTEGRGMIRGWVPQV  372

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              +LAH AIGGFVSHCGWNSIL +L HGVP+ TWP+Y EQHLNAFQ+VKELGLAVE+   Y
Sbjct  373   KVLAHPAIGGFVSHCGWNSILASLWHGVPLATWPLYGEQHLNAFQLVKELGLAVELRLKY  432

Query  1243  KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             ++G+ L SAE+VER +R LM GD EV+ +VKE  E  + V++++GSS  SLG+LIE+
Sbjct  433   RNGVDLASAEEVERSIRALMVGDSEVKRRVKEMGEKSRAVFIESGSSFASLGRLIED  489



>ref|XP_004161972.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Cucumis sativus]
Length=464

 Score =   453 bits (1165),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 231/468 (49%), Positives = 317/468 (68%), Gaps = 19/468 (4%)
 Frame = +1

Query  25    VVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS---LASDGNL  195
             +VF+ TP IGNLVP VEF+  L + +    VT L I++P R L+ +Y  S   L+   NL
Sbjct  8     LVFICTPAIGNLVPAVEFAIRLINHDSRFFVTFLAIDIPGRSLVNAYTQSRSSLSPSPNL  67

Query  196   EFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD--DDVRIAGFFVDMFC  369
             +F+ LP+ +PPSP+   S  ++LS+   +H+P+V+  L+ L+    +  RI G FVDMF 
Sbjct  68    QFIHLPSLQPPSPNLYHSHTAYLSLIFNSHKPNVKHTLSDLQKKLPNSARIVGMFVDMFT  127

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
             T+FIDVA +L IP YL+FASPA+FLS M+ +   D     NS   ++  E+V+P + +P+
Sbjct  128   TTFIDVANDLQIPPYLFFASPATFLSLMVQVSKTDHD-RFNSLIRNSEAEFVLPSYVHPL  186

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYP  729
              V   P  +SK  ED    +  H +R+ ET+G+V+NTF+ELE + L S+   ++V PVY 
Sbjct  187   TVSMLPLTLSKT-EDGLFWYGYHGRRFGETKGIVINTFEELEPHALRSL-ELDEVPPVYA  244

Query  730   IGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLER  909
             IGP+VD  GPA+W       E V+KWLD Q   SVV L+ GSMGSL+  Q+REIA GLER
Sbjct  245   IGPMVDLGGPAQWQSGEGRVERVVKWLDGQEEGSVVLLSFGSMGSLDEGQVREIAFGLER  304

Query  910   AGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIG  1089
              G+RF+W +R+PPK+     ND      VLP GF  RT G+G+VCGWVPQVTIL+H+AIG
Sbjct  305   GGFRFVWVVRQPPKA-----ND------VLPEGFLSRTAGRGLVCGWVPQVTILSHRAIG  353

Query  1090  GFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLVSA  1269
             GFVSHCGWNSILE+L  GVPI TWP+YAEQ +NAF+MVKEL LAVE+  DY +G  +V+ 
Sbjct  354   GFVSHCGWNSILESLWFGVPIATWPLYAEQQMNAFEMVKELELAVEVRLDYMEGSKVVTG  413

Query  1270  EDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             E++ER +R+LMD +++V+ +V    E CK V M+NGS+ V+   LIE+
Sbjct  414   EELERALRRLMDDNNKVKSRVNRMREKCKMVLMENGSAYVAFNSLIEK  461



>ref|XP_004145207.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Cucumis sativus]
 ref|XP_004154174.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Cucumis sativus]
Length=499

 Score =   452 bits (1163),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 231/468 (49%), Positives = 317/468 (68%), Gaps = 19/468 (4%)
 Frame = +1

Query  25    VVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS---LASDGNL  195
             +VF+ TP IGNLVP VEF+  L + +    VT L I++P R L+ +Y  S   L+   NL
Sbjct  43    LVFICTPAIGNLVPAVEFAIRLINHDSRFFVTFLAIDIPGRSLVNAYTQSRSSLSPSPNL  102

Query  196   EFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD--DDVRIAGFFVDMFC  369
             +F+ LP+ +PPSP+   S  ++LS+   +H+P+V+  L+ L+    +  RI G FVDMF 
Sbjct  103   QFIHLPSLQPPSPNLYHSHTAYLSLIFNSHKPNVKHTLSDLQKKLPNSARIVGMFVDMFT  162

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
             T+FIDVA +L IP YL+FASPA+FLS M+ +   D     NS   ++  E+V+P + +P+
Sbjct  163   TTFIDVANDLQIPPYLFFASPATFLSLMVQVSKTDHD-RFNSLIRNSEAEFVLPSYVHPL  221

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYP  729
              V   P  +SK  ED    +  H +R+ ET+G+V+NTF+ELE + L S+   ++V PVY 
Sbjct  222   TVSMLPLTLSKT-EDGLFWYGYHGRRFGETKGIVINTFEELEPHALRSL-ELDEVPPVYA  279

Query  730   IGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLER  909
             IGP+VD  GPA+W       E V+KWLD Q   SVV L+ GSMGSL+  Q+REIA GLER
Sbjct  280   IGPMVDLGGPAQWQGGEGRVERVVKWLDGQEEGSVVLLSFGSMGSLDEGQVREIAFGLER  339

Query  910   AGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIG  1089
              G+RF+W +R+PPK+     ND      VLP GF  RT G+G+VCGWVPQVTIL+H+AIG
Sbjct  340   GGFRFVWVVRQPPKA-----ND------VLPEGFLSRTAGRGLVCGWVPQVTILSHRAIG  388

Query  1090  GFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLVSA  1269
             GFVSHCGWNSILE+L  GVPI TWP+YAEQ +NAF+MVKEL LAVE+  DY +G  +V+ 
Sbjct  389   GFVSHCGWNSILESLWFGVPIATWPLYAEQQMNAFEMVKELELAVEVRLDYMEGSKVVTG  448

Query  1270  EDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             E++ER +R+LMD +++V+ +V    E CK V M+NGS+ V+   LIE+
Sbjct  449   EELERALRRLMDDNNKVKSRVNRMREKCKMVLMENGSAYVAFNSLIEK  496



>ref|XP_010260883.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nelumbo 
nucifera]
Length=472

 Score =   448 bits (1152),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 228/472 (48%), Positives = 316/472 (67%), Gaps = 9/472 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M++ ++VFV +P  G+LV  +E +K L  ++  LS+TVL I  P   L   YIDSLAS  
Sbjct  1     MEKEELVFVPSPGAGHLVSTIELAKRLIDRHDRLSITVLCIK-PPSILNAGYIDSLASSA  59

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-KSDDDVRIAGFFVDM  363
               + ++ LP+ +PPSP+  +   SF+S +IE H PHV++A+T+L  S    RIAG  +D+
Sbjct  60    PWIRWIELPSVDPPSPETCKLPFSFISRFIEGHRPHVKQAVTQLMASQRQSRIAGLVLDL  119

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFEN  543
             FC+  IDVA EL IP Y++F SPA+ L  MLH PTL++Q    ++  D+  E +IP + N
Sbjct  120   FCSPLIDVAAELGIPSYMFFTSPAAMLGLMLHFPTLNSQT--TTDLKDSV-ELIIPSYVN  176

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
             PV     P  +  R ED Y+ +L H + +RE +G++VN+F ELES+ + S F      PV
Sbjct  177   PVSPRFLPVSLWIRKEDAYIRWLYHCRPFREAKGIIVNSFSELESHAINS-FSDGRTPPV  235

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             YP+GP++D E       +    + ++KWLD+Q  SSVV L  GSMG     Q++EIA GL
Sbjct  236   YPVGPLIDLESRIHSPSNRIRRDKIVKWLDDQPPSSVVLLCFGSMGGFGAPQVKEIAVGL  295

Query  904   ERAGYRFLWSIREPPKSKLDLPNDYT--DLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             ER+  RFLWS+R+P +  +  P DYT  +L  +LP GF DRT+G+G++CGW+PQV +L H
Sbjct  296   ERSDVRFLWSLRQPSEVMMGPPRDYTSVELGEILPNGFLDRTEGRGLICGWIPQVEVLGH  355

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGIT  1257
              AIGGF+SHCGWNSILE+L  GVP+ TWP+YAEQHLNAF+MV++LGLA+EI  DY++G  
Sbjct  356   PAIGGFISHCGWNSILESLWFGVPVATWPLYAEQHLNAFEMVRDLGLALEIRLDYRNGDD  415

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             LVSAE+VER VR LMDGD EVR +V +  E  +   +  GSS  SLG LI++
Sbjct  416   LVSAEEVERSVRSLMDGDSEVRRRVWDMREKSRATVVDGGSSFSSLGFLIDD  467



>ref|XP_002279427.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=469

 Score =   430 bits (1105),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 230/468 (49%), Positives = 308/468 (66%), Gaps = 8/468 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS-LASD  186
             MK+A++VFVS    G+LV  VEF+K L  ++   SVT+L IN P  P    Y  S LA +
Sbjct  1     MKKAELVFVSVAGRGHLVSTVEFAKRLIQRDDRFSVTILSINSPFGPDAHGYNKSHLAFE  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
               L  + LP  +PP P   +S   FLS++IE++ PHV+ A+  LKS     +AG  +D  
Sbjct  61    PGLSLIDLPPQDPPPPYLKKSIAQFLSVYIESYIPHVKDAIINLKSTRP--LAGVVLDFI  118

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENP  546
             C S IDVA EL +P YL+  S A+ +S ML++PT   Q+  ++ F DA  E VIPGF NP
Sbjct  119   CISMIDVANELGLPSYLFLTSGAALVSLMLYLPTRHTQI--SAAFEDADPELVIPGFINP  176

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VPV   P  +  +H   Y  F++ A+R+RE +G+++NTF ELE + +GS F      PVY
Sbjct  177   VPVSVLPEALRDKH-GGYAAFIKVAQRFREAKGIIINTFTELEPFLVGS-FSDGQAPPVY  234

Query  727   PIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLE  906
              +GPV+D EG A    D  +H+ VM WLD Q  SSVVFL  GS+G+ +  Q+REIA GLE
Sbjct  235   TVGPVLDLEGQAHSSADRADHDKVMSWLDTQPESSVVFLCFGSLGTFDVPQVREIALGLE  294

Query  907   RAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKA  1083
             R+G+RFLWS+R PP   K   P++ T+LD +LP GF +R  GKGM+CGW PQV +LAH+A
Sbjct  295   RSGHRFLWSLRRPPPDGKFGSPSEGTNLDEMLPEGFMERIGGKGMICGWAPQVKVLAHEA  354

Query  1084  IGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLV  1263
             I GFVSHCGWNSILE++ + VPI TWP+YAEQ LNAF+MVKELGLAVE+  D +    +V
Sbjct  355   IAGFVSHCGWNSILESVWNSVPIVTWPLYAEQKLNAFEMVKELGLAVEMRLDSRYDGDVV  414

Query  1264  SAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
              AE+++  VR++M+ D  VR+ VKE  EM +R  M+ GSS  S  +LI
Sbjct  415   MAEEIDGAVRRVMEADSTVRKMVKEMGEMSRRALMEGGSSYNSFERLI  462



>ref|XP_007217386.1| hypothetical protein PRUPE_ppa025943mg [Prunus persica]
 gb|EMJ18585.1| hypothetical protein PRUPE_ppa025943mg [Prunus persica]
Length=473

 Score =   429 bits (1102),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 227/482 (47%), Positives = 314/482 (65%), Gaps = 25/482 (5%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP----QRPLIQSYIDS  174
             + K A++VF+ +P +G+LV  VE +KLL  ++  L +TVL + +P     +  + +Y DS
Sbjct  1     MKKAAELVFIPSPGVGHLVSAVEIAKLLVARDDQLFITVLTMKLPFDCMPKGTVDAYTDS  60

Query  175   LASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL----KSDDDVRI  342
             ++    ++F+ LP     +   N +   FL  +IENH+ HV+ A+TKL    +SD   R+
Sbjct  61    MSQ--RIKFVDLPEEAIETRGINPNL--FLKFFIENHKAHVKDAVTKLTESDQSDSKPRL  116

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKE  519
             AGF VD+FCTS IDVA+E  +P Y++F S A FL  M H+ TL D Q     EF D+  E
Sbjct  117   AGFVVDLFCTSMIDVADEFGVPTYIFFTSSAGFLGLMFHLQTLHDEQNKDCIEFKDSDAE  176

Query  520   YVIPGFENPVPVESFPP--FMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGS  693
              V+P F NP+P  S  P  F+ K        F+ HA+R+RET+G++VNTF ELES+ L S
Sbjct  177   LVVPSFVNPLPAGSVLPGVFLDKH---GAAEFINHARRFRETKGILVNTFIELESHALHS  233

Query  694   MFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNP  873
             +       P+YP+GP+++ +       D+     ++KWLD+Q  SSVVFL  GSMGS   
Sbjct  234   ISDEGKTPPLYPVGPILNLKSD-----DNHKGSEILKWLDDQPPSSVVFLCFGSMGSFGE  288

Query  874   AQIREIATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGW  1050
              Q+REIA  LE +G RFLWS+R+ PPK  +  P+DY D   VLP GF DRT G G V  W
Sbjct  289   DQVREIACALEHSGLRFLWSLRQAPPKGVVAFPSDYADHKGVLPEGFLDRTVGIGKVIRW  348

Query  1051  VPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEI  1230
              PQV IL+H+AIGGFVSHCGWNS LE+L HGVP+ TWP+YAEQ LNAFQ+V++LGLAVEI
Sbjct  349   APQVAILSHRAIGGFVSHCGWNSTLESLWHGVPVATWPMYAEQQLNAFQLVRDLGLAVEI  408

Query  1231  TFDY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                Y +D   +VSAE++ERG++++M+ D + R++VKE SE CK+  M  GSS  SLG+ I
Sbjct  409   KMSYRRDDQVVVSAEEIERGIKEVMEHDSDQRKRVKEMSEKCKKALMDGGSSHSSLGRFI  468

Query  1408  EE  1413
             ++
Sbjct  469   DQ  470



>ref|XP_008229635.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Prunus mume]
Length=473

 Score =   428 bits (1101),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 228/482 (47%), Positives = 314/482 (65%), Gaps = 29/482 (6%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP----QRPLIQSYIDSLA  180
             K A++VF+ +P +G+LV  VE +KLL  ++  L +TVL + +P     +  + +Y DS++
Sbjct  3     KAAELVFIPSPGVGHLVSAVEIAKLLVARDDQLFITVLTMKLPFDCMPKGTVDAYTDSMS  62

Query  181   SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL----KSDDDVRIAG  348
                 ++F+ LP     +   N +   FL  +IENH+ HV+ A+TKL    +SD   R+AG
Sbjct  63    Q--RIKFVDLPEEAIETRGINPNL--FLKFFIENHKAHVKDAVTKLTELDQSDFKPRLAG  118

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYV  525
             F +D+FCTS IDVA+E  +P Y++F S + FL  M H+ TL D Q     EF D+  + V
Sbjct  119   FVIDLFCTSMIDVADEFGVPTYIFFTSSSGFLGLMFHLQTLHDEQKKDCIEFKDSDAKLV  178

Query  526   IPGFENPVPVESFPP--FMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF  699
             +P F NP+P  S  P  F+ K        F+ HA+R+RET+G++VNTF ELES+ L S+ 
Sbjct  179   VPSFVNPLPAGSVLPGVFLDKH---GAAEFINHARRFRETKGILVNTFIELESHALHSIS  235

Query  700   GGNDVGPVYPIGPVVDREGPARWHPDSWNHE--LVMKWLDNQLSSSVVFLTTGSMGSLNP  873
                   P+YP+GP+++ +          NHE   ++KWLD+Q  SSVVFL  GSMGS   
Sbjct  236   DDGKTPPLYPVGPILNLKSDD-------NHEGSEILKWLDDQPPSSVVFLCFGSMGSFGE  288

Query  874   AQIREIATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGW  1050
              Q+REIA  LE +G RFLWS+R+ PPK  +  P+DY D   VLP GF DRT G G V GW
Sbjct  289   DQVREIACALEHSGLRFLWSLRQAPPKGMVAFPSDYADHKGVLPEGFLDRTVGIGKVIGW  348

Query  1051  VPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEI  1230
              PQV ILAH+AIGGFVSHCGWNS LE+L HGVP+ TWP+YAEQ LNAFQ+V +LGLAVEI
Sbjct  349   APQVAILAHRAIGGFVSHCGWNSTLESLWHGVPVATWPMYAEQQLNAFQLVNDLGLAVEI  408

Query  1231  TFDY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                Y +D   +VSAE++ERG++++M+ D + R++VKE SE CK+  M +GSS  SLG  I
Sbjct  409   KMSYRRDDQVVVSAEEIERGIKEVMEHDSDQRKRVKEMSEKCKKALMDDGSSHSSLGHFI  468

Query  1408  EE  1413
             ++
Sbjct  469   DQ  470



>gb|KCW75565.1| hypothetical protein EUGRSUZ_E04316 [Eucalyptus grandis]
Length=413

 Score =   424 bits (1091),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 212/399 (53%), Positives = 276/399 (69%), Gaps = 5/399 (1%)
 Frame = +1

Query  217   AEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFCTSFIDVAEE  396
             A+ P P + +ST++ +S+ I NH P V+ AL +L+S   VR+A  F+DMF     DVA E
Sbjct  2     ADLPRPGEYQSTLAHISLHIANHAPLVKEALLELRSTG-VRVAALFLDMFTVPMADVASE  60

Query  397   LDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPVPVESFPPFM  576
             L IP YL+FASPASFL F L++  LD +  +  E  D   +  +P F + +P    P  +
Sbjct  61    LGIPHYLFFASPASFLGFTLYL--LDPEAREAIESEDMTIDLPVPSFVSSLPKRVLPSSV  118

Query  577   SKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYPIGPVVDREG  756
                 ED    +L HA RY  T G+VVNTF+ELE + L ++       PVYP+GPV+D +G
Sbjct  119   LN-GEDALAWWLAHAGRYGGTEGIVVNTFEELEVHALRALRASVS-SPVYPVGPVIDLDG  176

Query  757   PARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAGYRFLWSI  936
             P +WHP     E +++WLD Q  +SVVFL  GSMGSL+  Q++EIA GLERAG+RFLWS+
Sbjct  177   PVKWHPQRAEQEALVQWLDKQPPASVVFLCFGSMGSLSTPQVKEIADGLERAGFRFLWSL  236

Query  937   REPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIGGFVSHCGWN  1116
             REPP+ KL+ P DY ++D  LP GF DRT   G+VCGWVPQVTILAHKAIGGFVSHCGWN
Sbjct  237   REPPRGKLENPTDYANVDQALPEGFLDRTAETGLVCGWVPQVTILAHKAIGGFVSHCGWN  296

Query  1117  SILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLVSAEDVERGVRK  1296
             SILE+L +GVP  TWP+Y+EQ +NAFQMV ELGLAVE+  DY+ G TLVSAE++ERG+R 
Sbjct  297   SILESLWYGVPTATWPVYSEQQMNAFQMVAELGLAVEVRLDYRVGSTLVSAEELERGLRH  356

Query  1297  LMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             LMD D EVR KVKE  +  +    ++GSS  S+ +L++E
Sbjct  357   LMDSDGEVRSKVKEMRDKSRMAVTEHGSSHASMRRLVQE  395



>emb|CDP04202.1| unnamed protein product [Coffea canephora]
Length=473

 Score =   422 bits (1084),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/473 (45%), Positives = 309/473 (65%), Gaps = 11/473 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK++++VFV  P  G++V  ++F+KLL  +++ +S+TVL+I  P  P + SYI+  A S+
Sbjct  1     MKKSELVFVPAPARGHMVSTIQFAKLLLERDERISITVLVIKRPHPPNLDSYIEEFAASN  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTK-LKSDDDVRIAGFFVDM  363
              N+ F+ L   +PP P+  +S  +FLSI IE H+  V+ A++  + S    ++AG  VD+
Sbjct  61    SNIRFVHLCHVDPPPPELLKSAENFLSIHIEKHKSLVKDAISNHVVSGPSTKLAGLVVDL  120

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFEN  543
             F T  IDVA EL +P Y++F S A+FL  +L++PT  AQ+   +EF  +  +  IP + N
Sbjct  121   FSTPMIDVANELGVPSYVFFPSSAAFLGLLLYLPTRHAQL--GTEFSISNPDSTIPVYAN  178

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
             PVP    P F+  +    Y   L H  R++ETRG ++NTF ELE + + S+    +   +
Sbjct  179   PVPSRVLPSFLFDKQNGGYSSMLHHGTRFKETRGFIINTFAELEPHAIESLESRKESAAI  238

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             Y +GP+++ E        S + + VMKWLD+Q SS+VVFL  GS+G   P Q+ E+AT L
Sbjct  239   YTVGPLLNLE----LQEHSQSDQKVMKWLDDQPSSTVVFLCFGSLGGFEPPQLAEMATAL  294

Query  904   ERAGYRFLWSIREPPKSKLDL-PNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             ER+G+RFLWSI+ PP   L + P +YT+   +LP GF +RT+ +G+VCGW PQV +L+H+
Sbjct  295   ERSGHRFLWSIQAPPLKDLRVKPAEYTNFSEILPEGFLERTQNRGLVCGWAPQVEVLSHE  354

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK--DGI  1254
             A+GGFVSHCGWNSILE+L +GVPI TWPIYAEQ  NAF++VKEL LAVE+T DY+     
Sbjct  355   AVGGFVSHCGWNSILESLWNGVPIATWPIYAEQQSNAFELVKELELAVELTLDYRITSSD  414

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              LV A+ +E+ +R LMD  + VR +VKE  E  ++     GSS +S G+ IE+
Sbjct  415   KLVMADAIEKAIRLLMDSGNPVRNRVKEVGETGRKALKDGGSSFLSAGRFIED  467



>ref|XP_002279387.2| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=483

 Score =   420 bits (1079),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 226/468 (48%), Positives = 304/468 (65%), Gaps = 8/468 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS-LASD  186
             MK+A++VFV     G+LV  VEF+K L  ++   SVT+L IN P  P    Y  S LA +
Sbjct  1     MKKAELVFVPVAFRGHLVSTVEFAKRLIQRDDRFSVTILSINSPFGPDAHGYNKSHLAFE  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
               L  + LP  +PP P   +S   FLS++IE++ PHV+ A+  LKS     +AG  +D  
Sbjct  61    PGLRLIDLPPQDPPPPHLKKSIAQFLSVYIESYIPHVKDAIINLKSTRP--LAGVVLDFV  118

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENP  546
             C S IDVA EL +P YL+  S A+ +S ML++PT   Q+  ++ F DA  E VIPGF NP
Sbjct  119   CISMIDVANELGLPSYLFLTSGAALVSLMLYLPTRHTQI--SAAFEDADPELVIPGFINP  176

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VPV   P  +  +H   Y  F++ A+R+RE +G+++NTF ELE + +GS F      PVY
Sbjct  177   VPVSVLPEALRDKH-GGYASFIKVAQRFREAKGIIINTFTELEPFLVGS-FSDGQAPPVY  234

Query  727   PIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLE  906
              +GPV+D EG A    D  +H+ VM WLD Q  SSV+FL  GS+G+ +  Q+REIA GLE
Sbjct  235   TVGPVLDLEGQAHSSADRADHDKVMAWLDTQPESSVMFLCFGSLGTFDVPQVREIALGLE  294

Query  907   RAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKA  1083
             R+G+RFLWS+R PP   K   P++ T+LD +LP GF +R  GKGM+CGW PQV +LAH+A
Sbjct  295   RSGHRFLWSLRRPPPDGKFGSPSEGTNLDEMLPEGFMERIGGKGMICGWAPQVKVLAHEA  354

Query  1084  IGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLV  1263
             I GFVSHCGWNSILE++ + VPI TWP+YAEQ LNAF+MVKELGLAVE+  D +    +V
Sbjct  355   IAGFVSHCGWNSILESVWNSVPIVTWPLYAEQKLNAFEMVKELGLAVEMRLDSRYDGDVV  414

Query  1264  SAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
              AE+++  VR++M  D  VR+ VKE  E  +R   + GSS  S  +LI
Sbjct  415   MAEEIDGAVRRVMKADSTVRKMVKEMGEKSRRALTEGGSSYNSFERLI  462



>ref|XP_008220630.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Prunus 
mume]
Length=482

 Score =   419 bits (1078),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 222/481 (46%), Positives = 322/481 (67%), Gaps = 21/481 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MK+ +++F+  P  G+LV  ++F+K L  +N  +S+T+L I  P    + SY +SL AS+
Sbjct  1     MKKVELLFIPVPGSGHLVSTLQFAKNLIGRNDTISITILSIPSPLPSSLSSYTNSLVASE  60

Query  187   GNLEFLSLPA--AEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD----DDVRIAG  348
               ++ + +P   A+PPS +  +S     S++IE H P++R  +T++ S     D VR+AG
Sbjct  61    PRIQLIDVPQPPAKPPSTELFKSPAKIFSLYIETHLPNIRNIITEIVSSHAKSDSVRVAG  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL---DAQVPKNSEFGDAAKE  519
               VD FC S IDVA+EL +P YL+  S   +LSFMLH+P     + +VPK+S+      E
Sbjct  121   IVVDFFCASMIDVAKELHLPSYLFMPSNTGYLSFMLHLPAYHEQNGEVPKDSD-----PE  175

Query  520   YVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF  699
             ++I G E PVP    P  ++   + +Y  +++ A R+RET+G++VNTF ELE++ + S  
Sbjct  176   WLIKGIEIPVPPRVLPVALT---DGSYSAYVKLASRFRETKGIIVNTFLELETHAINSFS  232

Query  700   GGNDVGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
               +   P+YP+GPV+D  +G A  + +    + ++KWLD+Q  SSVVFL  GSMGS    
Sbjct  233   DDDQTPPLYPVGPVIDLDDGLAHSNLEQAQRDRIIKWLDDQPQSSVVFLCFGSMGSFEAE  292

Query  877   QIREIATGLERAGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWV  1053
             Q++EIA GLE +G RFLW++R  PP+ K  +P+D ++L+ VLP GF ++T GKG++CGW 
Sbjct  293   QVKEIAAGLEHSGQRFLWALRMPPPRGKGMMPSDSSNLEEVLPDGFLEKTHGKGLICGWA  352

Query  1054  PQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT  1233
             PQV +LAH+AIGGFVSHCGWNSILE+L HGVPI TWP+YAEQ LNAF+MVKELGLA+E+ 
Sbjct  353   PQVEVLAHEAIGGFVSHCGWNSILESLWHGVPIVTWPMYAEQQLNAFRMVKELGLAMEMR  412

Query  1234  FDYKDGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
              DYK G   +V A+++ER V  +MD D EVR+KVKE  EM ++     GSS  S+G+ IE
Sbjct  413   LDYKKGSGEVVGADEIERAVVAVMDMDSEVRKKVKEMGEMTRKAVKDGGSSFASVGRFIE  472

Query  1411  E  1413
             +
Sbjct  473   D  473



>ref|XP_008220642.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Prunus 
mume]
Length=486

 Score =   418 bits (1075),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 216/482 (45%), Positives = 310/482 (64%), Gaps = 19/482 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             M + ++VF+  P  G+LV  ++F+K L  + + +S+T+L I       + SY  S+A S+
Sbjct  1     MDKVRLVFIPAPGSGHLVSTLQFAKRLIDREERISITILAIQSASPTTLSSYAKSVAASE  60

Query  187   GNLEFLSLPAAEP---PSPDQNRSTISFLSIWIENHEPHVRRALTKL-------KSDDDV  336
               ++ + +P  +P   P+ D  +S     S++IE+H P+V++ +T L       KS D +
Sbjct  61    PKIQLIDVPKPQPEHPPAQDSFKSPAKSFSLYIESHLPNVKKIVTSLVSSSHASKSLDSI  120

Query  337   RIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAK  516
             R+AG  VD FC S +DVA+EL +P YL+  S A +L+ MLH+P          E  D+  
Sbjct  121   RVAGLVVDFFCVSMVDVAKELHLPTYLFMTSNAGYLALMLHLPIQHKH--NEVEPKDSDP  178

Query  517   EYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSM  696
             E++IPG  +PVP    P  ++   + +Y  +++ A R+RETRG++ NTF ELE+Y + S 
Sbjct  179   EWLIPGIVHPVPPRVLPVALT---DGSYSAYVKVASRFRETRGIIANTFVELETYAINSF  235

Query  697   FGGNDVGPVYPIGPVVDREG-PARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNP  873
             F      PVYP+GPV+D E   A  + +    + +++WLD+Q  SSVVF   GSMGS   
Sbjct  236   FHDGQTPPVYPVGPVIDLEDYQAHSNLEQAQRDKIIRWLDDQPQSSVVFFCFGSMGSFGA  295

Query  874   AQIREIATGLERAGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGW  1050
              Q++EIA GLE +G RFLW++R  PPK K  +P D  +L+ VLP GF +RT GKG++CGW
Sbjct  296   EQVKEIAVGLEHSGQRFLWALRMPPPKGKGMMPIDCPNLEEVLPDGFLERTHGKGLICGW  355

Query  1051  VPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEI  1230
              PQV +LAHKA GGFVSHCGWNSILE+L +GVPI TWP+YAEQ LNAF+MVKELGLA+E+
Sbjct  356   APQVEVLAHKATGGFVSHCGWNSILESLWYGVPIVTWPMYAEQQLNAFRMVKELGLALEM  415

Query  1231  TFDYKD-GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
               DYK  G  +V A+++ER V  +MD + EVR+KVKE  EM ++     GSS  S+G+ I
Sbjct  416   RLDYKKGGREVVRADEIERAVVAVMDKESEVRKKVKEMGEMTRKAVKDGGSSFASVGRFI  475

Query  1408  EE  1413
             E+
Sbjct  476   ED  477



>ref|XP_008229636.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Prunus mume]
Length=473

 Score =   417 bits (1071),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 216/478 (45%), Positives = 307/478 (64%), Gaps = 21/478 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP----QRPLIQSYIDSLA  180
             K A++V +    +G+L+  VE +KLL  ++  L +TVL++ +P     +  + +Y DS++
Sbjct  3     KAAELVLIPALGVGHLMSAVEIAKLLVARDDQLFITVLIMKLPFDSMPKGTVDAYTDSMS  62

Query  181   SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL----KSDDDVRIAG  348
                 ++F+ LP     +   N +   F+  +IENH+ HV+ A+ KL    +SD   R+AG
Sbjct  63    Q--RIKFVDLPEEAIETRGINPNL--FIKFFIENHKAHVKDAINKLTESDQSDSKPRLAG  118

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYV  525
             F +DMFCTS IDVA E  +P Y++F S   FL  M H+ T+ D Q    ++F D+  E V
Sbjct  119   FVIDMFCTSMIDVANEFGVPTYIFFTSSVGFLGLMFHLQTVHDEQNKDCTKFKDSDAELV  178

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             +P F NP+P  S  P M          F+ HA+R+RET+G++VNTF ELES+ L S+   
Sbjct  179   VPSFVNPLPTGSVLPGMFLDQHGAA-EFINHARRFRETKGILVNTFMELESHALHSISDD  237

Query  706   NDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
                 P+YP+GP ++ +       D+     ++KWLD+Q  S VVFL  GSMGS    Q++
Sbjct  238   GKTPPLYPVGPTLNLKSD-----DNHEGSEILKWLDDQPPSCVVFLCFGSMGSFGEDQVK  292

Query  886   EIATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             EIA  LE +G RFLWS+R+ PPK  + LP+DY D   VLP GF +RT G G V GW PQV
Sbjct  293   EIACALEHSGLRFLWSLRQAPPKGMIALPSDYADHKGVLPEGFLNRTVGIGKVIGWAPQV  352

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              ILAH+AIGGFVSHCGWNS LE+L HGVP+ TWP+YAEQ LNAFQ+V++LGLAVEI   Y
Sbjct  353   AILAHRAIGGFVSHCGWNSTLESLWHGVPVATWPMYAEQQLNAFQLVRDLGLAVEIKMSY  412

Query  1243  -KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +D   +V+AE++ERG++++M+ D + R++VKE SE CK+  M  GSS  +LG+ I++
Sbjct  413   RRDDQVVVNAEEIERGIKEVMEHDSDQRKRVKEMSEKCKKALMDGGSSHSALGRFIDQ  470



>ref|XP_010104648.1| UDP-glycosyltransferase 71C3 [Morus notabilis]
 gb|EXC01454.1| UDP-glycosyltransferase 71C3 [Morus notabilis]
Length=469

 Score =   415 bits (1067),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/476 (44%), Positives = 308/476 (65%), Gaps = 24/476 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MK++++VF+  P IG+L+  +EF+  L  ++  LSVTVL +  P  P   +Y  SL  S 
Sbjct  1     MKRSELVFIPAPGIGHLISTLEFANRLIDRHDRLSVTVLCMKFPIAPYADAYTKSLVGSQ  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL----KSDDDVRIAGFF  354
               +  + LP  +PP P++ RS   ++ ++IE+  PHVR AL+ +     +   +++AG  
Sbjct  61    SRITLIDLPQVDPPLPERLRSPEHYIYVYIESLNPHVRNALSDIVLSRSNSGSIQVAGLV  120

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             +D FC   +DVA E D+PCY++  S   FL  ML+IP+   Q+  + EF D+  + ++PG
Sbjct  121   LDFFCMPMMDVANEFDLPCYMFLTSNLGFLGLMLYIPSRHEQI--SCEFKDSDPDMILPG  178

Query  535   FENPVPVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
             F +PVP    P P  +K  +  Y  +++ A+R+RET+G++VN+F ELES  L S+   + 
Sbjct  179   FVSPVPANVLPSPVFNK--DGGYTAYVKLAQRFRETKGIIVNSFTELESNALNSL-ADDQ  235

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
               P+Y +GPV+D +G A    D    E +MKWLD Q   SVVFL  GSMG    +Q+REI
Sbjct  236   TPPIYLVGPVLDLKGQAHPSLDQIQRERIMKWLDEQPPLSVVFLCFGSMGGFGESQLREI  295

Query  892   ATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVC-GWVPQVT  1065
              +GLER+ +RF+WSIR P PK           L+ +LP GF +R  GKG++C GW PQV 
Sbjct  296   TSGLERSVHRFVWSIRVPQPKG----------LEEILPEGFLERIGGKGLICNGWAPQVE  345

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAH+A GGFVSHCGWNSILE+L +GVPI TWPIYAEQ +NAF+MV+E GLAVE+  D++
Sbjct  346   VLAHRATGGFVSHCGWNSILESLWYGVPIATWPIYAEQQMNAFRMVREFGLAVELRLDFR  405

Query  1246  DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +G  LV A+++E  V +LM+GD E+R+KVKE SEM ++   + GSS  ++GK + +
Sbjct  406   NG-DLVMADEIETAVTRLMEGDSELRKKVKEMSEMARKAVAEGGSSFTAVGKFVND  460



>emb|CDP06220.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   414 bits (1065),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 207/473 (44%), Positives = 312/473 (66%), Gaps = 13/473 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-D  186
             MK  ++VFV  P  G++V ++EF+K L  +++ +S+TVL+I +P    ++SY++ LA+ +
Sbjct  1     MKTEELVFVPAPGRGHMVSMIEFAKRLLERDERISITVLVIRLPTPSKLESYVEELAAAN  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTK-LKSDDDVRIAGFFVDM  363
              N+ F+ LP+ + PSP+ + S     S++IE H+P V+ A+   + SD    +AG  +D+
Sbjct  61    SNIRFIDLPSVDRPSPELSSSIEKSASVYIEKHKPLVQDAIINHVLSDPSTHLAGLVIDL  120

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFEN  543
             FCTS ID+A EL +P Y++F S A+FL  ML++P   +   K +EF  +  + +IP + +
Sbjct  121   FCTSMIDIANELGVPSYVFFTSSAAFLGLMLYLPVRHSL--KGTEFSISDPDSIIPAYTH  178

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
             PVP    P F+       Y   L H  R+RE +G+++NTF ELE + + S+    ++ P+
Sbjct  179   PVPSRVLPSFLFD-ETGGYESMLYHGTRFREAKGLIINTFAELEPHAIKSLESDKELAPI  237

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             Y IGPV++ E     +PD    E ++KWLD+Q SSSV+FL  GS+G   P Q+ E+A  L
Sbjct  238   YTIGPVLNFE--LDKNPD---FEKIIKWLDDQPSSSVLFLCFGSLGGFEPPQLAEMAAAL  292

Query  904   ERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             ER+GYRFLWS+R P P+       +YT+   +LP GF +RTK KG+VCGW PQ+ +LAH+
Sbjct  293   ERSGYRFLWSVRAPMPRDFRTRQIEYTNFSEILPEGFFERTKDKGLVCGWAPQLDVLAHE  352

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY--KDGI  1254
             A+GGFVSHCGWNSILE+L +GVPI TWP+YAEQ  +AFQ+VK+L  AVE+T DY  K+  
Sbjct  353   AVGGFVSHCGWNSILESLWNGVPIATWPVYAEQQSSAFQLVKDLEFAVELTLDYRFKNPD  412

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              LV A+++E+ +R LMD ++ VR +VK+  +  +   M  GSS +SLG+ IE+
Sbjct  413   KLVPAKEIEKAMRCLMDSENPVRRRVKDIGKRAREALMDGGSSFISLGRFIED  465



>ref|XP_008229632.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Prunus 
mume]
Length=475

 Score =   413 bits (1061),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 213/475 (45%), Positives = 311/475 (65%), Gaps = 15/475 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRP--LIQSYIDS---  174
             MK+A++VFV TP +G+LV  +EFSK L       S+T+L++  P  P   + S I +   
Sbjct  1     MKRAELVFVPTPAVGHLVSAIEFSKRLLDGCDRFSITILVMKPPFEPSATLNSNISAQSL  60

Query  175   LASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFF  354
              AS G+++ + LP    P     +S   +++++IE ++ HVR A+          ++G  
Sbjct  61    AASQGHIKIIDLPTVNRPLELLQQSVEKYITVYIEGYKNHVREAIAS-HVLPSCSVSGLV  119

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             VDMFCT+ IDVA EL +P +L+F S A FL F+LH+ +   +V   + F ++  E V+P 
Sbjct  120   VDMFCTTMIDVANELKVPSFLFFTSGAGFLGFLLHLSSRYDRV--GTVFKESDSESVVPS  177

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             + NPVP    P F      D Y+ F  HA+R++ET+G++VNTF ELES+ +GS+  G + 
Sbjct  178   YVNPVPASVIPSFAFS--SDGYVTFANHARRFKETKGIIVNTFVELESHAVGSLSDG-ET  234

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              PVY +GP++    PA+        + +M WLD+Q   SV+FL  GS GS + AQ+REIA
Sbjct  235   PPVYTVGPLIGVH-PAQHSDHQSKFDKIMTWLDDQPFKSVLFLCFGSSGSFDEAQLREIA  293

Query  895   TGLERAGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLE++  RFLWS+R +PPK K  +P ++T  +  LP GF +RT G G++CGW PQV +L
Sbjct  294   IGLEQSKQRFLWSVRKDPPKGKFMVPEEHTSHEEFLPRGFLERTSGVGILCGWAPQVEVL  353

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KD  1248
             AH+A+GGFVSHCGWNSI+E+L HGVP+ TWP+YAEQ +NAFQMV++LG+AVE+  +Y KD
Sbjct  354   AHRAVGGFVSHCGWNSIMESLWHGVPVVTWPLYAEQQINAFQMVRDLGVAVELRLNYRKD  413

Query  1249  GIT-LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             G+   V A+++ER VR +MDG+DE+R+KV+E S +C+      GSS+ S  +LIE
Sbjct  414   GVDHFVVADEIERAVRCVMDGNDELRKKVQEMSGVCRTAVGDEGSSSASFERLIE  468



>ref|XP_002520576.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF41809.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=469

 Score =   412 bits (1060),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 221/476 (46%), Positives = 303/476 (64%), Gaps = 21/476 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQR-PLIQSYIDSLASD  186
             MK+ ++VFV  P  G+L   VE +KLL  ++  LS+++L++       ++   IDSL + 
Sbjct  1     MKKPELVFVPIPGAGHLTSAVEAAKLLLDRDARLSISILILRRSSDGKVVSDLIDSLTAT  60

Query  187   GN---LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFV  357
                  ++F++LP  +  S   N         +IE ++PH+R A++KL S  D  +AGF +
Sbjct  61    TTTRRIQFINLPVEDTESMGLN---------FIEKYKPHIREAVSKLASRSDFTLAGFVL  111

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPG  534
             DMFC   +DVA E  +P Y++F S A+FLSFMLHI  L D Q    ++F ++  E  +P 
Sbjct  112   DMFCMPVMDVANEFGVPSYVFFTSGAAFLSFMLHIQALHDEQDMDPTQFKNSDDELALPC  171

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F NP+P    P  + ++   +   FL  A+R++E +G+VVNTF ELES  L S+  G   
Sbjct  172   FINPLPARILPSVVLEKEWISL--FLGMARRFKEAKGIVVNTFMELESSALNSLSDGTIR  229

Query  715   GP-VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
              P VYP+GP+++ +G      D    +++M+WLDNQ  SSVVFL  GSMG     Q +EI
Sbjct  230   SPPVYPVGPILNVKGGDSVKSD--GSKIIMEWLDNQPPSSVVFLCFGSMGGFREDQAKEI  287

Query  892   ATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             A  LE +G RFLWS+R+P P  K+    DY +L+  LP GF DRT G GMV GW PQV +
Sbjct  288   AFALEGSGQRFLWSLRQPSPTGKMTGSTDYQNLERSLPEGFLDRTAGIGMVIGWAPQVAV  347

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-K  1245
             LAH AIGGFVSHCGWNS LE++ +GVPI TWP+YAEQ  NAFQ+VKELGLAVEIT DY K
Sbjct  348   LAHPAIGGFVSHCGWNSTLESIWYGVPIATWPMYAEQQFNAFQLVKELGLAVEITVDYRK  407

Query  1246  DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             D   +V A D+ERG+R +M+ D E+R KVK+ SE  ++V M  GSS  SL +LIE+
Sbjct  408   DSDVIVKAADIERGIRCVMEHDSEIRMKVKDMSEKSRKVLMDGGSSFSSLNRLIED  463



>ref|XP_002323168.1| hypothetical protein POPTR_0016s01740g [Populus trichocarpa]
 gb|EEF04929.1| hypothetical protein POPTR_0016s01740g [Populus trichocarpa]
Length=474

 Score =   411 bits (1057),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 214/475 (45%), Positives = 309/475 (65%), Gaps = 11/475 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVL-LINMPQRPLIQSYIDSLAS-  183
             MK+A++V V +P IG+LVP +EF+K L  Q+ +  VTVL +I  P  P   +   S+ + 
Sbjct  1     MKKAQLVLVPSPGIGHLVPAIEFAKRLLDQDDSFLVTVLVIIRAPFGPDTDTSNQSVLTT  60

Query  184   -DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTK--LKSDDDVRIAGFF  354
              D  +++++LP   PP  D  RS  ++++ ++E H+P V+ A+    + +   V + G  
Sbjct  61    IDTRIQYITLPTVTPPDLDPLRSPENYVTSFMEAHKPLVKDAVVNHVMSNKSSVPVVGLV  120

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             VD+FC S IDVA EL I  Y+YFAS A+FL  +L++PT   QV    EF +   + ++  
Sbjct  121   VDLFCASMIDVANELGISSYVYFASSAAFLGLLLYLPTRQEQV--GIEFKETDPDLIVSC  178

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F NPVP    P  +  + +  Y  F    +R+RE +G+VVN++ ELES+ + S  GG   
Sbjct  179   FANPVPARVLPSALLNK-DGGYTCFENLGRRFREAKGIVVNSYVELESHAVSSFLGGG-T  236

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              PVY +GP+++  G +    +S  H  +M+WLD+Q   SVVFL  GS+G    AQ++EIA
Sbjct  237   PPVYTVGPLLNVNGHSLMGSNSDRHGKIMEWLDDQPEKSVVFLCFGSIGRFREAQVKEIA  296

Query  895   TGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLE++G+RFLWS+R+PP +    LP+DY++ + VLP GF +RTK  GMVCGW PQ+ +L
Sbjct  297   LGLEQSGHRFLWSVRKPPPEGHFALPSDYSNFEEVLPDGFLERTKNIGMVCGWAPQMQVL  356

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-D  1248
             AHKAI GFVSHCGWNSILE+L HGVPI TWP++AEQ +NAFQMV++LG+AVE+T DY+  
Sbjct  357   AHKAIKGFVSHCGWNSILESLWHGVPIVTWPMHAEQQINAFQMVEDLGIAVEMTLDYRMR  416

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                LV A+ + R V+  M+ D EVR KVK  SE  ++  M+ GSS  +LG LI++
Sbjct  417   SDNLVLADKIARSVKSAMEEDGEVRNKVKAMSEASRKAVMEGGSSFAALGDLIKD  471



>ref|XP_002264329.2| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=490

 Score =   411 bits (1057),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 216/475 (45%), Positives = 313/475 (66%), Gaps = 18/475 (4%)
 Frame = +1

Query  1     KAIMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA  180
             + +MKQ ++VF+ +P IG+LV  VE +KL++H+++ LS+T+L++  P         DS+ 
Sbjct  22    RLVMKQTELVFIPSPGIGHLVATVEIAKLMTHRDRRLSITILIMKFPF-----GSNDSMT  76

Query  181   SDGN-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFV  357
             SD + + FL+LP  E  SP     T  FL   I    P VR A+ ++   + VR+ GF +
Sbjct  77    SDSDSIRFLTLPPVEV-SPGTTGIT-EFLKPQI----PLVRDAVHEITRSNSVRLGGFVI  130

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPG  534
             DMFCTS IDVA+E ++P YL+F S A+FL FM H+  L D +    +EF D+  E  +P 
Sbjct  131   DMFCTSMIDVADEFEVPSYLFFTSSAAFLGFMFHLQFLHDNEGLDFNEFKDSDAELEVPS  190

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             + NPVP + FP  M  +       FL H +R+R+ +G++VNT  ELES+ + S F G+ +
Sbjct  191   YANPVPGKVFPSLMFGKEGGGAEKFLYHTRRFRQVKGIMVNTLVELESHAIQS-FSGSTI  249

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              PVYP+GPV+  +G +       +   VM WLD+Q  SSVVFL  GSMG     Q++EIA
Sbjct  250   PPVYPVGPVLKTQGGSVG--GQQDASAVMSWLDDQPPSSVVFLCFGSMGGFGGDQVKEIA  307

Query  895   TGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLER+G+RFLWS+R+P  K K++  ++Y +++ VLP GF  RT   G V GW PQV IL
Sbjct  308   HGLERSGHRFLWSLRQPSSKGKIESRSNYANVEEVLPEGFLHRTARIGKVIGWAPQVAIL  367

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AH A+GGFVSHCGWNS LE++ +GVP+ TWP++AEQ +NAFQMVK+LGLAV+I  +Y   
Sbjct  368   AHSAVGGFVSHCGWNSTLESIFYGVPVATWPMFAEQRINAFQMVKDLGLAVKIKMNYNKD  427

Query  1252  IT-LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             I+ +VSA ++E G++ LM+ D+EVR+K +E  ++ ++V ++ GSS  SLG  IE+
Sbjct  428   ISYVVSAREIEIGLKNLMNIDNEVRKKREEMKKISRKVMIEGGSSHFSLGHFIED  482



>ref|XP_002264213.2| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=476

 Score =   410 bits (1055),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 217/472 (46%), Positives = 311/472 (66%), Gaps = 13/472 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MKQ ++VF+ +P IG+L   VE +KLL+ ++   S+T+ +I  P      S   S+ SD 
Sbjct  1     MKQTELVFIPSPGIGHLAATVEIAKLLTQRDPRFSITIFIIKFP----FWSDDISMTSDS  56

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + +L+LP  E  SP      +  +S ++E   P +R A+ +L   + VR+AGF VDMF
Sbjct  57    DSIRYLTLPPVEV-SPRATEPAL-LMSEFLEAQIPLLRDAVQELTLSNSVRLAGFVVDMF  114

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
              TS IDVA+E  +P YL++ S A+FL F  H+  L D +    +EF D+  E  +P F N
Sbjct  115   STSMIDVADEFGVPSYLFYTSSAAFLGFKFHLQFLHDYEDLDFNEFKDSDAELEVPSFAN  174

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VPV+ FP  M  +       FL + +R+R+ +G++VNTF ELES+ + S F G+ + PV
Sbjct  175   SVPVKVFPSVMFDKEGGGTEMFLYNTRRFRQVKGIMVNTFVELESHAIQS-FSGSTIPPV  233

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             YP+GPV++ +G +       +   VM WLD+Q  SSVVFL  GSMG     Q++EIA GL
Sbjct  234   YPVGPVLNTQGGSVG--GRQDATAVMSWLDDQPPSSVVFLCFGSMGGFGGDQVKEIAHGL  291

Query  904   ERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             ER+G+RFLWS+R+PP K K++ P++Y +++ VLP GF  RT   G V GW PQV ILAH 
Sbjct  292   ERSGHRFLWSLRQPPPKGKIESPSNYANVEEVLPEGFLHRTARIGKVIGWAPQVAILAHS  351

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGIT  1257
             A+GGFVSHCGWNS LE++ +GVP+ TWP++AEQ +NAFQMVK+LGLAVEI  DY KD   
Sbjct  352   AVGGFVSHCGWNSTLESIYYGVPVATWPMFAEQQINAFQMVKDLGLAVEIKMDYNKDSSY  411

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +VSA+++E G++ LM+ D+EVR+K +E  ++ K+V ++ GSS  SLG  IE+
Sbjct  412   IVSAQEIEIGLKNLMNIDNEVRKKREEMKKISKKVMIEGGSSHFSLGHFIED  463



>ref|XP_002279475.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=478

 Score =   410 bits (1055),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 219/477 (46%), Positives = 302/477 (63%), Gaps = 13/477 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MK+A++VFV TP  G+ +  +EF+K L H +   S T+L +     P    Y  SL AS+
Sbjct  1     MKKAELVFVPTPAAGHCISAIEFAKRLIHTDDRFSATILQMRSLLNPHSDIYNKSLLASE  60

Query  187   GNLEFLSLPAAEPPSPDQN--RSTISFLSIWIENHEPHVRRALTKLKSD----DDVRIAG  348
               L  + LP  + P P     +S   ++ ++IE++ PHV+ A+T L S     D V +AG
Sbjct  61    TRLHLIDLPPIDNPPPHDLFLKSAEHYILLFIESYIPHVKDAITHLMSSRSSPDSVPLAG  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               +D FC   IDVA +L +P YLYF S A FL  ML +PT  +Q+   +EF D+  +  +
Sbjct  121   LVLDFFCLPMIDVANQLGLPSYLYFTSGAGFLGLMLSLPTRHSQI--GTEFEDSDPDLEL  178

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
               F NPVPV   P  +S +H   Y  +++ A+R+RE RG++VNTF ELE Y + S F   
Sbjct  179   RSFVNPVPVRVLPEAVSDKH-GGYAAYIKIAQRFREARGIIVNTFSELEPYAVES-FADG  236

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                PVY +GPV+D  G A    D  +   +M WLD Q   SVVFL  GS+G+ +  Q+RE
Sbjct  237   QTPPVYTVGPVLDLGGQAHAGSDRVDRSKIMGWLDAQPKLSVVFLCFGSIGAFDAPQVRE  296

Query  889   IATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA GLER+G+RFLW++R P P  KL   +D ++L  +LP GF DR   +GM+CGW PQ+ 
Sbjct  297   IALGLERSGHRFLWALRLPGPDGKLGGSSDGSELSEILPEGFLDRIGERGMICGWAPQME  356

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAHKAIGGFVSHCGWNSILE++ + VP+ TWP+YAEQ LNAF +VKELGLAVE+  DY+
Sbjct  357   VLAHKAIGGFVSHCGWNSILESIWNSVPMATWPMYAEQQLNAFGLVKELGLAVELRLDYR  416

Query  1246  D-GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               G  +V AE+++  +R +M+ D  VR+KVKE  EM +R  M  GSS+ SLG+LI +
Sbjct  417   QSGGEVVVAEEIDGAIRCVMEHDSMVRKKVKEMGEMSRRAVMDGGSSSNSLGRLIAD  473



>ref|XP_011001023.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Populus 
euphratica]
Length=474

 Score =   410 bits (1055),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 213/475 (45%), Positives = 307/475 (65%), Gaps = 11/475 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVL-LINMPQRPLIQSYIDS--LA  180
             MK+A++V V +P IG+L P +EF+K L  Q+ +  +TVL +I  P  P   +   S  + 
Sbjct  1     MKKAQLVLVPSPGIGHLFPAIEFAKRLLDQDDSFLITVLVIIRAPFGPDTDTSNQSELIT  60

Query  181   SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTK--LKSDDDVRIAGFF  354
              D  +++++LP   PP  D  RS  ++++ ++E H+P V+ A+    + S   V + G  
Sbjct  61    IDTRIQYITLPTVTPPDLDPLRSPENYVTSFMEAHKPLVKDAVVNHVMSSKSSVPVVGLV  120

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             VD+FC S IDVA EL I  Y+YFAS A+FL  +L++PT   QV    EF +   + ++  
Sbjct  121   VDLFCASMIDVANELGISSYVYFASSAAFLGLLLYLPTRQEQV--GIEFKETDPDLIVSC  178

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F NPVP    P  +  + +  Y  F    +R+RE +G+VVN+F ELES+ + S  GG   
Sbjct  179   FANPVPARVLPSVLLNK-DGGYTCFENLGRRFREAKGIVVNSFVELESHAVSSFLGGG-T  236

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              PVY +GP+++  G +    +S  H  +M+WLD+Q   SVVFL  GS+G    AQ++EIA
Sbjct  237   PPVYTVGPLLNVNGHSLMGSNSDRHGKIMEWLDDQPEKSVVFLCFGSIGRFREAQVKEIA  296

Query  895   TGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLE++G+RFLWS+R+PP +    LP+DY++ + VLP GF +RTK  GMVCGW PQ+ +L
Sbjct  297   LGLEQSGHRFLWSVRKPPPEGHFALPSDYSNFEEVLPDGFLERTKNIGMVCGWAPQMQVL  356

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-D  1248
             AHKAI GFVSHCGWNSILE+L HGVPI TWP++AEQ +NAFQMV++LG+A+E+T DY+  
Sbjct  357   AHKAIKGFVSHCGWNSILESLWHGVPIVTWPLHAEQQINAFQMVEDLGIAIEMTLDYRMR  416

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                LV A+ V + V+  M+ D EVR KVK  SE  ++  M+ GSS  +LG LI++
Sbjct  417   SDNLVLADKVAKSVKSAMEEDGEVRNKVKAMSEASRKAVMEGGSSFAALGDLIKD  471



>ref|XP_008229727.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Prunus mume]
Length=470

 Score =   410 bits (1053),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 219/478 (46%), Positives = 304/478 (64%), Gaps = 27/478 (6%)
 Frame = +1

Query  22    KVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGNLEF  201
             ++VF+  P IG+LV  VE +K L+ ++  L +TVL++ +P   L  +   S++    + F
Sbjct  3     RLVFIPGPGIGHLVSTVEIAKQLAARDHQLFITVLIMKLPFEQLFTNTDASISR--RINF  60

Query  202   LSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD---DDVRIAGFFVDMFCT  372
             ++LP A   +  QN    SF   ++ENH+ HVR A+++  +    +  R+AG  VDMFCT
Sbjct  61    INLPEAHVDT--QNTGPSSFFKTFVENHKTHVRAAVSESSTQSESNQARLAGLVVDMFCT  118

Query  373   SFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENPV  549
             + IDVA+E  +P Y++F S A  L+F+LH+ TL D      ++  D+  E  IP F N +
Sbjct  119   TMIDVADEFGVPSYVFFTSNAGCLAFLLHLQTLRDEHGTDAAQLMDSEAELAIPSFVNSL  178

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYP  729
             P    P  +  +   T   FL HAKR+RET+G++VNTF ELES  L S+  G    PVYP
Sbjct  179   PAHVLPGVLLDKEGAT--AFLNHAKRFRETKGILVNTFSELESRALHSLSDGK-TPPVYP  235

Query  730   IGPVVDREG--------PARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
             +GP+++ E          AR   D      +++WLD+Q S SVVFL  GSMGS   AQ++
Sbjct  236   VGPLLNLESDDFHVGTDKARQKYD------ILRWLDDQPSLSVVFLCFGSMGSFGEAQVK  289

Query  886   EIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             E+A  LE  G+RFLWS+R+PP K ++ +P+DY     VLP GF DRT   G V GW PQV
Sbjct  290   EMACALEYGGFRFLWSLRKPPPKGEIAMPSDYAVPKGVLPEGFLDRTARIGKVIGWAPQV  349

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              ILAH AIGGFVSHCGWNS+LE+L HGVPI TWP+Y+EQ LN F++VKELGLAVEI  DY
Sbjct  350   AILAHPAIGGFVSHCGWNSVLESLWHGVPIATWPMYSEQQLNTFELVKELGLAVEIKMDY  409

Query  1243  KDGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             + G   +VSAE++ RG+RK+M+ D ++RE+VKE S   K+  +  GSS  SLG  I++
Sbjct  410   RKGSEVVVSAEEIGRGIRKVMEKDSDIRERVKEMSVKSKKALVDGGSSHSSLGCFIDQ  467



>emb|CAN76057.1| hypothetical protein VITISV_032000 [Vitis vinifera]
Length=478

 Score =   410 bits (1054),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 219/477 (46%), Positives = 302/477 (63%), Gaps = 13/477 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MK+A++VFV TP  G+ +  +EF+K L H +   S T+L +     P    Y  SL AS+
Sbjct  1     MKKAELVFVPTPAAGHCISAIEFAKRLIHTDDRFSXTILQMRSLLNPHSDIYNKSLLASE  60

Query  187   GNLEFLSLPAAEPPSPDQN--RSTISFLSIWIENHEPHVRRALTKLKSD----DDVRIAG  348
               L  + LP  + P P     +S   ++ ++IE++ PHV+ A+T L S     D V +AG
Sbjct  61    TRLHLIDLPPIDNPPPHDLFLKSAEHYILLFIESYIPHVKDAITHLMSSRSSPDSVPLAG  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               +D FC   IDVA +L +P YLYF S A FL  ML +PT  +Q+   +EF D+  +  +
Sbjct  121   LVLDFFCLPMIDVANQLGLPSYLYFTSGAGFLGLMLSLPTRHSQI--GTEFEDSDPDLEL  178

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
               F NPVPV   P  +S +H   Y  +++ A+R+RE RG++VNTF ELE Y + S F   
Sbjct  179   RSFVNPVPVRVLPEAVSDKH-GGYAAYIKIAQRFREARGIIVNTFSELEPYAVES-FADG  236

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                PVY +GPV+D  G A    D  +   +M WLD Q   SVVFL  GS+G+ +  Q+RE
Sbjct  237   QTPPVYTVGPVLDLGGQAHAGSDRVDRSKIMGWLDAQPKLSVVFLCFGSIGAFDAPQVRE  296

Query  889   IATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA GLER+G+RFLW++R P P  KL   +D ++L  +LP GF DR   +GM+CGW PQ+ 
Sbjct  297   IALGLERSGHRFLWALRLPGPDGKLGGSSDGSELSEILPEGFLDRIGERGMICGWAPQME  356

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAHKAIGGFVSHCGWNSILE++ + VP+ TWP+YAEQ LNAF +VKELGLAVE+  DY+
Sbjct  357   VLAHKAIGGFVSHCGWNSILESIWNSVPMATWPMYAEQQLNAFGLVKELGLAVELRLDYR  416

Query  1246  D-GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               G  +V AE+++  +R +M+ D  VR+KVKE  EM +R  M  GSS+ SLG+LI +
Sbjct  417   QSGGEVVVAEEIDGAIRCVMEHDSMVRKKVKEMGEMSRRAVMDGGSSSNSLGRLIAD  473



>ref|XP_004309300.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Fragaria vesca subsp. vesca]
Length=465

 Score =   409 bits (1050),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 219/475 (46%), Positives = 306/475 (64%), Gaps = 23/475 (5%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             K A++VF+  P IG++V  +E +KLL  ++  L +TVL++ +      +    +      
Sbjct  3     KAAELVFIPAPAIGHIVSAMEMAKLLVARDDQLFITVLIMKLDLESKPREIDVACTGIDR  62

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFFVDMF  366
             + F++LP  E     +  S  + L ++IE+H P ++  ++KL  +S  + R+AGF +DM 
Sbjct  63    INFITLP--EVNIGTEVISPTNALKLFIESHRPQIKDTVSKLMSQSQSESRLAGFVIDML  120

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIPGFEN  543
             CTS IDVA EL +P Y+YFAS A FL  + H+     +  K+ +   D+  E V+P F N
Sbjct  121   CTSMIDVANELGVPTYVYFASNARFLELLFHLQIHHDEHNKDCTNVYDSDVELVLPSFTN  180

Query  544   PVPVESFPP-FMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             P+P  + P  F+ K    T   F+ HA+R+RET+G++VNTF ELE+  L S+  G +  P
Sbjct  181   PLPASALPSMFLDKGCTTT---FINHARRFRETKGILVNTFMELEANALHSLSNG-ETPP  236

Query  721   VYPIGPVVDREGPARWHPDSWNHE---LVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
             VYPIGP+++          + NHE     +KWLD + S SVVFL  GSMGS +  Q++EI
Sbjct  237   VYPIGPLLNI-------TRNQNHEGSDSTLKWLDEKPSLSVVFLCFGSMGSFDKDQVKEI  289

Query  892   ATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             A  LE +G +FLWS+REPP K K   P++Y D   VLP GF DRT G G V GW PQ  I
Sbjct  290   ANALEHSGLQFLWSLREPPAKGKFTYPSEYADYKEVLPEGFLDRTTGIGKVIGWAPQAAI  349

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD  1248
             LAH AIGGFVSHCGWNSILE+L +GVP+GT P+YAEQHLNAF+MV+ELGLAVE++  YK 
Sbjct  350   LAHPAIGGFVSHCGWNSILESLWYGVPVGTLPMYAEQHLNAFEMVRELGLAVEVSVAYKK  409

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             G   V+A+D+ERG+R++M+ D + R++VKE SEM K+  M  GSS  SLG+ IE+
Sbjct  410   GS--VNAQDIERGIRQVMEHDSDTRKRVKEMSEMSKKALMHGGSSHSSLGRFIEQ  462



>ref|XP_010260709.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nelumbo 
nucifera]
Length=474

 Score =   409 bits (1051),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 222/474 (47%), Positives = 305/474 (64%), Gaps = 12/474 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             MK+A+++F  +  IG+LV  VE ++ L  ++  LS TVL   +P       Y +SL S  
Sbjct  1     MKKAELIFFPSRGIGHLVSTVELAQRLVERDDRLSATVL--TLPATA-TSPYTESLDSTL  57

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
               +  +SLP  +  S  +N S  SF+S +++ H   V+ A+T+  S D VR+AG  VD+F
Sbjct  58    TQVRLISLPRVDL-SGMENLSGESFISQFMDRHITFVKDAITQRISTDSVRLAGLVVDLF  116

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENP  546
              T+ +D+A+EL IP YLYF S A+ L  MLH+P L   +    +  D   E VIP F N 
Sbjct  117   STTIVDLADELGIPAYLYFTSGAAMLGVMLHLPNLVTDI--TEDLKDYPGELVIPSFVNS  174

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP    P  +    E+ Y+  L HA+ +R T+G++VNTF E+E + + S    + + PVY
Sbjct  175   VPPLVLPKVLLNNKENGYVWMLTHARNFRRTKGIIVNTFVEIEPHAIHSFKVDSQIPPVY  234

Query  727   PIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLE  906
             P+GP++D  G      +    + +M+WLD Q  SSV+FL  GS GS + +Q +EIA GLE
Sbjct  235   PVGPLLDLNGKFHSPSNRPQFDKIMRWLDQQPPSSVIFLCFGSRGSFSVSQTKEIALGLE  294

Query  907   RAGYRFLWSIR--EPPKSKLDLPND--YTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
             R+GYRFLWS+R  EP KS+   P+D  YT+L+ VLP GF +RT+G+G+VCGW PQV +LA
Sbjct  295   RSGYRFLWSLRQPEPSKSRFAPPSDYSYTNLEEVLPDGFLNRTEGRGLVCGWSPQVEVLA  354

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEI-TFDYKDG  1251
             H A GGF+SHCGWNSILE+L  GVPI  WP+YAEQ LNAF++V ELGLAVE+     ++G
Sbjct  355   HPATGGFLSHCGWNSILESLWFGVPILVWPLYAEQKLNAFRLVMELGLAVEMGCVSRRNG  414

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                V AEDVERGVR +MDGD+EVR KVKE  E  ++   + GSS VSLG+LI +
Sbjct  415   DDFVKAEDVERGVRIMMDGDNEVRRKVKEIQERSRKAVAQGGSSFVSLGRLIHD  468



>ref|XP_002265388.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=474

 Score =   409 bits (1050),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 214/472 (45%), Positives = 304/472 (64%), Gaps = 15/472 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M+Q ++VF+  P IG+L P +E +KLL+ ++   SVT+ +I +P        ID + +D 
Sbjct  1     MEQTELVFIPFPIIGHLAPALEIAKLLTQRDPRFSVTIFIIKLPF-----GSIDGMDADS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S         FLS +++ H P VR A+ +L   + +R+AGF VDMF
Sbjct  56    DSVRFVTLPRVEVSSGTTPSGL--FLSEFVKAHIPLVRDAVHELTRSNPIRLAGFVVDMF  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+F S A+FL F+LH+  L D +    +EF D+  E  +P F N
Sbjct  114   CTHMIDVADEFGVPSYLFFTSSAAFLGFLLHLQFLHDYEGLDINEFKDSDAELEVPSFAN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP ++FP  ++ +       FL   +R+R+ +G++VNTF ELES+ + S+   + V  V
Sbjct  174   SVPGKAFPSLLTDKESGGTEMFLFQTRRFRQVKGILVNTFIELESHAIQSL-SCSTVPVV  232

Query  724   YPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             YP+GP+++ R G      D+     +M WLD+Q  SSVVFL  GSMGS    QI+EIA  
Sbjct  233   YPVGPILNTRMGSDGGQQDA---SPIMNWLDDQPPSSVVFLCFGSMGSFGADQIKEIAHA  289

Query  901   LERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             LE +G+RFLWS+R+PP     +P+DY +++ VLP GF  RT   G V GW PQ+ +LAH 
Sbjct  290   LEHSGHRFLWSLRQPPPEGKMIPSDYENIEQVLPEGFLHRTAKIGKVIGWAPQIAVLAHS  349

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGIT  1257
             A+GGFVSHCGWNS+LE++ +GVP+ TWPIY EQ +NAFQMVK+LGLAVEI  DY KD   
Sbjct  350   AVGGFVSHCGWNSLLESIWYGVPVATWPIYGEQQINAFQMVKDLGLAVEIKIDYNKDRDY  409

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +VSA ++E G+R LM+ + EVR K KE  ++ +RV +  GSS  SLG  IE+
Sbjct  410   IVSAHEIENGLRNLMNTNSEVRRKKKEMQKISRRVMIDGGSSHFSLGHFIED  461



>ref|XP_007217855.1| hypothetical protein PRUPE_ppa024083mg [Prunus persica]
 gb|EMJ19054.1| hypothetical protein PRUPE_ppa024083mg [Prunus persica]
Length=475

 Score =   407 bits (1047),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 214/475 (45%), Positives = 308/475 (65%), Gaps = 15/475 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLI----QSYIDSL  177
             MK+A++VFV TP +G+LV  +EFSK L       S+T+L++  P  P       +   SL
Sbjct  1     MKRAELVFVPTPAVGHLVSAIEFSKRLLDVCDRFSITILVMKPPFEPSATLNSNTSAQSL  60

Query  178   A-SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFF  354
             A S G+++ + LP    P     +S   +++++IE ++ HVR A+          ++G  
Sbjct  61    AVSHGHIKIIDLPTVNRPLEFLQQSVEKYITVYIEGYKNHVREAIAS-HVLPSCSVSGLV  119

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             VDMFCT+ IDVA EL +P +L+F S A FL F+LH+ +   +V   + F ++  E V+P 
Sbjct  120   VDMFCTTMIDVANELKVPSFLFFTSGAGFLGFLLHLSSRYDRV--GTVFKESDSESVVPS  177

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             + NPVP    P F      + Y+ F  HA+R++ET+G++VNT  +LES+ +GS+  G + 
Sbjct  178   YVNPVPASVIPSFAFS--SEGYISFANHARRFKETKGIIVNTIFQLESHAVGSLSDG-ET  234

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              PVY +GP++  E PA+        + VM WLD+Q   SVVFL  GS GS + AQ+REIA
Sbjct  235   PPVYTVGPLIG-EHPAQHSDHQSKFDKVMMWLDDQPLRSVVFLCFGSSGSFDEAQLREIA  293

Query  895   TGLERAGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLE++  RF+WS+R +PPK K  +  ++T  +  LP GF +RT G G++CGW PQV IL
Sbjct  294   IGLEQSKQRFVWSVRKDPPKGKFVVLEEHTSHEEFLPQGFLERTSGVGILCGWAPQVEIL  353

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KD  1248
             AH+A+GGFVSHCGWNSI+E+L HGVP+ TWP+YAEQ +NAFQMV++LGLAVE+  +Y KD
Sbjct  354   AHRAVGGFVSHCGWNSIMESLWHGVPVVTWPLYAEQQINAFQMVRDLGLAVELRLNYRKD  413

Query  1249  GIT-LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             G+   V A+++ER VR +MDG+DE+R+KV+E S  C+R     GSS+ S   LIE
Sbjct  414   GVDHFVVADEIERAVRCVMDGNDELRKKVQEMSGACRRAVGNGGSSSASFESLIE  468



>ref|XP_004490589.1| PREDICTED: UDP-glycosyltransferase 71D1-like [Cicer arietinum]
 gb|AGU14120.1| UDP-glycosyltransferase [Cicer arietinum]
Length=466

 Score =   406 bits (1044),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 207/468 (44%), Positives = 292/468 (62%), Gaps = 15/468 (3%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS-LASDG  189
             K+A+++F+ +P IG+L   +EF+KLL + N NL +TVL IN+P  P   SYI S L S  
Sbjct  4     KKAELIFIPSPGIGHLTSSLEFAKLLINTNTNLHITVLCINLPDTPFSDSYIKSVLNSQP  63

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
              +  + LP  EPPS +   +  S+    IE   PHV+  +  + S    ++ G  +D FC
Sbjct  64    QIHLIDLPKVEPPSKELFITPPSYFKTLIETLIPHVKATIQNILSSHSNQVVGLVLDFFC  123

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
              S +DV  EL IP YL+  S   FL FML + T       N  F D+  E +IPGF NPV
Sbjct  124   ISIVDVGTELGIPSYLFLTSNVGFLGFMLSLQTRQI----NDVFHDSDPELLIPGFSNPV  179

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND-VGPVY  726
             P  S  P  +   +  Y  + + A+R+  T+G++VNTF ELE Y + +++   D   P+Y
Sbjct  180   P-SSVLPNSAFSKDGGYEAYYKLAERFNNTKGIIVNTFSELEKYAIDALYDHYDRTPPIY  238

Query  727   PIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLE  906
              +GP++D +     +      +L++KWLD Q   SVVFL  GSMGS   +Q REIA GL+
Sbjct  239   AVGPLIDLKSQPNPNLHQAQRDLILKWLDEQPHKSVVFLCFGSMGSFGSSQTREIALGLK  298

Query  907   RAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAI  1086
              +G RFLW++R PP S         + + +LP GF +  +GKGM+C W PQV +LAHKAI
Sbjct  299   HSGVRFLWAMRSPPTS--------NNEEKILPEGFLEWMEGKGMICEWAPQVEVLAHKAI  350

Query  1087  GGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLVS  1266
             GGFVSHCGWNSILE+L  GVPI TWPIYAEQ LNAF+M+KE GLAVE+  DY+ G  ++ 
Sbjct  351   GGFVSHCGWNSILESLWFGVPILTWPIYAEQQLNAFRMIKEFGLAVELRLDYRKGSDVLV  410

Query  1267  AEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             AE++E+G++ LMD D+ V +K++E  E+ ++  +  GSS +S+GKLI+
Sbjct  411   AEEIEKGLKTLMDKDNVVHKKLQEMKEIARKAVVNGGSSFISVGKLID  458



>emb|CAN67919.1| hypothetical protein VITISV_030046 [Vitis vinifera]
Length=472

 Score =   406 bits (1044),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 216/472 (46%), Positives = 305/472 (65%), Gaps = 10/472 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+ ++VFV +P +G+L   +E +KL++ ++  LSVT+ ++ +P         +S+AS  
Sbjct  1     MKKVELVFVPSPGVGHLAATLEMAKLIADRDDRLSVTIFIMKLPFESEDSKTTESVAS--  58

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKS-DDDVRIAGFFVDMF  366
             ++ F++LP  E  S        +F +  ++ + P  R A+ +L +    VR+AGF +DMF
Sbjct  59    SIRFITLPRIEISSSSSTSPA-NFFTDVVKAYTPLAREAVHELMTRSGSVRLAGFVIDMF  117

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CTS IDVA E  +P YL+F S A+FL F+LH+ +L D    + +EF D+  E  +P F N
Sbjct  118   CTSMIDVANEFGVPSYLFFTSSAAFLGFVLHLQSLHDHHNLEITEFKDSDAELEVPSFVN  177

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP  +  +  D     L H +R+RET+G++VNTF ELES+ + S F G+   P+
Sbjct  178   SVPGKVFPSVVFDKEGDEIPILLHHTQRFRETKGIIVNTFVELESHAINS-FSGDTSPPI  236

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             YPIGP+++ E  +           +M WL++Q  SSVVFL  GSMGS N  Q+REIA GL
Sbjct  237   YPIGPILNTEVESSEVQQQAIE--IMNWLNDQPPSSVVFLCFGSMGSFNGEQVREIAHGL  294

Query  904   ERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             E +G RFLWS+R+PP K K++ P +Y + + VLP GF DRT   G V GW PQV +LAH 
Sbjct  295   EGSGCRFLWSLRQPPPKGKMEYPIEYGNKEEVLPEGFLDRTTKIGKVIGWAPQVAVLAHP  354

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGIT  1257
             A+GGFVSHCGWNS LE+L +GVP  TWP+YAEQ LNAFQMVK+L LAVEI  DY KD   
Sbjct  355   AVGGFVSHCGWNSTLESLWYGVPTATWPMYAEQQLNAFQMVKDLELAVEIKIDYDKDKGY  414

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +VS++D+E+G+R+LMD D EVR+K ++  E  ++  M  GSS   LG  IE+
Sbjct  415   IVSSQDIEKGLRQLMDADSEVRKKRQKMQEKSRKAMMDGGSSYSYLGYFIED  466



>gb|KDP42778.1| hypothetical protein JCGZ_00477 [Jatropha curcas]
Length=468

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/474 (46%), Positives = 303/474 (64%), Gaps = 18/474 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+ ++VFV +P +G+L   ++ + LL  +++ +S+TV +I +     I  YIDSL +  
Sbjct  1     MKKVELVFVPSPGVGHLASTLKAANLLLGRHERISITVFVIKLSSDLKIAKYIDSLPTSD  60

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
              + F+ L     P+ D N S ++F    IE ++PH++ A++KL ++ D  +AGF +DMFC
Sbjct  61    RIRFIHLR----PNDDSNDSPLTF----IEKYKPHIKEAVSKLTANSDSSLAGFVLDMFC  112

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENP  546
                IDVA E  +P Y+++ S A+ L F L++  + D Q    ++F D+  E V+P   N 
Sbjct  113   APVIDVANEFGVPSYIFYTSSAASLGFWLYVQFIHDEQHVDLTQFKDSNTELVVPTSVNS  172

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVG---  717
             VP   FP   S   ++  +P L H +R+RE++G++VN+F ELES+   + FG ++     
Sbjct  173   VPGRVFPS--SFFEKERLVPLLAHGRRFRESKGIMVNSFMELESHAF-NYFGHSESSKTP  229

Query  718   PVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIAT  897
             PVYP+GP++  EG         + E +MKWLD+Q   SVVFL  GS G     Q++EIA 
Sbjct  230   PVYPVGPILGLEGDVVSDGSIGDKE-IMKWLDDQAPESVVFLCFGSGGGFPEDQVKEIAC  288

Query  898   GLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
              LE  GYRFLWS+R+ PPK K+  P+DY DL  VLP GF DRT G G + GW PQ  IL 
Sbjct  289   ALEHTGYRFLWSLRQLPPKGKMGPPSDYEDLAQVLPTGFLDRTDGIGKIIGWAPQTAILG  348

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDG  1251
             H AIGGFVSHCGWNSILE+L  GVPI TWP+YAEQ  NAF MV ELGLAVEI  DY KD 
Sbjct  349   HPAIGGFVSHCGWNSILESLWFGVPIATWPMYAEQQFNAFAMVIELGLAVEIKMDYKKDS  408

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               +VSA+D+E+G++ LM+ D+EVR KVKE SE  ++     GSS+ SL +LI++
Sbjct  409   EIIVSAKDIEKGIKCLMEHDNEVRMKVKEMSENSRKALSDGGSSSFSLDRLIQD  462



>ref|XP_002279444.3| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=509

 Score =   407 bits (1046),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 219/473 (46%), Positives = 304/473 (64%), Gaps = 9/473 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MK+A++VFV TP  G+ +  VEF+K L H +   SVT+L +     P    Y  SL AS+
Sbjct  27    MKKAELVFVPTPGAGHYISAVEFAKRLIHTDDRFSVTLLHMRSSLHPHTDPYNTSLLASE  86

Query  187   GNLEFLSLPAAEPP-SPDQNRSTISFLSIWIENHEPHVRRALTKLKSD-DDVRIAGFFVD  360
              +L  + LP  +PP S   ++S   ++ ++ E+  PHV+ A+T L S+ D V +AG  +D
Sbjct  87    THLRIIDLPPVDPPPSHLIHKSVEHYILLYFESFIPHVKDAITHLMSNPDSVPLAGLVLD  146

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFE  540
              FC   IDVA+EL +P YLY  S A FL  ML++PT  +Q+   +EF D+  +  +  F 
Sbjct  147   FFCLPMIDVAKELGLPSYLYLTSGAGFLGLMLYLPTHHSQI--GTEFEDSDPDLELRSFV  204

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             NPVPV   P  +S +H   Y  +++ A+R+RE RG++VNTF ELE Y + S F      P
Sbjct  205   NPVPVRVLPEAVSNKH-GGYAAYIKVAQRFREARGIIVNTFSELEPYAVES-FADGQTPP  262

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VY +GPV+D  G A    D  +H  +M WLD Q  SSVVFL  GSMG+ +  Q+REIA G
Sbjct  263   VYTVGPVLDLGGQAHSCSDRVDHGKIMGWLDAQPESSVVFLCFGSMGTFDAPQVREIALG  322

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LER+G+RFLW++R      KL   +D T+L  +LP GF DR   +GM+C W PQ+  L+H
Sbjct  323   LERSGHRFLWALRLLRLDGKLGGSSDGTELSDILPEGFLDRIGERGMICEWAPQMEALSH  382

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD-GI  1254
             K+IGGF+SHCGWNSILE++ + VP+ TWP+YAEQ LNAF +VKELGLAVE+  DY+  G 
Sbjct  383   KSIGGFLSHCGWNSILESIWNSVPVATWPMYAEQQLNAFGLVKELGLAVEMRLDYRQIGG  442

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +V AE+++  +R +M+ D  VR+KVKE  EM +R  M  GSS+ SLG+LI +
Sbjct  443   EVVMAEEIDGAIRCVMEHDSMVRKKVKEMGEMSRRAVMDGGSSSKSLGRLIAD  495



>ref|XP_002314111.2| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|EEE88066.2| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=471

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 211/475 (44%), Positives = 312/475 (66%), Gaps = 16/475 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MKQ +++FV  P IG+L   +E +K L   +  LS+T+L++NMP  P I SY  SL AS 
Sbjct  1     MKQEELIFVPGPGIGHLASGLELAKRLLDHDDRLSITILVMNMPFTPSINSYTRSLTASQ  60

Query  187   GNLEFLSLPAAEPPSPDQ-NRSTISFLSIWIENHEPHVRRALTKL---KSDDDVRIAGFF  354
               ++ + LP  +PP  +   +S  +++  +IE++ PHV+  +T +    S+ DVR+AGF 
Sbjct  61    PRIKLVDLPEVDPPPSELLTKSPEAYICDFIESYIPHVKTTVTDIISSLSNSDVRVAGFI  120

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             +D FC S ID+A E  +P Y++  S A FL  ML++P    ++ +  +  D   + +IPG
Sbjct  121   LDFFCVSMIDIANEFSLPPYIFITSNAGFLGLMLNLPKRHDEISEVMQMSDP--DSLIPG  178

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F NPVP    P  +  +H   Y  +++ A+R+++ +G++VNTF ELE + L S    + +
Sbjct  179   FFNPVPARVLPDAVFNKH-GGYAAYVKVAQRFKDGKGIIVNTFAELEPFVLRSFSDDHRI  237

Query  715   GPVYPIGPVVDREGPARWHPDSWNHEL--VMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
              PVYP+GPV+  +G  + HP+    +L  +MKWLD Q  SSVVFL  G+ GS +P Q++E
Sbjct  238   PPVYPVGPVLHLKG--QPHPEINQDQLDKIMKWLDEQPQSSVVFLCFGNFGSFSPLQVKE  295

Query  889   IATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             IA G+E++G++FLWS+R P        N + + + VLP GF +R +G+G++CGW PQV +
Sbjct  296   IALGIEQSGFKFLWSMRFPRSPS----NQFMNPEDVLPEGFLERIEGRGIMCGWAPQVEV  351

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD  1248
             LAHKAIGGFVSHCGWNSILE+L +GVPI T PIYAEQ LNAF+MVKELGL+VE+  DY+ 
Sbjct  352   LAHKAIGGFVSHCGWNSILESLWYGVPIVTLPIYAEQQLNAFRMVKELGLSVELKLDYRV  411

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             G  LV+A+++ + V  +M  D EVR+KVKE SE  ++  M  GSS  S+ +LI++
Sbjct  412   GGDLVTADEIAKSVICVMQSDSEVRKKVKEMSEKGRKAVMDGGSSFTSITQLIQD  466



>emb|CAN72668.1| hypothetical protein VITISV_022183 [Vitis vinifera]
Length=476

 Score =   406 bits (1043),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/475 (45%), Positives = 302/475 (64%), Gaps = 19/475 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MKQ ++VF+ TP I +L   VE +KLL+ +++  S T+L++  P     +S IDS+ +D 
Sbjct  1     MKQTELVFIPTPGISHLAATVEIAKLLTQRDRRFSSTILIMKFP----FESNIDSMTTDS  56

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + +  ++LP  E  S    R  + F S  +  + P VR A+ +L   + VR+AGF +DMF
Sbjct  57    DSVRLVTLPPVELSSGP--RPPVVFFSELVRAYAPLVRDAVHELTLSNSVRLAGFVIDMF  114

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+F S A+FL FM H+  L D +    +EF D   E  +P + N
Sbjct  115   CTPMIDVADEFGVPSYLFFTSGAAFLGFMFHLQFLHDHEGLDFNEFKDTDAELEVPSYVN  174

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP  +  +        L H +R+R+ +G +VNTF ELES+ + S F G    PV
Sbjct  175   SVPGKVFPSVVLDKEGGGTEMILHHTRRFRQVKGTIVNTFVELESHAIQS-FSGCKAPPV  233

Query  724   YPIGPVVD---REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
             YP+GP+++   R G A+   ++     +M WLD+Q  SSVVFL  GS GS    QI+EIA
Sbjct  234   YPVGPLLNNHVRSGGAQQDANA-----IMSWLDDQPPSSVVFLCFGSKGSFGVDQIKEIA  288

Query  895   TGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLE +G+RFLWS+R+P PK K+ LP DY +++ VLP GF  R  G G V GW PQV IL
Sbjct  289   HGLEHSGHRFLWSLRQPLPKGKMGLPRDYANVEEVLPEGFLHRMAGIGKVIGWAPQVAIL  348

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KD  1248
             AH A+GGFVSHCGWNS LE++ +GVP+ TWP++AEQ +NAFQMVK+LGLAVEI  DY KD
Sbjct  349   AHSAVGGFVSHCGWNSTLESIYYGVPVATWPMFAEQQINAFQMVKDLGLAVEIKMDYNKD  408

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                +VSA+++E G++ LM+ + EVR K KE  ++ +      GSS  SLG+ IE+
Sbjct  409   SSYVVSAQEIEIGLKNLMNMNSEVRMKRKEMQKLSRTAIEDGGSSHFSLGQFIED  463



>emb|CAN79975.1| hypothetical protein VITISV_033140 [Vitis vinifera]
Length=448

 Score =   404 bits (1039),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 213/473 (45%), Positives = 305/473 (64%), Gaps = 37/473 (8%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MKQ ++VF+ +P IG+L   VE +KL++H+++ LS+T+L++  P                
Sbjct  1     MKQTELVFIPSPGIGHLAATVEIAKLMTHRDRRLSITILIMKFP----------------  44

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
                     + +  SP     T  FL   I    P VR A+ ++   + VR+ GF +DMFC
Sbjct  45    ------FGSNDKVSPGTTGIT-EFLKPQI----PLVRDAVHEITRSNSVRLGGFVIDMFC  93

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENP  546
             TS IDVA+E ++P YL+F S A+FL FM H+  L D +    +EF D+  E  +P + NP
Sbjct  94    TSMIDVADEFEVPSYLFFTSSAAFLGFMFHLQFLHDYEGLDFNEFKDSHAELEVPSYANP  153

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP + FP  M  +       FL H +R+R+ +G++VNT  ELES+ + S F G+ + PVY
Sbjct  154   VPGKVFPSVMFDKEGCGAEKFLYHTRRFRQVKGIMVNTXVELESHAIQS-FSGSTIPPVY  212

Query  727   PIGPVVDREGPA--RWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             P+GPV++ +G +  R   DS     VM WLD+Q  SSV+ L  GSMGS    Q++EIA G
Sbjct  213   PVGPVLNTQGGSVXRQQDDS----AVMTWLDDQPPSSVLXLCFGSMGSFGGDQVKEIAHG  268

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LER+G+RFLWS+R+PP K K++ P++Y +++ VLP GF  RT   G V GW PQV ILAH
Sbjct  269   LERSGHRFLWSLRQPPPKGKIESPSNYANVEEVLPEGFLHRTARIGKVIGWAPQVAILAH  328

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGI  1254
              A+GGFVSHCGWNS LE++ +GVP+ TWP++AEQ +NAFQMVK+LGLAVEI  DY KD  
Sbjct  329   SAVGGFVSHCGWNSTLESIYYGVPVATWPMFAEQQINAFQMVKDLGLAVEIKMDYNKDSS  388

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +VSA+++E G++ LM+ D+EVR+K +E  ++ ++V ++ GSS  SLG  IE+
Sbjct  389   YIVSAQEIEIGLKNLMNIDNEVRKKREEMKKISRKVMIEGGSSHFSLGHFIED  441



>ref|XP_006373634.1| hypothetical protein POPTR_0016s01750g [Populus trichocarpa]
 gb|ERP51431.1| hypothetical protein POPTR_0016s01750g [Populus trichocarpa]
Length=457

 Score =   404 bits (1039),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 211/474 (45%), Positives = 303/474 (64%), Gaps = 28/474 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-D  186
             MK+A++V V +P IG+LV  +EF+K L  Q+++  +TVL+I  P    + ++  SL + D
Sbjct  1     MKKAQLVLVPSPGIGHLVSTIEFAKRLLDQDESFLITVLVIKAPFALDVDTFNQSLTTID  60

Query  187   GNLEFLSLPAAEPPSPDQN--RSTISFLSIWIENHEPHVRRALTK--LKSDDDVRIAGFF  354
               + +++LP   PP  DQ+  RS  ++ S ++E H+PHV+ A+    +     V + G  
Sbjct  61    TRISYITLPQVTPPD-DQDPFRSPENYFSTFLERHKPHVKDAILNHVMSKKSSVPVVGLV  119

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             VD+FC+S IDVA+EL IP Y+Y +S A FL  MLH+PT   QV    EF +   +  +P 
Sbjct  120   VDLFCSSMIDVAKELGIPSYVYISSSAGFLGLMLHLPTRKDQV--GIEFKETDPDLNVPC  177

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F N VP    P  +  +    Y+ F  HA+R+++T+G +VNTF ELES+ + S  GG D 
Sbjct  178   FFNHVPARVMPSVLLNK-AGGYICFENHARRFKDTKGFIVNTFTELESHAVSSFLGG-DT  235

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              PVY +GP+++                +MKWLD+Q   SVVFL  GS+G  + AQ++EIA
Sbjct  236   PPVYTVGPLLN----------------IMKWLDDQPEKSVVFLCFGSIGRFSDAQVKEIA  279

Query  895   TGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLE++G+RFL SIR+PP + +  +P+DY   + VLP GF +RTK  GMVCGW PQ+ +L
Sbjct  280   LGLEQSGHRFLCSIRKPPPEGQFAMPSDYMSFEEVLPDGFLERTKNIGMVCGWAPQIQVL  339

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-D  1248
             AH+++GGFVSHCGWNSILE+L +GVP  TWP+YAEQ LNAFQMV +LGLA+E+T DY+ D
Sbjct  340   AHRSVGGFVSHCGWNSILESLWYGVPAVTWPMYAEQQLNAFQMVNDLGLAIEMTLDYRMD  399

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
                L+ A+ + + V+ LM+    VR KVK  SE  ++  +  GSS  + G LIE
Sbjct  400   SNELIVADKIAKSVKSLMEEGSTVRNKVKAVSEASRKTVVDGGSSFAAFGDLIE  453



>ref|XP_002263661.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=472

 Score =   405 bits (1040),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 215/472 (46%), Positives = 306/472 (65%), Gaps = 10/472 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+ ++VFV +P +G+L   +E +KL+++++  LSVT+ ++ +P         +S+AS  
Sbjct  1     MKKVELVFVPSPGVGHLAATLEMAKLIANRDDRLSVTIFIMKLPFESEDSKTTESVAS--  58

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKS-DDDVRIAGFFVDMF  366
             ++ F++LP  E  S        +F +  ++ + P  R A+ +L +    VR+AGF +DMF
Sbjct  59    SIRFITLPRIEISSSSSTSPA-NFFTDVVKAYTPLAREAVHELMTRSGSVRLAGFVIDMF  117

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CTS IDVA E  +P YL+F S A+FL F+LH+ +L D    + +EF D+  E  +P F +
Sbjct  118   CTSMIDVANEFGVPSYLFFTSSAAFLGFVLHLQSLHDHHNLEITEFKDSDAELEVPSFVH  177

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP  +  +  D     L H +R+RET+G++VNTF ELES+ + S F G+   P+
Sbjct  178   SVPGKVFPSVVFDKEGDEIPILLHHTQRFRETKGIIVNTFVELESHAINS-FSGDTSPPI  236

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             YPIGP+++ E  +           +M WL++Q  SSVVFL  GSMGS N  Q+REIA GL
Sbjct  237   YPIGPILNTEVESSEVQQQAIE--IMNWLNDQPPSSVVFLCFGSMGSFNGEQVREIAHGL  294

Query  904   ERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             E +G RFLWS+R+PP K K++ P +Y + + VLP GF DRT   G V GW PQV +LAH 
Sbjct  295   EGSGCRFLWSLRQPPPKGKMEYPIEYGNKEEVLPEGFLDRTTKIGKVIGWAPQVAVLAHP  354

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGIT  1257
             A+GGFVSHCGWNS LE+L +GVP  TWP+YAEQ LNAFQMVK+L LAVEI  DY KD   
Sbjct  355   AVGGFVSHCGWNSTLESLWYGVPTATWPMYAEQQLNAFQMVKDLELAVEIKIDYDKDKGY  414

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +VS++D+E+G+R+LMD D EVR+K ++  E  ++  M  GSS   LG  IE+
Sbjct  415   IVSSQDIEKGLRQLMDADSEVRKKRQKMQEKSRKAMMDGGSSYSYLGYFIED  466



>ref|XP_010657837.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=476

 Score =   405 bits (1040),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 216/475 (45%), Positives = 301/475 (63%), Gaps = 19/475 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MKQ ++VF+ TP I +L   VE +KLL+ +++  S T+L++  P     +S IDS+ +D 
Sbjct  1     MKQTELVFIPTPGISHLAATVEIAKLLTQRDRRFSSTILIMKFP----FESNIDSMTTDS  56

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + +  ++LP  E  S    R  + F S  +  + P VR A+ +L   + VR+AGF +DMF
Sbjct  57    DSVRLVTLPPVELSSGP--RPPVVFFSELVRAYAPLVRDAVHELTLSNSVRLAGFVIDMF  114

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+F S A+FL FM H+  L D +    +EF D   E  +P + N
Sbjct  115   CTPMIDVADEFGVPSYLFFTSGAAFLGFMFHLQFLHDHEGLDFNEFKDTDAELEVPSYVN  174

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP  +  +        L H +R+R+ +G +VNTF ELES+ + S F G    PV
Sbjct  175   SVPGKVFPSVVLDKEGGGTEMILHHTRRFRQVKGTIVNTFVELESHAIQS-FSGCKAPPV  233

Query  724   YPIGPVVD---REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
             YP+GP+++   R G A+   ++     +M WLD+Q  SSVVFL  GS GS    QI+EIA
Sbjct  234   YPVGPLLNNHVRSGGAQQDANA-----IMSWLDDQPPSSVVFLCFGSKGSFGVDQIKEIA  288

Query  895   TGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLE +G+RFLWS+R+P P  K+ LP DY +++ VLP GF  R  G G V GW PQV IL
Sbjct  289   HGLEHSGHRFLWSLRQPLPNGKMGLPRDYANVEEVLPEGFLHRMAGIGKVIGWAPQVAIL  348

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KD  1248
             AH A+GGFVSHCGWNS LE++ +GVP+ TWP++AEQ +NAFQMVK+LGLAVEI  DY KD
Sbjct  349   AHSAVGGFVSHCGWNSTLESIYYGVPVATWPMFAEQQINAFQMVKDLGLAVEIKMDYNKD  408

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                +VSA+++E G++KLM+ + EVR K KE  +  +      GSS  SLG+ IE+
Sbjct  409   SSYVVSAQEIEIGLKKLMNMNSEVRMKRKEMQKFSRTAIEDGGSSHFSLGQFIED  463



>ref|XP_007207423.1| hypothetical protein PRUPE_ppa004906mg [Prunus persica]
 gb|EMJ08622.1| hypothetical protein PRUPE_ppa004906mg [Prunus persica]
Length=486

 Score =   405 bits (1040),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 210/482 (44%), Positives = 306/482 (63%), Gaps = 19/482 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             M++ ++VF+  P  G+LV  ++F+K L  + + +S+T+L I       + SY  S+A S+
Sbjct  1     MEKVRLVFIPAPRSGHLVSTLQFAKRLIAREERISITILAIQSASPTTLSSYAKSVAASE  60

Query  187   GNLEFLSLPAAEP---PSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD-------DDV  336
               ++ + +P  +P   P+ D  +S      ++IE+H P+V++ +T L S        D +
Sbjct  61    PKIQLIDVPKPQPEHPPAQDSFKSPAKSFCLYIESHLPNVKKIVTNLVSSSHAKESLDSI  120

Query  337   RIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAK  516
              +AG  VD FC S IDVA+EL +P YL+  + A + + MLH+P          E  D+  
Sbjct  121   HVAGLVVDFFCVSMIDVAKELHLPTYLFMTNNAGYQALMLHLPIRHKH--NEVEPKDSDP  178

Query  517   EYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSM  696
             E++I G  +PVP    P  ++   + +Y  +++ A R+RETRG++ NTF ELE+Y + S 
Sbjct  179   EWLISGIVHPVPPRVLPVALT---DGSYSAYVKVASRFRETRGIIANTFVELETYAINSF  235

Query  697   FGGNDVGPVYPIGPVVDREG-PARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNP  873
             F      PVYP+GPV+D E   A  + +    + +++WLD+Q  SSVVFL  GSMGS   
Sbjct  236   FHDGQTPPVYPVGPVIDLEDCQAHSNLEQAQRDKIIRWLDDQPQSSVVFLCFGSMGSFGA  295

Query  874   AQIREIATGLERAGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGW  1050
              Q++EIA GLE++G RFLW++R  PPK K  +P D  + + VLP GF +RT GKG++CGW
Sbjct  296   EQVKEIAVGLEQSGQRFLWALRMPPPKGKGMMPIDCPNPEEVLPDGFLERTHGKGLICGW  355

Query  1051  VPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEI  1230
              PQV +LAHKA GGFVSHCGWNSILE+L HGVPI TWP+YAEQ LNAF+MVKELGLA+E+
Sbjct  356   APQVEVLAHKATGGFVSHCGWNSILESLWHGVPIVTWPMYAEQQLNAFRMVKELGLALEM  415

Query  1231  TFDYKD-GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
               DYK  G  +V A+++ER V  +MD + EVR+KVK+  EM ++     GSS   +G+ I
Sbjct  416   RLDYKKGGGEVVRADEIERAVVAVMDKESEVRKKVKQMGEMTRKAVKDGGSSFAYVGRFI  475

Query  1408  EE  1413
             E+
Sbjct  476   ED  477



>ref|XP_008229638.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Prunus mume]
Length=479

 Score =   404 bits (1039),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 220/480 (46%), Positives = 313/480 (65%), Gaps = 19/480 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASDG  189
             K +++V + +  IG+LV  VE SKLL  ++  L +TVL++ +P      ++Y  SL +  
Sbjct  3     KASQLVVIPSGRIGHLVSAVEISKLLVSRHDQLYITVLIMKLPFDSKGTEAYRASLEASP  62

Query  190   NL---EFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRA---LTKLKSDDDVRIAGF  351
              L    F++LP    P  D++ S+ SF + +IE+H+ +V+ A   LT+ +SD   R+AGF
Sbjct  63    VLPRVNFITLPKV--PDLDKHLSSHSFRNQFIESHKTNVKNAVAELTESQSDSRPRLAGF  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVI  528
              +DMFCT+ IDVA++  +P Y++F SPA FL  + ++  +     K+ SEF D+  E  +
Sbjct  121   VIDMFCTTMIDVADDFGVPTYMFFTSPAGFLGLLFNLQRIRDVYGKDVSEFKDSDTELSL  180

Query  529   PGFENPVPVESFPPF-MSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             P F N VP    P   + K   +T   FL +AKRY ET+G++VNTFKELES+ L S+  G
Sbjct  181   PTFVNSVPDRVLPSVVLDKEGAET---FLSYAKRYTETKGILVNTFKELESHALDSLSDG  237

Query  706   NDVGPVYPIGPVVD--REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
              +  P+YP+GP+++   +        +     +++WLD Q  SSVVFL  GSMGS +  Q
Sbjct  238   -ETPPLYPVGPMLNLMSDETQSGSEQAQQKSDILEWLDEQPPSSVVFLCFGSMGSFDEDQ  296

Query  880   IREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             +REIA GLER+G RFLWS+R+PP K  +  P DY++L  VLP GF DRT   G V GW P
Sbjct  297   VREIALGLERSGLRFLWSLRQPPPKGTVVSPGDYSNLSGVLPDGFLDRTAAMGKVIGWAP  356

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV ILAH A+GGFVSHCGWNS LE+L  GVP+  WP+YAEQ LNAF++V+ELGLAV I  
Sbjct  357   QVAILAHPAVGGFVSHCGWNSTLESLWFGVPMAAWPVYAEQQLNAFELVRELGLAVAIKM  416

Query  1237  DY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DY +D   +VSAE++ERG+R++M+ D +VR++VKE SE  K+  M+ GSS  SLG  +++
Sbjct  417   DYRRDTQVVVSAEEIERGIREVMEHDSDVRKRVKEMSEKSKKALMEGGSSHSSLGHFLDQ  476



>emb|CDP19014.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   404 bits (1037),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 206/472 (44%), Positives = 299/472 (63%), Gaps = 15/472 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQS-YIDSLASD  186
             MK A++VFV +P  G++V ++EF+K L  Q++ LSV++++I  P    + S   D  AS+
Sbjct  1     MKAAELVFVPSPGRGHIVAIIEFAKRLLQQDERLSVSIIVIKRPYSTTVDSDTADLAASN  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
              N+ F+ LP  +PP         + +S++IE H+ HV+  +          IAG  +D+F
Sbjct  61    TNIRFIYLPQVDPPVIKTCFE--NSMSVYIEMHKSHVKAGIIDHVLSKSTPIAGLVIDLF  118

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENP  546
             C+  IDVA ELD+P YL+F S A+FL  ML++P   +++   SEF  +  + +IP F NP
Sbjct  119   CSPMIDVANELDVPSYLFFTSSAAFLGLMLYLPVRHSEI--GSEFFISDPDSIIPTFANP  176

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP    P F+  +  D Y  FL H  ++ +T+G ++NTF ELE + +  +    ++ PVY
Sbjct  177   VPSRFIPSFLLDK--DGYASFLSHGTQFIKTKGFIINTFAELEPHAIKYLTSAPELPPVY  234

Query  727   PIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLE  906
              +GPV+  E   +  P+    E +M+WLDNQ SSSVVFL  GS+G     Q+ EIAT LE
Sbjct  235   TVGPVLSVEDKKK--PE---FEKIMQWLDNQPSSSVVFLCFGSLGGFEKPQLEEIATALE  289

Query  907   RAGYRFLWSIREPPKSKLDL-PNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKA  1083
              +G RFLWS+R PP    +L P +YT+   VLP GF DRT+ +G+VCGW PQV +LAH+A
Sbjct  290   WSGLRFLWSVRPPPPKDFNLKPVEYTNFSDVLPAGFLDRTENRGLVCGWAPQVEVLAHEA  349

Query  1084  IGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK--DGIT  1257
             +GGFVSHCGWNS LE+L +GVPI  WP+YAEQ  NAFQ+V EL LAVE+  DY+      
Sbjct  350   VGGFVSHCGWNSTLESLWNGVPIAAWPVYAEQQPNAFQLVNELKLAVELKSDYRITQAAK  409

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             LV AE++E+ ++ LMD ++ VR++ KE  E   +  +  GSS +SLG+ I++
Sbjct  410   LVMAEEIEKSIKSLMDTENHVRKRAKEIGEKAGKALLDGGSSFISLGRFIDD  461



>ref|XP_007215289.1| hypothetical protein PRUPE_ppa004957mg [Prunus persica]
 gb|EMJ16488.1| hypothetical protein PRUPE_ppa004957mg [Prunus persica]
Length=483

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 218/483 (45%), Positives = 310/483 (64%), Gaps = 21/483 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASDG  189
             K +++VF+ +  +G+LV  VE + LL  ++  L +TV ++ +P      +SYI SL +  
Sbjct  3     KASELVFIPSAGMGHLVSAVEMATLLVARHDRLFITVFIMKLPFDSKGTESYIASLEASP  62

Query  190   ---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL---KSDDDVRIAGF  351
                 + F++LP    P+ D + S  SF + +IE+H+PHV+ A+ KL   +SD   R+AGF
Sbjct  63    VSPRVNFITLPKV--PAIDNHISPNSFRNQFIESHKPHVKNAVAKLTESESDSRPRLAGF  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVI  528
              +DMFCT+ IDVA+E  +P Y++F SPA FL  + ++  + D    + SEF D+  E  +
Sbjct  121   VIDMFCTTMIDVADEFGVPTYMFFTSPAGFLGLLFNLQRIRDVYNKEVSEFKDSDAELAL  180

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P F N VP    P  +  +  D     L +AKR+RET+G++VNTF ELES+ L S+  G 
Sbjct  181   PTFVNSVPANVLPSVLLDK--DGAKAILGYAKRFRETKGILVNTFMELESHALDSLSDG-  237

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHEL--VMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             +  P+YP+GP+++ +            +   V++WLD+Q  SSVVFL  GSMGS    Q+
Sbjct  238   ETPPLYPVGPILNLKSDDSQSDSKQAQQKSDVLEWLDDQPPSSVVFLCFGSMGSFGEDQV  297

Query  883   REIATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             REIA GLER+G RFLWS+R+ PPK  +  P+DY+D   VLP GF DR  G G V GW PQ
Sbjct  298   REIAWGLERSGLRFLWSLRQAPPKETVASPSDYSDPKAVLPEGFLDRAVGIGKVIGWAPQ  357

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V ILAH+AIGGFVSHCGWNS LE+L  GVP+ TWP+YAEQ LNAF++V+ELGLAVEI  +
Sbjct  358   VAILAHRAIGGFVSHCGWNSTLESLWFGVPVATWPMYAEQQLNAFELVRELGLAVEIKME  417

Query  1240  YK-----DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKL  1404
             Y+     +   +V AE++ERG+R++M  D ++R++VKE SE  K+  M  GSS  SLG  
Sbjct  418   YRRDFYGESPKVVKAEEIERGIREVMVQDSDLRKRVKEMSEKGKKALMDGGSSHSSLGHF  477

Query  1405  IEE  1413
             + +
Sbjct  478   LHQ  480



>ref|XP_002264548.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=476

 Score =   403 bits (1036),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 210/473 (44%), Positives = 304/473 (64%), Gaps = 16/473 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M+Q ++VF+  P IG+L   +E +KL++ ++   S+T++++  P        ID + +D 
Sbjct  1     MEQTELVFIPFPIIGHLASALEIAKLITQRDPRFSITIIIMKFPFES-----IDGMDTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S  +   +  FLS ++  H P VR A+ +L   + VR+AGF +DMF
Sbjct  56    DSIRFVTLPRLEVSS--RTAPSGLFLSEFLNAHIPLVRDAVHELTRSNSVRLAGFVIDMF  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+   +P YL+F+S A+FL F+LH+  L D +    +EF D+  E  +P F N
Sbjct  114   CTHMIDVADVFGVPSYLFFSSSAAFLGFLLHLQFLHDYEGLDFNEFKDSGAELEVPSFAN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP ++FP  M  +        L H +R+R+ +G++VNTF ELES+ + S+  G+ V  V
Sbjct  174   SVPGKTFPSLMIDKESGGAEMLLYHTRRFRQVKGILVNTFIELESHAIQSL-SGSTVPAV  232

Query  724   YPIGPVVDRE-GPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             YPIGP+++ + G      D+    ++M WLD+Q  SSV+FL  GSMGS    QI+EI  G
Sbjct  233   YPIGPILNTQMGSGGGQQDA---SVIMSWLDDQPPSSVIFLCFGSMGSFGADQIKEITYG  289

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE  G+RFLWS+ +PP K K++  +DY +++ VL  GF  RT   G V GW PQ+ +LAH
Sbjct  290   LEHNGHRFLWSLCQPPRKDKMEFQSDYENIEEVLLEGFLHRTARIGKVIGWAPQIAVLAH  349

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGI  1254
              A+GGFVSHCGWNS+LE + +GVP+ TWPIYAEQ +NAFQMVK+LGLA EI  DY KD  
Sbjct  350   SAVGGFVSHCGWNSLLENVWYGVPVATWPIYAEQQINAFQMVKDLGLATEIKIDYNKDND  409

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +VSA ++E G+R LM+ D EVR+K KE  ++ +RV +  GSS  SLG  IE+
Sbjct  410   YVVSAHEIENGLRNLMNIDSEVRQKRKEMQKISRRVMIDGGSSHFSLGHFIED  462



>dbj|BAB60721.1| glucosyltransferase [Nicotiana tabacum]
Length=479

 Score =   403 bits (1036),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 206/478 (43%), Positives = 307/478 (64%), Gaps = 15/478 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK A++VF+  P +G+LVP VE +K L  +++ LS+TVL++ +P    I SY  SL+SD 
Sbjct  1     MKTAELVFIPAPGMGHLVPTVEVAKQLVDRHEQLSITVLIMTIPLETNIPSYTKSLSSDY  60

Query  190   NLEFLSLPAAEPPSPDQNRS--TISFLSIWIENHEPHVRRALTKLKSDDD--VRIAGFFV  357
             +     LP ++P +     S   I+F   +I +++  V+ A+++        V++AGF +
Sbjct  61    SSRITLLPLSQPETSVTMSSFNAINFFE-YISSYKGRVKDAVSETSFSSSNSVKLAGFVI  119

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQV-PKNSEFGDAAKEYVIPG  534
             DMFCT+ IDVA E  IP Y+++ S A+ L   LH  +L  +  PK   + +   E +I  
Sbjct  120   DMFCTAMIDVANEFGIPSYVFYTSSAAMLGLQLHFQSLSIECSPKVHNYVEPESEVLIST  179

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             + NPVPV+  P  +    E + + F+ HA+R+RET+G++VNTF ELES+ L ++     +
Sbjct  180   YMNPVPVKCLPGIILVNDESSTM-FVNHARRFRETKGIMVNTFTELESHALKALSDDEKI  238

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              P+YP+GP+++ E     H  +  ++ +MKWLD + +SSVVFL  GS GS    Q++EIA
Sbjct  239   PPIYPVGPILNLENGNEDH--NQEYDAIMKWLDEKPNSSVVFLCFGSKGSFEEDQVKEIA  296

Query  895   TGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
               LE +GY FLWS+R PP K KL  P+++ + + VLP GF  RTKG+G V GW PQ+ IL
Sbjct  297   NALESSGYHFLWSLRRPPPKDKLQFPSEFENPEEVLPEGFFQRTKGRGKVIGWAPQLAIL  356

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             +H ++GGFVSHCGWNS LE++  GVPI TWP+YAEQ  NAFQ+VK+LG+AVEI  DY++ 
Sbjct  357   SHPSVGGFVSHCGWNSTLESVRSGVPIATWPLYAEQQSNAFQLVKDLGMAVEIKMDYRED  416

Query  1252  IT-----LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
                    LV AE++E G+RKLMD ++++R KV E  +  +   ++ GSS V+LG  +E
Sbjct  417   FNTRNPPLVKAEEIEDGIRKLMDSENKIRAKVTEMKDKSRAALLEGGSSYVALGHFVE  474



>emb|CDP09590.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   403 bits (1036),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/473 (41%), Positives = 315/473 (67%), Gaps = 13/473 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ K+VFV +P IG+L+  VE SK L+ ++  LS+ VL+I+ P  P ++SY   +A S+
Sbjct  1     MKKTKLVFVPSPGIGHLISTVELSKRLTERDDQLSIFVLVISSPVGPDLESYTQQVAASN  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTK--LKSDDDVRIAGFFVD  360
               ++F+++P  +P  P    S  +  ++++E+H+ HV+ A+    L S+    +AG  VD
Sbjct  61    TGIQFINIPRVDPNLPQVWSSPENLYALYLESHKSHVKTAIIDQVLVSESITSLAGIVVD  120

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFE  540
             +FC+S +DVA EL +P Y++F S  ++L FM ++P   +Q  +  EF  +  + +IP + 
Sbjct  121   LFCSSMVDVANELGVPSYVFFPSGCAYLGFMFYLPIHYSQYGR--EFETSDSDSIIPTYS  178

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             +P+P +  P +   +H   Y  F++HA +++ET+G+++NTF ELE + +  +    +  P
Sbjct  179   HPIPSKVIPSYAFNKH-GGYSSFVKHATKFKETKGIIINTFAELEPHAVDQLKFDAETPP  237

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             +Y +GP++D EG  R  PD   HE ++KWLD+Q  SSV+FL  GSMGS  P Q+ E+A  
Sbjct  238   IYTVGPLLDLEGRKR-EPD---HEKIIKWLDDQPPSSVIFLCFGSMGSFEPDQLAEMALA  293

Query  901   LERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             LER+GYRFLWS+R   K+      +++++  +LP GF +R + +G+V  W PQ+ +LAH+
Sbjct  294   LERSGYRFLWSVR-LSKAYTKGTGEHSNISEMLPQGFLERVENRGLVSSWAPQMEVLAHE  352

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK--DGI  1254
             A+GGFVSHCGWNSILE+L HGVP+ TWP+YAEQ +NAF++V+EL LA+++  DY+  +  
Sbjct  353   AVGGFVSHCGWNSILESLWHGVPVATWPVYAEQQINAFELVRELELAMDLKMDYRMENAQ  412

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              LV AE++E+ +R LMD ++  R++V+E  EM ++     GSS +SLG+LIE+
Sbjct  413   NLVVAEEIEKAIRCLMDTENPTRKRVQEMKEMSRKAIENGGSSFISLGRLIED  465



>ref|XP_002264883.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=476

 Score =   403 bits (1036),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 212/473 (45%), Positives = 303/473 (64%), Gaps = 16/473 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M+Q ++VF+  P IG+L   +E +KL++ ++   S+T++++  P        ID + +D 
Sbjct  1     MEQTELVFIPFPIIGHLTSALEIAKLITQRDPRFSITIIIMKFPFES-----IDGMDTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S      +  FLS +++ H P VR A+ +L   + VR+AGF +DMF
Sbjct  56    DSIRFVTLPPVEVCS--STTPSGFFLSEFLKAHIPVVRDAIHELTRSNSVRLAGFVIDMF  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+F S A+FL F+LH+  L D +    ++F D+  E  +P F N
Sbjct  114   CTHMIDVADEFGVPSYLFFTSSAAFLGFLLHLQFLHDYEGLDFNKFKDSDAELDVPSFAN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP  M  +        L H +R+RE +G++VNTF ELE + + S+   + V  V
Sbjct  174   SVPGKVFPSRMFDKEGGGAETLLYHTRRFREVKGILVNTFIELELHAVRSL-SDSTVPEV  232

Query  724   YPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             YP+GP+++ R G      D+     +M WLD+Q  SSVVFL  GS G+    QI+EIA G
Sbjct  233   YPVGPILNTRMGSGGCQQDA---SAIMSWLDDQPPSSVVFLCFGSRGTFGAEQIKEIAYG  289

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE +G+RFLWS+R+PP K K+D P+DY  ++ VLP GF  RT   G V GW PQ  +L+H
Sbjct  290   LEHSGHRFLWSLRQPPPKGKMDFPSDYESIEEVLPEGFLHRTARIGKVIGWAPQAAVLSH  349

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGI  1254
              A+GGFVSHCGWNS+LE++ +GVP+ TWPIYAEQ +NAFQMVK+LGLA EI  DY KD  
Sbjct  350   SAVGGFVSHCGWNSLLESVWYGVPVATWPIYAEQQINAFQMVKDLGLATEIKIDYNKDND  409

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +VSA ++E G+R LM+ D EVR+K KE  ++ +RV +  GSS  SLG  IE+
Sbjct  410   YVVSAHEIENGLRNLMNIDSEVRQKRKEMQKISRRVMIDGGSSHFSLGHFIED  462



>sp|Q66PF3.1|UFOG3_FRAAN RecName: Full=Putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3; Short=FaGT3; AltName: Full=Flavonol 3-O-glucosyltransferase 
3 [Fragaria x ananassa]
 gb|AAU09444.1| UDP-glucose glucosyltransferase [Fragaria x ananassa]
Length=478

 Score =   403 bits (1035),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 215/480 (45%), Positives = 310/480 (65%), Gaps = 18/480 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQ-RPLIQSYIDSLASDG  189
             K A++V + +P IG+LV  +E +KLL  ++  L +TVL+++ P       +Y+ SLA   
Sbjct  3     KPAELVLIPSPGIGHLVSTLEIAKLLVSRDDKLFITVLIMHFPAVSKGTDAYVQSLADSS  62

Query  190   N-----LEFLSLPAAEPPSPDQNRSTI-SFLSIWIENHEPHVRRALTKLKSDDDVRIAGF  351
             +     + F++LP     + D    ++ + L  ++E+ +PHV+ A+  L+     R+AGF
Sbjct  63    SPISQRINFINLPHT---NMDHTEGSVRNSLVGFVESQQPHVKDAVANLRDSKTTRLAGF  119

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVI  528
              VDMFCT+ I+VA +L +P Y++F S A+ L  + H+  L  Q  K+ +EF D+  E +I
Sbjct  120   VVDMFCTTMINVANQLGVPSYVFFTSGAATLGLLFHLQELRDQYNKDCTEFKDSDAELII  179

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P F NP+P +  P  M  +  D+  PFL   KR+RET+G++VNTF +LES+ L ++    
Sbjct  180   PSFFNPLPAKVLPGRMLVK--DSAEPFLNVIKRFRETKGILVNTFTDLESHALHALSSDA  237

Query  709   DVGPVYPIGPVVD-REGPARWHPDSWNHEL-VMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             ++ PVYP+GP+++     +R   D    +  ++KWLD+Q   SVVFL  GSMGS + +Q+
Sbjct  238   EIPPVYPVGPLLNLNSNESRVDSDEVKKKNDILKWLDDQPPLSVVFLCFGSMGSFDESQV  297

Query  883   REIATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             REIA  LE AG+RFLWS+R  PP  K+  P+DY D   VLP GF DRT G G V GW PQ
Sbjct  298   REIANALEHAGHRFLWSLRRSPPTGKVAFPSDYDDHTGVLPEGFLDRTGGIGKVIGWAPQ  357

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V +LAH ++GGFVSHCGWNS LE+L HGVP+ TWP+YAEQ LNAFQ VKEL LAVEI   
Sbjct  358   VAVLAHPSVGGFVSHCGWNSTLESLWHGVPVATWPLYAEQQLNAFQPVKELELAVEIDMS  417

Query  1240  YKD-GITLVSAEDVERGVRKLMDGD-DEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             Y+     LVSA+++ERG+R++M+ D  ++R++VKE SE  K+  M  GSS  SLG  I++
Sbjct  418   YRSKSPVLVSAKEIERGIREVMELDSSDIRKRVKEMSEKGKKALMDGGSSYTSLGHFIDQ  477



>gb|ACZ44837.1| glycosyltransferase [Pyrus communis]
Length=481

 Score =   403 bits (1035),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 215/479 (45%), Positives = 312/479 (65%), Gaps = 18/479 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VF+ +P  G+LVP ++F+K L  +N  +S+T+L I       + SY  S+A S+
Sbjct  1     MKKVELVFIPSPGAGHLVPTLQFAKRLIDRNDRISITILAIQSYFPTTLSSYTKSIAASE  60

Query  187   GNLEFLSLPAAEP-PSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAG  348
               + F+ +P  +  P  +  +S   F S++IE+  P V++ +T L      S D +R+A 
Sbjct  61    PRIRFIDVPQPQDRPPQEMYKSPAKFFSLYIESQVPSVKKIITNLVSSSANSSDSIRVAA  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               VD+FC S IDVA+EL+IP YL+  S A +L+FMLH+P ++ +     E  D   E+ I
Sbjct  121   LVVDLFCVSMIDVAKELNIPSYLFLTSNAGYLAFMLHLPIVNEKNQIAVEESDP--EWSI  178

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             PG  +PVP   FP  ++      Y+     A R+RETRG++VNTF ELE++ + ++F  +
Sbjct  179   PGIVHPVPPRVFPVALTDGRCSAYIKL---ASRFRETRGIIVNTFVELETHAI-TLFSTD  234

Query  709   D-VGPVYPIGPVVDRE-GPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             D + PVYP+GPV+D + G A  + D    + ++KWLD+Q   SVVFL  GSMGS    Q+
Sbjct  235   DGIPPVYPVGPVIDMDDGQAHSNLDQAQRDRIIKWLDDQPQKSVVFLCFGSMGSFRAEQV  294

Query  883   REIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVPQ  1059
             +EIA GLE++G RFLWS+R P      +P D ++L+ VLP GF +RT GK G++CGW PQ
Sbjct  295   KEIALGLEQSGQRFLWSLRMPSPIG-TVPCDCSNLEEVLPDGFLERTNGKKGLICGWAPQ  353

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V ILAH A GGF+SHCGWNSILE+L HGVPI TWP+YAEQ LNAF+M +ELG+A+E+  D
Sbjct  354   VEILAHSATGGFLSHCGWNSILESLWHGVPITTWPMYAEQQLNAFRMARELGMALEMRLD  413

Query  1240  YKDG-ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             YK G   +V A+++ER V  +M+ D EVR+KV+E  +M ++     GSS  S+G+ IE+
Sbjct  414   YKRGSADVVGADEIERAVVGVMEKDSEVRKKVEEMGKMARKAVKDGGSSFASVGRFIED  472



>ref|XP_003633360.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
 emb|CBI19994.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   403 bits (1035),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 214/473 (45%), Positives = 303/473 (64%), Gaps = 16/473 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M+Q ++VF+  P IG+L   +E +KL++ ++   S+T++++  P        ID + +D 
Sbjct  1     MEQTELVFIPFPIIGHLTSALEIAKLITQRDPRFSITIIIMKFPFES-----IDGMDTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S      +  FLS  ++ H P VR A+ +L   + VR+AGF +DMF
Sbjct  56    DSIRFVTLPPVEVGS--STTPSGFFLSELLKAHIPVVRDAIHELTRSNSVRLAGFVIDMF  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA E  +P YL+F S A+FL F+LH+  L D +    +EF D+  E  +P F  
Sbjct  114   CTHMIDVANEFGVPSYLFFTSSAAFLGFLLHLQFLHDYEGLDFNEFKDSDAELDVPSFAI  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP  M  +        L + +R+RE +G++VNTF ELES+ + S+  G+ V  V
Sbjct  174   SVPGKVFPSRMFDKESGGAEMLLYYTRRFREVKGILVNTFIELESHAVRSL-SGSTVPKV  232

Query  724   YPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             YP+GP+++ R G      D+     +M WLD+Q  SSVVFL  GS GS    QI+EIA G
Sbjct  233   YPVGPILNTRMGSGGCQQDA---SAIMSWLDDQPPSSVVFLCFGSRGSFGADQIKEIAYG  289

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE +G+RFLWS+R+PP K K+D P DY  ++ VLP GF  RT   G V GW PQV +L+H
Sbjct  290   LEHSGHRFLWSLRQPPPKGKMDFPIDYESIEEVLPEGFLHRTARIGKVIGWAPQVAVLSH  349

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGI  1254
              A+GGFVSHCGWNS+LE++ +GVPI TWPIYAEQ +NAFQMVK+LGLA+EI  DY +D  
Sbjct  350   SAVGGFVSHCGWNSLLESVWYGVPIATWPIYAEQQINAFQMVKDLGLAIEIKIDYNEDSD  409

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +VSA ++E G+R LM+ + EVR+K KE  ++ +RV +  GSS  SLG  IE+
Sbjct  410   YVVSAHEIENGLRNLMNINSEVRQKKKEMQKISRRVMIDGGSSHFSLGHFIED  462



>ref|XP_009609116.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=479

 Score =   403 bits (1035),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 206/478 (43%), Positives = 307/478 (64%), Gaps = 15/478 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK A++VF+  P +G+LVP VE +K L  +++ LS+TVL++ +P    I SY  SL+SD 
Sbjct  1     MKTAELVFIPAPGMGHLVPTVEVAKQLVDRHEQLSITVLIMILPLETNIPSYTKSLSSDY  60

Query  190   NLEFLSLPAAEPPSPDQNRS--TISFLSIWIENHEPHVRRALTKLKSDDD--VRIAGFFV  357
             +     LP ++P +     S   I+F   +I +++  V+ A+++        V++AGF +
Sbjct  61    SSRITLLPLSQPETSVTMSSFNAINFFE-YISSYKGRVKDAVSETSFSSSNSVKLAGFVI  119

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQV-PKNSEFGDAAKEYVIPG  534
             DMFCT+ IDVA E  IP Y+++ S A+ L   LH  +L  +  PK   + +   E +I  
Sbjct  120   DMFCTAMIDVANEFGIPSYVFYTSSAAMLGLQLHFQSLSIECSPKVHNYVEPESEVLIST  179

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             + NPVPV+  P  +    E + + F+ HA+R+RET+G++VNTF ELES+ L ++     +
Sbjct  180   YMNPVPVKCLPGIILVNDESSTM-FVNHARRFRETKGIMVNTFTELESHALKALSDDEKI  238

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              P+YP+GP+++ E     H  +  ++ +MKWLD + +SSVVFL  GS GS    Q++EIA
Sbjct  239   PPIYPVGPILNLENGNEDH--NQEYDAIMKWLDEKPNSSVVFLCFGSKGSFEEDQVKEIA  296

Query  895   TGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
               LE +GY FLWS+R PP K KL  P+++ + + VLP GF  RTKG+G V GW PQ+ IL
Sbjct  297   NALESSGYHFLWSLRRPPPKDKLQFPSEFENPEEVLPEGFFQRTKGRGKVIGWAPQLAIL  356

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             +H ++GGFVSHCGWNS LE++  GVPI TWP+YAEQ  NAFQ+VK+LG+AVEI  DY++ 
Sbjct  357   SHPSVGGFVSHCGWNSTLESVRSGVPIATWPLYAEQQSNAFQLVKDLGMAVEIKMDYRED  416

Query  1252  IT-----LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
                    LV AE++E G+RKLMD ++++R KV E  +  +   ++ GSS V+LG  +E
Sbjct  417   FNTRNPPLVKAEEIEDGIRKLMDSENKIRAKVTEMKDKSRAALLEGGSSYVALGHFVE  474



>ref|XP_007016124.1| Glycosyltransferase, putative [Theobroma cacao]
 gb|EOY33743.1| Glycosyltransferase, putative [Theobroma cacao]
Length=475

 Score =   402 bits (1033),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 206/475 (43%), Positives = 306/475 (64%), Gaps = 12/475 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             MK+ +++F+ TP IG+LV  +EF+K L HQ+  + +TVL +       + +Y  SL +  
Sbjct  1     MKKVELIFIPTPGIGHLVSTIEFAKRLIHQDDRIWITVLSMKWSPSASVDAYTKSLVASQ  60

Query  187   -GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL----KSDDDVRIAGF  351
                ++ + LP  +PPS D  +S  +++  +IE++ P VR A+  +     S D  R+AG 
Sbjct  61    PDRIQLIDLPQVDPPSLDLRKSAENYIYAFIESYIPPVRDAVRNIVSLRSSSDSGRVAGL  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
              +D FC   ID+A EL +P Y+Y  +  +FL  ML++PT  +Q   +SEF     E +IP
Sbjct  121   VLDFFCAPMIDIATELGLPSYIYLTTNTAFLGLMLYLPTRHSQ--NSSEFEITDSEQLIP  178

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
             GF NPVP+   P  +  ++   Y  +++ A+R+++ +G++VNTF+ +E   L     G +
Sbjct  179   GFVNPVPLCVLPSAVFNKY-GGYTAYVKVAERFKDAKGIIVNTFEAIEPCALNYFLNGPN  237

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
               P+YP+GPV+D         D      VM WLD+Q  SSV+FL  GSMG     Q++EI
Sbjct  238   -PPIYPVGPVIDLNALPHPELDLDKRSKVMTWLDDQPQSSVIFLCFGSMGCFGAPQVKEI  296

Query  892   ATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
             A GLE++GYRFLWS+R PP S+ D    Y + + +LP GF +R +G+G++C W PQV +L
Sbjct  297   ALGLEQSGYRFLWSLRMPPPSQNDDTLIYKNPEEMLPEGFLERIQGRGIICEWAPQVEVL  356

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             A+KAIGGFVSHCGWNSILE+L  GVPI TWP+YAEQ LNA+ M KELGLAV +  DY+ G
Sbjct  357   ANKAIGGFVSHCGWNSILESLWFGVPIVTWPMYAEQQLNAYLM-KELGLAVVMRLDYRRG  415

Query  1252  IT-LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              + LV AE++E+ ++ +MDG  ++R+KVKE +EM ++  MK GSS +S+G+LIE+
Sbjct  416   RSDLVMAEEIEKAIQLVMDGGSDLRKKVKEMAEMARKAVMKGGSSFISIGRLIED  470



>ref|XP_002265306.2| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=468

 Score =   402 bits (1032),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 208/471 (44%), Positives = 302/471 (64%), Gaps = 14/471 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MKQ ++VF+  P IG+L P VE +KLL+ ++   S+T+ ++  P        IDS+ +D 
Sbjct  1     MKQTELVFIPLPIIGHLSPTVEMAKLLTQRDPRFSITIFIMKFPF-----GSIDSMTTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S         F+S +I+     VR A+ +L   + VR+AGF +D  
Sbjct  56    DSIRFVTLPPVEFSSGATTPGP--FMSEFIKAQTLLVRDAVHELTRSNSVRLAGFVIDAL  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+  S A+ L F+LH+  L D +     EF D+  E  +P + N
Sbjct  114   CTHMIDVADEFGVPSYLFSTSSAASLGFLLHLQFLHDYEGLNLDEFKDSDAELQVPSYAN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FPP +  +       ++ H +R R+ +GV+VNTF +LES+ + S F G+ + PV
Sbjct  174   SVPGKVFPPMIFYKELGGAPGYMYHMRRLRQAKGVMVNTFIDLESHAIQS-FSGSKIPPV  232

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             YP+GP+++ +    +  D  +   +M WLD+Q  SSVVFL  GS+GS    QI+EIA GL
Sbjct  233   YPVGPILNTQ--MGYGGDQQDASAIMSWLDDQPPSSVVFLCFGSIGSFGADQIKEIAYGL  290

Query  904   ERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             ER+G+RFLWS+R+ PP  K+  P D+ +++ VLP GF  RT G G + GW PQV +LAH 
Sbjct  291   ERSGHRFLWSLRQAPPNGKMAFPRDFENIEEVLPEGFLPRTAGIGKMIGWAPQVAVLAHS  350

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGIT  1257
             A+GGFVSHCGWNS+LE++ +GVP+ TWP+YAEQ +NAFQMVK+LGLAVEI  DY KD   
Sbjct  351   AVGGFVSHCGWNSLLESIWNGVPVATWPMYAEQQINAFQMVKDLGLAVEIKIDYDKDNSY  410

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             +V+A ++E G++KLM  + EVR+K+ E  ++ +RV +  GSS  SLG  IE
Sbjct  411   IVNAHEIENGLKKLMSINSEVRKKMNEMQQISRRVMIDGGSSHSSLGHFIE  461



>ref|XP_002265387.2| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=468

 Score =   402 bits (1032),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 208/471 (44%), Positives = 302/471 (64%), Gaps = 14/471 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MKQ ++VF+  P IG+L P VE +KLL+ ++   S+T+ ++  P        IDS+ +D 
Sbjct  1     MKQTELVFIPLPIIGHLSPTVEMAKLLTQRDPRFSITIFIMKFPF-----GSIDSMTTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + +  ++LP  E  S         F+S +I+     VR A+ +L   + VR+AGF +D+ 
Sbjct  56    DSIRLVTLPPVEISSGATTPG--PFISEFIKTQTLLVRDAVHELTRSNSVRLAGFVIDVL  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+  S A+ L F+LH+  L D +     EF D+  E  +P + N
Sbjct  114   CTHMIDVADEFGVPSYLFSTSSAASLGFLLHLQFLHDYEGLNLDEFKDSDAELQVPSYAN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FPP +  +  D     + H +R R+ +GV+VNTF +LES+ + S F G+ + PV
Sbjct  174   SVPGKVFPPMIFDKGVDGAAGHVYHMRRLRQAKGVLVNTFIDLESHAIQS-FSGSKIPPV  232

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             YP+GP+++ +    +  D  +   +M WLD+Q  SSVVFL  GS+GS    QI+EIA GL
Sbjct  233   YPVGPILNTQ--MGYGGDQQDASAIMSWLDDQPPSSVVFLCFGSIGSFGADQIKEIAYGL  290

Query  904   ERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             ER+G+RFLWS+R+PP K K+  P DY +++ VLP GF  RT   G + GW PQV +LAH 
Sbjct  291   ERSGHRFLWSLRQPPPKGKMAFPRDYENIEEVLPEGFLHRTARVGRIIGWAPQVAVLAHT  350

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGIT  1257
             A+GGFVSHCGWNS+LE++ +GVP+ TWP+YAEQ +NAFQMVK+LGLAVEI  DY KD   
Sbjct  351   AVGGFVSHCGWNSLLESIWYGVPVATWPMYAEQQINAFQMVKDLGLAVEIKIDYDKDNNY  410

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             +V+A ++E G++KLM  + EVR+K+ E  ++ ++V +  GSS  SLG  IE
Sbjct  411   IVNAYEIENGLKKLMSINSEVRKKMNEMQQISRKVMIDGGSSHSSLGHFIE  461



>ref|XP_002265585.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=472

 Score =   402 bits (1032),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 213/476 (45%), Positives = 310/476 (65%), Gaps = 21/476 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MKQ +++F+  P +G+L P VE +KLL+ + +  S+T+ ++N+P       ++DS+  D 
Sbjct  1     MKQTELIFIPFPIMGHLGPTVEIAKLLAQRARRFSITIFIMNIPFE-----FLDSMTKDS  55

Query  190   N---LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVD  360
             +   + F++LP  E  S   +     FLS +++   P VR A+ +L   + VR+AGF +D
Sbjct  56    DSYSIRFVALPPVEVSSEAMSDP---FLSEFVKASIPLVRDAVHELTRSNSVRLAGFVID  112

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGF  537
             M CT  ID+A+E  +P YL+F S A+FL F+LH+  L D +     EF D+  E  +P +
Sbjct  113   MCCTHMIDLADEFGVPSYLFFPSSAAFLGFLLHLQFLHDYEGLNLDEFKDSNAELEVPSY  172

Query  538   ENPVPVESFPPFM-SKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
              N VP + FP  M  K      LP L H +R+R+ +G++ NTF ELES+ + S F G+ V
Sbjct  173   ANSVPGKVFPSVMFDKEVNGAELP-LYHMRRFRQVKGIMANTFIELESHAIQS-FSGSTV  230

Query  715   GPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
              PVYP+GP+++ R G   +  D  N   +M WLD+Q  SSVVFL  GSMGS    QI+EI
Sbjct  231   PPVYPVGPILNTRMG---FGEDQQNASAIMSWLDDQPPSSVVFLCFGSMGSFGADQIKEI  287

Query  892   ATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             A GL+ +G+RFLWS+R+PP K K++LP+DY +++ VLP GF  RT   G V GW PQV +
Sbjct  288   AHGLDHSGHRFLWSLRQPPLKGKMELPSDYENIEEVLPEGFLHRTARIGKVIGWAPQVAV  347

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-  1245
             LAH A+GGFVSHCGWNS++E++ +GVP+ TWP+Y EQ ++AFQM+K+LGLA EI  DY  
Sbjct  348   LAHSAVGGFVSHCGWNSLIESIWYGVPVATWPMYGEQQIHAFQMIKDLGLAEEIKIDYNM  407

Query  1246  DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +   +VSA +VE G+R LM+ + EVR+K KE  ++ ++V +  GSS  SLG  IE+
Sbjct  408   NSGYIVSACEVENGLRNLMNINSEVRKKKKEMQKISRKVVIDGGSSHFSLGHFIED  463



>ref|XP_010036083.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW47604.1| hypothetical protein EUGRSUZ_K01350 [Eucalyptus grandis]
Length=484

 Score =   402 bits (1033),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 215/487 (44%), Positives = 308/487 (63%), Gaps = 28/487 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS--  183
             MK+ ++VFV +P IG LVP VE +KLL  ++  LS T+ +I +P    I +Y DSLAS  
Sbjct  1     MKRGELVFVPSPGIGQLVPAVEVAKLLVQRDHRLSATIFIITLPFDNKITTYTDSLASSS  60

Query  184   ---DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDD----DVRI  342
                DG ++F++LP  + PS + N     FL+  IE  +PHV++   +    +    + R+
Sbjct  61    SSIDGRVKFITLPE-QKPSLEAN-----FLTSLIEIQKPHVKKVAAQFAHSESGPEEPRL  114

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKE  519
             A F + MFCT+ IDVA E  +P Y+++ S A  L  MLH+ TL D      +E  D+  E
Sbjct  115   AAFVIGMFCTTMIDVANEFGVPTYVFYTSSAGALGLMLHLQTLRDVHSQDITELKDSDTE  174

Query  520   YVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF  699
              ++P   NPVP +  P  +  R  D  +  L   +R++ET+G++VNTF ELE + + S F
Sbjct  175   LMVPSCINPVPAKVLPSVVLNR--DWSMVILDQFQRFKETKGILVNTFLELEGHAVKS-F  231

Query  700   GGNDVGPVYPIGPVVDREGPAR-WHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
               +++  VYP+GP++D +G A     D    E ++ WLD+Q  +SVVFL  GSMGS +  
Sbjct  232   ANSEIPSVYPVGPILDLKGNAHVGSSDDRQGEDLICWLDDQPPASVVFLCFGSMGSFSED  291

Query  877   QIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWV  1053
             Q+REIA  LE+ GYRF+WS+R PP K K+  P+DYT+    LP GF +R    G V GW 
Sbjct  292   QVREIACALEQCGYRFVWSLRRPPPKGKMGYPSDYTNPAAALPEGFLERMATVGRVIGWA  351

Query  1054  PQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT  1233
             PQV +LAH A+GGFVSHCGWNSILE+L +GVP+ TWP+Y+EQ  NAF+MV+ELGL+VEI 
Sbjct  352   PQVAVLAHPAVGGFVSHCGWNSILESLWYGVPVATWPLYSEQQFNAFEMVRELGLSVEIR  411

Query  1234  FDYKDGI-----TLVSAEDVERGVRKLMDGDD--EVREKVKEYSEMCKRVWMKNGSSAVS  1392
              DY+  +     ++V A+++ERG++ LM+  +  E+R+KVKE    C+ V M+ GSS   
Sbjct  412   MDYRRDVRAESESMVCADEIERGLKSLMESGNEMEMRKKVKEMKAKCRMVTMEGGSSYFY  471

Query  1393  LGKLIEE  1413
             LG+LI E
Sbjct  472   LGQLISE  478



>ref|XP_009790789.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nicotiana 
sylvestris]
Length=515

 Score =   402 bits (1034),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/479 (43%), Positives = 303/479 (63%), Gaps = 13/479 (3%)
 Frame = +1

Query  4     AIMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS  183
             ++  +A++VF+  P  G+L+  VE +KL+  +++ L ++VL++ +P     QSY++SL+S
Sbjct  33    SMTTKAELVFIPAPGAGHLISAVEIAKLILDRDERLCISVLIMKLPMDLGTQSYVESLSS  92

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDM  363
                L+F+ + A E  + +   +  +F   +I  H+P V   +  + S+   R+AGF +DM
Sbjct  93    TARLQFVDITADEKTAAELISNKETFFLDFIRGHKPKVIDFVHNMTSNS--RLAGFVLDM  150

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVP-KNSEFGDAAKEYVIPGFE  540
             FC   IDVA E  +P Y++F S ASFL+  LH  +L  +     S++ D+ +E  IPGF+
Sbjct  151   FCIPMIDVANEFSVPSYIFFTSSASFLALCLHFESLKKEHNIDTSKYMDSNEELAIPGFK  210

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
              P P +  P   + +     + F     RY+ET+G++VNTF ELE + L  + G   V  
Sbjct  211   TPYPAKLLPRVTTDQSAVITM-FFDFVTRYKETKGIMVNTFAELEPFALQFLSGSKKVPK  269

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             +YP+GPVV+ +            E ++KWLD++  SSVVFL  GSMGS  P Q++EIA  
Sbjct  270   IYPVGPVVNIKEGGHGRNSQSETESIIKWLDDKPESSVVFLCFGSMGSFEPEQVKEIAIA  329

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE +G+RFLWS+R+PP K K++LP++Y + + VLP GF +RT G G V GW PQVT+L+H
Sbjct  330   LECSGHRFLWSLRKPPPKGKMELPSNYENFEEVLPEGFIERTNGVGKVIGWAPQVTVLSH  389

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-----  1242
              A+GGFVSHCGWNSILE+ C GVP+ TWP +AEQ +NAF +VKEL LAVEI  DY     
Sbjct  390   PAVGGFVSHCGWNSILESFCFGVPMATWPHHAEQQMNAFALVKELELAVEIRMDYVKDFQ  449

Query  1243  -KDGITLVSAEDVERGVRKLM-DGD-DEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
              K+ + +V+AE++E G+R+LM DGD + +R+K KE  E       + GSS  SLG LIE
Sbjct  450   GKNPVDIVTAEEIESGIRQLMADGDHNGIRKKAKEMKEKSSATMKEGGSSYASLGLLIE  508



>ref|XP_009350669.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=489

 Score =   402 bits (1032),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 219/478 (46%), Positives = 305/478 (64%), Gaps = 19/478 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP---QRPLIQ--SYIDS  174
             M ++++VFV TP +G+LV  +EFSK L       SVT+L++        PLI   S   S
Sbjct  9     MNRSELVFVPTPAVGHLVSTIEFSKRLLDCCDKFSVTILVMESAFESSTPLISNPSTTQS  68

Query  175   LA-SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGF  351
             LA S   ++ + LP+   P     +S   +L+++IEN++ HVR A+      +   ++G 
Sbjct  69    LAASHARIKIVDLPSVNRPVEILQQSVEKYLTVFIENYKCHVRDAIANHVLPNS-SVSGL  127

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
              VDMFCTS IDVA EL +P YL+F S A FL  +LH+P    ++     F  +  E V+P
Sbjct  128   VVDMFCTSMIDVAYELKVPSYLFFTSGAGFLGLLLHLPGRYDRL--GMVFKPSDPESVVP  185

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG-GN  708
              + NPVP    P F  K  +  Y  F+  A+R++ET+G++VNTF ELES+ + S+     
Sbjct  186   SYANPVPAYVLPSFAYK--DTGYSCFVNCARRFKETKGIIVNTFFELESHAVSSLLDFDT  243

Query  709   DVGPVYPIGPVVDREGPARWHP-DSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
             ++ PVY +GP++   G     P D      +M WLD+Q   SVVFL  GS GS + AQ+R
Sbjct  244   EIPPVYTMGPLI---GEHHVEPSDRAKFGKIMTWLDDQPPKSVVFLCFGSFGSFDEAQLR  300

Query  886   EIATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             EIA GLE++G +FLWS+R+ PPK +L +P DY++ +  LP GF +RTK  G++CGW PQV
Sbjct  301   EIAVGLEKSGKKFLWSVRKGPPKGQLAMPGDYSNHEKFLPQGFLERTKDVGILCGWAPQV  360

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              ILAH+A GGFVSHCGWNSI E+L HGVPI TWP+YAEQ +NAFQMVK+LGLAVE+  DY
Sbjct  361   EILAHRATGGFVSHCGWNSISESLWHGVPIVTWPLYAEQQINAFQMVKDLGLAVELRLDY  420

Query  1243  K--DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             +  DG   V A+++E+ VR +MDGD  VR++V+E SE+C++     GSS+ S   LIE
Sbjct  421   RTDDGNHFVVADEIEKAVRCVMDGDGAVRKRVEEMSEVCRKAVGDGGSSSTSFQHLIE  478



>ref|XP_009371510.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=477

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 211/479 (44%), Positives = 310/479 (65%), Gaps = 18/479 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VF+ +P  G+LVP ++F+K L  +N  +S+T+L I       + SY  S+A S+
Sbjct  1     MKKVELVFIPSPGAGHLVPTLQFAKRLMDRNDRISITILAIQSSFPTTLSSYTKSIAASE  60

Query  187   GNLEFLSLPAAEP-PSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAG  348
               + F+ +P  +  P  +  +S   F SI+IE+H P+V++ +T L      S D  R+A 
Sbjct  61    PRIRFIDVPQPQDRPPQEMYKSPAKFFSIYIESHVPNVKKIITNLVSSSANSSDSSRVAA  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               VD FC S IDVA+EL+IP YL+  S A +L+FMLH+P +  +     +  D   E+ I
Sbjct  121   LAVDFFCVSMIDVAKELNIPSYLFLTSNAGYLAFMLHLPIVHEKNQIAVDVSDP--EWSI  178

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             PG  +PVP    P  ++      Y+     A R+RETRG++VNTF ELE + + S    +
Sbjct  179   PGIVHPVPPRVLPVALTDGSCSAYIKL---ASRFRETRGIIVNTFVELEEHTITSFSTDD  235

Query  709   DVGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
              + P+YP+GPV+D  +G A  + +    + ++KWLD+Q   SVVFL  G+MGS    Q++
Sbjct  236   GIPPLYPVGPVIDLDDGQAHSNLNQAQRDRIIKWLDDQPQKSVVFLCFGNMGSFRAEQVK  295

Query  886   EIATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVPQ  1059
             EIA GLE++G RFLWS+R P P  ++  P+D ++L+ VLP GF +RT GK G++CGW PQ
Sbjct  296   EIALGLEQSGQRFLWSLRMPSPNGRV--PSDCSNLEEVLPDGFLERTNGKKGLICGWAPQ  353

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V ILAH A GGF+SHCGWNSILE+L HG+PI TWP+YAEQ LNAF+MV+ELG+A+E+  D
Sbjct  354   VEILAHSATGGFLSHCGWNSILESLWHGIPIATWPMYAEQQLNAFRMVRELGMALEMRLD  413

Query  1240  YKDG-ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             YK G   +V A+++ER V  +M+ D EVR+KV++  +M ++     GSS  S+G+ IE+
Sbjct  414   YKRGSADVVGADEIERAVVGVMEKDGEVRKKVEKMGKMARKAVKDGGSSFASVGRFIED  472



>ref|XP_004303955.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Fragaria vesca subsp. vesca]
Length=475

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 215/480 (45%), Positives = 310/480 (65%), Gaps = 18/480 (4%)
 Frame = +1

Query  10    MKQ-AKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLAS  183
             MKQ A++VF+ +P IG+LV  VE +KLL  ++  L +TVL++  P     I +YI+S A 
Sbjct  1     MKQSAELVFIPSPGIGHLVSTVEVAKLLLSRDDRLFITVLIMKFPFNSDPIDAYIESFAD  60

Query  184   DG---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-KSDDDVRIAGF  351
                   ++F++LP     +  Q  STI+F + +I++ + +V+  + KL +S  + R+AGF
Sbjct  61    SSISQRIKFINLPQQNIET--QGNSTINFFN-FIDSQQTNVKDVVVKLIESKTETRLAGF  117

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNS-EFGDAAKEYVI  528
              +DMFCTS IDVA EL +P Y +F S A+ L  M H+  L     K+  EF D+A + V+
Sbjct  118   VIDMFCTSMIDVANELGVPTYAFFTSGAAMLGLMFHLQALRDDHNKHCIEFKDSATDLVV  177

Query  529   PGFENPVPVESFPP--FMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG  702
             P + +P+P     P  F  K   +    F+  AKR R+ +G+V+NTF ELES+ L S+  
Sbjct  178   PSYSHPLPAARVLPSVFFDKEASNR---FVNIAKRLRDVKGIVINTFTELESHALLSLSS  234

Query  703   GNDVGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
                + PVYP+GP+++ +        +S     ++ WLD+Q  SSVVFL  GSMGS +  Q
Sbjct  235   DGKLPPVYPVGPILNLKSDDNNDQVNSKQKSDILNWLDDQPPSSVVFLCFGSMGSFSEDQ  294

Query  880   IREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             ++EIA  LE+ G+RFLWS+R+PP K K  +P+DY D   VLP GF DRT G G V GW P
Sbjct  295   VKEIACALEQGGFRFLWSLRQPPPKGKNGVPSDYADHTGVLPEGFLDRTAGVGKVIGWAP  354

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV IL H A+GGFVSHCGWNS LE+L  GVP+ TWP+YAEQ +NAFQ+VKELG+AVEI  
Sbjct  355   QVAILGHPAVGGFVSHCGWNSTLESLWFGVPVATWPLYAEQQVNAFQLVKELGIAVEIDM  414

Query  1237  DYK-DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              Y+ +G  +V+AE +ERG+++LM+ D ++R++V++ S+  K+  M  GSS  SLG  I++
Sbjct  415   SYREEGPVVVTAEKIERGIKELMELDSDIRKRVRQVSDNSKKALMDGGSSYASLGHFIDQ  474



>gb|KDO64387.1| hypothetical protein CISIN_1g011311mg [Citrus sinensis]
Length=489

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 207/488 (42%), Positives = 317/488 (65%), Gaps = 24/488 (5%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLL--------SHQNQNLSVTVLLI--NMPQRPLI  156
             + ++A++VF+ +P++G+LV V+ F+K L        +  N + S+TVL++  +       
Sbjct  1     MKEKAELVFIPSPSVGHLVSVIVFAKRLLLLDRDNAAGSNNSFSITVLVMQEHTATASDN  60

Query  157   QSYIDSLASDG-----NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLK  321
              ++I SLA  G     ++ F+ +P   PP  D  +S   F++ ++++H+  ++ A+ +  
Sbjct  61    DAHIKSLAGAGATADVSIRFIGVPKMNPPPLDYFKSPEKFITEYVDSHKDCIKEAIIEHV  120

Query  322   SDDDVRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEF  501
              +++V+IAG  +D FC+S ID A EL +P Y++F S A+FL F+LH+PT   +  + SE 
Sbjct  121   LNNNVKIAGLVLDFFCSSMIDTANELGVPSYVFFTSGAAFLGFVLHLPTRGGEEFEESE-  179

Query  502   GDAAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESY  681
              D+A  +    + NPVP    P     +H   +  F    +R++ET+G++VNTF+ELES+
Sbjct  180   ADSADIFT---YANPVPYRVLPSLCFNKH-GGFSAFENFGRRFKETKGIIVNTFEELESH  235

Query  682   CLGSMFGGNDVGPVYPIGPVVDREGP--ARWHPDSWNHELVMKWLDNQLSSSVVFLTTGS  855
              +  +   + V PVY +GP++D  G   AR        + +++WLD+Q +SSVVFL  GS
Sbjct  236   AVEYLMKCDGVPPVYNVGPMIDLHGDIHARPRGGGTQRDEIIRWLDDQPASSVVFLCFGS  295

Query  856   MGSLNPAQIREIATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGK  1032
             MGS    QI+EIA+GLE++G RFLWS+R+ PPK + ++P +YT ++ +LP GF +R+KG+
Sbjct  296   MGSFGEEQIQEIASGLEKSGVRFLWSLRKTPPKDRPEMPGEYTCVEDILPRGFQERSKGR  355

Query  1033  GMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKEL  1212
             GM+CGW PQ  +LAH AIGGFVSHCGWNSILE++  GVPI TWPIYAEQ +NAFQMV++L
Sbjct  356   GMICGWAPQKEVLAHSAIGGFVSHCGWNSILESVWFGVPIVTWPIYAEQQINAFQMVRDL  415

Query  1213  GLAVEITFDYKDGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAV  1389
             GLAVE+  DY+ G    V A+++ R V  +MDGD EVR++VKE SE  +      GSS  
Sbjct  416   GLAVELRLDYRRGTENHVMADELARAVGCVMDGDSEVRKRVKEVSEKARLALRDGGSSYA  475

Query  1390  SLGKLIEE  1413
             + G+LIE+
Sbjct  476   ATGRLIED  483



>ref|XP_010657554.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like isoform 
X1 [Vitis vinifera]
Length=468

 Score =   400 bits (1029),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 212/472 (45%), Positives = 300/472 (64%), Gaps = 16/472 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MKQ ++VF+  P I +L P VE +KLL+ ++   S+T+ ++  P        IDS+ +D 
Sbjct  1     MKQTELVFIPVPIISHLSPTVEIAKLLTQRDPRFSITIFIMKFPF-----GSIDSMTTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S         F+S +I+     VR A+ +L   + VR+AGF +D+ 
Sbjct  56    DSIRFVTLPPVEISSGATTPG--PFMSEFIKAQTLLVRDAVHELTRSNSVRLAGFVIDVM  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+  S A+ L F+LH+  L D +     EF ++  E  +P + N
Sbjct  114   CTHMIDVADEFGVPSYLFSTSSAASLGFLLHLQFLHDYEGLNLDEFKNSDAELQVPSYAN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP  +  +  D     + H +R R+ +GV+VNTF +LES+ + S F G+ V PV
Sbjct  174   SVPGKVFPTMIFDKGVDGAAGHMYHMRRLRQAKGVMVNTFIDLESHAIQS-FSGSTVPPV  232

Query  724   YPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             YP+GP+++ R G   +  D  N   +M WLD+Q  SSVVFL  G MGS    QI+EIA G
Sbjct  233   YPVGPILNTRTG---FGEDQQNASAIMSWLDDQPPSSVVFLCFGGMGSFGTDQIKEIAYG  289

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LER+G+RFLWS+R+ P K K+  P DY +++ VLP GF  RT   G + GW PQV +LAH
Sbjct  290   LERSGHRFLWSLRQAPQKGKMAFPRDYENIEEVLPDGFLHRTARIGKIIGWAPQVAVLAH  349

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGI  1254
              A+GGFVSHCGWNS+LE++ +GVP+ TWPIYAEQ +NAFQMVK+LGLAVEI  DY KD  
Sbjct  350   TAVGGFVSHCGWNSLLESIWYGVPVATWPIYAEQQINAFQMVKDLGLAVEIKIDYNKDNN  409

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
              +V+A ++E G+RKLM  + EVR+K+ E  ++ +RV +  GSS  SLG  IE
Sbjct  410   YIVNAHEIENGLRKLMSINSEVRKKMNEMQQISRRVIIDGGSSHSSLGHFIE  461



>ref|XP_008229637.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Prunus mume]
Length=502

 Score =   402 bits (1032),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 217/483 (45%), Positives = 311/483 (64%), Gaps = 21/483 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASDG  189
             K +++VF+ +  +G+LV  VE ++LL  ++  L +TV ++ +P      +SYI SL +  
Sbjct  22    KASELVFIPSAGMGHLVSAVEMARLLVARHDRLFITVFIMKLPFDSKGTESYIASLEASP  81

Query  190   ---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRA---LTKLKSDDDVRIAGF  351
                 + F++LP    P+ D++ S  SF + +IE+H+ HV+ A   LT+ +SD   R+AGF
Sbjct  82    VSPRVNFITLPKV--PTIDKHMSPNSFRNQFIESHKTHVKNAVAELTESESDSRPRLAGF  139

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVI  528
              +DMFCT+ IDVA+E  +P Y++F SPA+FL  +  +  +     K+ S+F D+  E  +
Sbjct  140   IIDMFCTTMIDVADEFGVPTYMFFTSPAAFLGLLFSLQRIRDVYNKDVSDFKDSDAELAL  199

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P F N VP +  P  +  +  D     L +AKR+RET+G++VNTF ELES+ L S+  G 
Sbjct  200   PTFVNSVPAKVLPSVLLDK--DGAEALLGYAKRFRETKGILVNTFMELESHALDSLSNG-  256

Query  709   DVGPVYPIGPVVD--REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             +  P+YP+GP+++   +        +     V++WLD+Q  SSVVFL  GSMGS    Q+
Sbjct  257   ETPPLYPVGPILNLKSDDSQSGSEQAQQKSDVLEWLDDQPPSSVVFLCFGSMGSFGEDQV  316

Query  883   REIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             REIA GLER+G RFLWS+R+PP K  +  P+DY+D   VLP GF DR  G G V GW PQ
Sbjct  317   REIAWGLERSGLRFLWSLRQPPPKETVASPSDYSDPKAVLPEGFLDRAVGIGKVIGWAPQ  376

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V ILAH AIGGFVSHCGWNS LE+L  GVP+ TWP+YAEQ LNAF++V+ELGLAVEI  +
Sbjct  377   VAILAHPAIGGFVSHCGWNSTLESLWFGVPVATWPMYAEQQLNAFELVRELGLAVEINME  436

Query  1240  YK-----DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKL  1404
             Y+     D   +V AE++ERG+R++M  D ++R++VKE SE  K   M  GSS  SLG  
Sbjct  437   YRRSFYGDSPKVVKAEEIERGIREVMVQDSDLRKRVKETSEKSKAALMDGGSSHSSLGHF  496

Query  1405  IEE  1413
             +++
Sbjct  497   LDQ  499



>ref|XP_007216098.1| hypothetical protein PRUPE_ppa018557mg [Prunus persica]
 gb|EMJ17297.1| hypothetical protein PRUPE_ppa018557mg [Prunus persica]
Length=478

 Score =   400 bits (1029),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 219/481 (46%), Positives = 311/481 (65%), Gaps = 19/481 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASD  186
             MK + +V + +  IG+LV  VE SKLL  ++  L +TVL++ +P      ++Y  SL + 
Sbjct  1     MKASHLVVIPSGRIGHLVSAVEISKLLVSRHDQLFITVLIMKLPFDSKGTEAYRASLEAS  60

Query  187   GNL---EFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRA---LTKLKSDDDVRIAG  348
               L    F++LP    P  D++ S+ SF + ++E+H+ HV+ A   LT+ +SD   R+AG
Sbjct  61    PVLPRVNFITLPKV--PDLDKHLSSHSFRNQFVESHKTHVKNAVAELTESQSDSRPRLAG  118

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYV  525
             F +DMFCT+ IDVA++  IP Y++F SPA FL  + ++  +     K+ SEF D+  E  
Sbjct  119   FVIDMFCTTMIDVADDFGIPTYMFFTSPAGFLGLLFNLQRIRDVYGKDVSEFKDSDTELY  178

Query  526   IPGFENPVPVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG  702
             +P F N VP    P   + K   +T   FL +AKR+ ET+G++VNTFKELE + L S+  
Sbjct  179   LPTFVNSVPGRVLPSAVLDKEGAET---FLSYAKRFTETKGILVNTFKELEPHALDSLSD  235

Query  703   GNDVGPVYPIGPVVD--REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
             G +  P+YP+GP+++   +        +     +++WLD+Q  SSVVFL  GSMGS +  
Sbjct  236   G-ETPPLYPVGPMLNLMSDETQSGSEQAQRKSDILEWLDDQPPSSVVFLCFGSMGSFDED  294

Query  877   QIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWV  1053
             Q+REIA GLER+G RFLWS+R+PP K  +  P DY+DL  VLP GF DRT   G V GW 
Sbjct  295   QVREIALGLERSGLRFLWSLRQPPPKGTVVSPGDYSDLTGVLPEGFLDRTAAMGKVIGWA  354

Query  1054  PQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT  1233
             PQV ILAH A+GGFVSHCGWNS LE+L  GVP+  WP+YAEQ LNAF++V+ELGLAV I 
Sbjct  355   PQVAILAHPAVGGFVSHCGWNSTLESLWFGVPMAAWPVYAEQQLNAFELVRELGLAVAIK  414

Query  1234  FDY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
              DY +D   +VSAE++ERG+R++M+ D +VR++VKE SE  K+   + GSS  SL   ++
Sbjct  415   MDYRRDTQVVVSAEEIERGIREVMEHDSDVRKRVKEMSEKSKKALTEGGSSHSSLEHFLD  474

Query  1411  E  1413
             +
Sbjct  475   Q  475



>ref|XP_011001024.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Populus 
euphratica]
 ref|XP_011001025.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Populus 
euphratica]
 ref|XP_011001026.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Populus 
euphratica]
Length=482

 Score =   400 bits (1028),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 220/487 (45%), Positives = 318/487 (65%), Gaps = 30/487 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPL---IQSYIDSLA  180
             MK++++VFV +P +G+LVP VE +KL+  ++  LSVTVL++  P  PL   I  YI+S++
Sbjct  1     MKKSELVFVPSPGVGHLVPAVEIAKLMVKRDDRLSVTVLVMRRP--PLDTKINRYIESVS  58

Query  181   ---SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV----R  339
                SD +++F+ LP  E  S     S I+FLS +IE+ +PHV+ A+ KL   +      +
Sbjct  59    VSISD-HIQFVDLPNDEKTS-----SGINFLSSFIESQKPHVKNAVFKLVQSESSSESPQ  112

Query  340   IAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAK  516
             +AGF V MFCT+ IDVA E  +P Y++ AS A+ LS ML++  L D +    +EF D+  
Sbjct  113   LAGFVVGMFCTTMIDVANEFGVPSYVFCASSAAALSLMLYMQALNDEKNVDTTEFKDSDA  172

Query  517   EYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSM  696
             E+++PG  N VP +  P  +  +  D +  +  +A+R++E  G++VNT+ ELES  + + 
Sbjct  173   EFMLPGIINQVPAKVLPSVVFNK--DWHPIYFGNARRFKEAEGIMVNTYVELESQVINA-  229

Query  697   FGGNDVGPVYPIGPVVDREGPAR--WHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLN  870
             F      P+YPIGP+++ +G        ++  ++ +M+WLD+Q  SSVVFL  GSMGS +
Sbjct  230   FSDGKTPPLYPIGPILNLKGDGHDGGSAETNKNKDIMEWLDDQPPSSVVFLCFGSMGSFS  289

Query  871   PAQIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCG  1047
               Q++EIA+ LE +G RFLWS+R+PP K K+  P DY + +  LP GF DRT G G V G
Sbjct  290   EKQLKEIASALEHSGNRFLWSVRQPPPKGKMGFPADYANPEEALPTGFLDRTAGIGKVIG  349

Query  1048  WVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVE  1227
             W PQV ILAH AIGGFVSHCGWNSILE+L  GVPI  WP+++EQ LNAF+M+ ELGLA E
Sbjct  350   WAPQVAILAHPAIGGFVSHCGWNSILESLWFGVPIAAWPLFSEQQLNAFEMMIELGLAAE  409

Query  1228  ITFDYKDGI-----TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVS  1392
             I  DY+         +VSA+ +E+G+  +M+ D EVR+KVK  SEM K+  +  GSS + 
Sbjct  410   IKMDYRKDFRAENEVIVSADIIEKGIMSVMEQDSEVRKKVKAMSEMGKKALLDGGSSHLI  469

Query  1393  LGKLIEE  1413
             LG+LIE+
Sbjct  470   LGRLIED  476



>dbj|BAB60720.1| glucosyltransferase [Nicotiana tabacum]
Length=478

 Score =   400 bits (1028),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 204/477 (43%), Positives = 300/477 (63%), Gaps = 14/477 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             MK  ++VF+  P +G+LVP VE +K L  +++ LS+TVL++ +P    I SY  SL+SD 
Sbjct  1     MKTTELVFIPAPGMGHLVPTVEVAKQLVDRDEQLSITVLIMTLPLETNIPSYTKSLSSDY  60

Query  187   -GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTK-LKSDDDVRIAGFFVD  360
                +  L L   E      + + I+F   +I +++  V+ A+ +   S   V++ GF +D
Sbjct  61    SSRITLLQLSQPETSVSMSSFNAINFFE-YISSYKDRVKDAVNETFSSSSSVKLKGFVID  119

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQV-PKNSEFGDAAKEYVIPGF  537
             MFCT+ IDVA E  IP Y+++ S A+ L   LH  +L  +  PK   + D   E  I  +
Sbjct  120   MFCTAMIDVANEFGIPSYVFYTSNAAMLGLQLHFQSLSIEYSPKVHNYLDPESEVAISTY  179

Query  538   ENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVG  717
              NP+PV+  P  +    +   + F+ HA+R+RET+G++VNTF ELES+ L ++     + 
Sbjct  180   INPIPVKCLPGIILDNDKSGTM-FVNHARRFRETKGIMVNTFAELESHALKALSDDEKIP  238

Query  718   PVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIAT  897
             P+YP+GP+++       H  +  ++++MKWLD Q  SSVVFL  GS GS    Q++EIA 
Sbjct  239   PIYPVGPILNLGDGNEDH--NQEYDMIMKWLDEQPHSSVVFLCFGSKGSFEEDQVKEIAN  296

Query  898   GLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
              LER+G RFLWS+R PP K  L  P+++ + + VLP GF  RTKG+G V GW PQ+ IL+
Sbjct  297   ALERSGNRFLWSLRRPPPKDTLQFPSEFENPEEVLPVGFFQRTKGRGKVIGWAPQLAILS  356

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGI  1254
             H A+GGFVSHCGWNS LE++  GVPI TWP+YAEQ  NAFQ+VK+LG+AVEI  DY++  
Sbjct  357   HPAVGGFVSHCGWNSTLESVRSGVPIATWPLYAEQQSNAFQLVKDLGMAVEIKMDYREDF  416

Query  1255  T-----LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
                   LV AE++E G+RKLMD ++++R KV E  +  +   ++ GSS V+LG  +E
Sbjct  417   NKTNPPLVKAEEIEDGIRKLMDSENKIRAKVMEMKDKSRAALLEGGSSYVALGHFVE  473



>ref|XP_011032131.1| PREDICTED: UDP-glycosyltransferase 71D1-like [Populus euphratica]
Length=471

 Score =   399 bits (1025),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 209/475 (44%), Positives = 307/475 (65%), Gaps = 16/475 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MK+ +++FV  P IG+    +E +K L   +  LS+T L++NMP  P   SY  SL AS 
Sbjct  1     MKKEELIFVPGPGIGHFASGLELAKRLLDHDDRLSITTLVMNMPFTPSTNSYTRSLTASQ  60

Query  187   GNLEFLSLPAAEPPSPDQ-NRSTISFLSIWIENHEPHVRRALTKL---KSDDDVRIAGFF  354
               ++ + LP  +PP  +   +S  +++  +IE++ PHV+  +T +    S+ DVR+AGF 
Sbjct  61    PRIKLVDLPEVDPPPSELLTKSPEAYICDFIESYIPHVKTTVTDIISSLSNSDVRVAGFI  120

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             VD FC S ID+A E  +P Y++  S A FL  M ++P    ++ +  +  D   + +IPG
Sbjct  121   VDFFCVSMIDIANEFSLPSYIFVTSNAGFLGLMRYLPKRHDEISEVMQMSDP--DSLIPG  178

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F NPVP    P  +  +H   Y  +++ A+R+++ RG++VNTF ELE + L S    + +
Sbjct  179   FFNPVPARVLPDAVFNKH-GGYAAYVKVAQRFKDGRGIIVNTFAELEPFVLRSFSDDHRI  237

Query  715   GPVYPIGPVVDREGPARWHPDSWNHEL--VMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
              PVYP+GPV+  +G  + HP+    +L  +MKWLD Q  SSVVFL  GS GS +P Q++E
Sbjct  238   PPVYPVGPVLHLKG--QPHPEINQDQLDKIMKWLDEQPQSSVVFLCFGSFGSFSPPQVKE  295

Query  889   IATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             IA G+E++ ++FLWS+R P        N + + + VLP GF +R +G+G++CGW PQV +
Sbjct  296   IALGIEQSRFKFLWSMRFPRSPS----NQFMNPEDVLPEGFLERIEGRGIMCGWAPQVEV  351

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD  1248
             LAHKAIGGFVSHCGWNSILE+L +GVPI T PIYAEQ LNAF+MVKELGL+VE+  DY+ 
Sbjct  352   LAHKAIGGFVSHCGWNSILESLWYGVPIVTLPIYAEQQLNAFRMVKELGLSVELKLDYRV  411

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             G  LV+A+++ + V  +M  D EVR+KVKE SE  ++  M  GSS  S+ +LI++
Sbjct  412   GGDLVTADEIAKSVICVMQSDSEVRKKVKEMSEKGRKAVMDGGSSFTSITQLIQD  466



>ref|XP_008365188.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like isoform 
X2 [Malus domestica]
Length=481

 Score =   399 bits (1026),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 219/479 (46%), Positives = 306/479 (64%), Gaps = 21/479 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP---QRPLIQ--SYIDS  174
             M ++++VFV TPT+G+LV  +EFSK L       SVT+L++         LI   S   S
Sbjct  1     MNRSELVFVPTPTVGHLVSTIEFSKRLLDCCDKFSVTILVMESAFESSTTLISNPSTTQS  60

Query  175   LA-SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGF  351
             LA S  +++ + LP+   P     +S   +L+++IEN++ HVR A+      +   ++G 
Sbjct  61    LAASHAHIKIVDLPSVHRPLEILQQSVEKYLTVFIENYKCHVRDAIANHVLPNS-SVSGL  119

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
              VDMFCTS IDVA EL +P YL+F S A FL  +LH+P    ++     F  +  E V+P
Sbjct  120   VVDMFCTSMIDVAYELKVPSYLFFTSGAGFLGLLLHLPGRYDRL--GMVFKPSDPESVVP  177

Query  532   GFENPVPVESFPPFMSKRHEDT-YLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG-  705
              + NPVP    P F    +EDT Y  F  HA+R++ET+G++VNTF ELES+ + S+    
Sbjct  178   SYANPVPANVLPSFA---YEDTGYSCFANHARRFKETKGIIVNTFFELESHAVSSLLDCE  234

Query  706   NDVGPVYPIGPVVDREGPARWHP-DSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
              ++ PVY +GP++   G     P D      +M WLD+Q   SVVFL  GS GS + AQ+
Sbjct  235   TEIPPVYTVGPLI---GEHHVKPSDRAKFGKIMTWLDDQPPKSVVFLCFGSSGSFDEAQL  291

Query  883   REIATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             REIA GLE++G +FLWS+R+ PPK +L  P +Y++ +  LP GF +RTK  G++CGW PQ
Sbjct  292   REIAVGLEKSGKKFLWSVRKAPPKGQLXTPGEYSNYEKFLPQGFLERTKDVGILCGWAPQ  351

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V +LAHKA GGFVSHCGWNSI E+L HGVPI TWP+YAEQ +NAFQMVK+LGLAVE+  D
Sbjct  352   VEVLAHKATGGFVSHCGWNSISESLWHGVPIVTWPLYAEQQINAFQMVKDLGLAVELRLD  411

Query  1240  YKD--GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             Y+   G   V A+++E+ VR +MDGD  VR++V+E SE+C++     GSS+ S   LI+
Sbjct  412   YRTDGGNHFVVADEIEKAVRCVMDGDGAVRKRVEEMSEVCRKAVGDGGSSSTSFQHLIK  470



>emb|CDP09593.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   399 bits (1025),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 202/472 (43%), Positives = 306/472 (65%), Gaps = 12/472 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VFV  P  G+L+  VEFSK L+ ++  LS+ VL+I  P    ++SY   +A S+
Sbjct  1     MKKKQLVFVPAPVRGHLISTVEFSKRLTQRDDLLSIFVLVIRHPHGQSLESYTQQVAASN  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
              +++F+++P  +   P+   S     + ++E+H+ HV+ A+   +S+    +AG  VD+F
Sbjct  61    TSIQFINIPRVDQHLPEFLGSPEHGFTRYLESHKSHVKNAIVD-QSESFTSLAGIVVDLF  119

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENP  546
             CTS IDVA EL +P Y+YF S A+FL FML++P    Q     EF  +  + +IP + +P
Sbjct  120   CTSMIDVANELGVPSYVYFTSSAAFLGFMLYLPIHYNQ--NGREFETSNPDAIIPTYSHP  177

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP    P F   +    Y   L+HA +++ET+G+++NTF ELE + +  +   ++  P+Y
Sbjct  178   VPSSVMPSFAFNK-VGGYSSILKHAMKFKETKGIIINTFAELEPHAVSQLKFDDETPPIY  236

Query  727   PIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLE  906
              +GP++  EG  +  PD    E +MKWLD Q  SSVVFL  GS G+  P Q+ E+A  +E
Sbjct  237   TVGPLLGAEG-EKLKPDC---ERIMKWLDVQPPSSVVFLCFGSRGTFEPDQLAEMAIAIE  292

Query  907   RAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKA  1083
             ++GYRFLWS+R P  K     P +Y+    +LP GF +RT+ +GMVCGW PQ+ +LAH+A
Sbjct  293   QSGYRFLWSVRSPGSKDFTKPPGEYSSFSGILPEGFLERTENRGMVCGWAPQLEVLAHEA  352

Query  1084  IGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK--DGIT  1257
             +GGFVSHCGWNS LE+L HGVPI TWP+YAEQ + AF++V EL LAV++  DY+  +   
Sbjct  353   VGGFVSHCGWNSTLESLWHGVPIATWPLYAEQQICAFELVSELELAVDLKMDYRMENAEN  412

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             LV AE++E+ +R LMD ++ +R++V+E  EM ++V    GSS +SLG+LIE+
Sbjct  413   LVKAEEIEKAIRCLMDTENPIRKRVREMKEMSRKVVEDEGSSFISLGRLIED  464



>ref|XP_004303953.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Fragaria vesca subsp. vesca]
Length=478

 Score =   398 bits (1023),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 212/480 (44%), Positives = 309/480 (64%), Gaps = 18/480 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQ-RPLIQSYIDSLASDG  189
             K A++V + +P IG+LV  +E +KLL  ++  L +TVL+++ P       +Y+ SLA   
Sbjct  3     KPAELVLIPSPGIGHLVSTLEIAKLLVSRDDQLFITVLIMHFPAVSKGTDAYVQSLADSS  62

Query  190   N-----LEFLSLPAAEPPSPDQNRSTI-SFLSIWIENHEPHVRRALTKLKSDDDVRIAGF  351
             +     + F++LP     + D    ++ + L  ++E+ +PHV+ A+TKL+     R+AGF
Sbjct  63    SPISQRINFINLPNI---NMDHTEGSVRNSLVGFVESQQPHVKDAVTKLRDSKTTRLAGF  119

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVI  528
              VDMFC + IDVA +L +P Y++F S A+ L  M H+  L  Q  K+ +E  D+  E ++
Sbjct  120   VVDMFCATMIDVANQLGVPSYVFFTSSAATLGLMFHLQELRDQYNKDCTELKDSDAELIV  179

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P F NP+P +  P  +  +  D+   FL   KR+R+T+G++VNTF +LES+ L ++    
Sbjct  180   PSFFNPLPAKVLPGRILVK--DSAESFLNVIKRFRDTKGILVNTFTDLESHALHALSSDA  237

Query  709   DVGPVYPIGPVVD-REGPARWHPDSWNHEL-VMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             ++ PVYP+GP+++     +R   D    +  ++KWLD+Q   SVVFL  GSMGS +  Q+
Sbjct  238   EIPPVYPVGPLLNVNSNESRVDSDEVKKKNDILKWLDDQPPLSVVFLCFGSMGSFDENQV  297

Query  883   REIATGLERAGYRFLWSIREPPKS-KLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             REIA  LE AG+RFLWS+R PP + K+  P+DY D   VLP GF DRT G G V GW PQ
Sbjct  298   REIAKALEHAGHRFLWSLRRPPPTGKIAFPSDYDDHTGVLPEGFLDRTGGIGKVIGWAPQ  357

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V +LAH ++GGFVSHCGWNS LE+L HGVP+ TWP+YAEQ LNAFQ+VKEL LAVEI   
Sbjct  358   VAVLAHPSVGGFVSHCGWNSTLESLWHGVPVATWPLYAEQQLNAFQLVKELELAVEIDMS  417

Query  1240  Y-KDGITLVSAEDVERGVRKLMDGD-DEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             Y  +   LVS +++ERG+R++M+ D  ++R++VKE SE  K+  M  GSS  SLG  I++
Sbjct  418   YMSESPVLVSEKEIERGIREVMELDSSDIRKRVKEMSEKGKKALMDGGSSYTSLGHFIDQ  477



>ref|XP_006481382.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Citrus sinensis]
Length=489

 Score =   398 bits (1023),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 205/488 (42%), Positives = 316/488 (65%), Gaps = 24/488 (5%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLL--------SHQNQNLSVTVLLI--NMPQRPLI  156
             + ++A++VF+ +P++G+LV V+ F+K L        +  N + S+TVL++  +       
Sbjct  1     MKEKAELVFIPSPSVGHLVSVIVFAKRLLLLDRDNAAGSNNSFSITVLVMQEHTATASDN  60

Query  157   QSYIDSLASDG-----NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLK  321
              ++I SLA  G     ++ F+ +P   PP  D  +S   F++ ++++H+  ++ A+ +  
Sbjct  61    DAHIKSLAGAGATADVSIRFIGVPKMNPPPLDYFKSPEKFITEYVDSHKDCIKEAIIEHV  120

Query  322   SDDDVRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEF  501
              +++V+IAG  +D FC+S ID A EL +P Y++F S A+FL F+LH+PT   +  + SE 
Sbjct  121   LNNNVKIAGLVLDFFCSSMIDTANELGVPSYVFFTSGAAFLGFVLHLPTRGGEEFEESE-  179

Query  502   GDAAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESY  681
              D+A  +    + NPVP    P     +H   +  F    +R++ET+G++VNTF+ELES+
Sbjct  180   ADSADIFT---YANPVPYRVLPSLCFNKH-GGFSAFENFGRRFKETKGIIVNTFEELESH  235

Query  682   CLGSMFGGNDVGPVYPIGPVVDREGP--ARWHPDSWNHELVMKWLDNQLSSSVVFLTTGS  855
              +  +   + V PVY +GP++D  G   AR        + +++WLD+Q +SSVVFL  GS
Sbjct  236   AVEYLMKCDGVPPVYNVGPMIDLHGDIHARPRGGGTQRDEIIRWLDDQPASSVVFLCFGS  295

Query  856   MGSLNPAQIREIATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGK  1032
             MGS    QI+E+A+GL ++G RFLWS+R+ PPK + ++P +YT ++ +LP GF +R+KG+
Sbjct  296   MGSFGEEQIKEVASGLGKSGVRFLWSLRKTPPKDRPEMPGEYTCVEDILPRGFQERSKGR  355

Query  1033  GMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKEL  1212
             GM+CGW PQ  +LAH AIGGFVSHCGWNSILE++  GVPI TWPIYAEQ +NAFQMV++L
Sbjct  356   GMICGWAPQKEVLAHSAIGGFVSHCGWNSILESVWFGVPIVTWPIYAEQQINAFQMVRDL  415

Query  1213  GLAVEITFDYKDGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAV  1389
             GLAVE+  DY+ G    V A+++ R V  +MDGD EVR++VKE SE  +      GSS  
Sbjct  416   GLAVELRLDYRRGTENHVMADELARAVGCVMDGDSEVRKRVKEVSEKARLALRDGGSSYA  475

Query  1390  SLGKLIEE  1413
             + G+LIE+
Sbjct  476   ATGRLIED  483



>ref|XP_002265234.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=468

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 210/471 (45%), Positives = 295/471 (63%), Gaps = 14/471 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MKQ ++VF+  P I +L P VE +KLL+ ++   S+T+ ++  P        IDS+ +D 
Sbjct  1     MKQTELVFIPVPIISHLSPTVEIAKLLTQRDPRFSITIFIMKFPF-----GSIDSMTTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S     S   F+  +I+     VR A+ +L   + VR+AGF +D  
Sbjct  56    DSIRFVTLPPVEISSGATTPS--PFMPEFIKAQTLLVRDAVHELTRSNSVRLAGFVIDAL  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E   P YL+  S A+ L F+LH+  L D +     EF D+  E  +P   N
Sbjct  114   CTHMIDVADEFGAPSYLFSTSSAASLGFLLHLQFLHDYEGLNLDEFKDSDAELQVPSCAN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FPP +  +  D     + H +R R+ +GV+VNTF ELES+ + S F G+ + PV
Sbjct  174   SVPGKVFPPMIFDKGVDGAAGLMYHMRRLRQAKGVMVNTFIELESHAIQS-FSGSTLPPV  232

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             YP+GP+++     R+  D  N   +M WLD+Q  SSVVFL  G MGS    QI+EIA GL
Sbjct  233   YPVGPILNTR--TRFGEDQQNASDIMSWLDDQPPSSVVFLCFGGMGSFGADQIKEIANGL  290

Query  904   ERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             ER+G+RFLWS+R+ PPK K+    DY +++ VLP GF  RT   G + GW PQV +LAH 
Sbjct  291   ERSGHRFLWSLRQAPPKGKMAFSRDYENIEEVLPDGFLHRTARIGKIIGWAPQVAVLAHT  350

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGIT  1257
             A+GGFVSHCGWNS+LE++ +GVP+ TWPIYAEQ +NAFQMVK+LGLAVEI  DY KD   
Sbjct  351   AVGGFVSHCGWNSLLESIWYGVPVATWPIYAEQQINAFQMVKDLGLAVEIKIDYNKDNNY  410

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             +V+A ++E G++ LM  + EVR+K+ E  ++ +RV +  GSS   LG  IE
Sbjct  411   IVNAHEIENGLKNLMSINSEVRKKMNEMQQISRRVIIDGGSSHSFLGHFIE  461



>ref|XP_004294260.1| PREDICTED: UDP-glycosyltransferase 71C3-like [Fragaria vesca 
subsp. vesca]
Length=478

 Score =   398 bits (1022),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 211/475 (44%), Positives = 304/475 (64%), Gaps = 13/475 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MK+A++VF+  P  G+LV  ++F K L  ++  +S+TVL I       + SY ++L AS+
Sbjct  1     MKKAELVFIPAPGAGHLVSALQFGKRLLQRDDRISITVLAIKSAAPSSLGSYTEALVASE  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKS--DDDVRIAGFFVD  360
               L+ + +P AE P  +  +S   F  + IENH P+VR ALT   S   D V I G  +D
Sbjct  61    SRLQLIDVPQAELPPLEFAKSPAKFFILNIENHVPNVREALTNYVSSKQDSVSIVGVVLD  120

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFE  540
              FC S I V  E ++P YL+  S A +LSF  H P  D++  +  +  D+  ++++PG  
Sbjct  121   FFCVSMIHVVNEFNLPSYLFMTSNAGYLSFEFHFPAQDSRTGRPPK--DSDPDWLVPGIV  178

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
              PVP +  P  ++   + +Y  +L  A R+RE +G++ NT  ELE++   S        P
Sbjct  179   PPVPTKVLPVSLT---DGSYYNYLGVASRFREAKGIIANTCVELETHAFNSFAEDQTTPP  235

Query  721   VYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIAT  897
             VYP+GPV+D  +G AR + +    + ++ WLD+Q   SVVFL  GSMGS   AQ++EIA 
Sbjct  236   VYPVGPVLDLNDGQARSNLNQAQRDKIISWLDDQPEESVVFLCFGSMGSFTEAQVKEIAL  295

Query  898   GLERAGYRFLWSIR-EPPK-SKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
             GLE++G RFLWS+R  PPK SK   P D ++L+ VLP GF +RT+ KG++CGW PQV +L
Sbjct  296   GLEQSGQRFLWSLRLTPPKGSKSLTPVDCSNLEEVLPDGFLERTREKGLICGWAPQVDVL  355

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-D  1248
             +HKA GGFVSHCGWNSILE+L HGVPI TWP+YAEQ LNAF++VKE+GL +E+  DYK  
Sbjct  356   SHKATGGFVSHCGWNSILESLWHGVPIVTWPMYAEQQLNAFRLVKEMGLGLEMRLDYKRG  415

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             G  +V A+++ + V  +M+ + EVR+KVKE   +C++     GSS+VSLG+ IE+
Sbjct  416   GDEVVKADEIGKAVASVME-NSEVRKKVKEIGVVCRKAVEDGGSSSVSLGRFIED  469



>ref|XP_002322547.2| hypothetical protein POPTR_0016s01880g [Populus trichocarpa]
 gb|EEF04308.2| hypothetical protein POPTR_0016s01880g [Populus trichocarpa]
Length=482

 Score =   397 bits (1021),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 214/483 (44%), Positives = 307/483 (64%), Gaps = 22/483 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ TP I +LV  VE +KLL  +++ LS+T L++ +     I S+IDS+ +  
Sbjct  1     MKKAELVFIPTPVISHLVSTVEVAKLLVDRDERLSITFLIMKLCSSSKIDSFIDSVRTAS  60

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAGF  351
             N + F+ LP  EP  P+Q   T   LS   E  +PHV+  ++KL      S D   +AGF
Sbjct  61    NRIRFIDLPQDEP-GPNQPNKTFFSLS---ETQKPHVKEEVSKLVSQSESSPDTPTLAGF  116

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNS-EFGDAAKEYVI  528
              +DMFCTS IDVA E  +P Y++  S A++L  + +I  L  +   +  EF D+  E V+
Sbjct  117   VLDMFCTSLIDVANEFGVPSYIFLTSGAAYLGLVFYIQALHGEQRVDPLEFKDSEAEVVM  176

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P   NP P    P F+   +++     L  A+R+RE++G++VNTF+ELES+ + S   GN
Sbjct  177   PCLANPFPARVLPSFL--LNKEWLGSVLAQARRFRESKGIIVNTFEELESHAINSFSNGN  234

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
              + PVYP+GP+++         +S   + + +WLD+Q  SSVV++  GSMGS    Q++E
Sbjct  235   TL-PVYPVGPILNLSRDGHRDVESDEFKDIKQWLDDQPLSSVVYICFGSMGSFGVDQVKE  293

Query  889   IATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA GLE++G+RFLWS+R+PP K K++ P+DYT+   VLP GF DRT   G + GW PQ  
Sbjct  294   IACGLEQSGHRFLWSLRQPPPKGKIEPPSDYTNPQGVLPEGFLDRTANTGKIIGWAPQTD  353

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             ILAH ++GGFVSHCGWNSILE++  GVPI  WP+YAEQ LNAFQ++ ELGL VEI  DY+
Sbjct  354   ILAHPSVGGFVSHCGWNSILESIWFGVPIAAWPLYAEQQLNAFQIIVELGLGVEIKMDYR  413

Query  1246  -----DG--ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKL  1404
                  DG  I ++SA ++ERGVR LM+  DE RE++KE S   ++     GSS   LG+ 
Sbjct  414   KELKSDGNEINVISAGEIERGVRCLMELCDEKRERLKEMSGKGRKALENGGSSFTWLGRF  473

Query  1405  IEE  1413
             I++
Sbjct  474   IQD  476



>ref|XP_010648210.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 6-like [Vitis 
vinifera]
Length=485

 Score =   397 bits (1020),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 208/481 (43%), Positives = 302/481 (63%), Gaps = 15/481 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP--QRPLIQSYIDSLAS  183
             MK+A++VFV  P +G++V +VEF+KLL  ++  +SVTVL++ +P  +  ++ +YI  L++
Sbjct  1     MKKAELVFVPLPFVGHMVSIVEFAKLLVDRDDRISVTVLIMKLPVLEHSVVNNYIHLLSA  60

Query  184   D--GNLEFLSLPAAEP------PSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVR  339
                G + F+ LP   P      PS  +  S    +  +I++ +P VR A+ +L     +R
Sbjct  61    SVSGRIRFVHLPQLNPQLASTSPSNSKALSPTHVICSFIDDQKPLVRDAVKQLTQSVSIR  120

Query  340   IAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAK  516
             +AGF  DM CTS +DVA+EL +P Y++F + ++FL  MLH+  L D Q    +E  D+  
Sbjct  121   LAGFVFDMLCTSMVDVADELGVPSYVFFTASSAFLGLMLHLQALHDNQGVDVTELVDSDA  180

Query  517   EYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSM  696
             E V+P F N  P    P  +  +       FL+  + ++  +G++VNTF ELES+ + S 
Sbjct  181   ELVVPSFVNSGPGRVLPSVVGDKQGGGSTAFLRCVRGFKGMKGILVNTFMELESHAINSF  240

Query  697   FGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
               G    P+YP+GP+++ +     + D+ N + +M WLD+Q  SSVVFL  GS G     
Sbjct  241   VDGTS-PPIYPVGPMLNLKHREHLNHDNTNKD-IMNWLDDQPPSSVVFLCFGSNGFFPLD  298

Query  877   QIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWV  1053
              ++EIA GLE + +RFLWS+R+PP K ++ +P+DY D +  LP GF DRT G G V GW 
Sbjct  299   PVKEIAQGLECSRHRFLWSLRQPPPKGEIAMPSDYVDFEEALPQGFLDRTIGIGKVIGWA  358

Query  1054  PQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT  1233
             PQ+ +LAH +IGGFVSHCGWNSILE+L +GVP+ TWP+Y+EQ LNAFQMVKELGLA+EI 
Sbjct  359   PQLDVLAHPSIGGFVSHCGWNSILESLWYGVPVATWPLYSEQQLNAFQMVKELGLAIEIK  418

Query  1234  FDYKDGIT-LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
              DYK G + LVSA+++E  +R LM  D EVR +  E  E      +  GSS   LG LIE
Sbjct  419   LDYKTGDSHLVSAKEIENAIRSLMMNDSEVRRRANEMKEESTNALIDGGSSHTCLGHLIE  478

Query  1411  E  1413
             +
Sbjct  479   D  479



>ref|XP_009774030.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nicotiana 
sylvestris]
Length=478

 Score =   397 bits (1019),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 206/476 (43%), Positives = 301/476 (63%), Gaps = 18/476 (4%)
 Frame = +1

Query  22    KVVFVSTPTIGNLVPVVEFSKL-LSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGNLE  198
             +++F+    +G+LV  +EF+KL L+    NL ++VL++ +P    +Q++I SL S   L+
Sbjct  3     ELIFIPLAGLGHLVSAIEFAKLVLNRDENNLCISVLVMKLPLDYGVQNFIQSLTSQPRLK  62

Query  199   FLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFCTSF  378
             F+ +   E  S     +  SFL  +I+ H+ +VR  +  +      R+AGF +DMFCTS 
Sbjct  63    FIDISLDEKTSSVFLNNHDSFLYDFIDGHKSNVREYVQNIP-----RLAGFVLDMFCTSM  117

Query  379   IDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENPVPV  555
             ID+A E ++P Y+YFAS A+FL F LH   L + Q    S++ ++ KE  IP F+NP P 
Sbjct  118   IDIANEFNVPSYIYFASNAAFLGFCLHFQALRNEQNLDTSKYINSDKELSIPYFKNPCPT  177

Query  556   ESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYPIG  735
             +  P  +      + L F    +R++ET+G+++NTF ELES+ L ++     V  +YP+G
Sbjct  178   KVLPKHLLNSRLASTL-FFDGIRRFKETKGIIINTFFELESFSLQALMDSEIVPTIYPVG  236

Query  736   PVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAG  915
             PVV       +  +    E +++WLD Q   SVV+L  GSMGS    QI+EIAT LE  G
Sbjct  237   PVVSFAKSGHFRNNMSETESIIEWLDEQPDLSVVYLCFGSMGSFEAEQIKEIATALEHCG  296

Query  916   YRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIGG  1092
             +RFLWS+R  PPK K+D+P++YT+ + VLP GF +RTKG G V GW PQV IL+HK++GG
Sbjct  297   HRFLWSLRRSPPKGKIDIPSNYTNFEEVLPKGFLERTKGIGKVIGWAPQVAILSHKSVGG  356

Query  1093  FVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-------KDG  1251
             FV HCGWNSILE++  GVPI TWP+YAEQ +NAF +VKELG+A EI+ DY        + 
Sbjct  357   FVCHCGWNSILESVYFGVPIATWPLYAEQQMNAFLLVKELGIAKEISMDYVIDFEGKNNK  416

Query  1252  ITLVSAEDVERGVRKLM--DGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             + +VSAE++E G+++LM    ++EVR+K+KE  E  +      GSS  SLG LI +
Sbjct  417   VDIVSAEEIEGGLQRLMVKSEENEVRKKIKEMKEKSRVAMEDGGSSYTSLGLLIND  472



>ref|XP_002264998.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=475

 Score =   396 bits (1018),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 209/472 (44%), Positives = 300/472 (64%), Gaps = 14/472 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M+Q ++VFV +P IG+L   VE +KLL+ +++ +SVTV ++  P     +S     +   
Sbjct  1     MEQTELVFVPSPGIGHLAATVEIAKLLTQRDRRVSVTVFIMKFP----FESNGGMTSDSD  56

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
             ++  ++LP+ E  S   +     FL+ +++ H P VR A+ +L   + VR+AGF +DMFC
Sbjct  57    SIRCVTLPSVEISSGPMSPGV--FLTEFVKAHIPLVRDAVHELTLSNSVRLAGFVIDMFC  114

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENP  546
             T  IDVA+E  +P YL+F S A+FL FM H+  L D +    +EF D+     +P + N 
Sbjct  115   TPMIDVADEFGVPSYLFFTSSAAFLGFMFHLQFLHDYKGLDFNEFKDSDAVLEVPSYVNS  174

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP + FP  M  +        L H +R+++ +G++VNTF ELE + + S F G +  PVY
Sbjct  175   VPGKVFPSVMFDKEGGGTEMLLHHTRRFKQVKGIMVNTFIELEPHAIQS-FSGCNARPVY  233

Query  727   PIGPVVDRE-GPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             P+GP+++ + G      D+     +M WLD+Q  SSVVFL  GSMGS    QI+EIA GL
Sbjct  234   PVGPLLNIQVGSGGAQQDA---NAIMSWLDDQPPSSVVFLCFGSMGSFGVDQIKEIAHGL  290

Query  904   ERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             E +G RFLWS+R+PP K ++  P+DY ++  VLP GF  R  G G V GW PQV +LAH 
Sbjct  291   EHSGQRFLWSLRQPPQKGRMGFPSDYANVKEVLPEGFLHRMAGTGKVIGWAPQVAVLAHP  350

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGIT  1257
             AIGGFVSHCGWNSILE++ +GVPI  WP+YAEQ +NAFQMVK+LGL VEI  DY KD   
Sbjct  351   AIGGFVSHCGWNSILESIWYGVPIAAWPMYAEQQINAFQMVKDLGLVVEIKIDYNKDSGY  410

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +VSA ++E G++ LM+ ++E R K+KE  ++ + V +  GSS   LG+ IE+
Sbjct  411   IVSAREIENGLKNLMNMNNEARVKMKEMQKISRTVMIDGGSSHFFLGQFIED  462



>ref|XP_008229641.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Prunus mume]
Length=469

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 211/473 (45%), Positives = 306/473 (65%), Gaps = 13/473 (3%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             + A++VF+  P  G++V  VE +K L  ++  L +T+L++ +P   L  +   S++    
Sbjct  3     RPAQLVFIPAPGAGHIVSTVEIAKQLVARDDQLFITILIMKLPFDKLFINTDPSISH--R  60

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDD-DVRIAGFFVDMFC  369
             + F++LP +   +  Q  +  SF+  +++ H+ HV+ A+TKL ++   V +AGF +DMFC
Sbjct  61    ISFINLPESHIDT--QGLAFPSFIKTFVQGHKTHVKDAVTKLLAESAQVELAGFVIDMFC  118

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENP  546
             T  I+VA+E  IP YL+F S A+ L F  H+ +L D Q    +E      E V+P F NP
Sbjct  119   TPMINVADEFQIPSYLFFTSSAASLGFSFHLQSLHDEQGKDVAEITGWDSELVVPSFINP  178

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP   +P     R ++  +  +  A R+R+T+G+++NTF+ELE + L S+  G  + PVY
Sbjct  179   VPAGVWPGVT--RTKEGAIASIDFAARFRQTKGILINTFRELEPHALRSLSDGK-IPPVY  235

Query  727   PIGPVVD-REGPARWHPD-SWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             P+GP+++ +        D S     +++WLD+Q  SSVVFL  GSMGS + AQ++EIA  
Sbjct  236   PVGPLLNLKSDDGHVGTDQSIQKSDILEWLDDQPPSSVVFLCFGSMGSFDEAQVKEIACA  295

Query  901   LERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE++G RFLWS+R+P PK K+ +P+DY D+  VLP GF DRT   G V GW PQV ILAH
Sbjct  296   LEQSGQRFLWSLRQPKPKGKMGMPSDYVDVKLVLPEGFLDRTARIGKVIGWAPQVAILAH  355

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-DGI  1254
              A+GGFVSHCGWNS LE+L  GVPI TWP+YAEQ LNAF +VKELGL VEI  DYK D  
Sbjct  356   PAVGGFVSHCGWNSTLESLWCGVPIATWPMYAEQQLNAFGLVKELGLGVEIKMDYKQDSE  415

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +VSAED+ERG+R++M+ D ++R +VKE SE  K+     GSS  SLG+ +++
Sbjct  416   VVVSAEDIERGIRQVMEKDSDIRARVKEISEKSKKALTDGGSSYSSLGRFLDQ  468



>ref|XP_007215298.1| hypothetical protein PRUPE_ppa005052mg [Prunus persica]
 gb|EMJ16497.1| hypothetical protein PRUPE_ppa005052mg [Prunus persica]
Length=479

 Score =   396 bits (1018),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 214/479 (45%), Positives = 310/479 (65%), Gaps = 17/479 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASDG  189
             K +++V + +  IG+LV  VE SKLL  ++  L +TVL++ +P      ++YI SL +  
Sbjct  3     KASELVVIPSAGIGHLVSAVEMSKLLVARHDQLFITVLIMKLPFNSKGTEAYIASLEASP  62

Query  190   ---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRA---LTKLKSDDDVRIAGF  351
                 L F++LP    P  D++ S+ SF + ++E+H+ HV+ A   LT+ +S+   R+AGF
Sbjct  63    VLPRLNFITLPKV--PDLDKHLSSHSFRNQFVESHKTHVKNAVAELTESQSESRPRLAGF  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVI  528
              +DMFCT+ IDVA +  +P Y++F SPA FL  + ++  +     K+ SEF D+  E  +
Sbjct  121   VIDMFCTTMIDVAYDFGVPTYMFFTSPAGFLGLLFNLQRIRDVYGKDVSEFKDSDAELSL  180

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P F N VP    P  +  +  +    FL +AKR+ ET+G++VNTF ELES+ L S+  G 
Sbjct  181   PTFVNSVPGRVLPSVVLDK--EGAESFLSYAKRFTETKGILVNTFMELESHALDSLSDG-  237

Query  709   DVGPVYPIGPVVD--REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             +  P+YP+GP+++   +        +     +++WLD+Q  SSVVFL  GSMGS    Q+
Sbjct  238   ETPPLYPVGPILNLMSDDTQSGSEQAQQKSDILEWLDDQPPSSVVFLCFGSMGSFGEDQV  297

Query  883   REIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             REIA GLER+G RFLWS+R+PP K  +  P DY++   VLP GF  RT   G V GW PQ
Sbjct  298   REIAWGLERSGLRFLWSLRQPPPKGTVVSPGDYSNPKGVLPEGFLFRTAAMGKVIGWAPQ  357

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V ILAH+A+GGFVSHCGWNS LE+L  GVP+ TWP+YAEQ LNAF++V+ELGLAV I  D
Sbjct  358   VAILAHQAVGGFVSHCGWNSTLESLWFGVPMATWPVYAEQQLNAFELVRELGLAVAIKMD  417

Query  1240  Y-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             Y +D   +VSAE++ERG+R++M+ D +VR++VKE SE  K+   + GSS  SLG  +++
Sbjct  418   YRRDTQVVVSAEEIERGIREVMEDDSDVRKRVKEMSEKSKKALTEGGSSHSSLGHFLDQ  476



>emb|CAN64610.1| hypothetical protein VITISV_019066 [Vitis vinifera]
Length=485

 Score =   396 bits (1018),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 210/481 (44%), Positives = 300/481 (62%), Gaps = 15/481 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP--QRPLIQSYIDSLAS  183
             MK+A++VFV  P  G++V ++EF+KLL  ++  +SVTVL++ +P  +  ++ +YI  L++
Sbjct  1     MKKAELVFVPLPFAGHMVSILEFAKLLVDRDDRISVTVLIMKLPVLEHSVVNNYIHLLSA  60

Query  184   D--GNLEFLSLPAAEP------PSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVR  339
                G + F+ LP   P      PS  +  S    +  +I++ +P VR A+ +L     +R
Sbjct  61    SVSGRIRFVHLPQLNPQLASTSPSNSKALSPTHVICSFIDDQKPLVRDAVKQLTQSVSIR  120

Query  340   IAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAK  516
             +AGF  DM CTS +DVA+EL +P Y++F + A+FL  MLH+  L D Q    +E  D+  
Sbjct  121   LAGFVFDMLCTSMVDVADELGVPSYVFFTASAAFLGLMLHLQALXDNQGVDVTELVDSDA  180

Query  517   EYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSM  696
             E V P F N V     P  +  +     + FL+  + ++  +G++VNTF ELES+ + S 
Sbjct  181   ELVXPSFVNSVXGRVLPSVVGDKQGGGSIAFLRCVRGFKGMKGILVNTFMELESHAINSF  240

Query  697   FGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
               G    P+YP+GP+++ +     + D+ N + +M WLD+Q  SSVVFL  GS G     
Sbjct  241   VDGTS-PPIYPVGPMLNLKHREHLNHDNTNKD-IMNWLDDQPPSSVVFLCFGSNGFFPLD  298

Query  877   QIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWV  1053
             Q++EIA GLE +  RFLWS+R+PP K ++ +P+DY D +  LP GF DRT G G V GW 
Sbjct  299   QVKEIAQGLECSRQRFLWSLRQPPPKGEIAMPSDYVDFEEALPQGFLDRTIGIGKVIGWA  358

Query  1054  PQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT  1233
             PQ+ ILAH +IGGFVSHCGWNS LE+L +GVPI TWP+Y+EQ LNAFQMVKELGLA+EI 
Sbjct  359   PQLDILAHPSIGGFVSHCGWNSTLESLWYGVPIATWPLYSEQQLNAFQMVKELGLAIEIK  418

Query  1234  FDYKDGIT-LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
              DY  G   LVSA+++E G+R LM  D +VR +V E  E      +  GSS   LG LIE
Sbjct  419   LDYNTGDGHLVSAKEIENGIRSLMKNDGDVRRRVNEMKEKSTNALIDGGSSHTCLGHLIE  478

Query  1411  E  1413
             +
Sbjct  479   D  479



>gb|AAZ80472.1| glycosyltransferase [Malus domestica]
Length=471

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 212/480 (44%), Positives = 300/480 (63%), Gaps = 21/480 (4%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-  183
             + + A++VFV  P IG++V  VE +K L+ ++  L +TVL++ +P     Q + ++ +S 
Sbjct  1     MKRPAQLVFVPAPGIGHIVSTVEMAKQLAARDDQLFITVLVMKLP---YAQPFTNTDSSI  57

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV-------RI  342
                + F++LP A+P   D   +  SF  +++ENH+ HVR A+  +  + D        R+
Sbjct  58    SHRINFVNLPEAQPDKQDIVPNPGSFFRMFVENHKSHVRDAVINVLPESDQSESTSKPRL  117

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKE  519
             AGF +DMF  S IDVA E  +P YL+F S AS L+ M H  +L D      +E   +  E
Sbjct  118   AGFVLDMFSASLIDVANEFKVPSYLFFTSNASALALMSHFQSLRDEGGIDITELTSSTAE  177

Query  520   YVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF  699
               +P F NP P    P   S    ++    L H  +Y++T+G++VNTF ELES+ L  + 
Sbjct  178   LAVPSFINPYPAAVLPG--SLLDMESTKSTLNHVSKYKQTKGILVNTFMELESHALHYLD  235

Query  700   GGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
              G+ + PVYP+GP+++ +       D      +++WLD+Q   SVVFL  GSMGS   AQ
Sbjct  236   SGDKIPPVYPVGPLLNLKSS-----DEDKASDILRWLDDQPPFSVVFLCFGSMGSFGEAQ  290

Query  880   IREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             ++EIA  LE +G+RFLWS+R PP + K  +P+DY DL  VLP GF DRT   G V GW P
Sbjct  291   VKEIACALEHSGHRFLWSLRRPPPQGKRAMPSDYEDLKTVLPEGFLDRTATVGKVIGWAP  350

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             Q  IL H A GGFVSHCGWNS LE+L +GVPI  WP+YAEQ+LNAFQ+V ELGLAVEI  
Sbjct  351   QAAILGHPATGGFVSHCGWNSTLESLWNGVPIAAWPLYAEQNLNAFQLVVELGLAVEIKM  410

Query  1237  DY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DY +D   +VSAED+ERG+R++M+ D +VR++VKE SE  K+  +  GSS  SLG+ I++
Sbjct  411   DYRRDSDVVVSAEDIERGIRRVMELDSDVRKRVKEMSEKSKKALVDGGSSYSSLGRFIDK  470



>ref|XP_008229639.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Prunus mume]
Length=468

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 301/472 (64%), Gaps = 12/472 (3%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             + A++VF+  P  G++V  VE +K L  Q+  L +T+L++ +P   L  +   S++    
Sbjct  3     RSAQLVFIPAPGAGHIVSTVEIAKQLVAQDDQLFITILIMKLPFDKLFTNTDPSISH--R  60

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDD-DVRIAGFFVDMFC  369
             + F++LP  E     Q  +  SF+  +++ H+ HV+ A+TKL ++   V +AGF +DMFC
Sbjct  61    ISFVNLP--EFHIDTQGLAFTSFIKTFVQGHKTHVKDAVTKLLAESAQVELAGFVIDMFC  118

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENP  546
             T  I+VA+E  IP YL+F S A+ L F   + +L D Q    +E      E ++P F NP
Sbjct  119   TPMINVADEFQIPSYLFFTSGAATLGFWFQLQSLHDEQRKDVAEITGWDSELIVPSFINP  178

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP   +P     R ++    F+  A  +R+T+G+++NTF+ELE + L S+  G    PVY
Sbjct  179   VPAGVWPEVT--RTKEGATDFIDFAAGFRQTKGILINTFRELEPHALRSLSDGK-FPPVY  235

Query  727   PIGPVVDREGPAR--WHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
              +GP+++ +          S     +++WLD+Q  SSVVFL  GSMGS + AQ++EIA  
Sbjct  236   SVGPLLNMKSDDGHVGSDQSIQKSDILEWLDDQPPSSVVFLCFGSMGSFDEAQVKEIACA  295

Query  901   LERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE++G RFLWS+R+P PK K+ +P+DY D+  VLP GF DRT G G V GW PQV ILAH
Sbjct  296   LEQSGQRFLWSLRQPGPKGKMGMPSDYVDVKLVLPEGFLDRTAGIGKVIGWAPQVAILAH  355

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGIT  1257
              A+GGFVSHCGWNS LE+L  GVPI TWP+YAEQ LNAF +VKELGL VEI  DYK G  
Sbjct  356   LAVGGFVSHCGWNSTLESLWCGVPIATWPLYAEQQLNAFGLVKELGLGVEIKIDYKKGSE  415

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +VS+E++ERG+R++M+ D ++R +VKE SE  K+     GSS  SLG+ +++
Sbjct  416   VVSSEEIERGIRRVMEKDSDIRARVKEISEKSKKALTDGGSSYSSLGRFLDQ  467



>ref|XP_002265264.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=476

 Score =   396 bits (1017),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 210/474 (44%), Positives = 300/474 (63%), Gaps = 13/474 (3%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLAS  183
             +MK+ +++FVS   IG++V  VEF+KLL  ++   SVT+L++ +P +     +YI S+++
Sbjct  1     MMKKIELIFVSVSAIGHIVSTVEFAKLLVGRDDRFSVTLLIMKLPLEDSAATNYIHSVSA  60

Query  184   D--GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFV  357
                G++ F+ LP  E  S   + ST    S  IE  +P VR A+ +L   +  R+AG  V
Sbjct  61    SVSGSIRFVHLP--ELDSDSSSSSTNVLFSNIIERQKPLVRDAIHQLTRSESGRLAGIVV  118

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPG  534
             D+ CTS IDVA EL +P Y+YFAS A+ L+ M H+ TL D Q    +EF ++  E V+PG
Sbjct  119   DLLCTSMIDVANELGVPSYVYFASSAACLALMFHLQTLKDHQGVDVTEFANSDAELVVPG  178

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F NPVP    P     +     + FL  A+ +RE +G++VNTF ELES+ + S   G   
Sbjct  179   FVNPVPARVLPAVAVDKEGGGSMDFLDLARGFREAKGILVNTFVELESHVINSFVDGT-T  237

Query  715   GPVYPIGPVVDREGPARWHPDSWNHEL-VMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
              P+Y +GP+++ +      PDS   +L V++WLD+Q +SSVVFL  GS G+ +  QI EI
Sbjct  238   PPIYKVGPLLNLQHANNQKPDS---DLDVIRWLDDQPTSSVVFLCFGSAGAFHMDQINEI  294

Query  892   ATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             A GLE +G+RFLW++R PP K K+ + +DY + + VLP GF DRT   G + GW PQ  I
Sbjct  295   AIGLENSGHRFLWTLRRPPPKDKMAISSDYVNFEEVLPEGFLDRTSKIGKIIGWAPQTAI  354

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-  1245
             LAH A+GGF+SHCGWNS LE++ +GVP+ TWP+YAEQ LNAFQ+V+EL + VEI FDY  
Sbjct  355   LAHSAVGGFISHCGWNSTLESIWYGVPVATWPMYAEQQLNAFQIVRELEMGVEIRFDYNM  414

Query  1246  DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
             D   LVSA+++E  +R LMD    +R K  +  E C +   + GSS  S+ +LI
Sbjct  415   DTSNLVSAQEIESRIRSLMDDSSNIRMKRTKMKEKCMKALTEGGSSDCSIQRLI  468



>ref|XP_009794931.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nicotiana 
sylvestris]
Length=478

 Score =   396 bits (1017),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 203/477 (43%), Positives = 299/477 (63%), Gaps = 14/477 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             MK  ++VF+  P +G+LVP VE +K L  +++ LS+TVL++ +P    I SY  SL+SD 
Sbjct  1     MKTTELVFIPAPGMGHLVPTVEVAKQLVDRDEQLSITVLIMTLPLETNIPSYTKSLSSDY  60

Query  187   -GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTK-LKSDDDVRIAGFFVD  360
                +  L L   E      + + I+F   +I +++  V+ A+ +   S   V++ GF + 
Sbjct  61    SSRITLLQLSQPETSVSMSSFNAINFFE-YISSYKDRVKDAVNETFSSSSSVKLKGFVIV  119

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQV-PKNSEFGDAAKEYVIPGF  537
             MFCT+ IDVA E  IP Y+++ S A+ L   LH  +L  +  PK   + D   E  I  +
Sbjct  120   MFCTAMIDVANEFGIPSYVFYTSNAAMLGLQLHFQSLSIEYSPKVHNYLDPESEVAISTY  179

Query  538   ENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVG  717
              NP+PV+  P  +    +   + F+ HA+R+RET+G++VNTF ELES+ L ++     + 
Sbjct  180   INPIPVKCLPGIILDNDKSGTM-FVNHARRFRETKGIMVNTFAELESHALRALSDDEKIP  238

Query  718   PVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIAT  897
             P+YP+GP+++       H  +  ++++MKWLD Q  SSVVFL  GS GS    Q++EIA 
Sbjct  239   PIYPVGPILNLGDGNEDH--NQEYDMIMKWLDEQPHSSVVFLCFGSKGSFEEDQVKEIAN  296

Query  898   GLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
              LER+G RFLWS+R PP K  L  P+++ + + VLP GF  RTKG+G V GW PQ+ IL+
Sbjct  297   ALERSGNRFLWSLRRPPPKDTLQFPSEFENPEEVLPVGFFQRTKGRGKVIGWAPQLAILS  356

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGI  1254
             H A+GGFVSHCGWNS LE++  GVPI TWP+YAEQ  NAFQ+VK+LG+AVEI  DY++  
Sbjct  357   HPAVGGFVSHCGWNSTLESVRSGVPIATWPLYAEQQSNAFQLVKDLGMAVEIKMDYREDF  416

Query  1255  T-----LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
                   LV AE++E G+RKLMD ++++R KV E  +  +   ++ GSS V+LG  +E
Sbjct  417   NKTNPPLVKAEEIEDGIRKLMDSENKIRAKVMEMKDKSRAALLEGGSSYVALGHFVE  473



>ref|XP_002264463.3| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=490

 Score =   396 bits (1018),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 212/475 (45%), Positives = 307/475 (65%), Gaps = 18/475 (4%)
 Frame = +1

Query  1     KAIMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA  180
             + +MKQ ++VF+ +P IG+L   VE +KL++H+++ LS+T+L++  P         DS+ 
Sbjct  22    RLVMKQTELVFIPSPGIGHLAATVEIAKLMTHRDRRLSITILIMKFPF-----GSNDSMT  76

Query  181   SDGN-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFV  357
             SD + + FL+LP  E  SP     T  FL   I    P VR A+ ++   + VR+ GF +
Sbjct  77    SDSDSIRFLTLPPVEV-SPGTTGIT-EFLKPQI----PLVRDAVHEITRSNSVRLGGFVI  130

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPG  534
             DMFCTS IDVA+E ++P YL+F S A+FL FM H+  L D +    +EF D+  E  +  
Sbjct  131   DMFCTSMIDVADEFEVPSYLFFTSSAAFLGFMFHLQFLHDNEGLDFNEFKDSDAELEVRV  190

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
                 VP + FP  M  +       FL H +R+R+ +G++VNT  ELES+ + S F G+ +
Sbjct  191   MPTRVPGKVFPSLMFGKEGGGAEKFLYHTRRFRQVKGIMVNTLVELESHAIQS-FSGSTI  249

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              PVYP+GPV+  +G +       +   VM WLD+Q  SSVVFL  GSMG     Q++EIA
Sbjct  250   PPVYPVGPVLKTQGGSVG--GQQDASAVMSWLDDQPPSSVVFLCFGSMGGFGGDQVKEIA  307

Query  895   TGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLER+G+RFLWS+R+P  K K++  ++Y + + VLP GF  RT   G V GW PQV IL
Sbjct  308   HGLERSGHRFLWSLRQPSSKGKIESRSNYANEEEVLPEGFLHRTARIGKVIGWAPQVAIL  367

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AH A+GGFVSHCGWNS LE++ +GVP+ TWP++AEQ +NAFQMVK+LGLAV+I  +Y   
Sbjct  368   AHSAVGGFVSHCGWNSTLESIYYGVPVATWPMFAEQRINAFQMVKDLGLAVKIKMNYNKD  427

Query  1252  IT-LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             I+ +VSA ++E G++ LM+ D+EVR+K +E  ++ ++V ++ GSS  SLG  IE+
Sbjct  428   ISYVVSAREIEIGLKNLMNIDNEVRKKREEMKKISRKVTIEGGSSHFSLGHFIED  482



>ref|XP_007215334.1| hypothetical protein PRUPE_ppa005290mg [Prunus persica]
 gb|EMJ16533.1| hypothetical protein PRUPE_ppa005290mg [Prunus persica]
Length=468

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 206/474 (43%), Positives = 305/474 (64%), Gaps = 13/474 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+ ++VF+  P +G++V  VE +K L  ++  L +T+L++ +P   L  +   S++   
Sbjct  1     MKRTQLVFIPAPGVGHIVSTVEIAKQLVARDDQLFITILIMKLPFDKLFTNTDPSISH--  58

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDD-DVRIAGFFVDMF  366
              + F++LP +   +  Q  +  SF+  +++ H+ HV+ A+TKL S+     +AGF +DMF
Sbjct  59    RISFVNLPESHIDT--QGLAFTSFIKTFVQGHKTHVKDAVTKLLSESAQAELAGFVIDMF  116

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  I+VA+E  IP Y++F S A+ L F  H+ +L D Q    +E      E ++P F N
Sbjct  117   CTPMINVADEFQIPSYVFFTSGAATLGFWFHLQSLHDEQGKDVAEIIGWESESIVPSFIN  176

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
             PVP   +P     R ++    F+  A R+R+T+G+++NTF+ELE + L S+  G    PV
Sbjct  177   PVPAGVWPRVT--RTKEGATDFIDFAARFRQTKGILINTFRELEPHALRSLSDGK-FPPV  233

Query  724   YPIGPVVDREGPAR--WHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIAT  897
             YP+GP+++ +          S     +++WLD+Q  SSVVFL  GSMGS + AQ++EIA 
Sbjct  234   YPVGPLLNMKSDDGHVGSDQSIQKSDILEWLDDQPPSSVVFLCFGSMGSFSEAQVKEIAC  293

Query  898   GLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
              LE++G RFLWS+R+P PK K+ +P DY D+  VLP GF DRT G G V GW PQV ILA
Sbjct  294   ALEQSGQRFLWSLRKPEPKGKMGMPTDYADVKGVLPEGFLDRTAGIGKVIGWAPQVAILA  353

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDG  1251
             H  +GGFVSHCGWNS LE++  GVP+ TWP+YAEQ LNAF++VKELGL VEI  DY +D 
Sbjct  354   HPGVGGFVSHCGWNSTLESIWCGVPVATWPLYAEQQLNAFELVKELGLGVEIKVDYNQDS  413

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               +VSAE++ERG+R++M+ D ++R +VKE SE  K+     GSS  SLG+ +++
Sbjct  414   EVVVSAEEIERGIRQVMEKDSDLRARVKEISEKSKKALSDGGSSYSSLGRFLDQ  467



>ref|XP_009347572.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=477

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 214/480 (45%), Positives = 311/480 (65%), Gaps = 20/480 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VF+  P  G+LV  ++F+K L  ++  +S+T+L I       + SY  S+A S+
Sbjct  1     MKKVELVFIPAPGAGHLVSTLQFAKRLIGRDDRISITILAIQSYFPTTLSSYTKSIAASE  60

Query  187   GNLEFLSLPAAEP-PSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAG  348
               +  + +P  +  PS +  +S   F S++IE+H P V++ +T L      S D +R+A 
Sbjct  61    PRIRIIDVPQPQDRPSQEMYKSPAKFFSLYIESHVPSVKKIITNLVSSSANSSDSIRVAA  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               VD FC S ID+A+EL+IP YL+  S A +L+FMLH+  L  +     E  D   E+ I
Sbjct  121   LVVDFFCVSMIDMAKELNIPSYLFMTSNAGYLAFMLHLLILHEKNQIAVEESDP--EWSI  178

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             PG  +PVP    P  ++     TY+     A R RETRG++VNTF ELE++ + ++F  +
Sbjct  179   PGIVHPVPPRVLPVALTDDGGSTYIKL---ASRLRETRGIIVNTFVELETHAI-TLFSND  234

Query  709   D-VGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             D + PVYP+GPV+D  +G A  + D    + ++KWLD+Q   SVVFL  GSMGS    Q+
Sbjct  235   DGIPPVYPVGPVIDLDDGQAHSNLDQAQRDKIIKWLDDQPQKSVVFLCFGSMGSFRVEQV  294

Query  883   REIATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVP  1056
             +EIA GLE++G RFLWS+R P PK ++  P+D ++L+ VLP GF +RT GK G+VCGW P
Sbjct  295   KEIALGLEQSGQRFLWSLRMPSPKGRV--PSDCSNLEEVLPDGFLERTNGKKGLVCGWAP  352

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV ILAH A GGF+SHCGWNSILE+L HG+PI TWP+YAEQ LNAF+MV+E G+A+E+  
Sbjct  353   QVEILAHSATGGFLSHCGWNSILESLWHGIPIATWPMYAEQQLNAFRMVREFGMALEMRL  412

Query  1237  DYKDG-ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DYK G   +V A+++ER V  +M+ D EVR+KV++  +M ++     GSS  S+G+ IE+
Sbjct  413   DYKRGSADVVGADEIERAVVGVMEKDSEVRKKVEDMGKMARKAVKGGGSSFASVGRFIED  472



>gb|ACZ44836.1| glycosyltransferase [Pyrus communis]
Length=471

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 216/481 (45%), Positives = 304/481 (63%), Gaps = 23/481 (5%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLAS  183
             + + A++VFV  P IG++V  VE +K L  ++  L +TVL++ +P  +P   +  DS  S
Sbjct  1     MKRSAQLVFVPAPGIGHIVSTVEMAKQLVARDDQLFITVLVMKLPYDQPFTNT--DSSIS  58

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV-------RI  342
                + F++LP A+    D   +  SF  +++ENH+ HVR A+  L  + D        R+
Sbjct  59    H-RINFVNLPEAQLDKQDTVPNPGSFFRMFVENHKTHVRDAVINLLPESDQSESTSKPRL  117

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKE  519
             AGF +DMF  S IDVA E ++P Y++F S +S L+ + H  +L D      +E   +  E
Sbjct  118   AGFVLDMFSASLIDVANEFEVPSYVFFTSNSSTLALLSHFQSLRDEGGIDITELTSSTAE  177

Query  520   YVIPGFENPVPVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSM  696
               +P F NP PV   P  F+ K    + L    +  RY++T+G++VNTF ELES+ L  +
Sbjct  178   LAVPSFINPYPVAVLPGSFLDKESTKSTL---NNVGRYKQTKGILVNTFLELESHALHYL  234

Query  697   FGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
               G  + PVYP+GP+++ +     H D  +   +++WLD+Q   SVVFL  GSMGS   A
Sbjct  235   DSGVKIPPVYPVGPLLNLKSS---HEDKGSD--ILRWLDDQPPLSVVFLCFGSMGSFGDA  289

Query  877   QIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWV  1053
             Q++EIA  LE +G+RFLWS+R+PP K K  LP+DY DL  VLP GF DRT   G V GW 
Sbjct  290   QVKEIACTLEHSGHRFLWSLRQPPSKGKRALPSDYADLKTVLPEGFLDRTATVGRVIGWA  349

Query  1054  PQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT  1233
             PQ  IL H AIGGFVSHCGWNS LE++ +GVPI  WP+YAEQ++NAFQ+V ELGLAVEI 
Sbjct  350   PQAAILGHPAIGGFVSHCGWNSTLESIWNGVPIAAWPMYAEQNMNAFQLVVELGLAVEIK  409

Query  1234  FDY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
              DY KD   +VSAED+ERG+R++M+ D +VR++VKE SE  K+  +  GSS  SLG+ I+
Sbjct  410   MDYRKDSDVVVSAEDIERGIRQVMELDSDVRKRVKEMSEKSKKALVDGGSSYSSLGRFID  469

Query  1411  E  1413
             +
Sbjct  470   Q  470



>emb|CDP21709.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 202/474 (43%), Positives = 318/474 (67%), Gaps = 14/474 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             M++ ++VFV  P IG+LV  VEFSK L+ ++  LS+ VL+I+      ++SY + +A S+
Sbjct  1     MEKTQLVFVPAPGIGHLVSTVEFSKRLTERDDRLSIVVLVISSVSAKKMESYTERVAASN  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
               ++F+++P A+PPS +  +S  ++ ++++ENH+ HV++A+  L S     +AG  VD+F
Sbjct  61    TAIQFINIPQADPPSAEFLKSLENYHALFMENHKSHVKKAIVDLVSQPYTSLAGIVVDLF  120

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENP  546
             C+S I++A EL +  Y++F   A+ L F+ ++P    Q+ +  EF  +  + +IP + +P
Sbjct  121   CSSMIELANELGVSSYVFFTCSAAILGFVFYLPIHYNQIGR--EFETSDSDSIIPTYSHP  178

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP    P F   ++   Y   L+HA R++ET+G++VNTF ELE + +  +   ++  P+Y
Sbjct  179   VPTNVVPSFAFNKY-GGYASSLKHATRFKETKGIIVNTFAELEPHAVNQLKSDSETPPIY  237

Query  727   PIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLE  906
               GP++D EG  +   DS + E +MKWLD+Q  SSVVFL  GSMGS  P Q+ E+A  +E
Sbjct  238   TAGPLLDLEGKRQ---DS-DCERIMKWLDDQPPSSVVFLCFGSMGSFEPDQLAEMAIAIE  293

Query  907   RAGYRFLWSIREPPKSKLDLPN---DYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             R+GYRFLW++R PP SK D      +Y++L  VLP GF +RT+ +G++CGW PQ+ +LAH
Sbjct  294   RSGYRFLWAVRSPP-SKDDTTKRMGEYSNLSEVLPEGFLERTENRGLLCGWAPQMEVLAH  352

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK--DG  1251
             +A+GGFVSHCGWNS LE+L  GVP+ TWP+YAEQ +NAF++V+EL LA+E+  DY+  + 
Sbjct  353   EAVGGFVSHCGWNSTLESLWSGVPVATWPLYAEQQINAFELVRELELALELKLDYRTENA  412

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               LV AE++E+ +R LMD ++ +R +VKE  EM ++     GSS +S+G+ IE+
Sbjct  413   KNLVMAEEIEKAIRCLMDSENPIRGRVKEMKEMSRKAIQNGGSSFISVGRFIED  466



>ref|XP_009371509.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=478

 Score =   395 bits (1016),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 209/480 (44%), Positives = 304/480 (63%), Gaps = 19/480 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VF+  P  G+LV  ++F+K L  ++  + +TVL I  P R  + SY +S+A S+
Sbjct  1     MKKVELVFIPAPGEGHLVSALQFTKRLIDRDDRILITVLAIQSPFRTTLSSYTESIAASE  60

Query  187   GNLEFLSLPAAEPPSP--DQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIA  345
               +  + +   +   P  +  +S   F++++IE H P+V++ +T L      S D +R+A
Sbjct  61    PRIRVIDVQQPQDHQPPQETYQSPEKFITLYIEGHIPNVKKIITNLVSPIANSSDSIRVA  120

Query  346   GFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYV  525
                VD FC S ID A+EL++P YL+  S A +L+ ML +P L  +     E  D   E++
Sbjct  121   ALVVDFFCVSMIDAAKELNLPSYLFMTSNAGYLALMLQLPILHEKNQVAVEESDP--EWL  178

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             IPG  +PVP    P  +       Y+     A R+RETRG+V NTF ELE++        
Sbjct  179   IPGIVHPVPPRVLPMALKDGSRPAYIKL---ASRFRETRGIVANTFVELETHAFTLFSND  235

Query  706   NDVGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
               + PVYP+GPV+D  +G A  + D    + ++KWLD+Q   SVVFL  GSMGS    Q+
Sbjct  236   TRIPPVYPVGPVIDLDDGQAHSNLDQAQRDKIIKWLDDQPQKSVVFLCFGSMGSFRAEQV  295

Query  883   REIATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVP  1056
             +EIA GLE++G RFLWS+R P PK ++  P+D ++L+ VLP GF +RT GK G++CGW P
Sbjct  296   KEIALGLEQSGQRFLWSLRMPSPKGRV--PSDCSNLEEVLPDGFLERTNGKKGLICGWAP  353

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV +LAH A GGF+SHCGWNSILE+L HGVPI TWP+YAEQ LNAF+MV+ELG+A+E+  
Sbjct  354   QVEVLAHSATGGFLSHCGWNSILESLWHGVPIATWPMYAEQQLNAFRMVRELGMALEMRL  413

Query  1237  DYKDG-ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DYK G   +V A+++ER V  +M+ D EVR+KV+E  +M ++     GSS  S+G+ IE+
Sbjct  414   DYKRGSADVVGADEIERAVVGVMEKDSEVRKKVEEMGKMARKAVKDGGSSFASIGRFIED  473



>ref|XP_004303956.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Fragaria vesca subsp. vesca]
Length=479

 Score =   395 bits (1014),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 206/474 (43%), Positives = 297/474 (63%), Gaps = 8/474 (2%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASDG  189
             K ++++F+  P +G++V  VE +KLL  ++ NL +T+L++  P        YI SLA D 
Sbjct  3     KASELIFIPIPGMGHIVSTVEIAKLLLCRDDNLFITILIMKFPFTADGSDVYIKSLAVDP  62

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFFVDM  363
             +L+   +     P      +  +    +I++H+ HV+ A+TKL     +  RIAGF +DM
Sbjct  63    SLKTQRIRFVNLPQEHFQGTGATGFFTFIDSHKSHVKDAVTKLMETKSETTRIAGFVIDM  122

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIPGFE  540
             FCT  IDVA E  +P Y+++ S A+ L  M H+  L  +  K+ +EF D+  E V+  F 
Sbjct  123   FCTGMIDVANEFGLPSYVFYTSGAADLGLMFHLQALRDEENKDCTEFKDSDAELVVSSFV  182

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             NP+P     P +    E     FL  AKRYRET+G++VNTF ELE + + S+     + P
Sbjct  183   NPLPAARVLPSVVFEKEGGNF-FLNFAKRYRETKGILVNTFLELEPHAIQSLSSDGKIPP  241

Query  721   VYPIGPV--VDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
             VYP+GP+  V  EG       S     +++WLD+Q  SSVVFL  GSMG     Q++EIA
Sbjct  242   VYPVGPILNVKSEGNQVSSEKSKQKSDILEWLDDQPPSSVVFLCFGSMGCFGEDQVKEIA  301

Query  895   TGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
               LE+ G RFLWS+R+P K K+  P+DYTD   VLP GF DRT   G V GW PQ+ ILA
Sbjct  302   HALEQGGIRFLWSLRQPSKEKIGFPSDYTDYKAVLPEGFLDRTTDLGKVIGWAPQLAILA  361

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDG  1251
             H A+GGFVSHCGWNS LE++ +GVPI TWP YAEQ +NAF++VKEL LAVEI   Y KD 
Sbjct  362   HPAVGGFVSHCGWNSTLESIWYGVPIATWPFYAEQQVNAFELVKELKLAVEIDMGYRKDS  421

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               +VS E++E+G++++M+ + E+R++VKE S+M ++   ++GSS  SLG+ +++
Sbjct  422   GVIVSRENIEKGIKEVMEQESELRKRVKEMSQMSRKALEEDGSSYSSLGRFLDQ  475



>ref|XP_010044998.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW88558.1| hypothetical protein EUGRSUZ_A00936 [Eucalyptus grandis]
Length=482

 Score =   395 bits (1014),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 214/482 (44%), Positives = 306/482 (63%), Gaps = 20/482 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M  A++V V TP  G+LV +VE +KLL  ++  LS+T+L++ +P    + SY  S A+  
Sbjct  1     MANAELVLVPTPVTGHLVSMVEMAKLLVDRDPRLSITILIMKLPIDSEVDSYTSSFAASM  60

Query  190   ---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD--DDVRIAGFF  354
                 + F+ LP     + D   S+ SFL+ ++E ++PH++RA+  L +      R+AGF 
Sbjct  61    AAARIRFIHLPHV---NLDTKISSGSFLTDFMEGYKPHIKRAVADLTNSAASTWRLAGFV  117

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFCT+ I++A+E+ +P Y+YF S A+FL  MLH+ +L D Q    +EF ++  E   P
Sbjct  118   IDMFCTTMIELADEIGVPSYVYFTSSAAFLGLMLHLQSLQDEQHVDITEFKNSVAELDFP  177

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
              F +P+P +  P  +  + E    PFL+HAKR R  +G+++NTF ELE + LGS+  G  
Sbjct  178   SFAHPLPAKVLPSVVLFKEE--VQPFLEHAKRIRAIKGIIINTFDELEPHALGSL-AGLG  234

Query  712   VGPVYPIGPVVDREGPARWHPDSWNH-ELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                VY +GP+++     +   D     + +M+WL+ Q  SSVVFL  GS GS    Q++E
Sbjct  235   APMVYTVGPILNLNEETKTKADGGGRGDDIMEWLNEQPPSSVVFLCFGSRGSFRDDQVKE  294

Query  889   IATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA  LER+G+RFLWS+R+PP K K DLP DYTD   VLP GF DRT   G V GW PQ  
Sbjct  295   IAYALERSGHRFLWSLRQPPSKGKYDLPRDYTDPVEVLPEGFLDRTASVGKVIGWAPQAA  354

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAH AIGGFVSHCGWNS LE++  GV + TWP+YAEQ  NAF++V ELGLAVEI  DY+
Sbjct  355   VLAHPAIGGFVSHCGWNSTLESIRFGVAVATWPLYAEQQFNAFELVVELGLAVEIKMDYR  414

Query  1246  DGITL-----VSAEDVERGVRKLM-DGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                 +     V+ +++E G++KLM D   E R+KVKE SE  ++V  + GSS ++LG+LI
Sbjct  415   RDFRMESDFVVTVDEIEGGIKKLMEDVGSERRKKVKELSEKSRKVLTEGGSSYLALGRLI  474

Query  1408  EE  1413
             E+
Sbjct  475   ED  476



>emb|CDP09591.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   394 bits (1013),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 194/473 (41%), Positives = 311/473 (66%), Gaps = 13/473 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ K+VFV +P + +L+  VE SK L+ ++  LS+ VL+I+ P  P  +SY   +A S+
Sbjct  1     MKKTKLVFVPSPGVSHLISTVELSKRLTERDDQLSIFVLVISSPVGPDSESYTQEVAASN  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTK--LKSDDDVRIAGFFVD  360
              +++F+++P A+P   +   S  +F ++++E+H  +V+ A+    L S+    +AG  VD
Sbjct  61    TSIQFINIPKADPNLSEALSSPENFYALYLESHRSYVKTAIIDQVLVSESITSLAGIVVD  120

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFE  540
             +FC+S +DVA EL +P Y++F S +++L F+ ++P   +Q     EF  +  + +IP + 
Sbjct  121   LFCSSMVDVANELGVPSYVFFTSGSAYLGFLFYLPIHYSQ--NGREFETSDSDSIIPTYS  178

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             +PVP +  P     +H   Y  F++HA +++ET+G+++NTF ELE + +  +    +  P
Sbjct  179   HPVPSKVIPSLAFNKH-GGYSSFIKHATKFKETKGIIINTFAELEPHAVDRLKFDAETPP  237

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             +Y +GP++D EG  R  PD   HE +MKWLD+Q  SSVVFL  GSMGS  P Q+ E+A  
Sbjct  238   IYTVGPLLDLEGRKR-EPD---HETIMKWLDDQPPSSVVFLCFGSMGSFEPDQLAEMALA  293

Query  901   LERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             LER+GYRFL S+R   K       +++++  +LP GF +R + +G+V  W PQ+ +LAH+
Sbjct  294   LERSGYRFLLSVR-LSKVFTKGTGEHSNISEMLPQGFLERIENRGLVSSWAPQMEVLAHE  352

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK--DGI  1254
             A+GGFVSHCGWNSILE+L HGVP+ TWP+YAEQ +NAF++V+EL LA+++  DY+  +  
Sbjct  353   AVGGFVSHCGWNSILESLWHGVPVATWPVYAEQQINAFELVRELELAMDLKMDYRMENAK  412

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              LV AE++E+ +R LMD ++  R++V+E  EM ++     GSS +SLG+L E+
Sbjct  413   NLVMAEEIEKAIRCLMDTENPTRKRVQEMKEMSRKAIENGGSSFISLGRLTED  465



>ref|XP_010093120.1| Putative UDP-glucose flavonoid 3-O-glucosyltransferase 3 [Morus 
notabilis]
 gb|EXB53572.1| Putative UDP-glucose flavonoid 3-O-glucosyltransferase 3 [Morus 
notabilis]
Length=467

 Score =   394 bits (1012),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 214/476 (45%), Positives = 301/476 (63%), Gaps = 23/476 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP---QRPLIQSYIDSLA  180
             MK+ ++VFV  P  G+L+  +EF+  L  ++   SVT+LL+  P     PL+ S+ +   
Sbjct  1     MKKTELVFVPAPARGHLLSALEFANQLLSRDNRFSVTILLMKSPFHLSLPLLTSHAN---  57

Query  181   SDGNLEFLSLPAAE--PPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFF  354
                NL ++ +P  E  PP    + S   ++S  IE+H+ +V+  +  L     +  +G  
Sbjct  58    ---NLRYVDVPTPEQLPPPELVSESLEKYISDCIESHKSNVKEIVANLLPKPTL-FSGLV  113

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             VDMFCT+ I VAEEL +P Y++F S A FL F+L++   +  V     F ++  E  IP 
Sbjct  114   VDMFCTAMISVAEELGVPSYVFFTSSAGFLGFILYVGDREGGV-----FEESDPESDIPS  168

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F NPVP    P F   R       F+ HA+ +++T+G++VNT  ELES+ + S F     
Sbjct  169   FANPVPTRVLPSFAFNRR-GGLASFVDHAREFKKTKGIIVNTVLELESHAVDS-FSYRGT  226

Query  715   GPVYPIGPVVDREGPARWHPD-SWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
              P+Y +GP++D  G      + S + + + KWLD Q   SVVFL  GS G+ +  Q+REI
Sbjct  227   PPIYTVGPLLDLSGKHDVRSERSQDDKKIFKWLDRQPPKSVVFLCFGSQGAFDAPQLREI  286

Query  892   ATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             A GLE++G RFLWS+R+ PP+ K+ +P DY D    LP GFS+RTK  G++CGWVPQV +
Sbjct  287   AIGLEQSGQRFLWSVRKTPPQGKI-MPEDYQDPGEFLPHGFSERTKEVGLLCGWVPQVEV  345

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-  1245
             LAHKAIGGFVSHCGWNS +E+L  GVPI TWP+YAEQ +NAFQMV++LGLAVE++ DYK 
Sbjct  346   LAHKAIGGFVSHCGWNSTMESLWFGVPIATWPMYAEQQINAFQMVRDLGLAVELSLDYKN  405

Query  1246  DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DG  +V+A+ + R V  LMDGD EVR +V+E SE C+R  +  GSS VS G+LIE+
Sbjct  406   DGGDVVTADQIARAVGCLMDGDGEVRRRVQEMSEKCRRAVVDGGSSFVSFGRLIED  461



>ref|XP_010045027.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
Length=482

 Score =   394 bits (1013),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 218/482 (45%), Positives = 312/482 (65%), Gaps = 20/482 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             M  A+++F+ TP +G+LV +VE +KL+  ++  LSVTVL++  P    + SY +SLA+  
Sbjct  1     MADAELLFIPTPGMGHLVAMVEMAKLIVDRDPRLSVTVLVMKFPFDSDVDSYTNSLATSM  60

Query  187   --GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFF  354
                 L F+ LP  E  +PD   S+  F++ ++E+++P V+RA+ +L   +    R+AGF 
Sbjct  61    AASRLRFIHLPR-ENANPD--FSSGQFITNFVESNKPRVKRAIAELADSAGSTGRLAGFV  117

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIP  531
             +DMFCT+ ID+A+EL +P Y+ F S A+FL  MLH+ +L  +   + +E+ D+A E   P
Sbjct  118   LDMFCTTMIDLADELGVPSYVLFTSSAAFLGMMLHLQSLQDEYHVDITEYKDSAAELDCP  177

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
                NP+P +  PP +  +  +T  PFL HAKR R  +G++VNTF+ELE Y L S+ G   
Sbjct  178   SLTNPLPAKVLPPLVLTK--ETVRPFLGHAKRMRAAKGIIVNTFEELEPYALRSLVGLG-  234

Query  712   VGPVYPIGPVVDREGPARWHPDSWNH-ELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                VYP+GP+++ +G  +      +    +M+WL+ Q SSSVVFL  GSMGSL   Q++E
Sbjct  235   APAVYPLGPILNLKGETKTKACGGHQGNDIMEWLNEQPSSSVVFLCFGSMGSLGEEQVKE  294

Query  889   IATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             +A  LER+G+RFLWS+R PP K K+  P++  D   VLP GF DRT   G V GW PQV 
Sbjct  295   MACALERSGHRFLWSLRRPPPKGKVWFPSELMDPTEVLPEGFLDRTATIGKVIGWAPQVA  354

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAH AIGGFVSHCGWNS LE++  GV + T P+Y EQ  NAF++V ELGLAVEI  DY+
Sbjct  355   VLAHPAIGGFVSHCGWNSTLESIWFGVAMATLPLYGEQQFNAFELVVELGLAVEIKMDYR  414

Query  1246  -----DGITLVSAEDVERGVRKLMDG-DDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                  D   +V+A+ +E G++KLM+  D E R+KV E SE  K V ++ GSS +SLG LI
Sbjct  415   RDPRMDSDFVVTADVIEGGIKKLMEEVDSERRKKVNEASEKSKMVLIEGGSSYLSLGCLI  474

Query  1408  EE  1413
             E+
Sbjct  475   ED  476



>dbj|BAG71126.1| glucosyltransferase [Phytolacca americana]
 dbj|BAH05015.1| glucosyltransferase [Phytolacca americana]
Length=491

 Score =   395 bits (1014),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 212/488 (43%), Positives = 314/488 (64%), Gaps = 27/488 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASD  186
             M++ ++VFV +P +G+L+  VE +K++ H++  +SV +L+ N+P   PL+ +Y++S + D
Sbjct  1     MRKTELVFVPSPGMGHLLSTVELAKVIVHRDDRISVVILMFNLPFDLPLVNAYVESQSRD  60

Query  187   GN---LEFLSLPAA-EPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFF  354
              +   L F+SLP    PP P  N    +F    ++ H+P V++A+        ++ AGF 
Sbjct  61    SDPSRLTFVSLPTLPNPPDPTSN----NFFYTLVDLHKPLVKKAVEDRVGSGSLKPAGFV  116

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL--DAQVPKNSEFGDAAKEYVI  528
             +D FCT+ IDVA EL +P Y+YF S AS L+ + H  +L  D  +   +EF D   E  +
Sbjct  117   LDFFCTTLIDVANELHLPSYIYFTSGASLLNMIFHFQSLAHDNGIDIATEFDDPDLELDV  176

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             PGF N VP +  P    ++   + + FL  A+R+R+++G++VNTF ELESY + S+   +
Sbjct  177   PGFRNRVPSKVVPGVFFEKDGGSDM-FLNLARRFRQSKGILVNTFIELESYAMQSLLE-H  234

Query  709   DVG---PVYPIGPVVDREGPARWHPDSW---NHELVMKWLDNQLSSSVVFLTTGSMGSLN  870
             D+G    VYP+GP+++ +  +R         + E +++WLD+Q   SVVFL  GSMGS +
Sbjct  235   DMGKIPAVYPVGPILELDNKSRSSSSKKKEDDQESIIRWLDDQPDFSVVFLCFGSMGSFS  294

Query  871   PAQIREIATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCG  1047
               Q++EIA GL+RAGYRFLWS+R P P+ K  +P+D T  +  LP GF  RT   G + G
Sbjct  295   EDQVKEIANGLDRAGYRFLWSLRRPAPEGKFGMPSDET-FEDALPEGFMGRTAHLGKIIG  353

Query  1048  WVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVE  1227
             W PQV+ILAH+A+GGFVSHCGWNS LE+L  G+P+ TWP+YAEQ LNAF++VKE+GLAVE
Sbjct  354   WAPQVSILAHRAVGGFVSHCGWNSTLESLWFGIPMATWPMYAEQQLNAFELVKEVGLAVE  413

Query  1228  ITFDY------KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAV  1389
             I  DY      K G  +++AE++E GV+KLM  D+E+ EKV+E SE  K+     GSS  
Sbjct  414   IRMDYRRDRRTKKGNFVITAEEIENGVKKLMSKDEEMSEKVREMSEKGKKALEDGGSSHH  473

Query  1390  SLGKLIEE  1413
              LG+ IE+
Sbjct  474   WLGRFIED  481



>gb|KCW88560.1| hypothetical protein EUGRSUZ_A00938 [Eucalyptus grandis]
Length=490

 Score =   394 bits (1013),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 218/482 (45%), Positives = 312/482 (65%), Gaps = 20/482 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             M  A+++F+ TP +G+LV +VE +KL+  ++  LSVTVL++  P    + SY +SLA+  
Sbjct  1     MADAELLFIPTPGMGHLVAMVEMAKLIVDRDPRLSVTVLVMKFPFDSDVDSYTNSLATSM  60

Query  187   --GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFF  354
                 L F+ LP  E  +PD   S+  F++ ++E+++P V+RA+ +L   +    R+AGF 
Sbjct  61    AASRLRFIHLPR-ENANPD--FSSGQFITNFVESNKPRVKRAIAELADSAGSTGRLAGFV  117

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIP  531
             +DMFCT+ ID+A+EL +P Y+ F S A+FL  MLH+ +L  +   + +E+ D+A E   P
Sbjct  118   LDMFCTTMIDLADELGVPSYVLFTSSAAFLGMMLHLQSLQDEYHVDITEYKDSAAELDCP  177

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
                NP+P +  PP +  +  +T  PFL HAKR R  +G++VNTF+ELE Y L S+ G   
Sbjct  178   SLTNPLPAKVLPPLVLTK--ETVRPFLGHAKRMRAAKGIIVNTFEELEPYALRSLVGLG-  234

Query  712   VGPVYPIGPVVDREGPARWHPDSWNH-ELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                VYP+GP+++ +G  +      +    +M+WL+ Q SSSVVFL  GSMGSL   Q++E
Sbjct  235   APAVYPLGPILNLKGETKTKACGGHQGNDIMEWLNEQPSSSVVFLCFGSMGSLGEEQVKE  294

Query  889   IATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             +A  LER+G+RFLWS+R PP K K+  P++  D   VLP GF DRT   G V GW PQV 
Sbjct  295   MACALERSGHRFLWSLRRPPPKGKVWFPSELMDPTEVLPEGFLDRTATIGKVIGWAPQVA  354

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAH AIGGFVSHCGWNS LE++  GV + T P+Y EQ  NAF++V ELGLAVEI  DY+
Sbjct  355   VLAHPAIGGFVSHCGWNSTLESIWFGVAMATLPLYGEQQFNAFELVVELGLAVEIKMDYR  414

Query  1246  -----DGITLVSAEDVERGVRKLMDG-DDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                  D   +V+A+ +E G++KLM+  D E R+KV E SE  K V ++ GSS +SLG LI
Sbjct  415   RDPRMDSDFVVTADVIEGGIKKLMEEVDSERRKKVNEASEKSKMVLIEGGSSYLSLGCLI  474

Query  1408  EE  1413
             E+
Sbjct  475   ED  476



>sp|Q2V6K0.1|UFOG6_FRAAN RecName: Full=UDP-glucose flavonoid 3-O-glucosyltransferase 6; 
AltName: Full=Flavonol 3-O-glucosyltransferase 6; Short=FaGT6 
[Fragaria x ananassa]
 gb|ABB92748.1| UDP-glucose glucosyltransferase [Fragaria x ananassa]
Length=479

 Score =   394 bits (1012),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 205/474 (43%), Positives = 297/474 (63%), Gaps = 8/474 (2%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASDG  189
             K ++++F+  P IG++V  VE +KLL  ++ NL +T+L++  P        YI SLA D 
Sbjct  3     KASELIFIPIPGIGHIVSTVEIAKLLLCRDDNLFITILIMKFPFTADGSDVYIKSLAVDP  62

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFFVDM  363
             +L+   +     P      +  +    +I++H+ HV+ A+T+L     +  RIAGF +DM
Sbjct  63    SLKTQRIRFVNLPQEHFQGTGATGFFTFIDSHKSHVKDAVTRLMETKSETTRIAGFVIDM  122

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIPGFE  540
             FCT  ID+A E  +P Y+++ S A+ L  M H+  L  +  K+ +EF D+  E V+  F 
Sbjct  123   FCTGMIDLANEFGLPSYVFYTSGAADLGLMFHLQALRDEENKDCTEFKDSDAELVVSSFV  182

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             NP+P     P +    E     FL  AKRYRET+G++VNTF ELE + + S+     + P
Sbjct  183   NPLPAARVLPSVVFEKEGGNF-FLNFAKRYRETKGILVNTFLELEPHAIQSLSSDGKILP  241

Query  721   VYPIGPV--VDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
             VYP+GP+  V  EG       S     +++WLD+Q  SSVVFL  GSMG     Q++EIA
Sbjct  242   VYPVGPILNVKSEGNQVSSEKSKQKSDILEWLDDQPPSSVVFLCFGSMGCFGEDQVKEIA  301

Query  895   TGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
               LE+ G RFLWS+R+P K K+  P+DYTD   VLP GF DRT   G V GW PQ+ ILA
Sbjct  302   HALEQGGIRFLWSLRQPSKEKIGFPSDYTDYKAVLPEGFLDRTTDLGKVIGWAPQLAILA  361

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDG  1251
             H A+GGFVSHCGWNS LE++ +GVPI TWP YAEQ +NAF++VKEL LAVEI   Y KD 
Sbjct  362   HPAVGGFVSHCGWNSTLESIWYGVPIATWPFYAEQQVNAFELVKELKLAVEIDMGYRKDS  421

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               +VS E++E+G++++M+ + E+R++VKE S+M ++   ++GSS  SLG+ +++
Sbjct  422   GVIVSRENIEKGIKEVMEQESELRKRVKEMSQMSRKALEEDGSSYSSLGRFLDQ  475



>ref|XP_008384817.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Malus 
domestica]
Length=478

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 208/480 (43%), Positives = 302/480 (63%), Gaps = 19/480 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VF+  P  G+LV  ++F+  L  ++  + +T+L I  P R    SY +S+A S+
Sbjct  1     MKKVELVFIPAPGEGHLVSALQFTXRLIDRDDRILITILAIQSPFRTTJNSYTESIAASE  60

Query  187   GNLEFLSL--PAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIA  345
               +  + +  P    P  + ++S   F+ ++IE H P+V++ +T L      S D +R+A
Sbjct  61    PRIRVIDVQEPQDHQPPQETHQSPEKFICLYIEGHVPNVKKIITNLVSFNANSLDSIRVA  120

Query  346   GFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYV  525
                VD FC S IDVA+EL++P YL+  S A +L+ ML +P L  +     E  D   E++
Sbjct  121   ALVVDFFCVSMIDVAKELNLPSYLFMPSNAGYLALMLQLPILHEKNQVAVEESDP--EWL  178

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             IPG  +PVP    P  ++      Y+     A R+RETRG+V NTF ELE++ +      
Sbjct  179   IPGIVHPVPPRVLPMALTDGSRPAYIKL---ASRFRETRGIVANTFVELETHAITLFSND  235

Query  706   NDVGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
               + PVYP+GP +D  +G A  + D    + ++KWLD+Q   SVVFL  GSMGS    Q+
Sbjct  236   TRIPPVYPVGPGIDLDDGQAHSNLDQAQRDKIIKWLDDQPQKSVVFLCFGSMGSFRAEQV  295

Query  883   REIATGLERAGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVP  1056
             +EIA GLE++G RFLWS+R + PK  +  P+D ++L+ VLP GF +RT GK G++CGW P
Sbjct  296   KEIALGLEQSGQRFLWSLRMQSPKGTV--PSDCSNLEEVLPDGFLERTNGKKGLICGWAP  353

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV +LAH A GGFVSHCGWNSILE+L HGVPI TWP+YAEQ LNAF MV+ELG+A+E+  
Sbjct  354   QVEVLAHSATGGFVSHCGWNSILESLWHGVPIATWPMYAEQQLNAFXMVRELGMALEMRL  413

Query  1237  DYKDGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DYK G   +V A+++ER V  +M+ D EVR+KV+E  +M ++     GSS  S+G+ IE+
Sbjct  414   DYKTGSGDVVGADEIERAVVGVMEKDSEVRKKVEEMGKMARKAVKDGGSSFASVGRFIED  473



>ref|XP_006429782.1| hypothetical protein CICLE_v10011544mg [Citrus clementina]
 gb|ESR43022.1| hypothetical protein CICLE_v10011544mg [Citrus clementina]
Length=499

 Score =   394 bits (1013),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 212/491 (43%), Positives = 309/491 (63%), Gaps = 35/491 (7%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ +P  G+LV  VE ++LL  ++  LSVTVL++ +P    + +Y  SLA+  
Sbjct  15    MKKAQLVFIPSPGAGHLVSTVEVARLLVERDDGLSVTVLIMKLPHDNTVATYTQSLAASN  74

Query  190   ---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFF  354
                 ++F++LP  +P    ++     F + ++E+ +PHV+  +  L  +S D  R+AGF 
Sbjct  75    LSSRIKFINLPDDQPDK--ESTPPKRFFADFVESKKPHVKEVVANLTDESPDSPRLAGFV  132

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFCT  I+VA+E  +P YL+F S A+FL FML +  L D +    +E  D+     +P
Sbjct  133   LDMFCTCMIEVADEFKVPSYLFFTSGAAFLGFMLRVQALHDEENTAITELKDSDAVLEVP  192

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG-N  708
             G  N VP + +P  +  +     L   QHA+R+R T+G++VNTF+ELES+ + S   G +
Sbjct  193   GLVNSVPAKVWPSVVFNKEWAEAL--YQHARRFRGTKGIMVNTFEELESHAVRSFSNGKS  250

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHEL----------VMKWLDNQLSSSVVFLTTGSM  858
                P+YP+GP+++ +G         N++L          +M WLD+Q  SSVVFL  GS 
Sbjct  251   KTPPLYPVGPILNIKGE--------NYDLGEGGADKKADIMAWLDDQPESSVVFLCFGSW  302

Query  859   GSLNPAQIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKG  1035
             GS    Q++EIA  LE++G+RFLWS+R  P K   + P+DY D   VLP GF DRT   G
Sbjct  303   GSFGEDQVKEIACALEQSGHRFLWSLRRAPSKDTFEKPSDYEDPTEVLPEGFMDRTANIG  362

Query  1036  MVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELG  1215
              V GW PQV +LAH +IGGFVSHCGWNS LE++  GVPI TWP+YAEQ  NAF++V ELG
Sbjct  363   KVIGWAPQVAVLAHPSIGGFVSHCGWNSTLESIWFGVPIATWPMYAEQQFNAFELVVELG  422

Query  1216  LAVEITFDYKDGI-----TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGS  1380
             LAVEI  DY++ I     T+V+AE +ERG+R LM+ + E+R +VKE SE  ++     GS
Sbjct  423   LAVEIKMDYRNDIMIENPTVVNAEVIERGIRCLMEHNSEMRMRVKEMSEKARKALSDGGS  482

Query  1381  SAVSLGKLIEE  1413
             S  S+G+LI++
Sbjct  483   SFSSMGRLIDD  493



>gb|KDP27744.1| hypothetical protein JCGZ_19773 [Jatropha curcas]
 gb|KDP27745.1| hypothetical protein JCGZ_19774 [Jatropha curcas]
Length=499

 Score =   394 bits (1012),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 204/482 (42%), Positives = 309/482 (64%), Gaps = 30/482 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRP--LIQSYIDSLAS  183
             M++A++VFV  P +G+L+ +VE +KLL +++  L++TVL++ +      +I++Y  S+A+
Sbjct  28    MEEAQLVFVPVPGMGHLISMVELAKLLLNRHHQLTITVLIMKLSNYDFNVIENYTQSVAA  87

Query  184   DGNL----EFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV--RIA  345
               +L     F+ LP  EP         +   S +IE  +PHV++ ++++  ++    R+ 
Sbjct  88    STSLSNRIRFMDLPKDEP--------EVFGFSSFIERQKPHVKQIVSEITKNESNSPRLI  139

Query  346   GFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEY  522
             G  +DMFCT  IDVA +  +P Y++F S A+FL FMLH+  + D Q    +E  +   E 
Sbjct  140   GLVLDMFCTPMIDVANDFGLPSYIFFTSSAAFLGFMLHMQVICDEQKANPTELKELNPEL  199

Query  523   VIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG  702
             V+P   NP P +  P  +  +     LP LQ+ +R++E +G++VNTF ELESY + S   
Sbjct  200   VVPSLVNPFPTKVMPSALLGKE---ILPPLQNFRRFKEVKGIIVNTFFELESYAIESFSD  256

Query  703   GN--DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
             G   ++ P+YP+GP+++     R       H+ +M+WLDNQ +SSVVFL  GSMGSL+  
Sbjct  257   GKVKNLSPLYPVGPILNLGDDGRS-----KHQEIMQWLDNQPASSVVFLCFGSMGSLSED  311

Query  877   QIREIATGLERAGYRFLWSIREP--PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGW  1050
             Q++EIA  LE +G+RFLWS+R P  P  +++ P+DY +   VLP GF DR  G G V GW
Sbjct  312   QVKEIANALEHSGHRFLWSLRRPHPPTGRMEAPSDYDNPQEVLPEGFLDRMAGIGKVVGW  371

Query  1051  VPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEI  1230
              PQ  ILAH+AIGGFVSHCGWNS+LE++ +GVP+  WPIY +Q  NAF+MV E+GLAVEI
Sbjct  372   APQAAILAHEAIGGFVSHCGWNSMLESIWYGVPVAAWPIYGDQQFNAFEMVIEIGLAVEI  431

Query  1231  TFDY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
               DY KD   +VS +++ERG+R +M+ D E R+KVK+ SE  +   M+ GSS + L +L+
Sbjct  432   KMDYRKDSEIIVSCDEIERGIRSVMELDSEKRKKVKQMSERSRMTIMEGGSSYMWLDRLM  491

Query  1408  EE  1413
             ++
Sbjct  492   KD  493



>ref|XP_004303954.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Fragaria vesca subsp. vesca]
Length=477

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 215/481 (45%), Positives = 306/481 (64%), Gaps = 18/481 (4%)
 Frame = +1

Query  10    MKQ-AKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLAS  183
             MKQ  ++VF+ +P IG+LV  VE +KLL  ++  L +TVL++  P     I +YI+S A 
Sbjct  1     MKQWVEIVFIPSPGIGHLVSTVELAKLLLSRDDRLLITVLIMKFPFSSDPIDAYIESFAD  60

Query  184   DG---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-KSDDDVRIAGF  351
                   ++F++LP     +  Q  STI+FL+ +    + +V+  + KL +S  + R+AGF
Sbjct  61    SSISHRIKFINLPQQNIET--QGNSTINFLN-FSGTQKTNVKDVVAKLIESKTETRLAGF  117

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVI  528
              +DMFCTS IDVA EL +P Y++F S A+ L  +LH+  L D Q     EF D+  + VI
Sbjct  118   VIDMFCTSMIDVANELGVPTYVFFTSSAASLGVLLHLQALRDDQNKDYLEFNDSTADLVI  177

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P + NP+P    P  + ++       FL  AKR R+ +G+++NT  ELES+ L S+    
Sbjct  178   PSYANPLPARVLPGILFEKEGGN--GFLNLAKRIRDVKGILINTMTELESHALLSLSSDG  235

Query  709   DVGPVYPIGPVV----DREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
              + PVYP+GP++    D          S     ++KWLD+Q  SSVVFL  GSMGS +  
Sbjct  236   KLPPVYPVGPILNVKSDDNNDQVDSKQSKQTSDILKWLDDQPPSSVVFLCFGSMGSFSED  295

Query  877   QIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWV  1053
             Q++EIA  LE+ G+RFLWS+R+PP K K+ +P+DY D   VLP GF D+T G G V GW 
Sbjct  296   QVKEIARALEQGGFRFLWSLRQPPPKGKIGVPSDYADHTGVLPEGFLDQTAGVGKVIGWA  355

Query  1054  PQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT  1233
             PQV IL+H A+GGFVSHCGWNS LE+L  GVP+ TWP+YAEQ  NAFQ+V+ELG+AVEI 
Sbjct  356   PQVAILSHPAVGGFVSHCGWNSTLESLWFGVPVATWPLYAEQQQNAFQLVRELGIAVEID  415

Query  1234  FDY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
               Y KDG  +V+AE ++ G+++LMD D ++R++VK+ S+  K+  M  GSS  SLG  I+
Sbjct  416   MSYRKDGPIVVTAEKIQSGIKELMDLDSDIRKRVKQVSDNSKKALMDGGSSYASLGHFID  475

Query  1411  E  1413
             +
Sbjct  476   Q  476



>ref|XP_008378326.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Malus domestica]
Length=471

 Score =   393 bits (1009),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 211/480 (44%), Positives = 299/480 (62%), Gaps = 21/480 (4%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-  183
             + + A++VFV  P IG++V  VE +K L+ ++  L +TVL++ +P     Q + ++ +S 
Sbjct  1     MKRPAQLVFVPAPGIGHIVSTVEMAKQLAARDDQLFITVLVMKLP---YAQPFTNTDSSI  57

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV-------RI  342
                + F++LP A+P   D   +  SF  +++ENH+ HVR A+  +  + D        R+
Sbjct  58    SHRINFVNLPEAQPDKQDIVPNPGSFFRMFVENHKSHVRDAVINVLPESDQSESTSKPRL  117

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKE  519
             AGF +DMF  S IDVA E  +P YL+F S AS L+ M H  +L D      +E   +  E
Sbjct  118   AGFVLDMFSASLIDVANEFKVPSYLFFTSNASALALMSHFQSLRDEGGIDITELTSSTAE  177

Query  520   YVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF  699
               +P F NP P    P   S    ++    L H  +Y++T+G++VNTF ELES+ L  + 
Sbjct  178   LAVPSFINPYPAAVLPG--SLLDMESTKSTLNHVSKYKQTKGILVNTFMELESHALHYLD  235

Query  700   GGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
              G+ + PVYP+GP+++ +       D      +++WLD+Q   SVVFL  GSMGS   AQ
Sbjct  236   SGDKIPPVYPVGPLLNLKSS-----DEDKASDILRWLDDQPPFSVVFLCFGSMGSFGEAQ  290

Query  880   IREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             ++ IA  LE +G+RFLWS+R PP + K  +P+DY DL  VLP GF DRT   G V GW P
Sbjct  291   VKGIACALEHSGHRFLWSLRRPPPQGKRAMPSDYGDLKTVLPEGFLDRTATVGKVIGWAP  350

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             Q  IL H A GGFVSHCGWNS LE+L +GVPI  WP+YAEQ+LNAFQ+V ELGLAVEI  
Sbjct  351   QAAILGHPATGGFVSHCGWNSTLESLWNGVPIAAWPLYAEQNLNAFQLVVELGLAVEIKM  410

Query  1237  DY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DY +D   +VSAED+ERG+R++M+ D +VR++VKE SE  K+  +  GSS  SLG+ I++
Sbjct  411   DYRRDSDVVVSAEDIERGIRRVMELDSDVRKRVKEMSEKSKKALVDGGSSYSSLGRFIDK  470



>ref|XP_002520574.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF41807.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=469

 Score =   392 bits (1008),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 212/476 (45%), Positives = 298/476 (63%), Gaps = 21/476 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQ-RPLIQSYIDSLA--  180
             MK+ ++VFV  P  G+L   VE +KLL  ++  LS+++L++       ++   IDSL   
Sbjct  1     MKKPELVFVPIPGAGHLTSAVEAAKLLLDRDARLSISILILRRSSDSKVVSDLIDSLTAT  60

Query  181   -SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFV  357
              +   ++F++LP  E  S   +         +IE ++PH+R A++KL +  D  +AGF +
Sbjct  61    ITSHRIQFINLPNEESESMGLD---------FIEKYKPHIREAVSKLATRSDFTLAGFVL  111

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPG  534
             DMFC   IDVA E  +P Y++F S A+F  FMLH+  L D Q    ++F ++  E  +P 
Sbjct  112   DMFCMPVIDVANEFGVPSYVFFTSGAAFFGFMLHLRALHDEQEVDPTQFKNSDDELALPC  171

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN-D  711
             F NP+P    P  + ++  ++   FL+ ++R+RE +G++VNTF ELES  + S+  G  +
Sbjct  172   FVNPLPARVLPSVLLEK--ESMPAFLEMSRRFREAKGIIVNTFMELESSAINSLSDGTIE  229

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
               PVYP+GP+++ +G       S   + +M+WLD+Q  SSVVFL  GSMG     Q +EI
Sbjct  230   SPPVYPVGPILNLKGGD--SVGSAESKEIMEWLDDQPPSSVVFLCFGSMGGFREDQAKEI  287

Query  892   ATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             A  LER G RFLWS+ +P P  K+    D  +L+  LP  F DRT G G V GW PQV +
Sbjct  288   AFALERCGQRFLWSLCQPLPMGKMTGYTDCQNLEGFLPEEFLDRTAGIGKVIGWAPQVAV  347

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-K  1245
             LAH AIGGFVSHCGWNS LE++ +GVPI TWP+YAEQ  NAFQ+V ELGLAVEIT DY K
Sbjct  348   LAHPAIGGFVSHCGWNSTLESIWYGVPIATWPMYAEQQFNAFQLVTELGLAVEITVDYRK  407

Query  1246  DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             D   +V A D+ERGVR +M+ D E+R KVKE SE  ++V M  GS+  SL +LIE+
Sbjct  408   DSDVIVKAADIERGVRCVMEQDSEIRMKVKEMSEKSRKVLMDGGSAFSSLNRLIED  463



>ref|XP_004304513.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Fragaria vesca subsp. vesca]
Length=479

 Score =   393 bits (1009),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 296/459 (64%), Gaps = 19/459 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ TP+ G+LV  +EFSK L  +    SVT+LL+  P        + + AS+ 
Sbjct  1     MKRAELVFIPTPSTGHLVSTIEFSKRLLDRCDQFSVTILLMKSPFGVAADQSLPA-ASNT  59

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
             N++ + LP   PP   +  S   FLS +IE ++ HV+  +      +  RIAG  +DMFC
Sbjct  60    NIKLIHLPNINPPI--KLDSVEKFLSDYIETYKHHVKDTILNQVLPNSSRIAGVVIDMFC  117

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
             T+ ID+A EL +P +L+F S A+FL  +L +P     V K  EF  +  + ++P + NPV
Sbjct  118   TTMIDIANELKVPSFLFFTSGAAFLGLLLCLPERYDLVGK--EFVHSDPDSIVPSYVNPV  175

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF----GGNDVG  717
             P    P F+   +   Y+ F  HA+R++ET+GV++NT  ELES+ + S+F    G     
Sbjct  176   PTNVLPGFVF--NNGGYVSFASHARRFKETKGVIINTLVELESHAVHSIFRVGEGDQSDQ  233

Query  718   P---VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
             P   VYP+GP++D +G  +   D    + +M++LDNQ   SVVFL  GS GS + AQ+RE
Sbjct  234   PWPAVYPVGPLIDTKGEHQVRSD---RDRIMEFLDNQPPKSVVFLCFGSFGSFDEAQLRE  290

Query  889   IATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA GLE++G+RFLWS+R+ PPK K + P +Y + +  LP GF +RTKG GM+CGW PQV 
Sbjct  291   IAIGLEKSGHRFLWSVRQRPPKGKTEFPGEYKNYEDFLPQGFLERTKGVGMLCGWAPQVE  350

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +L HK+ GGFVSHCGWNSILE+L +GVPI TWP+YAEQ +NAF + ++LGL VE+  DY 
Sbjct  351   VLGHKSTGGFVSHCGWNSILESLWYGVPIVTWPLYAEQQVNAFLIARDLGLGVELRLDYV  410

Query  1246  DGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKR  1359
              G    VSA+++ER V  LM GD E+R++V E SEMC+R
Sbjct  411   YGSGDFVSADEIERAVTGLMVGDSEIRKRVVEMSEMCRR  449



>ref|XP_002273538.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=475

 Score =   392 bits (1008),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 207/474 (44%), Positives = 302/474 (64%), Gaps = 18/474 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M+Q ++VF+  P +G+L   +E +KL++ ++   S+T+ ++  P         DS     
Sbjct  1     MEQTELVFIPFPVVGHLASALEIAKLITKRDPRFSITIFIMKFPFGSTEGMDTDS----D  56

Query  190   NLEFLSLPAAEPPSPDQNRSTIS--FLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDM  363
             ++ F++LP  E  S     +T+S  F+S +++ H P VR A+ +L   + VR++GF +DM
Sbjct  57    SIRFVTLPPVEVSS----ETTLSGHFISEFVKVHIPLVRDAVHELIRSNSVRLSGFIIDM  112

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFE  540
              CT  IDVA+E  +P YL+F+S A+ L F+LH+  L D +    +EF D+  E  +P F 
Sbjct  113   LCTHMIDVADEFGVPSYLFFSSGAAVLGFLLHVQFLHDYEGLDINEFKDSDAELDVPTFV  172

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             N VP   FP +M  +        L H +R+RE +G++VNTF ELES+ + S+  G+ V  
Sbjct  173   NSVPGNVFPAWMFDKESGGAEMLLYHTRRFREVKGILVNTFIELESHAIQSL-SGSTVPE  231

Query  721   VYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIAT  897
             VYP+GP+++ R G      D+      M+WLD+Q  SSV+FL  GS GS    QI+EIA 
Sbjct  232   VYPVGPILNTRMGSGGGQQDA---SATMRWLDDQPPSSVIFLCFGSRGSFGADQIKEIAY  288

Query  898   GLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
             GLE +G+RFLWS+R+PP K K++ P  Y +++ VLP GF  RT   G V GW PQ+ +LA
Sbjct  289   GLEHSGHRFLWSLRQPPQKGKMEFPGGYENIEEVLPEGFLHRTARIGKVIGWAPQIAVLA  348

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDG  1251
             H A+GGFVSHCGWNS+LE++ +GVP+ TWPIYAEQ +NAFQMVK+L LAVEI  DY KD 
Sbjct  349   HSAVGGFVSHCGWNSLLESIWYGVPVATWPIYAEQQINAFQMVKDLELAVEINIDYNKDR  408

Query  1252  ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               +VSA ++E G+R L+  + EVR+K KE  ++ ++V +  GSS  SLG  IE+
Sbjct  409   DHIVSAHEIENGLRNLIKTNSEVRQKKKEMQKISRKVMIDGGSSHFSLGHFIED  462



>ref|XP_009371513.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=481

 Score =   393 bits (1009),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 210/480 (44%), Positives = 311/480 (65%), Gaps = 20/480 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VF+  P  G+LV  ++F+K L  ++  +S+T+L I       + SY  S+A S+
Sbjct  1     MKKVELVFIPAPGAGHLVSTLQFTKRLIDRDDRVSITILAIQSSFPTTLSSYAKSIAASE  60

Query  187   GNLEFLSLPAAEP-PSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAG  348
               + F+ +P  +  P  +  +S   F S++IE+H P V++ +T L      S D +R+A 
Sbjct  61    PRIRFIDVPQPQDRPPQEMYKSPAKFFSLYIESHVPSVKKIITNLVSSSANSSDSIRVAA  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               VD FC S IDVA+E +IP YL+  S A +L+FMLH+P +  +     E  D   E+ I
Sbjct  121   LVVDFFCVSMIDVAKEFNIPSYLFLTSNAGYLAFMLHLPIVHEKNQIAVEESDP--EWSI  178

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             PG  +PV     P  +++     Y+     A R+RET+G++VNTF ELE++ + ++F  +
Sbjct  179   PGIVHPVFPRVLPVALTEGSRSAYIKL---ASRFRETKGIIVNTFVELETHAI-TLFSTD  234

Query  709   D-VGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             D + PVYP+GPV+D  +G A  + D    + ++ WLD+Q   SVVFL  GSMGS    Q+
Sbjct  235   DGIPPVYPVGPVIDLDDGQAHSNLDQAQRDRIINWLDDQPQKSVVFLCFGSMGSFRAEQV  294

Query  883   REIATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVP  1056
             +EIA GLE++G RFLWS+R P PK ++  P+D ++L+ VLP GF +RT GK G++CGW P
Sbjct  295   KEIALGLEQSGQRFLWSLRMPSPKGRV--PSDCSNLEEVLPDGFLERTNGKKGLICGWAP  352

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV +LAH A GGF+SHCGWNSILE+L HGVPI TWP+YAEQ LNAF+MV+ELG+A+E+  
Sbjct  353   QVEVLAHSATGGFLSHCGWNSILESLWHGVPIATWPMYAEQQLNAFRMVRELGMALEMRL  412

Query  1237  DYKDG-ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DYK G   +V A+++ER V  +M+ D EVR+K++E  +M ++     GSS  S+G+ IE+
Sbjct  413   DYKRGSADVVGADEIERAVVGVMEKDSEVRKKLEEMGKMARKAVKDGGSSFGSVGRFIED  472



>ref|XP_006373643.1| hypothetical protein POPTR_0016s01870g [Populus trichocarpa]
 gb|ERP51440.1| hypothetical protein POPTR_0016s01870g [Populus trichocarpa]
Length=481

 Score =   392 bits (1008),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 215/483 (45%), Positives = 305/483 (63%), Gaps = 23/483 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ TP I +LV  VE +KLL  +++ LS+T L++ +   P I  +I+S+++  
Sbjct  1     MKKAELVFIPTPGISHLVSTVEVAKLLVDRDERLSITFLIMKLRSDPKIDRFINSVSTAC  60

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAGF  351
             N + F+ LP  EP  P+Q R    FL   IE  +PHV   + KL      S D   +AGF
Sbjct  61    NRIRFIDLPKDEP-DPNQPRK---FLFSLIEAQKPHVTEEVCKLVSQSESSPDSPSLAGF  116

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVI  528
              +DMFCTS IDVA E  +P Y++  S A+FL    ++  L D +    +E+  +  E V+
Sbjct  117   VLDMFCTSMIDVANEFGVPSYIFLTSGAAFLGLQFYVQALHDDRKVDPTEYKGSDVELVM  176

Query  529   PGFENPVPVESFPPFMSKRHEDTYLP-FLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             P   NP+P +  P  M  +    +LP  L  A+R+RET+G+++NTF+ELES+ + S   G
Sbjct  177   PCLANPLPAKVLPSVMLNKE---WLPNMLSQARRFRETKGIIINTFEELESHAINSFSKG  233

Query  706   NDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
             N   PVYP+GP+++         +S   + + +WLD+Q  SSVV+L  GSMGS    Q++
Sbjct  234   NS-PPVYPVGPILNLNRDGDREEESDKRKDIKQWLDDQPLSSVVYLCFGSMGSFGVDQVK  292

Query  886   EIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             EIA GLE++G+RFLWS+R+PP K K++ P+DYT+   VLP GF DRT   G + GW PQ 
Sbjct  293   EIACGLEQSGHRFLWSLRQPPPKGKIEPPSDYTNPREVLPEGFLDRTANIGKIIGWAPQT  352

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              ILAH ++ GFVSHCGWNSILE++  GVPI  WP+YAEQ LNAFQ++ ELGL VEI  DY
Sbjct  353   DILAHPSVRGFVSHCGWNSILESIWFGVPIAAWPLYAEQQLNAFQIIVELGLGVEIKMDY  412

Query  1243  K-----DGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKL  1404
             +     DG   ++SA ++ERGVR LM+  DE RE++KE S   K+     GSS   LG+ 
Sbjct  413   RREFISDGNENVISAGEIERGVRCLMELCDEKRERLKEMSGKGKKALENGGSSFTWLGRF  472

Query  1405  IEE  1413
             I++
Sbjct  473   IQD  475



>ref|XP_007215333.1| hypothetical protein PRUPE_ppa005277mg [Prunus persica]
 gb|EMJ16532.1| hypothetical protein PRUPE_ppa005277mg [Prunus persica]
Length=469

 Score =   392 bits (1006),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 206/473 (44%), Positives = 304/473 (64%), Gaps = 13/473 (3%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             + A++VF+  P +G++V  +E +K L  ++  L +T+L++ +P   L  +   S++    
Sbjct  3     RPAQLVFIPAPGVGHIVSTIEIAKQLVARDDQLFITILIMKLPFDKLFTNTDPSISH--R  60

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDD-DVRIAGFFVDMFC  369
             + F++LP +   +  Q  +  SF+  +++ H+ HV+ A+TKL ++     +AGF +DMFC
Sbjct  61    ISFVNLPESHIDT--QGLAFTSFIKTFVQGHKTHVKEAVTKLLAESAQAELAGFVIDMFC  118

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENP  546
             T  I+VA+E  IP YL+F S A+ L F   + +L D Q    +E      E ++P F NP
Sbjct  119   TPMINVADEFQIPSYLFFTSGAAGLGFWFQLQSLHDEQGKDVAEITGWDSELIVPSFINP  178

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP   +P  M ++   T   F+  A R+R+T+G+++NTF+ELE + L S+  G    PVY
Sbjct  179   VPAGIWPGMMREKKGAT--DFIDFAARFRQTKGILINTFRELEPHALRSLSDGK-FPPVY  235

Query  727   PIGPVVD-REGPARWHPD-SWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             P+GP+++ +        D S     +++WLD+Q  SSVVFL  GSMGS   AQ++EIA  
Sbjct  236   PVGPLLNLKSDDGHVGSDQSIQKSDILEWLDDQPPSSVVFLCFGSMGSFGEAQVKEIACA  295

Query  901   LERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE++G RFLWS+R+P PK K+ +P+DY D+  VL  GF DRT G G V GW PQV ILAH
Sbjct  296   LEKSGQRFLWSLRKPEPKGKVGMPSDYADVKGVLHEGFLDRTAGIGKVIGWAPQVAILAH  355

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-DGI  1254
              ++GGFVSHCGWNS LE+L  GVPI TWP+YAEQ LNAF +VK+LGL VEI  DYK D  
Sbjct  356   PSVGGFVSHCGWNSTLESLWCGVPIATWPMYAEQQLNAFALVKDLGLGVEIKMDYKQDSE  415

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +VSAE++ERG+R++M+ D ++R +VKE SE  K+     GSS  SLG+ +++
Sbjct  416   VVVSAEEIERGIRQVMEKDSDIRARVKEISEKSKKALTDGGSSYSSLGRFLDQ  468



>ref|XP_002265389.2| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 isoform X1 
[Vitis vinifera]
Length=470

 Score =   392 bits (1006),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 205/473 (43%), Positives = 304/473 (64%), Gaps = 16/473 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M+Q ++VF+  P IG+L   +E +KL++ ++   S+T+ ++  P         D + +D 
Sbjct  1     MEQTELVFIPFPIIGHLASALEIAKLITKRDPRFSITIFIMKFPF-----GSTDGMDTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S  +   +  F S +++ H P VR A+ +L   + VR++GF +DMF
Sbjct  56    DSIRFVTLPPVEVSS--ETTPSGHFYSEFLKVHIPLVRDAVHELTRSNSVRLSGFVIDMF  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+F+S A+ L F+LH+  L D +    +EF D+  E  +P   N
Sbjct  114   CTHMIDVADEFGVPSYLFFSSGAAVLGFLLHVQFLHDYEGLDINEFKDSDAELDVPTLVN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP +M  +        L H +R+RE +G++VNTF ELES+ + S+  G+ V  V
Sbjct  174   SVPGKVFPAWMFDKVSGGAEMLLYHTRRFREVKGILVNTFIELESHAIQSL-SGSTVPEV  232

Query  724   YPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             YP+GP+++ R G      D+     +M WLD+Q  SSV+FL  GSMGS    QI+EIA G
Sbjct  233   YPVGPILNTRMGSGGGQQDA---STIMSWLDDQPPSSVIFLCFGSMGSFGADQIKEIAYG  289

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE +G+RFLWS+R+ P K K++  + Y +++ VLP GF  RT   G V GW PQ+ +LAH
Sbjct  290   LEHSGHRFLWSLRQSPQKGKMEFSSGYENIEEVLPEGFLHRTARIGKVIGWAPQIAVLAH  349

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGI  1254
              A+GGFVSHCGWNS+LE++ +GVP+ TW +YAEQ +NAFQMVK+LGLA+EI  DY KD  
Sbjct  350   SAVGGFVSHCGWNSLLESIWYGVPVATWSMYAEQQINAFQMVKDLGLAIEIKIDYNKDSD  409

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +VSA ++E G+R LM+ + EVR+K KE  ++ ++V +  GSS  SLG+ IEE
Sbjct  410   YVVSAHEIENGLRNLMNINSEVRKKRKEMKKISRKVKIDGGSSHFSLGRFIEE  462



>ref|XP_002266044.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 [Vitis vinifera]
Length=475

 Score =   392 bits (1007),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 216/480 (45%), Positives = 302/480 (63%), Gaps = 22/480 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASD  186
             MK+ + VF+  P IG+LVP VE +KLL  ++   S+T+L++ +P    ++ +++ S+++ 
Sbjct  1     MKKVEFVFIPLPLIGHLVPTVELAKLLVDRDDRFSITLLIMKLPIGNSVVTNFLHSVSAS  60

Query  187   --GNLEFLSLPAAEPPSPDQNRSTIS-----FLSIWIENHEPHVRRALTKL-KSDDDVRI  342
               G++ F+ LP  EP S   N    S     F+   IEN +P VR A+ +L +S +  R+
Sbjct  61    VSGSIRFVHLP--EPGSDSSNSDPSSSSRGPFVHNLIENQKPLVRDAVHQLVQSGESGRL  118

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKE  519
              G  VD+ CTS IDVA EL +P Y++F   A+ L+ + H+ TL D Q    +EFGD+  E
Sbjct  119   GGIVVDLTCTSMIDVANELGVPSYVFFTCSAALLALIFHLQTLKDHQGVDVTEFGDSDIE  178

Query  520   YVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF  699
              V+PGF N VP    P     +       FL   +R+RET+G++VNTF ELES+ + S F
Sbjct  179   LVVPGFVNSVPARVLPAAAVDKEGGGSTVFLDRPRRFRETKGILVNTFIELESHAINS-F  237

Query  700   GGNDVGPVYPIGPVVDREGPARWHPDSWNHEL-VMKWLDNQLSSSVVFLTTGSMGSLNPA  876
             G     PVYP+GP+++ +          N EL V+ WLD+Q  SSVVFL  GS+G+ N  
Sbjct  238   GNGTTPPVYPVGPLLNLK-------HDQNRELDVIHWLDDQPPSSVVFLCFGSLGAFNKG  290

Query  877   QIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             QI EIA GLE +G+RF+W++R PP       +DYTD D VLP GF +RT G G + GW P
Sbjct  291   QIMEIANGLENSGFRFVWTLRGPPPKDDIASSDYTDFDEVLPKGFLNRTFGVGKIIGWAP  350

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             Q  IL+H AIGGF+SHCGWNSILE++ +GVPI TWP+ AEQ LNAFQMV+ELG+A+EI  
Sbjct  351   QTDILSHHAIGGFISHCGWNSILESIWYGVPIATWPMDAEQQLNAFQMVRELGIAIEIKL  410

Query  1237  DYKDGIT-LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             D K  ++ LV+A++VE  ++ LMD   +V+ K KE  E C +  MK GSS   L  LIE+
Sbjct  411   DNKKNVSDLVNAQEVESKIKSLMDNSSDVKRKGKEMREKCVQALMKGGSSHNYLQCLIED  470



>ref|XP_008365187.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like isoform 
X1 [Malus domestica]
Length=488

 Score =   392 bits (1008),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 219/486 (45%), Positives = 306/486 (63%), Gaps = 28/486 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP---QRPLIQ--SYIDS  174
             M ++++VFV TPT+G+LV  +EFSK L       SVT+L++         LI   S   S
Sbjct  1     MNRSELVFVPTPTVGHLVSTIEFSKRLLDCCDKFSVTILVMESAFESSTTLISNPSTTQS  60

Query  175   LA-SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGF  351
             LA S  +++ + LP+   P     +S   +L+++IEN++ HVR A+      +   ++G 
Sbjct  61    LAASHAHIKIVDLPSVHRPLEILQQSVEKYLTVFIENYKCHVRDAIANHVLPNS-SVSGL  119

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
              VDMFCTS IDVA EL +P YL+F S A FL  +LH+P    ++     F  +  E V+P
Sbjct  120   VVDMFCTSMIDVAYELKVPSYLFFTSGAGFLGLLLHLPGRYDRL--GMVFKPSDPESVVP  177

Query  532   GFENPVPVESFPPFMSKRHEDT-YLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG-  705
              + NPVP    P F    +EDT Y  F  HA+R++ET+G++VNTF ELES+ + S+    
Sbjct  178   SYANPVPANVLPSFA---YEDTGYSCFANHARRFKETKGIIVNTFFELESHAVSSLLDCE  234

Query  706   NDVGPVYPIGPVVDREGPARWHP-DSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
              ++ PVY +GP++   G     P D      +M WLD+Q   SVVFL  GS GS + AQ+
Sbjct  235   TEIPPVYTVGPLI---GEHHVKPSDRAKFGKIMTWLDDQPPKSVVFLCFGSSGSFDEAQL  291

Query  883   REIATGLERAGYRFLWSIRE-PPKSKLDLPN-------DYTDLDHVLPPGFSDRTKGKGM  1038
             REIA GLE++G +FLWS+R+ PPK +L  P        +Y++ +  LP GF +RTK  G+
Sbjct  292   REIAVGLEKSGKKFLWSVRKAPPKGQLXTPGLENVMTGEYSNYEKFLPQGFLERTKDVGI  351

Query  1039  VCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGL  1218
             +CGW PQV +LAHKA GGFVSHCGWNSI E+L HGVPI TWP+YAEQ +NAFQMVK+LGL
Sbjct  352   LCGWAPQVEVLAHKATGGFVSHCGWNSISESLWHGVPIVTWPLYAEQQINAFQMVKDLGL  411

Query  1219  AVEITFDYKD--GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVS  1392
             AVE+  DY+   G   V A+++E+ VR +MDGD  VR++V+E SE+C++     GSS+ S
Sbjct  412   AVELRLDYRTDGGNHFVVADEIEKAVRCVMDGDGAVRKRVEEMSEVCRKAVGDGGSSSTS  471

Query  1393  LGKLIE  1410
                LI+
Sbjct  472   FQHLIK  477



>gb|KCW88565.1| hypothetical protein EUGRSUZ_A00945 [Eucalyptus grandis]
Length=483

 Score =   392 bits (1007),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 207/482 (43%), Positives = 307/482 (64%), Gaps = 19/482 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M  A++V V TP +G+LV +VE +KLL  ++  LS+TVL++ +P    + SY  SLA+  
Sbjct  1     MAYAELVLVPTPGMGHLVSMVEMAKLLVDRDPRLSITVLIMKLPIDSEVDSYTSSLATSM  60

Query  190   N---LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV--RIAGFF  354
             +   + F+ LP     +P+ +  T  FL+ ++E+++PHV++A+  L        R+ GF 
Sbjct  61    DATRIRFVHLPRVGVSNPEISSGT--FLAHFMESNKPHVKQAVADLTESAGSIRRLVGFV  118

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFC++ I++A+E  +P Y++F S A+FL  MLH+ +L D Q    ++F D+  E   P
Sbjct  119   IDMFCSTMIELADEFGVPSYVFFTSSAAFLGLMLHLQSLQDEQHMDITKFKDSDTELDFP  178

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
              F NP+P +  P  +  +  +    FL+HAKR R  +G+++NTF ELE + +GS+     
Sbjct  179   SFTNPLPAKVLPSVVLIK--EAVQSFLEHAKRIRAVKGIIINTFDELEPHAVGSL-ASLG  235

Query  712   VGPVYPIGPVVDREGPARWHPDSWNH-ELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                VYP+GP+++ +G  +   D     + +M+WL+ Q  SSVVFL  GS GS    Q++E
Sbjct  236   APTVYPVGPILNLKGETKTKADGGGRGDDIMEWLNEQPPSSVVFLCFGSGGSFGEDQVKE  295

Query  889   IATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA  LER+G+RFLWS+R PP K K DLP DYTD   VLP GF +RT G G V GW PQ  
Sbjct  296   IAYALERSGHRFLWSLRRPPPKGKFDLPRDYTDPAEVLPEGFLERTAGVGKVIGWAPQNA  355

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAH A+GGFVSHCGWNS LE++  GV + TWP+YAEQ  NAF++V ELGLAVEI  +Y+
Sbjct  356   VLAHPAVGGFVSHCGWNSTLESIWFGVAVATWPLYAEQQFNAFELVAELGLAVEIKMNYR  415

Query  1246  DGITL-----VSAEDVERGVRKLM-DGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                 +     V+A+++E G++KLM D   E  +KVK+ SE  ++  M+ GSS ++LG L+
Sbjct  416   RDFRMESDFIVTADEIEGGIKKLMEDASSERWKKVKDVSEKSRKALMEGGSSHLALGHLV  475

Query  1408  EE  1413
             E+
Sbjct  476   ED  477



>ref|XP_010657838.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2 isoform X2 
[Vitis vinifera]
Length=470

 Score =   392 bits (1006),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 205/473 (43%), Positives = 304/473 (64%), Gaps = 16/473 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M+Q ++VF+  P IG+L   +E +KL++ ++   S+T+ ++  P         D + +D 
Sbjct  1     MEQTELVFIPFPIIGHLASALEIAKLITKRDPRFSITIFIMKFPF-----GSTDGMDTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S  +   +  F S +++ H P VR A+ +L   + VR++GF +DMF
Sbjct  56    DSIRFVTLPPVEVSS--ETTPSGHFYSEFLKVHIPLVRDAVHELTRSNSVRLSGFVIDMF  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+F+S A+ L F+LH+  L D +    +EF D+  E  +P   N
Sbjct  114   CTHMIDVADEFGVPSYLFFSSGAAVLGFLLHVQFLHDYEGLDINEFKDSDAELDVPTLVN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP +M  +        L H +R+RE +G++VNTF ELES+ + S+  G+ V  V
Sbjct  174   SVPGKVFPAWMFDKVSGGAEMLLYHTRRFREVKGILVNTFIELESHAIQSL-SGSTVPEV  232

Query  724   YPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             YP+GP+++ R G      D+     +M WLD+Q  SSV+FL  GSMGS    QI+EIA G
Sbjct  233   YPVGPILNTRMGSGGGQQDA---STIMSWLDDQPPSSVIFLCFGSMGSFGADQIKEIAYG  289

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE +G+RFLWS+R+ P K K++  + Y +++ VLP GF  RT   G V GW PQ+ +LAH
Sbjct  290   LEHSGHRFLWSLRQSPQKGKMEFSSGYENIEEVLPEGFLHRTARIGKVIGWAPQIAVLAH  349

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGI  1254
              A+GGFVSHCGWNS+LE++ +GVP+ TW +YAEQ +NAFQMVK+LGLA+EI  DY KD  
Sbjct  350   SAVGGFVSHCGWNSLLESIWYGVPVATWSMYAEQQINAFQMVKDLGLAIEIKIDYNKDSD  409

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +VSA ++E G+R LM+ + EVR+K KE  ++ ++V +  GSS  SLG+ IEE
Sbjct  410   YVVSAHEIENGLRNLMNINSEVRKKRKEMKKISRKVKIDGGSSHFSLGRFIEE  462



>ref|XP_004304514.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   392 bits (1008),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 211/497 (42%), Positives = 315/497 (63%), Gaps = 38/497 (8%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M++A++VFV TP +G+LV  +EF+  L  Q    SVT+L++  P        + + AS  
Sbjct  1     MERAELVFVPTPAVGHLVSAIEFAIRLLDQCHRFSVTILVMKSPFGVTGDQSLPA-ASHT  59

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
             +++F+ LP  +PP+  +  S   +L+ +IEN++ HVR  +      +  ++AG  VDMFC
Sbjct  60    HIKFIHLPNVDPPT--ELVSAKKYLTDYIENYKSHVRDTIFNRVLPNTSQVAGMVVDMFC  117

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
             T+ ID+A EL +P +++F S A++L  +L+ P    ++     F ++  E +IP + +PV
Sbjct  118   TTMIDIANELKVPSFIFFTSGAAYLGLLLYHPKGVGKL-----FDESDCESIIPSYIHPV  172

Query  550   PVESFPPFM------------SKRHEDT----------YLPFLQHAKRYRETRGVVVNTF  663
             P  + P F             ++R  D           Y+ F+ HA+R+ ET+G++VNTF
Sbjct  173   PTNALPAFAFNYGGYMSFVNHARRFMDALPAFAFNYGGYMSFVNHARRFMETKGIIVNTF  232

Query  664   KELESYCLGSMFGGND-----VGP-VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLS  825
              ELES  + S+F GN+     + P VY IGP++D +G  +   +    + +MKWLD+Q  
Sbjct  233   VELESQAVHSLFDGNENYQSKLHPQVYKIGPLIDIKGRYQVQSNQAKVDKIMKWLDDQPP  292

Query  826   SSVVFLTTGSMGSLNPAQIREIATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLP  1002
              SVVFL  GS GS + +Q++EIA GLE++G RFLWS+R+ PP   L +P +YT+ +  LP
Sbjct  293   KSVVFLCFGSSGSFDESQLKEIAIGLEQSGQRFLWSVRQSPPTGTLAMPGEYTNYEDFLP  352

Query  1003  PGFSDRTKGKGMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQH  1182
             P FS RTKG GM+CGW PQ  +L HKAIGGFVSHCGWNSILE+L  GVPI TWPIYAEQ 
Sbjct  353   PDFSKRTKGIGMLCGWAPQAEVLGHKAIGGFVSHCGWNSILESLWFGVPIVTWPIYAEQQ  412

Query  1183  LNAFQMVKELGLAVEITFDY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKR  1359
             +NAFQM ++LGL +E+   Y KDG   V+A++++R +R+LM+GD E+R++V+E S +C++
Sbjct  413   INAFQMARDLGLGMELRVVYKKDGADFVTADEIKRALRRLMEGDGEIRKRVQEMSGICRK  472

Query  1360  VWMKNGSSAVSLGKLIE  1410
                  GSS+ S G LIE
Sbjct  473   AVADGGSSSASFGSLIE  489



>ref|XP_006429785.1| hypothetical protein CICLE_v10013653mg [Citrus clementina]
 gb|ESR43025.1| hypothetical protein CICLE_v10013653mg [Citrus clementina]
Length=476

 Score =   392 bits (1006),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 203/481 (42%), Positives = 311/481 (65%), Gaps = 23/481 (5%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLL--------SHQNQNLSVTVLLINMPQRPLIQS  162
             + ++A++VF+ +P++G+LV ++ F+K L        +  N + S+TVL++         +
Sbjct  1     MKEKAELVFIPSPSVGHLVSLIVFAKRLLLLDRDNAAGSNNSFSITVLVMQ-EHTSDNDA  59

Query  163   YIDSLASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRI  342
             +I SLA  G     +    +PP  D  +S   F++ ++++H+  ++ A+ +   +++V+I
Sbjct  60    HIKSLAGAG-----ATADMDPPPRDYFKSPEKFITEYVDSHKDCIKEAIIEHVLNNNVKI  114

Query  343   AGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEY  522
             AG  +D FC+S ID A EL +P Y++F S A+FL F+LH+PT   +  + SE  D+A  +
Sbjct  115   AGLVLDFFCSSMIDTANELGVPSYVFFTSGAAFLGFVLHLPTRGGEEFEESE-TDSADIF  173

Query  523   VIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG  702
                 + NPVP    P     +H   +  F    +R++ET+G++VNTF+ELES+ +  +  
Sbjct  174   T---YANPVPYRVLPSLCFNKH-GGFSAFENFGRRFKETKGIIVNTFEELESHAVEYLMK  229

Query  703   GNDVGPVYPIGPVVDREGPARWHPDSWNHE--LVMKWLDNQLSSSVVFLTTGSMGSLNPA  876
              + V PVY +GP++D  G     P     +   +++WLD+Q +SSVVFL  GSMGS    
Sbjct  230   CDGVPPVYSVGPMIDLHGDIHARPGGGGTQGDEIIRWLDDQPASSVVFLCFGSMGSFGEE  289

Query  877   QIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWV  1053
             QI+EIA+GLE++G RFLWS+R+PP K + ++P +YT ++ +LP GF +R+KG+GM+CGW 
Sbjct  290   QIQEIASGLEKSGVRFLWSLRKPPPKDRPEMPGEYTCVEDILPRGFQERSKGRGMICGWA  349

Query  1054  PQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT  1233
             PQ  +LAH AIGGFVSHCGWNSILE++  GVPI TWPIYAEQ +NAFQMV++LGLAVE+ 
Sbjct  350   PQKEVLAHSAIGGFVSHCGWNSILESVWFGVPIVTWPIYAEQQINAFQMVRDLGLAVELR  409

Query  1234  FDYKDGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
              DY+ G    V A+++ R V  +MDGD EVR++VKE SE  +      GSS  + G+LIE
Sbjct  410   LDYRRGTENHVLADELARAVGCVMDGDSEVRKRVKEVSEKARLALRDGGSSYAATGRLIE  469

Query  1411  E  1413
             +
Sbjct  470   D  470



>ref|XP_007016125.1| Glycosyltransferase, putative [Theobroma cacao]
 gb|EOY33744.1| Glycosyltransferase, putative [Theobroma cacao]
Length=475

 Score =   392 bits (1006),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 212/477 (44%), Positives = 304/477 (64%), Gaps = 16/477 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             MK+ +++FV  P IG+L   +EF+K L H +  + +T+L +       + +Y  SL +  
Sbjct  1     MKKIELIFVPIPGIGHLASTIEFAKRLIHHDDRIWITILSMTWFSPAFVDAYTKSLDASR  60

Query  187   -GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL----KSDDDVRIAGF  351
                ++ + LP  +PPS D  +S   ++  +IE++ P VR A+  +     S    R+AG 
Sbjct  61    PDRIQLIDLPQVDPPSFDLLKSPEGYIYAFIESYIPAVRNAVRNIVSLESSSGSGRVAGL  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
              +D+FC    D+A EL +P Y+Y  S A+FLS ML++PT   Q   +SEF     E +IP
Sbjct  121   VLDLFCAPMTDIAAELGLPSYIYLTSNAAFLSLMLYLPTRHNQ--NSSEFEITDPEQLIP  178

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
             GF NPVPV   P  +  ++   Y  F++ A+R ++ +G++VNTF+++E   L     G +
Sbjct  179   GFVNPVPVCVLPSPVFNKY-GGYTTFIKVAERLKDAKGIMVNTFEDIEPSALNYFLNGPN  237

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
               P+YP+GPV+D +       D      VM WLD+Q  SSV+FL  GSMGS    Q++EI
Sbjct  238   -PPIYPVGPVIDLKALPHPELDLDQRNKVMTWLDDQPQSSVIFLCFGSMGSFGAPQVQEI  296

Query  892   ATGLERAGYRFLWSIR--EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             A GLE++GYRFLWS+R   P +S   L +  T+    LP GF +R +G+GM+CGW PQV 
Sbjct  297   ALGLEQSGYRFLWSLRFSSPLQSDAALLDKNTE--ETLPEGFLERIQGRGMICGWAPQVE  354

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LA+KAIGGFVSH GWNSILE+L  GVPI TWP+YAEQ LNA+ M KELGLAV +  DY+
Sbjct  355   VLANKAIGGFVSHSGWNSILESLWFGVPIVTWPMYAEQQLNAYLM-KELGLAVVMRLDYR  413

Query  1246  DGIT-LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              G + LV A++VE+GVR +MDG  EVR+KVKE +EM ++  MK+GSS +S+G+LIE+
Sbjct  414   LGTSDLVMADEVEKGVRLVMDGGSEVRKKVKEMAEMARKSVMKDGSSFISMGRLIED  470



>ref|XP_006481379.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Citrus sinensis]
Length=499

 Score =   392 bits (1008),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 211/491 (43%), Positives = 308/491 (63%), Gaps = 35/491 (7%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ +P  G+LV  VE ++LL  ++  LSVTVL++ +P    + +Y  SLA+  
Sbjct  15    MKKAQLVFIPSPGAGHLVSTVEVARLLVDRDDRLSVTVLIMKLPHDNTVAAYTQSLAASN  74

Query  190   ---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFF  354
                 ++F++LP  +P    ++     F   ++E+ +PHV+  +  L  +S D  R+AGF 
Sbjct  75    LSSRIKFINLPDDQPDK--ESTPPKRFFGHFVESKKPHVKEVVANLTDESPDSPRLAGFV  132

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFCT  I+VA+E  +P YL+F S A+FL FML +  L D +    +E  D+     +P
Sbjct  133   LDMFCTCMIEVADEFKVPSYLFFTSGAAFLGFMLRVQALHDEENTTITELKDSDAVLEVP  192

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG-N  708
             G  N VP + +P  +  +     L   Q A+ +R T+G++VNTF+ELES+ + S   G +
Sbjct  193   GLVNSVPAKVWPSVVFNKEWAEVLN--QQARTFRGTKGIMVNTFEELESHAVRSFSDGKS  250

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHEL----------VMKWLDNQLSSSVVFLTTGSM  858
                P+YP+GP+++ +G         N++L          +M WLD+Q  SSVVFL  GS 
Sbjct  251   KTPPLYPMGPILNIKGE--------NYDLGEGGADKKADIMAWLDDQPESSVVFLCFGSW  302

Query  859   GSLNPAQIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKG  1035
             GS    Q++EIA  LE++G+RFLWS+R PP K   + P+DY D   VLP GF DRT   G
Sbjct  303   GSFGEDQVKEIACALEQSGHRFLWSLRRPPSKDTFEKPSDYEDPTEVLPEGFMDRTANIG  362

Query  1036  MVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELG  1215
              V GW PQ+ +LAH AIGGFVSHCGWNS LE++  GVPI TWP+YAEQ  NAF++V ELG
Sbjct  363   KVIGWAPQIAVLAHPAIGGFVSHCGWNSTLESIWFGVPIATWPMYAEQQFNAFELVVELG  422

Query  1216  LAVEITFDYKDGI-----TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGS  1380
             LAVEI  DY+  I     T+V+AE++ERG+R LM+ + E+R++VKE SE  ++     GS
Sbjct  423   LAVEIKMDYRKDILMENPTVVNAEEIERGIRCLMEHNSEMRKRVKEMSEKARKALSDGGS  482

Query  1381  SAVSLGKLIEE  1413
             S  S+G+LI++
Sbjct  483   SFSSMGRLIDD  493



>gb|KDO64385.1| hypothetical protein CISIN_1g045029mg [Citrus sinensis]
Length=485

 Score =   392 bits (1006),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 211/491 (43%), Positives = 308/491 (63%), Gaps = 35/491 (7%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ +P  G+LV  VE ++LL  ++  LSVTVL++ +P    + +Y  SLA+  
Sbjct  1     MKKAQLVFIPSPGAGHLVSTVEVARLLVDRDDRLSVTVLIMKLPHDNTVATYTQSLAASN  60

Query  190   ---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFF  354
                 ++F++LP  +P    ++     F   ++E+ +PHV+  +  L  +S D  R+AGF 
Sbjct  61    LSSRIKFINLPDDQPDK--ESTPPKRFFGHFVESKKPHVKEVVANLTDESPDSPRLAGFV  118

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFCT  I+VA+E  +P YL+F S A+FL FML +  L D +    +E  D+     +P
Sbjct  119   LDMFCTCMIEVADEFKVPSYLFFTSGAAFLGFMLRVQALHDEENTTITELKDSDAVLEVP  178

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG-N  708
             G  N VP + +P  +  +     L   Q A+ +R T+G++VNTF+ELES+ + S   G +
Sbjct  179   GLVNSVPAKVWPSVVFNKEWAEVLN--QQARTFRGTKGIMVNTFEELESHAVRSFSDGKS  236

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHEL----------VMKWLDNQLSSSVVFLTTGSM  858
                P+YP+GP+++ +G         N++L          +M WLD+Q  SSVVFL  GS 
Sbjct  237   KTPPLYPMGPILNIKGE--------NYDLGEGGADKKADIMAWLDDQPESSVVFLCFGSW  288

Query  859   GSLNPAQIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKG  1035
             GS    Q++EIA  LE++G+RFLWS+R PP K   + P+DY D   VLP GF DRT   G
Sbjct  289   GSFGEDQVKEIACALEQSGHRFLWSLRRPPSKDTFEKPSDYEDPTEVLPEGFMDRTANIG  348

Query  1036  MVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELG  1215
              V GW PQ+ +LAH AIGGFVSHCGWNS LE++  GVPI TWP+YAEQ  NAF++V ELG
Sbjct  349   KVIGWAPQIAVLAHPAIGGFVSHCGWNSTLESIWFGVPIATWPMYAEQQFNAFELVVELG  408

Query  1216  LAVEITFDYKDGI-----TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGS  1380
             LAVEI  DY++ I     T+V+AE +ERG+R LM+ + E+R++VKE SE  ++     GS
Sbjct  409   LAVEIKMDYRNDIMIENPTVVNAEVIERGIRCLMEHNSEMRKRVKEMSEKARKALSDGGS  468

Query  1381  SAVSLGKLIEE  1413
             S  S+G+LI++
Sbjct  469   SFSSMGRLIDD  479



>ref|XP_008393866.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Malus domestica]
Length=472

 Score =   391 bits (1005),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 214/482 (44%), Positives = 296/482 (61%), Gaps = 24/482 (5%)
 Frame = +1

Query  7     IMKQAKVVFVSTP-TIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS  183
             + + A++VFV  P  IG++VP VE +K L  ++  L +TVL++ +P     Q + ++ +S
Sbjct  1     MKRPAQLVFVPAPGIIGHMVPTVEMAKQLVARDDQLFITVLVMKLP---YAQPFTNTDSS  57

Query  184   -DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV-------R  339
                 ++F++LP A+    D   +  SFL + +ENH  HVR A+  L  + D        R
Sbjct  58    ISHRIDFVNLPEAQSDKQDTVPNPGSFLRMLVENHTSHVRDAVINLLPESDQSESTSKPR  117

Query  340   IAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAK  516
             +AGF +DMFC S +DVA E  +P YL+F S AS L+   H  +L D      +E   +  
Sbjct  118   LAGFVLDMFCASLMDVANEFKVPSYLFFTSNASTLALXFHFQSLXDEGGIDITELTSSTA  177

Query  517   EYVIPGFENPVPVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGS  693
             E  +P F NP P    P  F+ K    T    L    R+++T+G++VNTF ELES  L  
Sbjct  178   ELAVPSFXNPYPASVLPGSFLDKESTKT---ILDSVNRFKQTKGILVNTFMELESPALHY  234

Query  694   MFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNP  873
             +  G+ + PVYP+GP+++ +       D      +++WLD+Q   SVVFL  GSMGS   
Sbjct  235   LDSGDKIPPVYPVGPLLNLKSS-----DEDKVSDILRWLDDQPPFSVVFLCFGSMGSFGE  289

Query  874   AQIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGW  1050
             AQ+ EIA  LE +G+RFLWS+R PP K K  +P+DY D   VLP GF DRT   G V GW
Sbjct  290   AQVNEIACALEHSGHRFLWSLRRPPPKGKRAMPSDYEDPKAVLPEGFLDRTATVGKVIGW  349

Query  1051  VPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEI  1230
              PQ  IL H A G FVSHCGWNS LE+L +GVPI  WP+YAEQ+LNAFQ+VKELGL+VEI
Sbjct  350   APQAAILGHPATGAFVSHCGWNSTLESLWNGVPIAAWPMYAEQNLNAFQLVKELGLSVEI  409

Query  1231  TFDY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
               DY KD   +VSAED+ERG+R++M+ D +VR++VKE SE  K+  +  GSS  SLG+ I
Sbjct  410   KMDYRKDSDVVVSAEDIERGIRRVMELDSDVRKRVKEMSEKSKKALVDGGSSYSSLGRFI  469

Query  1408  EE  1413
             ++
Sbjct  470   DQ  471



>ref|XP_009371511.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=477

 Score =   391 bits (1005),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 212/479 (44%), Positives = 308/479 (64%), Gaps = 18/479 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VF+  P  G+LV  ++F+K L  ++  +S+T+L I       + SY  S+A S+
Sbjct  1     MKKVELVFIPAPGAGHLVSTLQFAKRLIGRDDRISITILAIQSYFPTTLSSYTKSIAASE  60

Query  187   GNLEFLSLPAAEP-PSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAG  348
               +  + +P  +  P  +  +S   F S++IE+H P V++ +T L      S D +R+A 
Sbjct  61    PRIRIIDVPQPQDRPPQEMYKSPAKFFSLYIESHVPGVKKIITNLVSSSANSSDSIRVAA  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               VD FC S ID+A+EL+IP YL+  S A +L+FMLH+  L  +     E  D   E+ I
Sbjct  121   LVVDFFCVSMIDMAKELNIPSYLFMTSNAGYLAFMLHLLILHEKNQIAVEESDP--EWSI  178

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             PG  +PVP    P  ++     TY+     A R RETRG++VNTF ELE++ + ++F  +
Sbjct  179   PGIVHPVPPRVLPVALTDDGGSTYIKL---ASRLRETRGIIVNTFVELETHAI-TLFSND  234

Query  709   D-VGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             D + PVYP+GPV+D  +G A  + D    + ++KWLD+Q   SVVFL  GSMGS    Q+
Sbjct  235   DGIPPVYPVGPVIDLDDGQAHSNLDQAQRDKIIKWLDDQPQKSVVFLCFGSMGSFRVEQV  294

Query  883   REIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVPQ  1059
             +EIA GLE++G RFLWS+R P   K  +P+D ++L+ VLP GF +RT GK G++CGW PQ
Sbjct  295   KEIALGLEQSGQRFLWSLRMP-SPKGTVPSDCSNLEEVLPDGFLERTNGKKGLICGWAPQ  353

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V ILAH A GGF+SHCGWNSILE+L HGVPI TWP+YAEQ LNAF+MV+E G+A+E+  D
Sbjct  354   VEILAHSATGGFLSHCGWNSILESLWHGVPIATWPMYAEQQLNAFRMVREFGMALEMRLD  413

Query  1240  YKDG-ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             YK G   +V A+++ER V  +M+ D EVR+KV++  +M ++     GSS  S+G+ IE+
Sbjct  414   YKRGSADVVGADEIERAVVGVMEKDGEVRKKVEKMGKMARKAVKGGGSSFASVGRFIED  472



>ref|XP_010045071.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
Length=482

 Score =   391 bits (1005),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 207/482 (43%), Positives = 307/482 (64%), Gaps = 20/482 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M  A++V V TP +G+LV +VE +KLL  ++  LS+TVL++ +P    + SY  SLA+  
Sbjct  1     MAYAELVLVPTPGMGHLVSMVEMAKLLVDRDPRLSITVLIMKLPIDSEVDSYTSSLATSM  60

Query  190   N---LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV--RIAGFF  354
             +   + F+ LP     + D   S+ +FL+ ++E+++PHV++A+  L        R+ GF 
Sbjct  61    DATRIRFVHLPRV---NSDPEISSGTFLAHFMESNKPHVKQAVADLTESAGSIRRLVGFV  117

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFC++ I++A+E  +P Y++F S A+FL  MLH+ +L D Q    ++F D+  E   P
Sbjct  118   IDMFCSTMIELADEFGVPSYVFFTSSAAFLGLMLHLQSLQDEQHMDITKFKDSDTELDFP  177

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
              F NP+P +  P  +  +  +    FL+HAKR R  +G+++NTF ELE + +GS+     
Sbjct  178   SFTNPLPAKVLPSVVLIK--EAVQSFLEHAKRIRAVKGIIINTFDELEPHAVGSL-ASLG  234

Query  712   VGPVYPIGPVVDREGPARWHPDSWNH-ELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                VYP+GP+++ +G  +   D     + +M+WL+ Q  SSVVFL  GS GS    Q++E
Sbjct  235   APTVYPVGPILNLKGETKTKADGGGRGDDIMEWLNEQPPSSVVFLCFGSGGSFGEDQVKE  294

Query  889   IATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA  LER+G+RFLWS+R PP K K DLP DYTD   VLP GF +RT G G V GW PQ  
Sbjct  295   IAYALERSGHRFLWSLRRPPPKGKFDLPRDYTDPAEVLPEGFLERTAGVGKVIGWAPQNA  354

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAH A+GGFVSHCGWNS LE++  GV + TWP+YAEQ  NAF++V ELGLAVEI  +Y+
Sbjct  355   VLAHPAVGGFVSHCGWNSTLESIWFGVAVATWPLYAEQQFNAFELVAELGLAVEIKMNYR  414

Query  1246  DGITL-----VSAEDVERGVRKLM-DGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                 +     V+A+++E G++KLM D   E  +KVK+ SE  ++  M+ GSS ++LG L+
Sbjct  415   RDFRMESDFIVTADEIEGGIKKLMEDASSERWKKVKDVSEKSRKALMEGGSSHLALGHLV  474

Query  1408  EE  1413
             E+
Sbjct  475   ED  476



>ref|XP_009350668.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
isoform X2 [Pyrus x bretschneideri]
Length=471

 Score =   391 bits (1004),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 212/478 (44%), Positives = 300/478 (63%), Gaps = 21/478 (4%)
 Frame = +1

Query  10    MKQA-KVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD  186
             MKQA ++VF+    IG+L    E +KLL  ++  L + VL + +P   L  ++    A D
Sbjct  1     MKQAAELVFIPAIGIGHLASAFEIAKLLVARDDRLFIIVLTMKLP---LESNFKLKGADD  57

Query  187   G-NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAG  348
                + F++LP     +   N     FL +++ENH+ HVR A+ KL     +SD   R+ G
Sbjct  58    AERIRFINLPEEAVETKGINL----FLKLFVENHKQHVRDAVAKLTSEPPQSDCKPRLVG  113

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYV  525
             F +DMFCT+ IDVA E  +P Y++F S A FL  +LH+ TL D Q    +E  ++  + V
Sbjct  114   FVIDMFCTTMIDVANEFGVPTYVFFTSGAGFLGLVLHLQTLHDEQNKDCTELKESDPDLV  173

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             +P   NP+P    P     +  D    F+ HA+R+RET+G++VNTF ELES+CL ++  G
Sbjct  174   LPCLVNPMPARVLPGVYLDK--DGATEFINHARRFRETKGILVNTFMELESHCLRALSDG  231

Query  706   NDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
                 P+YP+GPV++ +        +   E +++WLD+Q   SVVFL  GSMG     Q++
Sbjct  232   KP-PPLYPVGPVLNLKSDPEGSELAKKKE-ILEWLDDQSPLSVVFLCFGSMGCFGGDQVK  289

Query  886   EIATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             EIA  LE +G RFLWS+R+P PK +L   +DY D   VLP GF DRT G G V GW PQV
Sbjct  290   EIAAALEHSGLRFLWSLRQPLPKGELLFASDYADPSGVLPQGFLDRTAGTGKVIGWAPQV  349

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              +L H ++GGFVSHCGWNS LE+L +GVP+  WP+YAEQ LNAF++V+ELGLAVEI  DY
Sbjct  350   AVLGHPSVGGFVSHCGWNSNLESLWYGVPVAAWPVYAEQQLNAFELVRELGLAVEIKMDY  409

Query  1243  -KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              ++G  +V AE++ERG+R++M+ + E R+KVKE SE  +R  M  GSS  SLG+ I++
Sbjct  410   RREGEVVVRAEEMERGIREVMEVESEQRKKVKEMSEKSRRALMDGGSSHSSLGRFIDQ  467



>emb|CDP19044.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   390 bits (1003),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/476 (42%), Positives = 301/476 (63%), Gaps = 15/476 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA--S  183
             MK+ ++VFV +P +G+L   VE +KLL  +N++LS+TVL++  P    + S IDS    S
Sbjct  1     MKKPELVFVPSPGMGHLGSTVELAKLLIDRNEHLSITVLIMKFPFETKVGSSIDSQTEIS  60

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDM  363
             D  + FL L   E  S  Q  S+  F+  +IE+H+   R  L ++       +AG  +DM
Sbjct  61    DSRIRFLELKKDE--SASQTASSNLFMYQFIEDHKSSAREVLAEISDSASSDLAGVVIDM  118

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIPGFE  540
             FC+S IDVA E  +P Y+++ S A+ L  +LH+ +L     ++ + + ++  E  +P + 
Sbjct  119   FCSSMIDVANEFGVPSYVFYTSGAAMLGLILHLQSLRDDFGEDVTNYENSKVELAVPTYI  178

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             NPVPV+  P  +  +     + FL  AKRYRET+G+V+N+F +LE + + ++     + P
Sbjct  179   NPVPVKVLPSRLFDKEGGGNM-FLNLAKRYRETKGIVINSFLQLECHAIQALSNDKTIPP  237

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VYP+GP+++ +G    + ++   +++ KWLD Q  SSVVFL  GS G  +  Q++EIA  
Sbjct  238   VYPVGPILNHKGRNGQNQET---DMITKWLDIQPDSSVVFLCFGSGGWFDGEQVKEIAYA  294

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             L R+GYRFLWS+R PP K K + P DY +L+ VLP GF  RT   G V GW PQ  +L+H
Sbjct  295   LGRSGYRFLWSLRRPPPKGKFEFPGDYENLEEVLPEGFLQRTAEVGKVIGWAPQAAVLSH  354

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGI-  1254
              A+GGFVSHCGWNS LE++ HGVPI TWP+YAEQ +NAFQM+K+LG+AVEI  D+K+ I 
Sbjct  355   PAVGGFVSHCGWNSTLESVWHGVPIATWPLYAEQQVNAFQMLKDLGMAVEIKMDFKNTIR  414

Query  1255  ----TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
                  +V+A+ +E+ ++ LMD ++E+R+KVKE  E  +      GSS+  LG+ ++
Sbjct  415   EASTEIVAADLIEKAIKHLMDPENEIRKKVKEMKEKSRLTLNGEGSSSALLGRFLD  470



>dbj|BAI65912.1| UDP-sugar:glycosyltransferase [Forsythia x intermedia]
Length=468

 Score =   390 bits (1001),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 306/473 (65%), Gaps = 16/473 (3%)
 Frame = +1

Query  4     AIMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS  183
             A  K++++VF+  P IG+L+  +E +KLL+ ++++LS+TVL++ +P      SY  S  S
Sbjct  2     AETKKSELVFIPAPGIGHLISTIELAKLLTDRDEHLSITVLILKLPMESKTDSY--SQKS  59

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDD--VRIAGFFV  357
             +  + F+ L   +P +P+      +F++ +IE H+  +R A+TK+  D+   +R+AGF +
Sbjct  60    NSRIRFIELSLNQPITPN------NFVTDFIEGHKDPIRDAVTKIVRDESNSIRLAGFVI  113

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPG  534
             DMFCT+ IDVA E  +P Y++F + A+ L F+ ++ +  D Q    +E+ ++  + +IP 
Sbjct  114   DMFCTTMIDVANEFGVPTYVFFTTTAAMLGFIFYLQSRGDEQKLDVTEYKNSNTKLLIPT  173

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             + NPVP   FP  +  +  D+  PF+  A+R+RET+G+++NTF +LE+Y L S+   + +
Sbjct  174   YINPVPANVFPSKLFDK--DSLAPFVSMARRFRETKGILINTFLDLEAYALKSLSDDHTI  231

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              PVY IGP++  +          +++ ++ WL  Q  SSVVFL  GS+G  +  Q++EIA
Sbjct  232   PPVYSIGPILHVK--VENDDKKKDYDEIINWLHEQPVSSVVFLCFGSLGCFDVEQVKEIA  289

Query  895   TGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
               LE++G+RFLWS+R+PP    + P+DY + + VLP GF  RT G G V GW PQV +L+
Sbjct  290   VALEKSGHRFLWSLRKPPPKDFEHPSDYENFEEVLPEGFLQRTAGIGKVIGWAPQVAVLS  349

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGI  1254
             H ++GGFVSHCGWNS LE++  GVPI  WP+YAEQ  NAF++VK+LG+AVEI  DY+ G 
Sbjct  350   HHSVGGFVSHCGWNSTLESVWCGVPIAAWPMYAEQQTNAFELVKDLGIAVEIKMDYRKGS  409

Query  1255  -TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
               +V AE++E+G++ LM+ D E+R K+K+     +   M+ GSS   L + I+
Sbjct  410   DVIVKAEEIEKGIKHLMEPDSEMRNKMKQMKSKSRLALMEGGSSYNFLRRFID  462



>ref|XP_011001031.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 6-like isoform 
X2 [Populus euphratica]
Length=481

 Score =   390 bits (1002),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 210/482 (44%), Positives = 305/482 (63%), Gaps = 21/482 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ TP I +LV  VE +KLL  +++ LS+T L++ +   P I  +I+S+++  
Sbjct  1     MKKAELVFIPTPGISHLVSTVEVAKLLVDRDERLSITFLIMKLRSDPKIDRFINSVSTAC  60

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAGF  351
             N + F+ LP  EP  P+Q R    FL   IE   PHV+  + KL      S D   +AGF
Sbjct  61    NRIRFIDLPKDEP-DPNQPRK---FLFSLIEAQIPHVKEEVFKLVSQSESSPDSPPLAGF  116

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVI  528
              +DMFCTS IDVA E  +P Y++F S A+FL    ++  L D Q    +EF  +  E V+
Sbjct  117   VLDMFCTSMIDVATEFGVPSYIFFTSGAAFLGLQFYVQDLHDEQKVDPTEFKGSDAELVM  176

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P   NP+P +  P  M   +++   P L+ A+R+RE++G+++NTF+ELES+ + S   GN
Sbjct  177   PCLANPLPAKVLPSVM--LNKEWLPPVLRQARRFRESKGIIINTFEELESHAMDSFSKGN  234

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                PVYP+GP+++         +S   + + +WLD+Q  SSVV+L  GSMGS    Q++E
Sbjct  235   -TPPVYPVGPILNLNRDGDGDEESDKRKDIKQWLDDQPLSSVVYLCFGSMGSFGVDQVKE  293

Query  889   IATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA GLE++G+RF WS+R+P PK K+++P+DYT+   VLP GF DRT   G + GW P++ 
Sbjct  294   IACGLEQSGHRFSWSLRKPQPKGKMEIPSDYTNPQDVLPEGFLDRTAKIGKIIGWGPEID  353

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD--  1239
             IL+H ++GGFVSHCGW+SILE++  GVPI  WPI AEQ LNAFQ++ ELG  VEI  D  
Sbjct  354   ILSHPSVGGFVSHCGWSSILESIWFGVPIAAWPIQAEQQLNAFQIIVELGFGVEIKMDCR  413

Query  1240  ----YKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                 Y D   ++SA ++ERG+R LM+   E  E++KE SE  ++  M+ G S   LG+LI
Sbjct  414   REFFYDDNENIISAGEIERGIRCLMEIGKEKVERLKEMSEQSRKALMEGGCSNTWLGQLI  473

Query  1408  EE  1413
              E
Sbjct  474   HE  475



>ref|XP_011008629.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Populus 
euphratica]
Length=475

 Score =   390 bits (1002),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 203/476 (43%), Positives = 306/476 (64%), Gaps = 15/476 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-D  186
             MK+A++VF+ +P +G+LV   +F+KL+  +N +  +T+L+IN P    I  YI+SLAS  
Sbjct  1     MKKAQLVFIPSPGVGHLVSAAQFAKLVLDRNDSFLITMLVINNPYAESISKYIESLASAH  60

Query  187   GNLEFLSLPAA-EPPSPDQ-NRSTISFLSIWIENHEPHVRRAL-TKLKSDDDVRIAGFFV  357
               ++F++LP    PPS +    S     S +I +H+  VR A+  ++ +++   IA    
Sbjct  61    TQIKFITLPETIAPPSAEALAVSAEHAFSCYINDHKTIVRDAIVNQVMANNPAPIASVVF  120

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQ-VPKNSEFGDAAKEYVIPG  534
             D+FCT+FIDVA EL +P +++F S A+FL  ML++   +   +PK   F     +Y+IP 
Sbjct  121   DLFCTAFIDVARELGVPSHVFFTSGAAFLGLMLYLSDREEYGLPK---FRPTDPDYIIPF  177

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             + NPVP    P      +++ Y  F  H +++++  G+++NTF E+ES+ + ++   +DV
Sbjct  178   YANPVPYRVLPLL---HNDEGYETFAYHGRKFKDANGIIINTFSEVESHVVHALLARDDV  234

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              P++ +GP++D  G +    D+   + +MKWLD+Q   SVVFL  GS G  + AQ++EIA
Sbjct  235   PPIFNVGPLIDHRGKSLSGSDAVKRDEIMKWLDDQPEKSVVFLCFGSGGGFDEAQLKEIA  294

Query  895   TGLERAGYRFLWSIREPPKSKLDLPNDYTD-LDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLE++G+RFLWSIR  P SK  L   Y D    +LP GF +RTK  GM+CGW PQV IL
Sbjct  295   IGLEKSGHRFLWSIRLKP-SKGQLHASYFDNYGEILPEGFLERTKNIGMLCGWAPQVEIL  353

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AH+A+G FVSHCGWNS LE L +GVPI TWP+Y EQH+NAFQ+VK+LGLAVE+T D++  
Sbjct  354   AHRAVGAFVSHCGWNSTLETLWYGVPIITWPLYGEQHINAFQLVKDLGLAVELTLDFRRD  413

Query  1252  --ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                  V AED+ + V+ +M+   E+R K K  SEM ++  ++ GSS V+LG LI++
Sbjct  414   CPTDFVKAEDITKAVKTMMEQGGELRNKAKATSEMAQKAVVEGGSSYVALGNLIDQ  469



>ref|XP_010045032.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW88561.1| hypothetical protein EUGRSUZ_A00940 [Eucalyptus grandis]
Length=482

 Score =   390 bits (1002),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 207/482 (43%), Positives = 308/482 (64%), Gaps = 20/482 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M  A++V V TP +G+LV +VE +KLL  ++  LS+TVL++ +P    + SY  SLA+  
Sbjct  1     MAYAELVLVPTPGMGHLVSMVEIAKLLIDRDPRLSITVLIMKLPIDSEVDSYTSSLATSM  60

Query  190   N---LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV--RIAGFF  354
             +   + F+ LP     + D   S+ +FL+ ++E+++PHV++A+  L        R+ GF 
Sbjct  61    DATRIRFVHLPRV---NSDPEISSGTFLAHFMESNKPHVKQAVADLAESAGSIWRLVGFV  117

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFCT+ I++A+E  +P Y++F S A+FL  MLH+ +L D Q    ++F D+  E   P
Sbjct  118   IDMFCTTMIELADEFGVPSYVFFTSSAAFLGLMLHLQSLQDEQHMDITKFKDSDTELDFP  177

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
              F NP+P +  P  +  R ++   PFL+HAKR R  +G+++NTF ELE + +GS+     
Sbjct  178   SFTNPLPAKVLPSKV--RIKEAVQPFLEHAKRIRAVKGIIINTFDELEPHAVGSL-ASLG  234

Query  712   VGPVYPIGPVVDREGPARWHPDSWNH-ELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                VY +GP+++ +G  +   D     + +M+WL+ +  SSVVFL  GS GS    Q++E
Sbjct  235   APTVYSVGPILNLKGETKTKADGGGRGDDIMEWLNEKPPSSVVFLCFGSGGSFGEDQVKE  294

Query  889   IATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA  LER+G+RFLWS+R PP K K +LP DYTD   VLP GF +RT G G V GW PQ  
Sbjct  295   IAYALERSGHRFLWSLRRPPPKGKFELPRDYTDPAEVLPEGFLERTAGVGKVIGWAPQNA  354

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAH A+GGFVSHCGWNS LE++  GV + TWP+YAEQ  NAF++V ELGLAVEI  DY+
Sbjct  355   VLAHPAVGGFVSHCGWNSTLESIWFGVAVATWPLYAEQQFNAFELVAELGLAVEIKMDYR  414

Query  1246  DGITL-----VSAEDVERGVRKLM-DGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                 +     V+A+++E G++KLM D   E  +KVK+ SE  ++  M+ GSS ++LG L+
Sbjct  415   RDFRMESGFIVTADEIEGGIKKLMEDASSERWKKVKDVSEKSRKALMEGGSSHLALGHLV  474

Query  1408  EE  1413
             ++
Sbjct  475   DD  476



>ref|XP_002265548.2| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=469

 Score =   390 bits (1001),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 204/473 (43%), Positives = 301/473 (64%), Gaps = 16/473 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M+Q ++VF+  P IG+L   +E +KL++ +    S+T+ ++  P         D + +D 
Sbjct  1     MEQTELVFIPFPIIGHLASALEIAKLITKREPRFSITIFIMKFPF-----GSTDGMDTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S  +   +  F S +++ H P VR A+ +L   + VR++GF +DMF
Sbjct  56    DSIRFVTLPPVEVSS--ETTPSGHFFSEFLKVHIPLVRDAVHELTRSNSVRLSGFVIDMF  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+F S A+FL F+LH+  L D +    +EF D+  E  +  F N
Sbjct  114   CTHMIDVADEFGVPSYLFFPSGAAFLGFLLHVQFLHDYEGLDINEFKDSDAELGVLTFVN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP +M ++        L H +R+RE +G++VNTF ELES+ + S+  G+ V  V
Sbjct  174   SVPGKVFPAWMFEKENGGAEMLLYHTRRFREVKGILVNTFIELESHAIQSL-SGSTVPEV  232

Query  724   YPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             YP+GP+++ R G      D+      M WLD+Q  SSV+FL  GS GS    QI+EIA G
Sbjct  233   YPVGPILNTRMGSGGGQQDA---SATMSWLDDQPPSSVIFLCFGSRGSFGADQIKEIAYG  289

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE +G+RFLWS+R+PP K K++  + Y +++ VLP GF  R    G V GW PQ+ +LAH
Sbjct  290   LEHSGHRFLWSLRQPPQKGKMEFSSGYENIEEVLPEGFLHRAARIGKVIGWAPQIAVLAH  349

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGI  1254
              A+GGFVSHCGWNS+LE++ +GVP+ TW +YAEQ +NAFQMV++LGLAVEI  DY KD  
Sbjct  350   SAVGGFVSHCGWNSLLESIWYGVPVATWSMYAEQQINAFQMVQDLGLAVEIKIDYNKDSD  409

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +VSA ++E G+R LM+ + EVR+K KE  ++ ++V +  GSS  SLG  IE+
Sbjct  410   YVVSAHEIENGLRNLMNTNSEVRKKRKEMKKISRKVMIDGGSSHFSLGHFIED  462



>ref|XP_006373642.1| hypothetical protein POPTR_0016s01860g [Populus trichocarpa]
 gb|ERP51439.1| hypothetical protein POPTR_0016s01860g [Populus trichocarpa]
Length=470

 Score =   389 bits (999),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 210/482 (44%), Positives = 300/482 (62%), Gaps = 32/482 (7%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ TP I +LV  VE +KLL  +++ LS+T L++ +   P I  +I+S+++  
Sbjct  1     MKKAELVFIPTPGISHLVSTVEVAKLLVDRDERLSITFLIMKLRSDPKIDRFINSVST--  58

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAGFF  354
                      A  P P+Q R    FL   IE+ +PHV+  + KL      S D   +AGF 
Sbjct  59    ---------AYEPDPNQPRK---FLFSLIESQKPHVKEEVFKLVSQSESSPDSPSLAGFV  106

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFCTS IDVA E  +P Y++  S A+FL    ++  L D Q    +EF  +  E V+P
Sbjct  107   LDMFCTSMIDVANEFGVPSYIFLTSGAAFLGLQFYVQALHDEQKVDPTEFKGSDAELVMP  166

Query  532   GFENPVPVESFPPFMSKRHEDTYLP-FLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
                NP+P +  P  M  +    +LP  L  A+R+RE++G+++NTF+ELES+ + S   GN
Sbjct  167   CLANPLPAKVLPSVMLNKE---WLPNMLSQARRFRESKGIIINTFEELESHAIDSFSIGN  223

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                PVYP+GP+++         +S  ++ + +WLD+Q  SSVV+L  GSMGS    Q++E
Sbjct  224   S-PPVYPVGPILNLNRDGDCDEESDKYKDIKQWLDDQPLSSVVYLCFGSMGSFGADQVKE  282

Query  889   IATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA  LE++G+RFLWS+R+PP K K++ P+DYT+    LP GF DRT   G V GW PQ  
Sbjct  283   IACALEQSGHRFLWSLRKPPQKGKMEPPSDYTNPRDALPEGFLDRTANSGKVIGWAPQTD  342

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             ILAH ++GGFVSHCGWNSILE++  GVPI  WP+YAEQ LNAFQ++ ELGL VEI  DY+
Sbjct  343   ILAHPSVGGFVSHCGWNSILESIWFGVPIAAWPLYAEQQLNAFQIIVELGLGVEIKMDYR  402

Query  1246  DGI------TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
               +       ++SA ++ERGVR LM+  DE RE++KE S   K+     GSS   LG+ I
Sbjct  403   KDLYSDGNENVISAGEIERGVRCLMELCDEKRERLKEMSGKGKKALENGGSSFTWLGRFI  462

Query  1408  EE  1413
             ++
Sbjct  463   QD  464



>ref|XP_002308778.1| hypothetical protein POPTR_0006s01160g [Populus trichocarpa]
 gb|ABK96361.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE92301.1| hypothetical protein POPTR_0006s01160g [Populus trichocarpa]
Length=475

 Score =   389 bits (999),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 199/475 (42%), Positives = 304/475 (64%), Gaps = 13/475 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-D  186
             MK+A++VF+ +P +G+LV   +F+KL+  +N N  +T+L+IN P    I  YI+SLAS  
Sbjct  1     MKKAQLVFIPSPGVGHLVSAAQFAKLVLDRNDNFLITMLVINNPYAESISKYIESLASAH  60

Query  187   GNLEFLSLPAA-EPPSPDQ-NRSTISFLSIWIENHEPHVRRAL-TKLKSDDDVRIAGFFV  357
               ++F++LP    PPS +    S     S +I +H+  VR A+  ++ +++   IA    
Sbjct  61    TQIKFIALPETIAPPSAEALAVSAEHAFSCYINDHKTIVRDAIVNQVMANNPAPIASVVF  120

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGF  537
             D+FCT+FIDVA EL +P +++F S A+FL  M ++   D +     +F     +Y+IP +
Sbjct  121   DLFCTAFIDVARELGVPSHVFFTSGAAFLGLMFYLS--DREEYGQPKFRPTDPDYIIPFY  178

Query  538   ENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVG  717
              NPVP    P      +++ Y  F  H +++++  G+++NTF E+ES+ + ++   +D+ 
Sbjct  179   ANPVPYRVLPLL---HNDEGYETFAYHGRKFKDANGIIINTFSEVESHVVHALLARDDIP  235

Query  718   PVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIAT  897
             P++ +GP++D  G +    D+   + ++KWLD+Q   SVVFL  GS G  + AQ++EIA 
Sbjct  236   PIFNVGPLIDHRGKSLSGSDAVKRDEIIKWLDDQPEKSVVFLCFGSGGGFDEAQLKEIAI  295

Query  898   GLERAGYRFLWSIREPPKSKLDLPNDYTD-LDHVLPPGFSDRTKGKGMVCGWVPQVTILA  1074
             GLE++G+RFLWSIR  P SK  L   Y D    +LP GF +RT+  GM+CGW PQV ILA
Sbjct  296   GLEKSGHRFLWSIRLKP-SKGQLHASYFDNYGEILPEGFLERTENTGMLCGWAPQVEILA  354

Query  1075  HKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG-  1251
             H+A+G FVSHCGWNS LE L +GVPI TWP+Y EQH+NAFQ+VK+LGLAVE+T D++   
Sbjct  355   HRAVGAFVSHCGWNSTLETLWYGVPIITWPLYGEQHINAFQLVKDLGLAVELTLDFRRDC  414

Query  1252  -ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                 V AED+ + V+ +M+   E+R K K  SEM ++  ++ GSS V+LG LI++
Sbjct  415   PTDFVKAEDITKAVKTMMEQGGELRNKAKATSEMAQKAVVEGGSSYVALGNLIDQ  469



>ref|XP_009782109.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Nicotiana sylvestris]
Length=482

 Score =   389 bits (1000),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 203/478 (42%), Positives = 296/478 (62%), Gaps = 16/478 (3%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             K  ++VF+ +P +G+LVP VE SKLL  + + LS+ VL++NM   P +  YI SL+S+ N
Sbjct  5     KITELVFIPSPGMGHLVPAVEMSKLLIAREEQLSINVLIMNMNLDPNLNPYIQSLSSNTN  64

Query  193   -----LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFV  357
                  L+F+ LP  E      N ST  F S  I++H+P VR+   ++   +   ++G  +
Sbjct  65    FSSSRLKFIQLPRDESALQLLNNST--FFSGVIDSHKPQVRQVAAQILQSETATLSGLVI  122

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL--DAQVPKNSEFGDAAKEYVIP  531
             DM CT+ IDVA E  +P Y+++ + A+ L   LH+ +L  D  +   +   D   E  +P
Sbjct  123   DMMCTTMIDVANECGLPTYVFYTTSAAMLGLHLHMQSLQDDFNIDITNYNNDPESELSVP  182

Query  532   GFENPVPVESFPP-FMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
              + NP   +  P  F+ K    T   FL  AKRY+ET+G++VNTF E E++ L S+    
Sbjct  183   TYFNPFATKCLPSIFLDKDGGSTM--FLDIAKRYQETKGILVNTFLEFEAHALKSLSLDG  240

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
              + PVYP+GP+++       + D  +HE++ KWLD Q  SSVVFL  G+ GS N  Q++E
Sbjct  241   KIPPVYPVGPLLNLNSGVGDNEDLSDHEII-KWLDEQTPSSVVFLCFGTSGSFNEEQVKE  299

Query  889   IATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             IA  LE  G RFLWS+R+PP      P+DY +L+ VLP GF  RTKG GMV GW PQ  I
Sbjct  300   IANALEERGCRFLWSLRKPPPKDSWYPSDYKNLEDVLPEGFLQRTKGIGMVIGWAPQGVI  359

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-  1245
             L+H A+GGFVSHCGWNSILE++  GVPI TWP+Y+EQ  NAFQ+VK+LG+A++I  DY  
Sbjct  360   LSHGAVGGFVSHCGWNSILESIWFGVPIATWPMYSEQQANAFQLVKDLGMAMDIKMDYNI  419

Query  1246  --DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
               +   ++ AE ++  +R+LM+ ++E+R KVK+  E  +    + GSS  S+G+ IE+
Sbjct  420   SGNKTDIIKAEKIKSAIRQLMEPENEIRMKVKDMKEKSRLALKEGGSSYTSVGRFIEQ  477



>ref|XP_009350667.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score =   389 bits (999),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 209/477 (44%), Positives = 299/477 (63%), Gaps = 20/477 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             ++ A++VF+    IG+L    E +KLL  ++  L + VL + +P   L  ++    A D 
Sbjct  18    IQAAELVFIPAIGIGHLASAFEIAKLLVARDDRLFIIVLTMKLP---LESNFKLKGADDA  74

Query  190   -NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAGF  351
               + F++LP     +   N     FL +++ENH+ HVR A+ KL     +SD   R+ GF
Sbjct  75    ERIRFINLPEEAVETKGINL----FLKLFVENHKQHVRDAVAKLTSEPPQSDCKPRLVGF  130

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVI  528
              +DMFCT+ IDVA E  +P Y++F S A FL  +LH+ TL D Q    +E  ++  + V+
Sbjct  131   VIDMFCTTMIDVANEFGVPTYVFFTSGAGFLGLVLHLQTLHDEQNKDCTELKESDPDLVL  190

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P   NP+P    P     +  D    F+ HA+R+RET+G++VNTF ELES+CL ++  G 
Sbjct  191   PCLVNPMPARVLPGVYLDK--DGATEFINHARRFRETKGILVNTFMELESHCLRALSDGK  248

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                P+YP+GPV++ +        +   E +++WLD+Q   SVVFL  GSMG     Q++E
Sbjct  249   P-PPLYPVGPVLNLKSDPEGSELAKKKE-ILEWLDDQSPLSVVFLCFGSMGCFGGDQVKE  306

Query  889   IATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IA  LE +G RFLWS+R+P PK +L   +DY D   VLP GF DRT G G V GW PQV 
Sbjct  307   IAAALEHSGLRFLWSLRQPLPKGELLFASDYADPSGVLPQGFLDRTAGTGKVIGWAPQVA  366

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-  1242
             +L H ++GGFVSHCGWNS LE+L +GVP+  WP+YAEQ LNAF++V+ELGLAVEI  DY 
Sbjct  367   VLGHPSVGGFVSHCGWNSNLESLWYGVPVAAWPVYAEQQLNAFELVRELGLAVEIKMDYR  426

Query  1243  KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             ++G  +V AE++ERG+R++M+ + E R+KVKE SE  +R  M  GSS  SLG+ I++
Sbjct  427   REGEVVVRAEEMERGIREVMEVESEQRKKVKEMSEKSRRALMDGGSSHSSLGRFIDQ  483



>gb|AFD61601.1| anthocyanidin 3-O-glucosyltransferase [Hevea brasiliensis]
Length=470

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 212/479 (44%), Positives = 300/479 (63%), Gaps = 34/479 (7%)
 Frame = +1

Query  16    QAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASDGN  192
             QA++VFV  P +G+LV  VE +KLL  ++  LS+TVL++ +P     +Q+Y++S+    +
Sbjct  5     QAQLVFVPIPVMGHLVSTVEVAKLLLTRDHRLSITVLVLELPLTNSKVQNYVESVQDSSS  64

Query  193   -----LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL----KSDDDVRIA  345
                  L F+ LP        ++ S +  LS + E  +P+V+ A+ K+     S D  R+A
Sbjct  65    TLSNRLRFIDLP--------KDGSELFDLSSFFERQKPNVKDAVLKITQSESSVDSPRLA  116

Query  346   GFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNS-EFGDAAKEY  522
             GF +DMFCT  IDVA E  +P Y +  S A+FL F+L+   +  +   ++ +F D+  E 
Sbjct  117   GFVLDMFCTPMIDVANEFGVPSYFFCTSGAAFLGFVLYEQKIHDEAEFDAIQFKDSDTEL  176

Query  523   VIPGFENPVPVESFPPFMSKRHEDTYLPFLQHA-KRYRETRGVVVNTFKELESYCLGSMF  699
             ++P   NP P  S P  M  +     LP+L++A +R+RE +G++VNTF ELES+ + S  
Sbjct  177   LVPCLINPFPARSTPSAMLNKER---LPYLRNAARRFREAKGIIVNTFLELESHAIESF-  232

Query  700   GGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
                +  P+YP+GP+++ E   R      +H+ +M+WLD+Q  +SVVFL  GSMGS    Q
Sbjct  233   ---ETPPLYPVGPILNVELDGRN-----SHQEIMQWLDDQPVASVVFLCFGSMGSFGEDQ  284

Query  880   IREIATGLERAGYRFLWSIREPPK-SKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             ++EIA  LE +G+RFLWSIR PP   K   P DY D   VLP GF +RT   G V GW P
Sbjct  285   LKEIACALEHSGHRFLWSIRRPPPPGKQAFPTDYEDPQEVLPEGFLERTAAVGKVIGWAP  344

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV ILAH A+GGFVSHCGWNS+LE++  GVPI TWP+YAEQ  NAF+MV ELGLAVEI  
Sbjct  345   QVAILAHPAVGGFVSHCGWNSVLESIWFGVPIATWPMYAEQQFNAFEMVTELGLAVEIKM  404

Query  1237  DYK-DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             DY+ D   +V+  ++ERG+R LM+ D +  +KVKE SE  +R  M  GSS   LG+LI+
Sbjct  405   DYRNDSGVIVNCNEIERGIRSLMEHDSKKMKKVKEMSEKSRRALMDGGSSYCCLGRLIK  463



>emb|CBI19996.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   390 bits (1001),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/461 (45%), Positives = 292/461 (63%), Gaps = 16/461 (3%)
 Frame = +1

Query  43    PTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN-LEFLSLPAA  219
             P I +L P VE +KLL+ ++   S+T+ ++  P        IDS+ +D + + F++LP  
Sbjct  18    PIISHLSPTVEIAKLLTQRDPRFSITIFIMKFPF-----GSIDSMTTDSDSIRFVTLPPV  72

Query  220   EPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFCTSFIDVAEEL  399
             E  S         F+S +I+     VR A+ +L   + VR+AGF +D+ CT  IDVA+E 
Sbjct  73    EISSGATTPG--PFMSEFIKAQTLLVRDAVHELTRSNSVRLAGFVIDVMCTHMIDVADEF  130

Query  400   DIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENPVPVESFPPFM  576
              +P YL+  S A+ L F+LH+  L D +     EF ++  E  +P + N VP + FP  +
Sbjct  131   GVPSYLFSTSSAASLGFLLHLQFLHDYEGLNLDEFKNSDAELQVPSYANSVPGKVFPTMI  190

Query  577   SKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYPIGPVVD-RE  753
               +  D     + H +R R+ +GV+VNTF +LES+ + S F G+ V PVYP+GP+++ R 
Sbjct  191   FDKGVDGAAGHMYHMRRLRQAKGVMVNTFIDLESHAIQS-FSGSTVPPVYPVGPILNTRT  249

Query  754   GPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAGYRFLWS  933
             G   +  D  N   +M WLD+Q  SSVVFL  G MGS    QI+EIA GLER+G+RFLWS
Sbjct  250   G---FGEDQQNASAIMSWLDDQPPSSVVFLCFGGMGSFGTDQIKEIAYGLERSGHRFLWS  306

Query  934   IREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIGGFVSHCG  1110
             +R+ P K K+  P DY +++ VLP GF  RT   G + GW PQV +LAH A+GGFVSHCG
Sbjct  307   LRQAPQKGKMAFPRDYENIEEVLPDGFLHRTARIGKIIGWAPQVAVLAHTAVGGFVSHCG  366

Query  1111  WNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGITLVSAEDVERG  1287
             WNS+LE++ +GVP+ TWPIYAEQ +NAFQMVK+LGLAVEI  DY KD   +V+A ++E G
Sbjct  367   WNSLLESIWYGVPVATWPIYAEQQINAFQMVKDLGLAVEIKIDYNKDNNYIVNAHEIENG  426

Query  1288  VRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             +RKLM  + EVR+K+ E  ++ +RV +  GSS  SLG  IE
Sbjct  427   LRKLMSINSEVRKKMNEMQQISRRVIIDGGSSHSSLGHFIE  467



>ref|XP_008229642.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Prunus mume]
Length=459

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 208/476 (44%), Positives = 301/476 (63%), Gaps = 29/476 (6%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             + A++VF+    IG++V  +E +KLL  ++  L +T+L++  P   L  +   S++    
Sbjct  3     RPAELVFIPAAGIGHVVSTIEIAKLLVSRDDRLFITLLIMKRPFDELFTNTDSSISP--R  60

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV-----RIAGFFV  357
             + F++LP           + +S    ++EN +  VR A+ KL   +       R++GF V
Sbjct  61    INFVNLPET---------TDLSCFKFFVENQKTQVRDAVAKLVESNQSGSSKPRLSGFVV  111

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIPG  534
             DMFCT+ IDVA E  +P Y++F S A+ L  + H+ TL  +  K+ +EF  +  + V+P 
Sbjct  112   DMFCTTMIDVANEFGVPSYVFFTSSAACLGLLFHLQTLRDEHGKDVAEFMHSDSDLVVPS  171

Query  535   FENPVPVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
             F NP+P    P   + K   ++   FL +A+R+RET+G++VNTF ELES+ L S+  G +
Sbjct  172   FVNPLPASVLPGKLLDKESAES---FLNYARRFRETKGILVNTFWELESHALHSISYGKN  228

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
               PVYP+GP+++ +       D      ++ WLD+Q   SVVFL  GSMGS   AQ++EI
Sbjct  229   -PPVYPVGPLLNLKSS-----DDDKGGDILSWLDDQPPFSVVFLCFGSMGSFGEAQVKEI  282

Query  892   ATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             A  LER G RFLWS+R+PP K K+ +P+DY D   VLP GF DRT   G V GW PQV I
Sbjct  283   ACALERTGLRFLWSLRQPPPKGKMAMPSDYADPSGVLPEGFLDRTAKIGKVIGWAPQVDI  342

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-K  1245
             LAH +IGGFVSHCGWNS+LE+L +GVP+ TWP+YAEQ  NAFQ++KELGLAVEI  D+ K
Sbjct  343   LAHSSIGGFVSHCGWNSMLESLWYGVPVATWPMYAEQQTNAFQLIKELGLAVEIKMDFRK  402

Query  1246  DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             D   +VSA+D+ERG+R++M+    +R++VKE SE  K+  M  GSS  SLG+ I++
Sbjct  403   DSEVVVSAQDIERGIRQVMEPGSVIRKRVKEMSEKSKKSLMNGGSSYSSLGRFIDQ  458



>ref|XP_008229643.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Prunus mume]
Length=469

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 206/473 (44%), Positives = 303/473 (64%), Gaps = 13/473 (3%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             + A++VF+  P +G++V  VE +K L  Q+  L +T+L++ +P   L  +   S++    
Sbjct  3     RPAQLVFIPAPGVGHIVSTVEIAKQLVAQDDQLFITILIMKLPFDKLFTNTDPSISH--R  60

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDD-DVRIAGFFVDMFC  369
             + F++LP +   +     +  SF+  +++ H+ HV+ A+TKL ++   V +AGF +DMFC
Sbjct  61    ISFVNLPESHIDT--HGLAFPSFIKTFVQGHKTHVKDAVTKLLAESAQVELAGFVIDMFC  118

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIPGFENP  546
             T  I+VA E  IP YL+F S A+ L F     +L  +  K+ +E      E ++P F NP
Sbjct  119   TPMINVALEFQIPSYLFFTSSAATLGFWFQHQSLHDEKGKDIAEITGWDSELIVPSFINP  178

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP   +P  M  R +++   F+  A R+R+T+G+++NTF+ELE + L S+  G    PVY
Sbjct  179   VPAGVWPGVM--REKESATNFIDFAARFRQTKGILINTFRELEPHALRSLSDGK-FPPVY  235

Query  727   PIGPVVD-REGPARWHPD-SWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             P+GP+++ +        D S     +++WL +Q  SSVVFL  GSMGS   AQ++EIA  
Sbjct  236   PVGPLLNLKSDDGHVGSDQSIQKSDILEWLADQPPSSVVFLCFGSMGSFGEAQVKEIACA  295

Query  901   LERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE++G RFLWS+R+P PK K+ +P+DY D+  VLP GF DRT G G V GW PQV ILAH
Sbjct  296   LEQSGQRFLWSLRKPEPKGKMGMPSDYADVKGVLPEGFLDRTAGIGKVIGWAPQVAILAH  355

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-DGI  1254
               +GGFVSHCGWNS LE++  GVPI TWP+YAEQ LNAF +VKELGL VEI  D+K D  
Sbjct  356   PGVGGFVSHCGWNSTLESIWCGVPIATWPMYAEQQLNAFGLVKELGLGVEIKMDFKQDSD  415

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +VSAE++ERG+R++M+ D ++R +VKE SE  K+     GSS  SLG+ +++
Sbjct  416   VVVSAEEIERGIRQVMEKDSDIRARVKEISEKSKKALTDGGSSYSSLGRFLDQ  468



>ref|XP_004243652.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Solanum 
lycopersicum]
Length=482

 Score =   388 bits (997),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 201/478 (42%), Positives = 298/478 (62%), Gaps = 17/478 (4%)
 Frame = +1

Query  16    QAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGNL  195
             +A++VF+ +P  G+L+  VE +KL+ ++++ L +++L++ +P    +QSYI+SL+S   L
Sbjct  4     KAELVFIPSPAAGHLISAVEIAKLILNRDERLCISILIMKLPMDFGVQSYIESLSSIPRL  63

Query  196   EFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLK-SDDDVRIAGFFVDMFCT  372
             +F+ +   E        +  +F + ++ +H+P V+  L     S  D R+AGF +DMFCT
Sbjct  64    QFVDITVDENTIAGFMSNKETFFTNFVRSHKPKVKDFLNNSSFSRSDSRLAGFVLDMFCT  123

Query  373   SFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVP-KNSEFGDAAKEYVIPGFENPV  549
             S IDVA E  +P Y++F S A+FL+   H  +L  +     S+  ++ +E  IPGF+NP 
Sbjct  124   SMIDVANEFCVPSYIFFTSNAAFLALCFHFESLKKEHHVDTSKCKNSNEELTIPGFKNPY  183

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYP  729
             P + F P ++         F     R +ET+G++VNTF +LE   L S+     V P+YP
Sbjct  184   PTK-FLPRLTTDQSVITTTFFDSVTRIKETKGIMVNTFADLEPLPLRSL----SVPPIYP  238

Query  730   IGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLER  909
             +GPVV+ +            E ++KWLD+Q  SSVVFL  GSMGS    QIREIA  LE 
Sbjct  239   VGPVVNFKEGGHGRNSQSETESIIKWLDDQPESSVVFLCFGSMGSFEMEQIREIAIALEC  298

Query  910   AGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAI  1086
             +G+RFLWS+R PP K ++ LP++Y + + VLP GF +RT G G + GW PQV +L+H A+
Sbjct  299   SGHRFLWSLRRPPPKGQIGLPSNYENAEEVLPEGFIERTNGVGKMIGWAPQVAVLSHPAV  358

Query  1087  GGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-------K  1245
             GGFVSHCGWNS+LE+L  GVPI TWP+YAEQ +NAF++VKELG+ VEI  DY        
Sbjct  359   GGFVSHCGWNSVLESLYFGVPIATWPLYAEQQMNAFELVKELGVGVEIRMDYFKDFHGND  418

Query  1246  DGITLVSAEDVERGVRKLMDGDD--EVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             + + +V A+++E G+RKLM+  D  E+R K  E  E C     + GSS  +LG LI++
Sbjct  419   ENVEIVGAKEIESGIRKLMENADENEIRRKANEMKEKCHGAMKEGGSSYAALGLLIKD  476



>emb|CAN65223.1| hypothetical protein VITISV_011151 [Vitis vinifera]
Length=476

 Score =   387 bits (995),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 206/473 (44%), Positives = 294/473 (62%), Gaps = 11/473 (2%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLAS  183
             +MK+ +V+FVS   IG++V  VEF+KLL  ++   S T+L++ +P +     +YI S+++
Sbjct  1     MMKKIEVIFVSVSAIGHIVSTVEFAKLLVGRDDRFSATLLIMKLPFEDSAATNYIHSVSA  60

Query  184   D--GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFV  357
                G++ F+ LP  E  S   + ST    S  IE  +P VR A+  L   +  R+AG  V
Sbjct  61    SVSGSIRFVHLP--ELDSDSSSSSTSILFSNIIERQKPLVRDAIHHLTRSESGRLAGIVV  118

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPG  534
             D+ CTS IDVA EL +P Y+YFAS A+ L+ M H+ TL D Q    +EF ++  E V+PG
Sbjct  119   DLLCTSMIDVANELGVPSYVYFASSAACLALMFHLQTLKDHQGLDVTEFANSDAELVVPG  178

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F N VP    P     +     + FL  A+ +RE +G++VNTF ELES+ + S   G   
Sbjct  179   FVNSVPARVLPAVAVDKESGGSMDFLDRARGFREAKGILVNTFVELESHVINSFVDGT-T  237

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              P+Y +GP+++ +       DS     V++WLD+Q +SSVVFL  GS G+ +  QI+EIA
Sbjct  238   PPIYTVGPLLNLQHANNQKQDSSLD--VIRWLDDQPTSSVVFLCFGSAGAFHMDQIKEIA  295

Query  895   TGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLE +G+RFLW++R PP K K+ L +DY + + VLP GF DRT   G + GW PQ  +L
Sbjct  296   IGLENSGHRFLWTLRRPPPKDKMTLSSDYVNFNEVLPKGFLDRTSKIGKIIGWAPQAAVL  355

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-D  1248
             AH A+GGF+SHCGWNS LE++ +GVP+ TWP+YAEQ L AFQ+V+EL + VEI FDY  +
Sbjct  356   AHSAVGGFISHCGWNSTLESIWYGVPVATWPMYAEQQLIAFQIVRELEIGVEIRFDYNMN  415

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                LVSA ++E  +R LMDG  ++R K     E C +   + GSS  S+ +LI
Sbjct  416   TSNLVSAREIEGKIRSLMDGSSDIRMKRTRMKEKCMKALTEGGSSDSSIQRLI  468



>ref|XP_010045082.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW88567.1| hypothetical protein EUGRSUZ_A00947 [Eucalyptus grandis]
Length=482

 Score =   387 bits (994),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 208/482 (43%), Positives = 302/482 (63%), Gaps = 20/482 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             M  A++VFV  P +G+L+ +VE +KLL  ++  LSVTVL++  P    + SY +SLA+  
Sbjct  1     MTHAELVFVPIPAMGHLISMVEMAKLLVDRDPRLSVTVLIMKFPFDADVDSYTNSLATSV  60

Query  187   --GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFF  354
                 + F+ LP     +     S+  FL+ +IE+++PHV+RA+ KL   +    ++AGF 
Sbjct  61    AAARIRFVHLPGENIGT---EISSGRFLTDFIESNKPHVKRAVAKLVDSASSTQQLAGFV  117

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIP  531
             +DM CT+ ID+A+E  +P Y++F S A+FL  MLH+  L  +   N +EF D+A E   P
Sbjct  118   LDMVCTTMIDLADEFGVPSYVFFTSSAAFLGMMLHLQLLQDEHHVNITEFKDSASELDFP  177

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
              F NP+P +  P  +  +  ++  PF++ AKR R T+G++VNTF ELE   + S+  G  
Sbjct  178   SFTNPLPAKVLPSVVLTK--ESIGPFMEQAKRMRATKGIIVNTFDELEPQAVRSL-AGLG  234

Query  712   VGPVYPIGPVVDREGPARWHP-DSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                VYP+GP++   G  +    D    + +M+WLD Q  SSVVFL  GSMG     Q+++
Sbjct  235   APAVYPVGPILSLNGETKKKDIDGHRGDDIMEWLDKQPPSSVVFLCFGSMGCFGEDQVKQ  294

Query  889   IATGLERAGYRFLWSIREPPKSK--LDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             +A  LER+G+RFLWS+R PP SK  +++P+DY D   VLP GF  RT   G V GW PQ 
Sbjct  295   MACALERSGHRFLWSLRRPPPSKGQVEIPSDYADPAEVLPEGFLHRTASVGKVIGWAPQA  354

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              +LAH+AIGGFVSHCGWNS LE+L  GV + TWP+  EQ  NAF++V ELGLA EI  DY
Sbjct  355   AVLAHRAIGGFVSHCGWNSTLESLWFGVVVATWPLRGEQQFNAFELVVELGLATEIKMDY  414

Query  1243  KDGITL----VSAEDVERGVRKLM-DGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
             +    +    ++A+++E G+RKLM +   E  +KVKE SE  ++   K GSS +SLG+LI
Sbjct  415   RRDFRMESGILTADEIEGGIRKLMEEAGSERWKKVKEVSEKSRKALTKGGSSYLSLGRLI  474

Query  1408  EE  1413
             ++
Sbjct  475   DD  476



>ref|XP_010045093.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
Length=486

 Score =   387 bits (994),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 214/486 (44%), Positives = 306/486 (63%), Gaps = 24/486 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M  AK++F+ TP +G+LV +VE +KL+  ++  LSVTVLL+  P    + SY +SLA+ G
Sbjct  1     MADAKLLFIPTPGLGHLVAMVEMAKLIVDRDPRLSVTVLLMKYPFDSDVDSYTNSLATSG  60

Query  190   ---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFF  354
                 L F+ LP     + D   S+  FL+ ++E+++P V+RA+ +L   +    R+AGF 
Sbjct  61    ASPRLCFVHLPR---DNDDSQSSSAHFLTNFVESNKPRVKRAVAELADSAGSTGRLAGFV  117

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFCT+ ID+A+EL +P Y+ F S A+FL  MLH+ +L D      +E+ D+A E   P
Sbjct  118   LDMFCTTMIDLADELGVPSYVLFTSSAAFLGMMLHLQSLQDEHHVDITEYKDSAAELDFP  177

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
                NP+P +  P  +  +  +T  PFL HAKR R  +G+++NTF ELE + L S+  G  
Sbjct  178   SLTNPLPAKVLPGLVLLK--ETVRPFLGHAKRMRAAKGIIINTFDELEPHALRSL-AGLG  234

Query  712   VGPVYPIGPVVDREGPARWHPDSWNH-ELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                VYP+GP+++ +G  +           +M+WLD Q  SSVVFL  GSMGSL   Q++E
Sbjct  235   APAVYPLGPILNLKGETKTKACGGRQGNDIMEWLDKQPPSSVVFLCFGSMGSLGEEQVKE  294

Query  889   IATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             +A  LER+G+RFLWS+R+ PPK K+  P+D  D    LP GF DRT   G V GW PQV 
Sbjct  295   MACALERSGHRFLWSLRQAPPKDKVWFPSDLVDPTEALPEGFLDRTATIGKVIGWAPQVA  354

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAH AIGGFVSHCGWNS LE++  GVP+ T P+Y EQ  NAF++V ELG+AVEI  DY+
Sbjct  355   VLAHPAIGGFVSHCGWNSALESIRFGVPMATLPLYGEQQFNAFELVVELGVAVEIKMDYQ  414

Query  1246  ---------DGITLVSAEDVERGVRKLMDG-DDEVREKVKEYSEMCKRVWMKNGSSAVSL  1395
                      +   +V+A+ +E G++KLM+  D + R+KV E SE  +   ++ GSS +SL
Sbjct  415   RHPRRDPRLESDFVVTADVIEGGIKKLMEEVDSDRRKKVNEASEKSRMAVIEGGSSYLSL  474

Query  1396  GKLIEE  1413
             G LIE+
Sbjct  475   GCLIED  480



>ref|XP_011001028.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Populus 
euphratica]
 ref|XP_011001029.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Populus 
euphratica]
Length=481

 Score =   387 bits (993),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 214/484 (44%), Positives = 304/484 (63%), Gaps = 25/484 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ TP I +L   VE +KLL  +++  S+T L++ +   P I  +I+S+++  
Sbjct  1     MKKAELVFIPTPVISHLASTVEVAKLLVDRDERFSITFLIMKLRFDPKIDRFINSVSTAC  60

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAGF  351
             N + F+ LP  EP  P+Q R    FL   IE   PHV+  + KL      S D   +AGF
Sbjct  61    NRIRFIDLPKDEP-DPNQPRK---FLFSLIEAQIPHVKEEVFKLVSQSESSPDSPPLAGF  116

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVI  528
              +DMFCTS IDVA E  +P Y++  S A+FL    +   L D Q     EF D+  E+V+
Sbjct  117   VLDMFCTSMIDVANEFGVPSYIFLTSGAAFLGLQFYFQALHDEQRVDPIEFKDSEAEWVM  176

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P   NP+P +  P F+  +  +    FL  A+R RE++G++VNTF+ELES+ + S   GN
Sbjct  177   PCLANPLPAKVLPSFLLCK--EGLARFLVQARRLRESKGIIVNTFEELESHAINSFSNGN  234

Query  709   DVGPVYPIGPVVD--REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
                PVYP+GP+++  R+G      D +    + +WLD+Q  SSVV++  GSMGS    Q+
Sbjct  235   -TPPVYPVGPILNLGRDGHRDVESDKFKD--IKQWLDDQPLSSVVYICFGSMGSFGVDQV  291

Query  883   REIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             +EIA GLE++G+RFLWS+R+PP K  ++ P+DYT+   VLP GF +RT   G + GW PQ
Sbjct  292   KEIACGLEQSGHRFLWSLRQPPPKGTIEPPSDYTNPQGVLPEGFLERTAITGKIIGWAPQ  351

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
               ILAH ++GGFVSHCGWNS+LE++  GVPI  WP+YAEQ LNAFQ++ ELGL VEI  D
Sbjct  352   TDILAHPSVGGFVSHCGWNSVLESIWFGVPIAAWPLYAEQQLNAFQIIVELGLGVEIKMD  411

Query  1240  YK-----DGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGK  1401
             Y+     DG   ++SA ++ERGVR LM+  DE REK+KE S   ++     GSS   LG+
Sbjct  412   YRKEFISDGNENVISAGEIERGVRFLMELCDERREKLKEMSGKSRKALENGGSSFTWLGR  471

Query  1402  LIEE  1413
              I++
Sbjct  472   FIQD  475



>ref|XP_009613935.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=478

 Score =   386 bits (991),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 202/476 (42%), Positives = 299/476 (63%), Gaps = 18/476 (4%)
 Frame = +1

Query  22    KVVFVSTPTIGNLVPVVEFSKLLSHQNQN-LSVTVLLINMPQRPLIQSYIDSLASDGNLE  198
             +++F+    +G+LV  +EF+KL+ ++++N L ++VL++ +P    +Q++I SL S   L+
Sbjct  3     ELIFIPLAGLGHLVSAIEFAKLILNRDENNLCISVLIMKLPLDYGVQNFIQSLTSQSRLK  62

Query  199   FLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFCTSF  378
             F+ +   E  S     +   F+  +I+ H+ +VR  +  +      R+AGF +DMFCTS 
Sbjct  63    FIDISLDEKTSSGFLNNHERFVYDFIDGHKSNVREYVQNIP-----RLAGFVLDMFCTSM  117

Query  379   IDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENPVPV  555
             ID+A E ++P Y+YFAS A+FL   LH   L + Q    S++ ++ +E  IP F+NP P 
Sbjct  118   IDIANEFNVPSYIYFASNAAFLGLCLHFQALRNEQNLDTSKYVNSDEELSIPCFKNPCPT  177

Query  556   ESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYPIG  735
             +  P  +      + L F    +R++ET+G+++NTF ELE + L ++     V  +YP+G
Sbjct  178   KVLPKHLLDSRLASTL-FFDGIRRFKETKGIIINTFFELEPFSLQTILDSEIVPTIYPVG  236

Query  736   PVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAG  915
             PVV       +  +    E +M+WLD Q   SVVFL  GSMGS    QI+EIA  +E  G
Sbjct  237   PVVSFAKSGHFRNNPSEIESIMEWLDEQPDLSVVFLCFGSMGSFEAEQIKEIAIAMEHCG  296

Query  916   YRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIGG  1092
              RFLWS+R  PPK K+D+P++Y + + +LP GF +RTKG G V GW PQV IL+HK++GG
Sbjct  297   QRFLWSLRRSPPKGKIDIPSNYNNFEEILPKGFLERTKGIGKVIGWAPQVAILSHKSVGG  356

Query  1093  FVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY------KDG-  1251
             FVSHCGWNSILE++  GVPI TWP+YAEQ +NAF +VKELGLA EI  DY      KD  
Sbjct  357   FVSHCGWNSILESVYFGVPIATWPLYAEQQMNAFLLVKELGLAKEIRMDYVVDFEGKDNQ  416

Query  1252  ITLVSAEDVERGVRKLM--DGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             + +VSAE++E G+++LM   G++EVR+K KE  E  +   +  GSS   LG LI +
Sbjct  417   VDIVSAEEIEGGLQRLMVKSGENEVRKKTKEMKEKSRVAMVDGGSSYNFLGLLIND  472



>dbj|BAB88934.1| glucosyltransferase [Nicotiana tabacum]
Length=482

 Score =   386 bits (991),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 204/481 (42%), Positives = 299/481 (62%), Gaps = 25/481 (5%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-DG  189
             K+ ++VF+ +P IG+LV  VE +KLL  + + LS+TVL+I  P    + SYI S+A+   
Sbjct  5     KKIELVFIPSPGIGHLVSTVEMAKLLIAREEQLSITVLIIQWPNDKKLDSYIQSVANFSS  64

Query  190   NLEFLSLPAAEPPSPDQNRSTISFL-----SIWIENHEPHVRRALTK-LKSDDDVRIAGF  351
              L+F+ LP        Q+ S +  L     + +I +H+P VR A+   LKS+ +  +AG 
Sbjct  65    RLKFIRLP--------QDDSIMQLLKSNIFTTFIASHKPAVRDAVADILKSESNNTLAGI  116

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYV-  525
              +D+FCTS IDVA E ++P Y+++ S A+ L    HI  L  +  K+ +++ D  +E + 
Sbjct  117   VIDLFCTSMIDVANEFELPTYVFYTSGAATLGLHYHIQNLRDEFNKDITKYKDEPEEKLS  176

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             I  + NP P +  P     +   + + FL  AKR+RET+G+++NTF ELESY L S+   
Sbjct  177   IATYLNPFPAKCLPSVALDKEGGSTM-FLDLAKRFRETKGIMINTFLELESYALNSLSRD  235

Query  706   NDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
              ++ P+YP+GPV++       +  S +    MKWLD+Q +SSVVFL  GS GS    Q++
Sbjct  236   KNLPPIYPVGPVLNLNNVEGDNLGSSDQN-TMKWLDDQPASSVVFLCFGSGGSFEKHQVK  294

Query  886   EIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             EIA  LE +G RFLWS+R PP      P++Y +L+ +LP GF +RTKG G V GW PQ+ 
Sbjct  295   EIAYALESSGCRFLWSLRRPPTEDARFPSNYENLEEILPEGFLERTKGIGKVIGWAPQLA  354

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             IL+HK+ GGFVSHCGWNS LE+   GVPI TWP+YAEQ  NAFQ+VK+L + VEI  DY+
Sbjct  355   ILSHKSTGGFVSHCGWNSTLESTYFGVPIATWPMYAEQQANAFQLVKDLRMGVEIKMDYR  414

Query  1246  DGI------TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
               +       +V AE++E+ +R++MD + E+R KVKE  E  +   M+ GSS  S+G  I
Sbjct  415   KDMKVMGKEVIVKAEEIEKAIREIMDSESEIRVKVKEMKEKSRAAQMEGGSSYTSIGGFI  474

Query  1408  E  1410
             +
Sbjct  475   Q  475



>dbj|BAI65911.1| UDP-sugar:glycosyltransferase [Forsythia x intermedia]
Length=469

 Score =   385 bits (989),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 193/475 (41%), Positives = 306/475 (64%), Gaps = 19/475 (4%)
 Frame = +1

Query  4     AIMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS  183
             A  K++++VF+  P +G+L+  +E ++LL+ +++ LS+TV+++ +P       Y  S  S
Sbjct  2     AETKKSELVFIPVPGVGHLISTIEMAELLTDRDERLSITVIIMKLPMESKTDFY--SRKS  59

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDD--VRIAGFFV  357
             +  + F+     +P +P+      +F++ +IE+H+  +R A+TK+  D+   +R+AGF +
Sbjct  60    NSRIRFIEFSLNQPITPN------NFVTHFIESHKDPIRDAVTKIVRDESNSIRLAGFVI  113

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPG  534
             DMFCT+ IDVA E  +P Y++F + A+ L F  ++ +  D Q    +E+ ++  E +IP 
Sbjct  114   DMFCTTMIDVANEFGVPTYVFFTTTAALLGFTFYLQSRSDEQKLDVTEYKNSNAELLIPT  173

Query  535   FENPVPVESFPP-FMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
             + NPVP   FP  F  K   D    FL  A+R+RET+G+++NTF +LE++ + S+   + 
Sbjct  174   YINPVPANVFPSRFFDK---DGLAMFLGMARRFRETKGIMINTFLDLEAHAMKSLSDDHT  230

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
             + PVY IGP++     A    D+ +++ ++KWL  Q  SSVVFL  GSMG  +  Q++EI
Sbjct  231   IPPVYSIGPII--HVTAENDDDNKDYDEIIKWLHEQPVSSVVFLCFGSMGFFDDEQVKEI  288

Query  892   ATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             A  LE++G+RFLWS+R+PP K + + P+DY +L+ +LP GF  RT G G V GW PQV +
Sbjct  289   AVALEKSGHRFLWSLRKPPPKDRFEYPSDYENLEEILPEGFLQRTAGIGKVIGWAPQVAV  348

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD  1248
             L+H ++GGFVSHCGWNS LE++  GVPI  WP+YAEQ  NAF++VK+LG+AVEI  DY+ 
Sbjct  349   LSHHSVGGFVSHCGWNSTLESVWCGVPIAAWPMYAEQQTNAFELVKDLGIAVEIKMDYRR  408

Query  1249  GI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             G   +V AE++E+G+R LM+ D E+R K+K+     +   M+ GSS   L   I+
Sbjct  409   GSDVIVKAEEIEKGIRHLMEPDSEMRNKMKQMKNKSRLALMEGGSSYDFLRHFID  463



>ref|XP_010045044.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW88563.1| hypothetical protein EUGRSUZ_A00942 [Eucalyptus grandis]
Length=483

 Score =   385 bits (990),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 211/485 (44%), Positives = 306/485 (63%), Gaps = 27/485 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             M  A++VFV  P IG+L+ +VE +KLL  ++  LSVTVL++ +P    + SY +SLA+  
Sbjct  1     MTHAELVFVPIPAIGHLISMVEMAKLLVDRDPRLSVTVLIMKLPFDADVDSYTNSLATSV  60

Query  187   --GNLEFLSLPAAEPPSPDQNRSTI---SFLSIWIENHEPHVRRALTKL--KSDDDVRIA  345
                 + F+ LP        +N  T    SFL+ +IE+++PHV+RA+ +L   +    ++A
Sbjct  61    AATRIRFVHLPC-------ENIGTEILGSFLTDFIESNKPHVKRAVAELVDSASSTQQLA  113

Query  346   GFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEY  522
             GF +DM CT+ ID+A+EL +P Y++F S A+FL  MLH+  L  +   N +EF D+A E 
Sbjct  114   GFVLDMVCTTMIDLADELGVPSYVFFTSSAAFLGMMLHLQLLQDEHHVNITEFKDSASEL  173

Query  523   VIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG  702
               P F N +P +  P  +  +  ++  PFL+HAKR R T+G++VNTF ELE + + S+  
Sbjct  174   DFPSFTNLLPAKVLPSVVLTK--ESVRPFLEHAKRMRATKGIIVNTFDELEPHAVRSL-A  230

Query  703   GNDVGPVYPIGPVVDREGPARWHP-DSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
             G     VYP+GP++   G  +    D    + +M+WLD Q  SSVVFL  GS G     Q
Sbjct  231   GLGAPAVYPVGPILSLNGETKEKDIDGHRGDDIMEWLDKQPPSSVVFLCFGSRGWFGEDQ  290

Query  880   IREIATGLERAGYRFLWSIREPPKSK--LDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWV  1053
             ++++A  LER+G+RFLWS+R PP SK  +++P+DY D   VLP GF  RT   G V GW 
Sbjct  291   VKQMACALERSGHRFLWSLRRPPLSKGQVEIPSDYADPAEVLPEGFLHRTASVGKVIGWA  350

Query  1054  PQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT  1233
             PQ  +LAH+AIGGFVSHCGWNS LE+L  GV + TWP+ AEQ  NAF++V ELGLA EI 
Sbjct  351   PQAAVLAHRAIGGFVSHCGWNSTLESLWFGVRVATWPLRAEQQFNAFELVVELGLATEIK  410

Query  1234  FDYKDGITL----VSAEDVERGVRKLM-DGDDEVREKVKEYSEMCKRVWMKNGSSAVSLG  1398
              DY+    +    ++A+++E G+RKLM +   E  +KVKE SE  ++   + GSS +SLG
Sbjct  411   MDYRRDFRMESGILTADEIEGGIRKLMEEAGSESWKKVKEVSEKSRKALTEGGSSYLSLG  470

Query  1399  KLIEE  1413
             +LI++
Sbjct  471   RLIDD  475



>ref|XP_009587669.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6 {ECO:0000303|PubMed:18487633}-like 
[Nicotiana tomentosiformis]
Length=482

 Score =   385 bits (990),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 204/481 (42%), Positives = 299/481 (62%), Gaps = 25/481 (5%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-DG  189
             K+ ++VF+ +P IG+LV  VE +KLL  + + LS+TVL+I  P    + SYI S+A+   
Sbjct  5     KKIELVFIPSPGIGHLVSTVEMAKLLIAREEQLSITVLIIQWPNDKKLDSYIQSVANFSS  64

Query  190   NLEFLSLPAAEPPSPDQNRSTISFL-----SIWIENHEPHVRRALTK-LKSDDDVRIAGF  351
              L+F+ LP        Q+ S +  L     + +I +H+P VR A+   LKS+ +  +AG 
Sbjct  65    RLKFIRLP--------QDDSIMQLLKSNIFTTFIASHKPAVRDAVADILKSESNNTLAGI  116

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYV-  525
              +D+FCTS IDVA E ++P Y+++ S A+ L    HI  L  +  K+ +++ D  +E + 
Sbjct  117   VIDLFCTSMIDVANEFELPTYVFYTSGAATLGLHYHIQNLRDEFNKDITKYKDEPEEKLS  176

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             I  + NP P +  P     +   + + FL  AKR+RET+G+++NTF ELES+ L S+   
Sbjct  177   IATYLNPFPAKCLPSVALDKEGGSTM-FLDLAKRFRETKGIMINTFLELESHALNSLSRD  235

Query  706   NDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
              ++ P+YP+GPV++       +  S +    MKWLD+Q +SSVVFL  GS GS    Q++
Sbjct  236   KNLPPIYPVGPVLNLNNVEGDNLGSSDQN-TMKWLDDQPASSVVFLCFGSGGSFEQHQVK  294

Query  886   EIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             EIA  LE +G RFLWS+R PP      P+DY +L+ +LP GF +RTKG G V GW PQ  
Sbjct  295   EIAYALESSGCRFLWSLRRPPTEDARFPSDYENLEEILPEGFLERTKGIGKVIGWAPQFA  354

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             IL+HK++GGFVSHCGWNS LE+   GVPI TWP+YAEQ  NAFQ+VK+L + VEI  DY+
Sbjct  355   ILSHKSMGGFVSHCGWNSTLESTYFGVPIATWPMYAEQQANAFQLVKDLRMGVEIKMDYR  414

Query  1246  DGI------TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
               +       +V AE++E+ +R++MD + E+R KVKE  E  +   M+ GSS  S+G  I
Sbjct  415   KDMKVMGKEVIVKAEEIEKAIREIMDSESEIRVKVKEMKEKSRAAQMEGGSSYTSIGGFI  474

Query  1408  E  1410
             +
Sbjct  475   Q  475



>ref|XP_007216849.1| hypothetical protein PRUPE_ppa021727mg [Prunus persica]
 gb|EMJ18048.1| hypothetical protein PRUPE_ppa021727mg [Prunus persica]
Length=461

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 208/476 (44%), Positives = 300/476 (63%), Gaps = 27/476 (6%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             + A++VF+    IG+++  +E +KLL  ++  L +T+L++  P   L  +   S++   N
Sbjct  3     RPAELVFIPAAGIGHVMSTIEIAKLLVSRDDRLFITLLIMKRPFDKLFTNTDSSISPCIN  62

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV-----RIAGFFV  357
               F++LP       D   + +S    ++EN +  VR A+ KL   +       R+AGF V
Sbjct  63    --FVNLP-------DPETTDLSCFKFFVENQKTQVRDAVAKLVESNQSGSSKPRLAGFVV  113

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIPG  534
             DMFCT+ IDVA E ++P Y++F S A+ L  + H+ TL  +  K+ +EF  +  + V+P 
Sbjct  114   DMFCTTMIDVANEFEVPSYVFFTSSAACLGLLFHLQTLRDEHGKDVTEFMHSDSDLVVPS  173

Query  535   FENPVPVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
             F NP+P    P   + K   ++   FL +A+R+RET+G++VNTF ELES+ L S+  G +
Sbjct  174   FVNPLPASVLPGKLLDKESAES---FLNYARRFRETKGILVNTFWELESHALHSISYGKN  230

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
               PVYP+GP+++ +         W+   ++ WL +Q   SVVFL  GSMGS   AQ++EI
Sbjct  231   -PPVYPVGPLLNIKSSE--DDKVWD---ILSWLHDQPPLSVVFLCFGSMGSFGEAQVKEI  284

Query  892   ATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             A  LE  G RFLWS+R+PP K K+ +P+DY D   VLP GF DRT   G V GW PQV I
Sbjct  285   AYALEHTGPRFLWSLRQPPPKGKMAMPSDYADTSAVLPEGFLDRTAKIGKVIGWAPQVDI  344

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-K  1245
             LAH +IGGFVSHCGWNS LE+L +GVP+ TWP+YAEQ  NAF++VKELGLAVEI  DY K
Sbjct  345   LAHSSIGGFVSHCGWNSTLESLWYGVPVATWPMYAEQQTNAFELVKELGLAVEIKMDYRK  404

Query  1246  DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             D   +V A+D+ER +R++M+ D  +R++VKE SE  K+  M  GSS  SLG+ I++
Sbjct  405   DSEVVVGAQDIERAIRQVMEHDSVIRKRVKEMSEKSKKSLMNGGSSYSSLGRFIDQ  460



>ref|XP_006373644.1| hypothetical protein POPTR_0016s01890g [Populus trichocarpa]
 gb|ERP51441.1| hypothetical protein POPTR_0016s01890g [Populus trichocarpa]
Length=478

 Score =   385 bits (988),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 207/483 (43%), Positives = 303/483 (63%), Gaps = 26/483 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+  P I +L+  VE +KLL  +++ LS+T L++++        YIDSL++  
Sbjct  1     MKKAELVFIPAPGISHLMSTVEVAKLLLDRDERLSITFLIMSLSYDSKTACYIDSLSATC  60

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSD-----DDVRIAGF  351
             N + F+ LP  EP  P+      +FL   I   + HV+  ++KL S      D   +AGF
Sbjct  61    NRIRFIKLPEDEP-EPN------TFLFSLIGTQKRHVKEEVSKLVSQSESSPDSPTLAGF  113

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVI  528
              +D FCTS IDVA E  +P Y++  + A++L    +I  L D Q    ++F D+  E V+
Sbjct  114   VLDFFCTSMIDVANEFGVPSYIFLTTGAAYLGLQFYIQALHDEQRVDATQFKDSNAELVM  173

Query  529   PGFENPVPVESFPPFMSKRHEDTYLP-FLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             P    P+P ++ P   S      +LP FL  A+R+RET+G++VNTF+ELES+ + S   G
Sbjct  174   PCLAYPLPAKALP---SAALNKEWLPAFLDQARRFRETKGIIVNTFEELESHAINSFSNG  230

Query  706   NDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
             N   PVYP+GP+++         +S   + + +WLD+Q  SSVV+L  GSMGS    Q++
Sbjct  231   N-TPPVYPVGPILNLNRDGDHDVESDKRKDIKQWLDDQPLSSVVYLCFGSMGSFGVDQVK  289

Query  886   EIATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             EIA GLE++G+RFLWS+R+P PK K+++P+DYT+   VLP GF DRT   G + GW PQ+
Sbjct  290   EIACGLEQSGHRFLWSLRKPQPKGKMEIPSDYTNTQDVLPEGFLDRTAKIGKIIGWGPQI  349

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              IL+H ++GGFVSHCGWNSILE++  GVPI  WP+ AEQ LNAF+++ ELG  VEI  DY
Sbjct  350   DILSHPSVGGFVSHCGWNSILESIWFGVPIAAWPLQAEQQLNAFKIIVELGFGVEIKMDY  409

Query  1243  K------DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKL  1404
             +      D   ++SA ++ERG+R LM+   E  E++KE SE  ++  M+ GSS   LG+L
Sbjct  410   RREFFYDDNENIISAGEIERGIRCLMELGREKVERLKEMSEKSRKALMEGGSSYTWLGQL  469

Query  1405  IEE  1413
             I E
Sbjct  470   IHE  472



>ref|XP_004248013.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Solanum 
lycopersicum]
Length=476

 Score =   384 bits (987),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 204/476 (43%), Positives = 300/476 (63%), Gaps = 19/476 (4%)
 Frame = +1

Query  22    KVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGNLEF  201
             +++F+    +G++V  +EF+K + ++++N S++ L++ +P    ++++I SL S   L+F
Sbjct  3     ELIFIPLAGLGHIVSAIEFAKQILNKDENFSISFLIMELPLDYGVKNFIQSLTSQPRLKF  62

Query  202   LSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFCTSFI  381
             + +   E  S     +  +FL  +I+ H+P VR  +  +         GF +DMFCTS I
Sbjct  63    IDITLDEKTSSQFLNNHETFLYDFIDGHKPRVREYVHNICKTSPCY--GFVLDMFCTSMI  120

Query  382   DVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENPVPVE  558
             D+A E ++P Y+YFAS ASFL   LH  TL + Q    S + ++ +   IP F+N  P +
Sbjct  121   DIANEFNVPSYIYFASNASFLGLCLHFETLRNEQHSDTSRYMNSNEALSIPCFKNLCPTK  180

Query  559   SFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYPIGP  738
               P  +      + L F    +R++ET+G++VNTF ELES+ L ++     V  +YP+GP
Sbjct  181   VLPKHLLDSRLASTL-FFDGIRRFKETKGIIVNTFFELESFSLQALLDSKMVPKIYPVGP  239

Query  739   VVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAGY  918
             VV  E    +  +S   E  +KWLD+Q  SSVVFL  GSMGS    Q++EIAT LE +G+
Sbjct  240   VVSFEKSGHFINNSLEIESTIKWLDDQQDSSVVFLCFGSMGSFEAEQVKEIATALEHSGH  299

Query  919   RFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIGGF  1095
             RFLWS+R+ PPK K+D+P  Y+D + VLP GF +RTK +G + GW PQVTIL+H +IGGF
Sbjct  300   RFLWSLRKSPPKGKVDIPTSYSDYEEVLPKGFLERTKERGKIIGWAPQVTILSHPSIGGF  359

Query  1096  VSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-------KDGI  1254
             VSHCGWNSILE++  GVPI TWP+YAEQ +NAF +VKELGL  EI  DY        + +
Sbjct  360   VSHCGWNSILESVHFGVPIATWPLYAEQQMNAFLLVKELGLGEEIRLDYAVDFEGKNNQV  419

Query  1255  TLVSAEDVERGVRKLM--DGDDEVREKVKEYSEMCKRVWMKNGSSAV-SLGKLIEE  1413
               VSA+++E G+ KLM    ++EVR+K+KE S    RV M+ G S+  SLG LI++
Sbjct  420   DTVSAQEIESGLLKLMVKSEENEVRKKMKEKS----RVAMEEGGSSYNSLGLLIKD  471



>ref|XP_010657555.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like isoform 
X2 [Vitis vinifera]
Length=450

 Score =   383 bits (984),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 203/456 (45%), Positives = 288/456 (63%), Gaps = 16/456 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MKQ ++VF+  P I +L P VE +KLL+ ++   S+T+ ++  P        IDS+ +D 
Sbjct  1     MKQTELVFIPVPIISHLSPTVEIAKLLTQRDPRFSITIFIMKFPF-----GSIDSMTTDS  55

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
             + + F++LP  E  S         F+S +I+     VR A+ +L   + VR+AGF +D+ 
Sbjct  56    DSIRFVTLPPVEISSGATTPG--PFMSEFIKAQTLLVRDAVHELTRSNSVRLAGFVIDVM  113

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFEN  543
             CT  IDVA+E  +P YL+  S A+ L F+LH+  L D +     EF ++  E  +P + N
Sbjct  114   CTHMIDVADEFGVPSYLFSTSSAASLGFLLHLQFLHDYEGLNLDEFKNSDAELQVPSYAN  173

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPV  723
              VP + FP  +  +  D     + H +R R+ +GV+VNTF +LES+ + S F G+ V PV
Sbjct  174   SVPGKVFPTMIFDKGVDGAAGHMYHMRRLRQAKGVMVNTFIDLESHAIQS-FSGSTVPPV  232

Query  724   YPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             YP+GP+++ R G   +  D  N   +M WLD+Q  SSVVFL  G MGS    QI+EIA G
Sbjct  233   YPVGPILNTRTG---FGEDQQNASAIMSWLDDQPPSSVVFLCFGGMGSFGTDQIKEIAYG  289

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LER+G+RFLWS+R+ P K K+  P DY +++ VLP GF  RT   G + GW PQV +LAH
Sbjct  290   LERSGHRFLWSLRQAPQKGKMAFPRDYENIEEVLPDGFLHRTARIGKIIGWAPQVAVLAH  349

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGI  1254
              A+GGFVSHCGWNS+LE++ +GVP+ TWPIYAEQ +NAFQMVK+LGLAVEI  DY KD  
Sbjct  350   TAVGGFVSHCGWNSLLESIWYGVPVATWPIYAEQQINAFQMVKDLGLAVEIKIDYNKDNN  409

Query  1255  TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRV  1362
              +V+A ++E G+RKLM  + EVR+K+ E     + V
Sbjct  410   YIVNAHEIENGLRKLMSINSEVRKKMNEMQHFIENV  445



>ref|XP_007202984.1| hypothetical protein PRUPE_ppa018805mg [Prunus persica]
 gb|EMJ04183.1| hypothetical protein PRUPE_ppa018805mg [Prunus persica]
Length=479

 Score =   384 bits (986),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 211/489 (43%), Positives = 303/489 (62%), Gaps = 31/489 (6%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQ---------  159
             + + A +VF+ +P IG++V  VE +K L  ++ +L +TVLLI   + P ++         
Sbjct  1     MKRPAHLVFIPSPAIGHIVSTVEIAKQLVARDDHLFITVLLIT--KLPAVEDDQHKYFIT  58

Query  160   --SYIDSLASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDD  333
               +   S++S   + F++LP    P+      T S  S+ +E+ +P +R A+ KL     
Sbjct  59    DNTRDSSVSSQQRISFVNLPEEAGPT------TASSFSV-VEDRKPLIRDAIAKLADSKA  111

Query  334   VRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKN-SEFGD  507
              R+AG  +DM CT+ +DVA EL +P Y+++ S A+ L FML +  L D    K+ +E   
Sbjct  112   TRLAGLVIDMLCTAIVDVANELGLPSYIFYTSNAASLGFMLDLQRLRDESGGKHVAELMG  171

Query  508   AAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCL  687
              A E V+P F  PVP    P  +  +  +    FL HA+R+RET+G++VNTF +LE + L
Sbjct  172   PAAELVVPSFACPVPARVLPGILLDK--EGAESFLSHARRFRETKGILVNTFLDLEPHAL  229

Query  688   GSMFGG-NDVGPVYPIGPVVDREG---PARWHPDSWNHEL-VMKWLDNQLSSSVVFLTTG  852
              S+    +   PV+P+GP+++ +    P     D  N +  +  WLD+Q  SSVVFL  G
Sbjct  230   RSLSDSQSQTPPVFPVGPLLNLKSNDLPQGRGGDHANQKSDIFDWLDDQPPSSVVFLCFG  289

Query  853   SMGSLNPAQIREIATGLERAGYRFLWSIREPPKSK--LDLPNDYTDLDHVLPPGFSDRTK  1026
             SMGS   AQ+REIA  LER G+ FLWS+R+PP+    + +P D+ D   VLP GF DRT 
Sbjct  290   SMGSFVEAQVREIACALERTGFPFLWSLRQPPQEGNWIAMPKDHADPKSVLPQGFLDRTA  349

Query  1027  GKGMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVK  1206
             G G V GW PQV ILAH+AIGGFVSHCGWNS LE+L + VP+G WP+YAEQ LNAF++VK
Sbjct  350   GIGKVIGWAPQVAILAHRAIGGFVSHCGWNSTLESLWYDVPVGAWPLYAEQPLNAFELVK  409

Query  1207  ELGLAVEITFDYKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSA  1386
             ELGLAV+I  D KD   +V+AE++ERG+R +M  D ++RE+VKE S+  K+  M  GSS 
Sbjct  410   ELGLAVDINIDAKDNQLVVNAEEIERGIRHVMKHDSDIRERVKEMSQQSKKALMDGGSSY  469

Query  1387  VSLGKLIEE  1413
              SLG+ I++
Sbjct  470   SSLGRFIDQ  478



>ref|XP_011001030.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 6-like isoform 
X1 [Populus euphratica]
Length=482

 Score =   384 bits (987),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 210/483 (43%), Positives = 305/483 (63%), Gaps = 22/483 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ TP I +LV  VE +KLL  +++ LS+T L++ +   P I  +I+S+++  
Sbjct  1     MKKAELVFIPTPGISHLVSTVEVAKLLVDRDERLSITFLIMKLRSDPKIDRFINSVSTAC  60

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAGF  351
             N + F+ LP  EP  P+Q R    FL   IE   PHV+  + KL      S D   +AGF
Sbjct  61    NRIRFIDLPKDEP-DPNQPRK---FLFSLIEAQIPHVKEEVFKLVSQSESSPDSPPLAGF  116

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVI  528
              +DMFCTS IDVA E  +P Y++F S A+FL    ++  L D Q    +EF  +  E V+
Sbjct  117   VLDMFCTSMIDVATEFGVPSYIFFTSGAAFLGLQFYVQDLHDEQKVDPTEFKGSDAELVM  176

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P   NP+P +  P  M   +++   P L+ A+R+RE++G+++NTF+ELES+ + S   GN
Sbjct  177   PCLANPLPAKVLPSVM--LNKEWLPPVLRQARRFRESKGIIINTFEELESHAMDSFSKGN  234

Query  709   DVGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
                PVYP+GP+++          +S   + + +WLD+Q  SSVV+L  GSMGS    Q++
Sbjct  235   -TPPVYPVGPILNLNRDDGDGDEESDKRKDIKQWLDDQPLSSVVYLCFGSMGSFGVDQVK  293

Query  886   EIATGLERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             EIA GLE++G+RF WS+R+P PK K+++P+DYT+   VLP GF DRT   G + GW P++
Sbjct  294   EIACGLEQSGHRFSWSLRKPQPKGKMEIPSDYTNPQDVLPEGFLDRTAKIGKIIGWGPEI  353

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD-  1239
              IL+H ++GGFVSHCGW+SILE++  GVPI  WPI AEQ LNAFQ++ ELG  VEI  D 
Sbjct  354   DILSHPSVGGFVSHCGWSSILESIWFGVPIAAWPIQAEQQLNAFQIIVELGFGVEIKMDC  413

Query  1240  -----YKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKL  1404
                  Y D   ++SA ++ERG+R LM+   E  E++KE SE  ++  M+ G S   LG+L
Sbjct  414   RREFFYDDNENIISAGEIERGIRCLMEIGKEKVERLKEMSEQSRKALMEGGCSNTWLGQL  473

Query  1405  IEE  1413
             I E
Sbjct  474   IHE  476



>ref|XP_011001032.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Populus 
euphratica]
Length=488

 Score =   384 bits (987),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 216/489 (44%), Positives = 309/489 (63%), Gaps = 28/489 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ TP I +LV  VE +KLL  +++ LS+  L++ +   P I  +I+S+++  
Sbjct  1     MKKAELVFIPTPGISHLVSTVEVAKLLVDRDERLSIAFLIMKLRSDPKIDRFINSVSTAC  60

Query  190   N-LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAGF  351
             N + F+ LP  EP  P+Q R    FL   IE   PHV+  ++KL      S D   ++GF
Sbjct  61    NRIRFIDLPKDEP-DPNQPRK---FLFSLIEAQIPHVKEEVSKLVSLYESSPDPPTLSGF  116

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVI  528
              +DMFCT  IDVA E  +P Y++  S A+ L    ++  L D Q    +EF  +  E V+
Sbjct  117   VLDMFCTPMIDVANEFGVPSYIFLTSSAASLGLQFYVQALHDEQKVDPTEFKGSDAELVM  176

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P  ENP+P +  P FM  +   T+  FL  A+R+RE++G+++NTF+ LES+ + S F  +
Sbjct  177   PCLENPLPAKVLPSFMFNKEWLTF--FLGLARRFRESKGIIINTFEALESHAIDS-FSKD  233

Query  709   DVGPVYPIGPVVD------REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLN  870
             +  PVYP+GP+V+       +G      +S  ++ + +WLD+Q  SSVV+L  GSMGS  
Sbjct  234   NTPPVYPVGPIVNLHRDGDGDGDGDGDEESDKYKDIKQWLDDQPLSSVVYLCFGSMGSFG  293

Query  871   PAQIREIATGLERAGYRFLWSIREPP-KSKLDL-PNDYTDLDHVLPPGFSDRTKGKGMVC  1044
               Q++EIA GLE++G+RFLWS+R+PP K K++L P+DYT+    LP GF DRT   G V 
Sbjct  294   VDQVKEIACGLEQSGHRFLWSLRKPPPKGKMELLPSDYTNPRDALPEGFLDRTAKIGKVI  353

Query  1045  GWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAV  1224
             GW PQ  ILAH ++GGFVSHCGWNSILE++  GVPI TWP+YAEQ LNAF ++ ELGL V
Sbjct  354   GWAPQTDILAHPSVGGFVSHCGWNSILESIWFGVPIATWPLYAEQQLNAFMLIVELGLGV  413

Query  1225  EITFDYK-----DGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSA  1386
             EI  DY+     DG   ++SA ++ERGVR LM+  DE REK+KE S   ++     GSS 
Sbjct  414   EIKMDYRRDFNWDGSENVISAGEIERGVRCLMELCDEKREKLKEMSGKSRKALENGGSSF  473

Query  1387  VSLGKLIEE  1413
               LG+ I++
Sbjct  474   TWLGRFIQD  482



>ref|XP_008362332.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Malus domestica]
Length=474

 Score =   384 bits (985),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 212/480 (44%), Positives = 303/480 (63%), Gaps = 22/480 (5%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             K A++VFV  P IG+++  VE +K L  Q+  L +T+L++ +P   L  +   S++   N
Sbjct  3     KPAELVFVPAPGIGHIISTVEIAKQLVAQDDQLFITILIMKLPFDKLFTNTDSSISHRIN  62

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVR--------IAG  348
               F++LP      P        F++ ++E+H+ HV+ A+TKL +D   +        +AG
Sbjct  63    --FINLPETLVDIP---LVFPFFVNPFVESHKIHVKEAVTKLLTDQSAQSESKNPRALAG  117

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYV  525
             F +DMFCTS IDVA E  +P +L++ S A+ L   LH+ +L  +  K+  E  +++ E V
Sbjct  118   FVIDMFCTSMIDVANEFGVPSFLFYTSSAAMLGLWLHLASLRNEHDKDIYELINSSTEXV  177

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             IP F NPVP + FP  +S +       FL    R+RET+G++VNTF ELE+  + S+  G
Sbjct  178   IPSFVNPVPTKVFPSELSDKEGXAI--FLDFGTRFRETKGILVNTFSELEAXAIHSLSDG  235

Query  706   NDVGPVYPIGPVVD-REGPARWHPDSWNHEL-VMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
                 PVYP+GP+++ +    R  PD    +  ++ WLD+Q   SV+FL  GSMGS   AQ
Sbjct  236   K-TPPVYPVGPLLNLKSDDTRVAPDKAREKSDILDWLDDQPPLSVLFLCFGSMGSFCEAQ  294

Query  880   IREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             ++EIA  LE +G RFLWS+R+PP K  L LP+DY D   VLP GF DRT   G V GW P
Sbjct  295   VKEIACALEHSGLRFLWSLRKPPPKGTLTLPSDYADPKAVLPEGFLDRTATTGKVLGWAP  354

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV IL+H A+GGFVSHCGWNS LE++ HGVPI TWP+YAEQ  NAF+++ ELGLAVEI  
Sbjct  355   QVAILSHPAVGGFVSHCGWNSALESIWHGVPIATWPMYAEQQSNAFELL-ELGLAVEIKM  413

Query  1237  DYK-DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DYK +   +VSAE++ERG++++M+ D + R++VKE SE  K+     GSS  SLG+ I++
Sbjct  414   DYKTESEVVVSAEEIERGIKEVMELDXDTRKRVKETSEKGKKALEFGGSSYTSLGRFIDQ  473



>ref|XP_008378329.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Malus domestica]
Length=471

 Score =   384 bits (985),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 210/479 (44%), Positives = 297/479 (62%), Gaps = 23/479 (5%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLASDG  189
             + A++V V  P IG++V  +E ++ L  ++  L +TVL++ +P  +P   +  DS  S  
Sbjct  3     RPAQLVVVPGPVIGHIVSAIEIAEQLVARDDQLFITVLVMKLPYDQPF--TIADSSISH-  59

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV-------RIAG  348
              + F++LP A+P   +      S + I +ENH+ H+R A+  L S+ D        R+AG
Sbjct  60    RINFVNLPEAQPDKQEAIPKHGSLIRILVENHKTHIRDAVVNLLSESDQSESMSRPRLAG  119

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYV  525
             F +D  C + +DVA+E  +P Y +F S AS L+ + H   L D      +EF  ++ E  
Sbjct  120   FVLDFLCATLVDVADEFMVPSYAFFTSNASLLALLFHFQLLRDEGGIDITEFTRSSAELA  179

Query  526   IPGFENPVPVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG  702
             +P F NP P    P  F  K   ++    L +  R R+ +G++VNTF EL+ + L  +  
Sbjct  180   VPSFINPCPAAVLPGTFADKEITES---ILNYTSRCRQIKGILVNTFLELDLHALHYLDF  236

Query  703   GNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
              + + PVYP+GP+++ +       D      + +WLD+Q S SVVFL  GSMGS + AQ+
Sbjct  237   DDKIPPVYPVGPLLNLK-----RCDENKGSDIFRWLDDQPSLSVVFLCFGSMGSFSEAQV  291

Query  883   REIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             +EIA  LE +G RFLWS+R PP K K+ +P+DY DL+ VLP GF +RT   G V GW PQ
Sbjct  292   KEIACALEHSGQRFLWSLRRPPPKGKIAMPSDYADLNAVLPEGFLNRTAPIGKVIGWAPQ  351

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
               ILAH AIGGFVSHCGWNS LE+L +GVPI TWP+YAEQ+LNAFQ+VKELGLAVEI  D
Sbjct  352   AAILAHPAIGGFVSHCGWNSTLESLWNGVPIATWPMYAEQNLNAFQLVKELGLAVEIKLD  411

Query  1240  Y-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             Y KD   LVSAED+ERG+R+ M+ D +VR++VKE SE  K+  ++ GSS  SL + I +
Sbjct  412   YRKDSDVLVSAEDIERGIRQAMERDGDVRKRVKEMSEKSKKTLVEGGSSYSSLERFINQ  470



>gb|ABL85473.1| gylcosyltransferase UGT71A13 [Maclura pomifera]
Length=493

 Score =   384 bits (986),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 215/493 (44%), Positives = 305/493 (62%), Gaps = 35/493 (7%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS-LAS  183
             I + A++VFV  P +G+LV  VE +KLL  ++  L ++VL+I  P  P   SY +  L+S
Sbjct  2     IGQTAELVFVPAPGMGHLVATVEIAKLLVARDSRLFISVLIIKFPFDPKNTSYAEKFLSS  61

Query  184   DGN------LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL------KSD  327
               N      ++F+ LP ++   PD N  ++ FL  + EN +P VR A+TK+      + D
Sbjct  62    SANSTSTERIQFIDLPESQI-DPDFNAFSL-FLHSFFENQKPLVRDAVTKIVESKSGRPD  119

Query  328   DDVRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFG  504
                R+AGF +D+FCT+ +DVA+E  +P Y+++ S A  LS M H   L D      +EF 
Sbjct  120   SAPRLAGFVLDIFCTTMMDVADEFGVPSYMFYTSGAGSLSLMSHFQALTDKHKIDTTEFT  179

Query  505   DAA-KEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESY  681
             D    E++IPGF N VP +  P  +  +     L  L H ++ R+T+G++VNTF ELES 
Sbjct  180   DKPDTEFLIPGFVNSVPAKVLPGVLFDKVAVPLL--LNHYRKMRKTKGILVNTFIELESN  237

Query  682   CLGSMFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMG  861
              + S+   +++ P+YP+GP+++         D    E+V  WLDNQ  SSVVFL  GSMG
Sbjct  238   VIHSL-CNSELPPIYPVGPILNLNPGGM---DKRTTEIV-TWLDNQPPSSVVFLCFGSMG  292

Query  862   SLNPAQIREIATGLERAGYRFLWSIREPPKS-KLDLPNDYTDLDHVLPPGFSDRTKGKGM  1038
             S    Q+REIA  LE++G RFLWS+R+PP++ K+ LP DY DL+ VLP GF DRT   G 
Sbjct  293   SFGEDQVREIALALEKSGVRFLWSLRQPPENGKVPLPKDYADLNEVLPEGFLDRTTEIGQ  352

Query  1039  VCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGL  1218
             V GW PQVT+LAH +IGGFVSHCGWNS LE+L  GVP+ TWP+YAEQ LNAFQ+ +ELGL
Sbjct  353   VIGWAPQVTVLAHPSIGGFVSHCGWNSTLESLWFGVPVATWPLYAEQQLNAFQLTRELGL  412

Query  1219  AVEITFDYKDG----------ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWM  1368
             AVE+  DY+ G          + ++ AE++ R +R +M+ D + R KVKE SE  ++  +
Sbjct  413   AVEVKMDYRKGFNRGTGNDAEVVVLQAEEIVRAIRCVMEHDSDARNKVKEMSEKSRKGML  472

Query  1369  KNGSSAVSLGKLI  1407
               G +  SLG+ I
Sbjct  473   DGGPAYTSLGRFI  485



>ref|XP_002265067.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 6-like [Vitis 
vinifera]
Length=476

 Score =   383 bits (984),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 204/473 (43%), Positives = 294/473 (62%), Gaps = 11/473 (2%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLAS  183
             +MK+ +++FVS   IG++V  VEF+KLL  ++   S T+L++ +P +     +YI S+++
Sbjct  1     MMKKIELIFVSVSAIGHIVSTVEFAKLLVGRDDRFSATLLIMKLPFEDSAATNYIHSVSA  60

Query  184   D--GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFV  357
                G++ F+ LP  E  S   + ST    S  IE  +P VR A+  L   +  R+AG  V
Sbjct  61    SVSGSIRFVHLP--ELDSDSSSSSTSILFSNIIERQKPLVRDAIHHLTRSESGRLAGIVV  118

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPG  534
             D+ CTS IDVA EL +P Y+YFAS A+ L+ M H+ TL D Q    +EF ++  E V+PG
Sbjct  119   DLLCTSMIDVANELGVPSYVYFASSAACLALMFHLQTLKDHQGLDVTEFANSDAELVVPG  178

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
             F N VP    P     +     + FL  A+ +RE +G++VNTF ELES+ + S   G   
Sbjct  179   FVNSVPARVLPAVAVDKEGGGSMDFLDRARGFREAKGILVNTFVELESHVINSFVDGT-T  237

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              P+Y +GP+++ +       DS     V++WLD+Q +SSVVFL  GS G+ +  QI+EIA
Sbjct  238   PPIYTVGPLLNLQHANNQKQDSGLD--VIRWLDDQPTSSVVFLCFGSAGAFHMDQIKEIA  295

Query  895   TGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLE +G+ FLW++R PP K K+ L +DY + + VLP GF DRT   G + GW PQ  +L
Sbjct  296   IGLENSGHGFLWTLRRPPPKDKMTLSSDYVNFNEVLPEGFLDRTSKIGKIIGWAPQAAVL  355

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-D  1248
             AH A+GGF+SHCGWNS LE++ +GVP+ TWP+YAEQ L AFQ+V+EL + VEI FDY  +
Sbjct  356   AHSAVGGFISHCGWNSTLESIWYGVPVATWPMYAEQQLIAFQIVRELEIGVEIRFDYNMN  415

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
                LVSA+++E  +R LMDG  ++R K     E C +   + GSS  S+ +LI
Sbjct  416   TSNLVSAQEIEGKIRSLMDGSSDIRMKRTRMKEKCMKALTEGGSSDSSIQRLI  468



>ref|XP_007049129.1| UDP-glucosyl transferase 71B6, putative [Theobroma cacao]
 gb|EOX93286.1| UDP-glucosyl transferase 71B6, putative [Theobroma cacao]
Length=508

 Score =   384 bits (986),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 204/483 (42%), Positives = 302/483 (63%), Gaps = 33/483 (7%)
 Frame = +1

Query  16    QAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG--  189
             +A++VFV  P +G+LV  VE +KLL   N NLS+TVL+I  P  P + +YIDSL +D   
Sbjct  36    KAELVFVPMPVMGHLVSTVELAKLLVDLNSNLSITVLIIKTPYDPNLTAYIDSLIADTVT  95

Query  190   ---NLEFLSLPAAE-----PPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV---  336
                 ++F++LP  E     PP+         F++  I+   PH++ A+ K+    +    
Sbjct  96    ISTRIKFINLPQDEAQKGIPPN--------KFMTTIIQIQRPHIKEAIAKIVQYSNSVPN  147

Query  337   --RIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGD  507
               R+ GF +DMF T+ +D+A E  +  Y+++ S A+FL F  ++  L D Q    ++   
Sbjct  148   SPRLVGFVLDMFFTALVDLANEFGVASYIFYTSSAAFLGFQFYMQALRDEQNVDITKLKG  207

Query  508   AAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCL  687
             +  E+ IP + NP+  + FPP M K   +T +  L  A+  RE +G++VN+F ELES+ +
Sbjct  208   SDAEFTIPSYVNPIAAKFFPPLMFKL--ETLIVLLDVARELREVKGIMVNSFLELESHAV  265

Query  688   GSMFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSL  867
              S F   +   V+P+GP+++ +  +R H +S     +MKWLD Q  SSVVFL  GSMGS 
Sbjct  266   DS-FSNGEYPAVFPVGPILNLKSESRVHQNS----NIMKWLDEQPLSSVVFLCFGSMGSF  320

Query  868   NPAQIREIATGLERAGYRFLWSIREPPKSKLDLPN-DYTDLDHVLPPGFSDRTKGKGMVC  1044
                Q++EIA  LE++G+RFLWS+R+PP   + L + +Y +++ VLP GFS RT   G + 
Sbjct  321   GGDQVKEIARALEQSGHRFLWSLRQPPVEVMMLSSTNYENVEEVLPEGFSKRTATIGKII  380

Query  1045  GWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAV  1224
             GW PQV IL H AIGGFVSHCGWNS LE++  GVP+ TWP+YAEQ LNAFQMV ELGL V
Sbjct  381   GWAPQVAILGHPAIGGFVSHCGWNSTLESIWFGVPMATWPLYAEQQLNAFQMVMELGLGV  440

Query  1225  EITFDYKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKL  1404
             EIT+     + +VSAE++ERG++ LM+ D +VR + KE S+  ++  M+ GSS  +L + 
Sbjct  441   EITWT-DATVEIVSAENIERGIKCLMEQDSDVRNRAKEMSKQSRKALMEGGSSHSTLCRF  499

Query  1405  IEE  1413
             I++
Sbjct  500   IDD  502



>ref|XP_011001004.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Populus 
euphratica]
Length=480

 Score =   383 bits (983),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/465 (43%), Positives = 292/465 (63%), Gaps = 9/465 (2%)
 Frame = +1

Query  25    VVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASDGNLEF  201
             +VFV  P IG+LV V+EF+K L  ++ + S+T+LL++ P    + +Y++ L AS    +F
Sbjct  13    LVFVPAPGIGHLVSVMEFAKRLLERDDSFSITMLLMSPPFAHDVTTYVEKLNASHPEFQF  72

Query  202   LSLPAAEPPS-PDQNRSTISFLSIWIENHEPHVRRALTK-LKSDDDVRIAGFFVDMFCTS  375
             L LP   PP   D       F+S++I +H+ HV+  +   + S+  V++AG  +D+FCT+
Sbjct  73    LGLPTVTPPPLEDVLACPEHFVSVFIADHKNHVKDMIVNHVLSNKSVKLAGLVLDLFCTA  132

Query  376   FIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPVPV  555
             F+DVA++L +P Y++FAS A+FL  ML++P  D        +     + +IP + NPVP 
Sbjct  133   FVDVAKDLGVPSYIFFASGAAFLGSMLYLP--DRFDKGGVTYKPTDPDSIIPSYINPVPS  190

Query  556   ESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYPIG  735
                P  +   H+  Y  F+ HA++++E +G++VNTF ELES+ +  + G   V  VY +G
Sbjct  191   RVLPSLL--FHDGGYSTFVSHARKFKEAKGIIVNTFAELESHAVNYLNGEAGVPHVYTVG  248

Query  736   PVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAG  915
             PVVD +G +    D    E +MKWLD Q   SVVFL  GS GS    Q++EIA GLE++G
Sbjct  249   PVVDHKGNSPV-ADGNQREEIMKWLDAQPEKSVVFLCFGSQGSFGVLQLKEIALGLEQSG  307

Query  916   YRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIGGF  1095
              RFLWSIR PP  +   P +  D   +LP GF  RTK  G +CGW PQV +LAHKA G F
Sbjct  308   QRFLWSIRRPPSQESLNPGEVNDFSELLPEGFLGRTKNVGFICGWAPQVEVLAHKATGAF  367

Query  1096  VSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGITLVSAE  1272
             VSHCGWNSILE+  +GVP+ TWP+Y EQ +NAFQ+VK+ G+A+E+  DY KDG  +V A 
Sbjct  368   VSHCGWNSILESTWYGVPVVTWPLYGEQQINAFQLVKDAGVAIEMKMDYRKDGGEVVKAG  427

Query  1273  DVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
              V + V+ +++G  +V+ KVK  SE  ++  ++ GSS V+   L+
Sbjct  428   QVAKAVKDVIEGASDVKSKVKAMSETGRKALLEGGSSYVAFETLV  472



>ref|XP_008342308.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Malus domestica]
Length=474

 Score =   382 bits (981),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 209/480 (44%), Positives = 304/480 (63%), Gaps = 22/480 (5%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             K A++VF+  P IG+++  VE +K L  ++  L +T+L++ +P   L  +   S++   N
Sbjct  3     KPAELVFIPAPGIGHIISTVEIAKQLVARDDQLFITILIMKLPFDKLFTNTDSSISHRIN  62

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVR--------IAG  348
               F++LP      P      +SF++ ++E+H+ HV+ A+TKL +D   +        +AG
Sbjct  63    --FINLPETVVDIP---LVFLSFVNPFVESHKIHVKEAVTKLLTDQSAQSESKNPRVLAG  117

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYV  525
             F +DMFCTS IDVA E  +P +L++ S A+ L   LH+ +L  +  K+  E  +++ E+V
Sbjct  118   FVIDMFCTSMIDVANEFGVPSFLFYTSSAAMLGLWLHLASLRNEHDKDIYELINSSTEFV  177

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             IP F NPVP + FP  +S +  +    FL    R+RET+G++VNTF ELE+  + S+  G
Sbjct  178   IPSFVNPVPTKVFPSELSDK--EGVAIFLDFGTRFRETKGILVNTFSELEAXAIHSLSDG  235

Query  706   NDVGPVYPIGPVVD-REGPARWHPDSWNHEL-VMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
                 PVYP+GP+++ +    R  PD    +  ++ WLD+Q   SV+FL  GSMGS   AQ
Sbjct  236   K-TXPVYPVGPLLNLKSDDTRVAPDKAREKSDILDWLDDQPPLSVLFLCFGSMGSFCEAQ  294

Query  880   IREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             ++EIA  LE +G RFLWS+R+PP K  L LP+DY D   VLP GF DRT   G V GW P
Sbjct  295   VKEIACALEHSGLRFLWSLRKPPPKGTLTLPSDYADPKAVLPEGFLDRTATTGKVLGWAP  354

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV IL+H A+GGFVSHCGWNS LE++ HGVPI TWP+YAEQ  NAF+++ ELGLAVEI  
Sbjct  355   QVAILSHPAVGGFVSHCGWNSALESIWHGVPIATWPMYAEQQSNAFELL-ELGLAVEIKM  413

Query  1237  DYK-DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             D K +   +VSAE++ERG++++M+ D + R++VK  SE  K+     GSS  SLG  I++
Sbjct  414   DXKTESEVVVSAEEIERGIKEVMELDSDTRKRVKXTSEKGKKALEFGGSSYTSLGXFIDQ  473



>ref|XP_010645106.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Vitis 
vinifera]
Length=481

 Score =   382 bits (982),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 214/490 (44%), Positives = 292/490 (60%), Gaps = 42/490 (9%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVL----LINMPQRPLIQSYIDSLA  180
             K A++VF+  P IG+ + +V+ +K L +++  LSVT+L         Q P       S A
Sbjct  4     KFAELVFLPVPEIGHFLSMVDLAKRLVNRHHRLSVTILTYSTFFATVQLP------SSAA  57

Query  181   SDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDD-------DVR  339
             S   + FL+LP  +PP P Q  S  +  S++ ++ +PHV+ A+T     D         R
Sbjct  58    SLPGIRFLNLPHVDPP-PLQGVSGEACQSLFQQHLKPHVKHAITTRHGGDTESDPKYSSR  116

Query  340   IAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKE  519
             +AG  +D F T+ IDVA+EL +P Y+YF S A+FL F+L++P LD+Q+      G  A E
Sbjct  117   LAGLVLDFFSTAVIDVADELGVPAYVYFPSGAAFLGFLLNLPALDSQL------GGLATE  170

Query  520   YVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF  699
               IP F  PVP    P    ++ +D Y   L HA+R+RET+G++VN+F  LE   L  + 
Sbjct  171   LTIPSFFEPVPTSELPSVFLEKDQDGYHWMLYHARRFRETKGIIVNSFTGLEP-GLADLV  229

Query  700   GGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
                D  PVYP+GP++D+        D    + +MKWLD+Q   SVVFL  GS G+    Q
Sbjct  230   SKVDCPPVYPVGPLLDQ-----IEADRSGEDRIMKWLDDQPVGSVVFLCFGSRGAFGVGQ  284

Query  880   IREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             + EIA GLE +GYRFLWS+R+PP+ K   P+D+T+ D VLP GF DRT  KG+VCGW PQ
Sbjct  285   VHEIAHGLEHSGYRFLWSLRQPPRVKHLPPSDHTNFDGVLPEGFLDRTAEKGLVCGWAPQ  344

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT--  1233
               IL H +IGGFVSH GWNSI+E+L  GVPI  WPIYAEQ LN +++V++LGL VE+T  
Sbjct  345   FKILYHPSIGGFVSHGGWNSIMESLWCGVPILVWPIYAEQKLNRYRIVRDLGLGVEVTEN  404

Query  1234  ----------FDYKDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSS  1383
                         Y DG  LV  E V+  V+ LMDG+ EVR KVK+ SE C+      GSS
Sbjct  405   DEDMNGRDLLMAYTDGGHLVKREKVKVAVKALMDGESEVRRKVKQMSETCRETVRDGGSS  464

Query  1384  AVSLGKLIEE  1413
               SLG+ I +
Sbjct  465   FASLGQFITD  474



>ref|XP_010657882.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Vitis vinifera]
Length=416

 Score =   380 bits (976),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 188/379 (50%), Positives = 263/379 (69%), Gaps = 10/379 (3%)
 Frame = +1

Query  292   HVRRALTKLKSDDDVRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL  471
             H R A+ ++   + VR+ GF +DMFCTS  DVA+E ++P YL+F S A+FL FM H+  L
Sbjct  36    HSRDAVHEITRSNSVRLGGFVIDMFCTSMTDVADEFEVPSYLFFTSSAAFLGFMFHLQFL  95

Query  472   -DAQVPKNSEFGDAAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGV  648
              D +    +EF D+  E  +P + NPVP + FP  M  +       FL H +R+R+ +G+
Sbjct  96    HDYEGLDFNEFKDSHAELEVPSYANPVPGKVFPSVMFDKEGCGAEKFLYHTRRFRQVKGI  155

Query  649   VVNTFKELESYCLGSMFGGNDVGPVYPIGPVVDREGPA--RWHPDSWNHELVMKWLDNQL  822
             +VNTF ELES+ + S F G+ + PVYP+GPV++ +G +  R   DS     VM WLD+Q 
Sbjct  156   MVNTFVELESHAIQS-FSGSTIPPVYPVGPVLNTQGGSVGRQQDDS----AVMTWLDDQP  210

Query  823   SSSVVFLTTGSMGSLNPAQIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVL  999
              SSV+FL  GSMGS    Q++EIA GLER+G+RFLWS+R+PP K K++ P++Y +++ VL
Sbjct  211   PSSVLFLCFGSMGSFGGDQVKEIAHGLERSGHRFLWSLRQPPPKGKIESPSNYANVEEVL  270

Query  1000  PPGFSDRTKGKGMVCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQ  1179
             P GF  RT   G V GW PQV ILAH A+GGFVSHCGWNS LE++ +GVP+ TWP++AEQ
Sbjct  271   PEGFLHRTARIGKVIGWAPQVAILAHSAVGGFVSHCGWNSTLESMYYGVPVATWPMFAEQ  330

Query  1180  HLNAFQMVKELGLAVEITFDY-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCK  1356
              +NAFQMVK+LGLAVEI  DY KD   +VSA+++E G++ LM+ D+EVR+K +E  ++ +
Sbjct  331   QINAFQMVKDLGLAVEIKMDYNKDSSYIVSAQEIEIGLKNLMNIDNEVRKKREEMKKISR  390

Query  1357  RVWMKNGSSAVSLGKLIEE  1413
             +V ++ GSS  SLG  IE+
Sbjct  391   KVMIEGGSSHFSLGHFIED  409



>gb|KCW88568.1| hypothetical protein EUGRSUZ_A00948 [Eucalyptus grandis]
Length=487

 Score =   382 bits (982),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 214/487 (44%), Positives = 306/487 (63%), Gaps = 25/487 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M  AK++F+ TP +G+LV +VE +KL+  ++  LSVTVLL+  P    + SY +SLA+ G
Sbjct  1     MADAKLLFIPTPGLGHLVAMVEMAKLIVDRDPRLSVTVLLMKYPFDSDVDSYTNSLATSG  60

Query  190   ---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFF  354
                 L F+ LP     + D   S+  FL+ ++E+++P V+RA+ +L   +    R+AGF 
Sbjct  61    ASPRLCFVHLPR---DNDDSQSSSAHFLTNFVESNKPRVKRAVAELADSAGSTGRLAGFV  117

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFCT+ ID+A+EL +P Y+ F S A+FL  MLH+ +L D      +E+ D+A E   P
Sbjct  118   LDMFCTTMIDLADELGVPSYVLFTSSAAFLGMMLHLQSLQDEHHVDITEYKDSAAELDFP  177

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
                NP+P +  P  +  +  +T  PFL HAKR R  +G+++NTF ELE + L S+  G  
Sbjct  178   SLTNPLPAKVLPGLVLLK--ETVRPFLGHAKRMRAAKGIIINTFDELEPHALRSL-AGLG  234

Query  712   VGPVYPIGPVVDREGPARWHPDSWNH-ELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
                VYP+GP+++ +G  +           +M+WLD Q  SSVVFL  GSMGSL   Q++E
Sbjct  235   APAVYPLGPILNLKGETKTKACGGRQGNDIMEWLDKQPPSSVVFLCFGSMGSLGEEQVKE  294

Query  889   IATGLERAGYRFLWSIRE-PPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ-V  1062
             +A  LER+G+RFLWS+R+ PPK K+  P+D  D    LP GF DRT   G V GW PQ V
Sbjct  295   MACALERSGHRFLWSLRQAPPKDKVWFPSDLVDPTEALPEGFLDRTATIGKVIGWAPQRV  354

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              +LAH AIGGFVSHCGWNS LE++  GVP+ T P+Y EQ  NAF++V ELG+AVEI  DY
Sbjct  355   AVLAHPAIGGFVSHCGWNSALESIRFGVPMATLPLYGEQQFNAFELVVELGVAVEIKMDY  414

Query  1243  K---------DGITLVSAEDVERGVRKLMDG-DDEVREKVKEYSEMCKRVWMKNGSSAVS  1392
             +         +   +V+A+ +E G++KLM+  D + R+KV E SE  +   ++ GSS +S
Sbjct  415   QRHPRRDPRLESDFVVTADVIEGGIKKLMEEVDSDRRKKVNEASEKSRMAVIEGGSSYLS  474

Query  1393  LGKLIEE  1413
             LG LIE+
Sbjct  475   LGCLIED  481



>ref|XP_006374910.1| hypothetical protein POPTR_0014s02620g [Populus trichocarpa]
 gb|ERP52707.1| hypothetical protein POPTR_0014s02620g [Populus trichocarpa]
Length=488

 Score =   382 bits (982),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 193/476 (41%), Positives = 298/476 (63%), Gaps = 15/476 (3%)
 Frame = +1

Query  4     AIMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-A  180
             + MK+A++VFV  P IG+LV  V F+KL+  + +N  +T+L+IN P  P + SY++SL A
Sbjct  16    STMKRAQLVFVPCPGIGHLVSTVGFAKLILERTENFLITMLVINHPYDPSVNSYVESLVA  75

Query  181   SDGNLEFLSLPA-AEPPSPDQNRSTISFLSIWIENHEPHVRRALT-KLKSDDDVRIAGFF  354
             +   ++ +++PA A PP       T    + +I +H P VR A+  ++ ++    +A   
Sbjct  76    THTQIKSITIPAIAAPPV---EALTEKVFTQFIRDHSPLVRDAIVNQVIANSPAPVASVI  132

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             VD+FC  FIDVA+EL +P Y++F S A+F    +++    D   PK   F ++  +Y IP
Sbjct  133   VDLFCACFIDVAKELGVPSYVFFCSDAAFYGLTVYLSEREDGGQPK---FRESDLDYTIP  189

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
              + NPVP    P       +  Y  F    ++Y+E+ GV++NTF ELES+ + ++   +D
Sbjct  190   SYANPVPYRVLPLV---HRDQAYETFGALGRKYKESNGVIINTFSELESHAVNTLVARDD  246

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
             +  ++ +GP++D +G      ++   + +MKWLD+Q  +SVVFL  GS G+    Q++EI
Sbjct  247   LPSIFTVGPLIDHKGKGLSGSEAAKRDEIMKWLDDQHENSVVFLCFGSQGAFREEQLKEI  306

Query  892   ATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
             A GLER+G  FLW++R+PP     +P  YT  D + P  F ++TK  G +CGW PQV +L
Sbjct  307   AIGLERSGQLFLWAVRKPPSPGEIMPGYYTRYDEIFPAEFLEKTKNIGRLCGWAPQVEVL  366

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AH+A+G FVSHCGWNS LE+L +GVPI TWP Y EQ +NAFQ+VK+LGLAVE+T D++  
Sbjct  367   AHRAVGAFVSHCGWNSTLESLWYGVPIITWPYYGEQQINAFQLVKDLGLAVELTLDFRRD  426

Query  1252  IT--LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +   V AED+ + V+ +M+   E R+K K   E+ K+V ++ GSS V+ G+LIE+
Sbjct  427   CSTDFVKAEDITKAVKYMMEQGSEYRDKAKATGEIAKQVLLEGGSSYVAFGRLIEQ  482



>gb|KCW88556.1| hypothetical protein EUGRSUZ_A00934, partial [Eucalyptus grandis]
Length=469

 Score =   381 bits (979),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 210/476 (44%), Positives = 295/476 (62%), Gaps = 22/476 (5%)
 Frame = +1

Query  19    AKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS--DGN  192
             +++VFV  P +G+LV ++E +KLL  ++  LSV VL++  P    I+S ++S A+     
Sbjct  5     SELVFVPFPALGHLVSMLEMAKLLIDRDNRLSVMVLVMKSPLDSEIESRVESFAALVASR  64

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFCT  372
             + F+ LP     +P    S  + L+ ++E+H+  VR A+  L +    R+ G  VDMFCT
Sbjct  65    IRFIFLPRQ---NPSLEASPFAILNQFMESHKAGVRDAIAGLSACGSSRLEGLVVDMFCT  121

Query  373   SFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENPV  549
             S IDVA E  IP Y++  S  + L  ML++ +L + Q    +    +  E   P F NP+
Sbjct  122   SMIDVAIEFSIPSYVFIPSGGALLGLMLYLQSLQEEQHMDLTRLKGSDAELDFPCFANPL  181

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYP  729
             P   F P      ED  + FL HA+R+RET+G++VNTF ELE   + ++  G     VYP
Sbjct  182   PAAKFLPAEVFMKEDCRI-FLGHAQRFRETKGILVNTFTELEPRAVEAL-AGLGAPAVYP  239

Query  730   IGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLER  909
             +GP+++         +S     ++ WLD Q ++SVVFL  GS GS +  Q++EIA  LER
Sbjct  240   VGPILN------IKVESIKGFEILDWLDQQSNASVVFLCFGSFGSFDQDQVKEIARALER  293

Query  910   AGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAI  1086
             +G  FLWS+R+PP K KL+ P DY D   VLP GF DR  G G V GW PQV +LAH+AI
Sbjct  294   SGCHFLWSLRQPPAKGKLEGPCDYADPAEVLPEGFIDRMAGVGRVIGWAPQVAVLAHQAI  353

Query  1087  GGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGI----  1254
             GGFVSHCGWNS LE++  GVPI  WP YAEQ LNAFQ+V ELGLA EI  DY+  +    
Sbjct  354   GGFVSHCGWNSTLESIWFGVPIAAWPQYAEQQLNAFQLVVELGLAAEIKMDYRRDLVKGS  413

Query  1255  -TLVSAEDVERGVRKLMDGD--DEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              ++V+A+D+E G+RKLM+G+  DE R+KVKE SE  ++  M+ GSS +SLG+ IE+
Sbjct  414   DSIVTADDIEGGIRKLMEGEEADERRKKVKEVSEKSRKALMEGGSSYLSLGRFIED  469



>ref|XP_004490590.1| PREDICTED: UDP-glycosyltransferase 71D1-like [Cicer arietinum]
Length=487

 Score =   382 bits (980),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 196/470 (42%), Positives = 296/470 (63%), Gaps = 21/470 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS-LASDG  189
             K+++++F+ +P IG+L   +EF+KLL + N NL +TVL I  P  P   SYI + L S  
Sbjct  29    KKSELIFIPSPGIGHLASSLEFAKLLINTNTNLHITVLCIKFPGTPFSDSYIKTVLNSQP  88

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
              ++ + LP  E P  +  +S   ++  ++E+  PHVR  L  + S+   ++ G  +D FC
Sbjct  89    QIKLIDLPEVEQPPHELLKSHEFYILTFMESLIPHVRSTLQTITSN---QVVGLVLDFFC  145

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
              S ID+  EL IP Y++  S   FLS ML I   + ++    ++ D   + +IPGF N V
Sbjct  146   ISMIDIGNELGIPSYMFLTSNVGFLSLMLSIK--NRKIEDVFDYADPDNQLLIPGFSNLV  203

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND-VGPVY  726
             P    P     + +  Y  + + A+R+ +T+G++VNTF +LE Y + +++  ++ + P+Y
Sbjct  204   PFNVLPDAAFNK-DGGYFAYYKLAERFNDTKGIIVNTFSDLEQYAIDALYDHDEKIPPIY  262

Query  727   PIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLE  906
              +GP++D +     + D   H+L++K+L+ Q   SVVFL  GSMGS   +Q REIA GL+
Sbjct  263   AVGPLIDLKSQTNPNLDQAQHDLILKFLNEQPDKSVVFLCFGSMGSFVLSQTREIALGLK  322

Query  907   RAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSD--RTKGKGMVCGWVPQVTILAHK  1080
             ++G RFLW++R PP S         +    LP GF +    +GKGM+CGW PQV +LAHK
Sbjct  323   KSGVRFLWAMRSPPTS--------NNEGKSLPEGFLEWMNMEGKGMICGWAPQVEVLAHK  374

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITL  1260
             AIGGFVSHCGWNSILE+L  GVPI TWPIYAEQ LNAF+MVKE GL VE+  DY++G  +
Sbjct  375   AIGGFVSHCGWNSILESLWFGVPILTWPIYAEQQLNAFRMVKEFGLGVELRMDYRNGSDV  434

Query  1261  VSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             V AE++E+G++ LM+ D+ V++K++   EM +   +  GSS +S+GKLI+
Sbjct  435   VLAEEIEKGLKHLMEKDNVVQKKLQ---EMARNAVVDGGSSFISVGKLIQ  481



>gb|AGU14088.1| UDP-glycosyltransferase [Cicer arietinum]
Length=467

 Score =   381 bits (978),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/470 (42%), Positives = 296/470 (63%), Gaps = 21/470 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS-LASDG  189
             K+++++F+ +P IG+L   +EF+KLL + N NL +TVL I  P  P   SYI + L S  
Sbjct  9     KKSELIFIPSPGIGHLASSLEFAKLLINTNTNLHITVLCIKFPGTPFSDSYIKTVLNSQP  68

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
              ++ + LP  E P  +  +S   ++  ++E+  PHVR  L  + S+   ++ G  +D FC
Sbjct  69    QIKLIDLPEVEQPPHELLKSHEFYILTFMESLIPHVRSTLQTITSN---QVVGLVLDFFC  125

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
              S ID+  EL IP Y++  S   FLS ML I   + ++    ++ D   + +IPGF N V
Sbjct  126   ISMIDIGNELGIPSYMFLTSNVGFLSLMLSIK--NRKIEDVFDYADPDNQLLIPGFSNLV  183

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND-VGPVY  726
             P    P     + +  Y  + + A+R+ +T+G++VNTF +LE Y + +++  ++ + P+Y
Sbjct  184   PFNVLPDAAFNK-DGGYFAYYKLAERFNDTKGIIVNTFSDLEQYAIDALYDHDEKIPPIY  242

Query  727   PIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLE  906
              +GP++D +     + D   H+L++K+L+ Q   SVVFL  GSMGS   +Q REIA GL+
Sbjct  243   AVGPLIDLKSQTNPNLDQAQHDLILKFLNEQPDKSVVFLCFGSMGSFVLSQTREIALGLK  302

Query  907   RAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSD--RTKGKGMVCGWVPQVTILAHK  1080
             ++G RFLW++R PP S         +    LP GF +    +GKGM+CGW PQV +LAHK
Sbjct  303   KSGVRFLWAMRSPPTS--------NNEGKSLPEGFLEWMNMEGKGMICGWAPQVEVLAHK  354

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITL  1260
             AIGGFVSHCGWNSILE+L  GVPI TWPIYAEQ LNAF+MVKE GL VE+  DY++G  +
Sbjct  355   AIGGFVSHCGWNSILESLWFGVPILTWPIYAEQQLNAFRMVKEFGLGVELRMDYRNGSDV  414

Query  1261  VSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             V AE++E+G++ LM+ D+ V++K++   EM +   +  GSS +S+GKLI+
Sbjct  415   VLAEEIEKGLKHLMEKDNVVQKKLQ---EMARNAVVDGGSSFISVGKLIQ  461



>ref|XP_010104646.1| UDP-glycosyltransferase 71C5 [Morus notabilis]
 gb|EXC01452.1| UDP-glycosyltransferase 71C5 [Morus notabilis]
Length=474

 Score =   381 bits (978),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/476 (41%), Positives = 292/476 (61%), Gaps = 15/476 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MK+ ++VFV +P   +LV  +E +K L +Q+  +SVT+L +  P    + ++  SL  S+
Sbjct  1     MKKFELVFVPSPATSHLVSTIEIAKRLMNQDDRISVTILCMKAPTTTYLDAFTKSLVGSE  60

Query  187   GNLEFLSLPAAEPPSPDQ-NRSTISFLSIWIENHEPHVRRALTKLKSDDD----VRIAGF  351
               ++ + LP  +PP  +   +S   ++  +IE+  PHVR  L  + S        R++  
Sbjct  61    TRIKLVHLPQVDPPPTELITKSGEYYIYAYIESFVPHVRDTLKNILSSHSNSHSTRVSCL  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
              +D FC   +DVA ELD+PCYL+F     +LS ML I T    +   SEF D+  + ++P
Sbjct  121   VLDFFCMPMLDVANELDLPCYLFFTCNLGYLSLMLRISTRHELI--GSEFKDSDPDLILP  178

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELES-YCLGSMFGGN  708
             GF NP+P    P   +   +  Y  +LQ ++  RE +G+ VN+F ELES   L  +    
Sbjct  179   GFMNPIPTRVLP-LAAFNKDGGYTTYLQISQGLREIKGIFVNSFAELESPEALRMLSCDG  237

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSL-NPAQIR  885
             +  P+Y +GPVVD +G      D   HE +MKWLD Q + SV+ L+ GS G     +Q+R
Sbjct  238   NTPPIYMVGPVVDLKGQPNPCFDQAQHEKIMKWLDKQPNFSVLLLSFGSFGQFFKASQLR  297

Query  886   EIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             E+A GLER+G RFLW +R P +  +    +      +LP GF +RTKG+GM+C W PQ+ 
Sbjct  298   ELALGLERSGCRFLWCLRSPSQQTIRSATEGI----ILPEGFLERTKGRGMICEWAPQMD  353

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAHKA GGFVSHCGWNS+LE+L HGVP+ TWPIYAEQ LNAF+MV E GL+ E+  DY+
Sbjct  354   VLAHKATGGFVSHCGWNSMLESLWHGVPVATWPIYAEQQLNAFRMVWEFGLSTEVRLDYR  413

Query  1246  DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             +G   V+AE++E  +R+LM+G  E+R +VKE S+M K    + GSS+ +LG+L+++
Sbjct  414   EGGDDVTAEEIEVAIRRLMEGGVEMRSRVKEMSQMAKNAVAEGGSSSNALGELVKD  469



>emb|CDP05660.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   381 bits (978),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/480 (41%), Positives = 297/480 (62%), Gaps = 20/480 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M++ K++ + +P +G+L   +E +KL+  +N  LS+T L++ +P  P   + I SL +  
Sbjct  1     MEKFKLMMMVSPLMGHLTQALELAKLMLARNNQLSITALIMELPIDPDGTAKIQSLIAAT  60

Query  190   NLEFLSLPAAEPP--SPDQNRSTISFLSI-WIENHEPHVRRALTKLKSDDDVRIAGFFVD  360
             N+E L       P  + D N +   F  +  +E  +PHVR   +K +     +++GF +D
Sbjct  61    NVEGLHFHHLSTPEDTSDWNITHRRFFILKLLEYQKPHVREIASKTQ-----KLSGFLID  115

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGF  537
             +   + IDVA+EL +P YL+F S A+FL    H  TL D Q    SE        V+P F
Sbjct  116   LINMTMIDVADELGVPTYLFFTSGAAFLGLRFHFQTLEDEQNQDISELVKGESHLVLPSF  175

Query  538   ENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELE-----SYCLGSMFG  702
               PVP+   P   +K+   + + FL+  + YR  +G++VNTF  LE     S+ L S +G
Sbjct  176   AKPVPISVLPTLATKKEFRSNV-FLKCTRDYRRAKGIIVNTFSYLEFNAISSFSLNSYYG  234

Query  703   GNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
              + + P+YP+GP+++         + ++   +MKWLD Q  +SVVFL  GS+GS +  Q+
Sbjct  235   KSSLPPIYPVGPILNSSQIQTQSSEDYSS--MMKWLDCQPKNSVVFLCFGSLGSFHLDQV  292

Query  883   REIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             +EIA G+ER+G+RFLW +R P   K   P +Y +L+ VLP GF DRT   G V GWVPQ+
Sbjct  293   QEIAYGIERSGHRFLWVLRRPSTKKGGFPREYENLELVLPEGFLDRTASIGKVVGWVPQL  352

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              +L+H A+GGFVSHCGWNS+LE++  GVPI TWPI AEQ LNAFQ+VKELG+AVEI+ DY
Sbjct  353   AVLSHSAVGGFVSHCGWNSMLESIFFGVPIATWPIEAEQQLNAFQLVKELGIAVEISLDY  412

Query  1243  ---KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                K+   LV AE VE+G+R++MDG++EVR +VKE+SE  +    + GSS ++L  +I++
Sbjct  413   NQEKENQALVKAEQVEKGIREIMDGENEVRMRVKEFSEKSRLATKEGGSSYLALDNIIQD  472



>gb|KDO51068.1| hypothetical protein CISIN_1g045570mg [Citrus sinensis]
Length=468

 Score =   380 bits (976),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/470 (42%), Positives = 301/470 (64%), Gaps = 10/470 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A+++FV +P IG+LV  +EF+K L+ ++  +SVT+L + +   P + +Y  SL +D 
Sbjct  1     MKKAELIFVPSPGIGHLVSTLEFAKHLTDRDDRISVTILSMKLAVAPWVDAYTKSL-TDS  59

Query  190   NLEFLSLPAAEPPSPDQ---NRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVD  360
                   +       P      +S   F+S+ +E+H P+V+  ++   +   +++ G  +D
Sbjct  60    QPRICVIDLPPVDPPLPDVLKKSPEYFISLVVESHLPNVKNIVSSRSNSGSLQVTGLVLD  119

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFE  540
              FC S +D+A+EL +P Y++  S   FL  ML++PT   ++  ++ F  +  E +IPG  
Sbjct  120   FFCVSMVDIAKELSLPSYMFLTSNMGFLRLMLYLPTRQDRI--STVFESSDDELLIPGIT  177

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             +PVPV   P  +  + +  +   ++ A+R+++  G++VNTF ELE Y + + F G+   P
Sbjct  178   SPVPVCVMPSCLFNK-DGGHATLVKLAQRFKDVDGIIVNTFHELEPYAVNA-FSGDLNPP  235

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             +Y  GPV+  +       D   ++ + +WLD+   SSVVFL  GS GS + AQ++EIA G
Sbjct  236   LYTAGPVLHLKSQPNPDLDEAQYQKIFQWLDDLAESSVVFLCFGSSGSFDVAQVKEIAIG  295

Query  901   LERAGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LER+GY FLWS+R   PK ++   + Y   + V P GF +R KG+GM+ GWVPQV ILAH
Sbjct  296   LERSGYNFLWSLRVSSPKDEVS-AHRYVTNNGVFPEGFLERIKGRGMIWGWVPQVEILAH  354

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGIT  1257
             KAIGGFVSHCGWNSILE+L +GVPI TWPIYAEQ LNAF+MVKELGLA+++  DY+ G  
Sbjct  355   KAIGGFVSHCGWNSILESLWYGVPIATWPIYAEQQLNAFRMVKELGLALDLRLDYRVGSD  414

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
             LV A D+E  VR LMDG++++R+KVKE +E+ ++  M+ GSS  S+G+ I
Sbjct  415   LVMAGDIESAVRCLMDGENKIRKKVKEMAEISRKSLMEGGSSFNSIGQFI  464



>ref|XP_010044978.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
Length=477

 Score =   380 bits (976),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 210/476 (44%), Positives = 296/476 (62%), Gaps = 22/476 (5%)
 Frame = +1

Query  19    AKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS--DGN  192
             +++VFV  P +G+LV ++E +KLL  ++  LSV VL++  P    I+S ++S A+     
Sbjct  5     SELVFVPFPALGHLVSMLEMAKLLIDRDNRLSVMVLVMKSPLDSEIESRVESFAALVASR  64

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFCT  372
             + F+ LP     +P    S  + L+ ++E+H+  VR A+  L +    R+ G  VDMFCT
Sbjct  65    IRFIFLPRQ---NPSLEASPFAILNQFMESHKAGVRDAIAGLSACGSSRLEGLVVDMFCT  121

Query  373   SFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENPV  549
             S IDVA E  IP Y++  S  + L  ML++ +L + Q    +    +  E   P F NP+
Sbjct  122   SMIDVAIEFSIPSYVFIPSGGALLGLMLYLQSLQEEQHMDLTRLKGSDAELDFPCFANPL  181

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYP  729
             P   F P      ED  + FL HA+R+RET+G++VNTF ELE   + ++  G     VYP
Sbjct  182   PAAKFLPAEVFMKEDCRI-FLGHAQRFRETKGILVNTFTELEPRAVEAL-AGLGAPAVYP  239

Query  730   IGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLER  909
             +GP+++ +       +S     ++ WLD Q ++SVVFL  GS GS +  Q++EIA  LER
Sbjct  240   VGPILNIK------VESIKGFEILDWLDQQSNASVVFLCFGSFGSFDQDQVKEIARALER  293

Query  910   AGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAI  1086
             +G  FLWS+R+PP K KL+ P DY D   VLP GF DR  G G V GW PQV +LAH+AI
Sbjct  294   SGCHFLWSLRQPPAKGKLEGPCDYADPAEVLPEGFIDRMAGVGRVIGWAPQVAVLAHQAI  353

Query  1087  GGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGI----  1254
             GGFVSHCGWNS LE++  GVPI  WP YAEQ LNAFQ+V ELGLA EI  DY+  +    
Sbjct  354   GGFVSHCGWNSTLESIWFGVPIAAWPQYAEQQLNAFQLVVELGLAAEIKMDYRRDLVKGS  413

Query  1255  -TLVSAEDVERGVRKLMDGD--DEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              ++V+A+D+E G+RKLM+G+  DE R+KVKE SE  ++  M+ GSS +SLG+ IE+
Sbjct  414   DSIVTADDIEGGIRKLMEGEEADERRKKVKEVSEKSRKALMEGGSSYLSLGRFIED  469



>ref|XP_010048136.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW80290.1| hypothetical protein EUGRSUZ_C01648 [Eucalyptus grandis]
Length=479

 Score =   380 bits (976),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 204/481 (42%), Positives = 310/481 (64%), Gaps = 21/481 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             M  A+++F+ +P +G+LV +VE +KLL  ++  LS+TV+++ +       SY  SLA+  
Sbjct  1     MTHAELIFIPSPGMGHLVSMVEMAKLLVDRDPRLSITVVIMKLLFDSDADSYTTSLATTW  60

Query  187   --GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAGFF  354
                 + F+ LP     + +   S+ +F + +IE+++PH+++ + +L   +    ++AGF 
Sbjct  61    AAARIRFVHLPRG---NTNTLISSGNFRTHFIESNKPHIKQVVAELADSASSTRQLAGFV  117

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             +DMFCT+ ID+A+E  +P Y++F S A+ L  MLH+ +L D      +EF DAA E   P
Sbjct  118   LDMFCTTMIDLADEFGVPSYIFFTSSAACLGMMLHLQSLQDEHHMDITEFNDAAGELDFP  177

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG-GN  708
              F NP+P +  P  +  +  +   PFL+H +R R T+G+VVNTF+ELE + + S+ G G 
Sbjct  178   SFTNPLPAKVLPSVVLMK--EAVRPFLEHTRRMRATKGIVVNTFEELEPHAIRSLAGLGA  235

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
              V  VYP+GP+++ +G  +   +S   + +M+ L+ QL SSVVFL  GSMGS    Q++E
Sbjct  236   PV--VYPVGPILNLKGETKMKANSGADD-IMECLNGQLPSSVVFLCFGSMGSFGKDQVKE  292

Query  889   IATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             +A+ LER+G+RFLWS+R PP K K+++P+DY D   VLP GF DRT G G V GW PQV 
Sbjct  293   MASALERSGHRFLWSLRRPPPKGKVEIPHDYMDPAEVLPKGFLDRTAGIGKVIGWAPQVA  352

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +LAH AIGGFVSHCGWNS LE++  GV + TWP+YAEQ LNAF++V EL LA EI  DY+
Sbjct  353   VLAHPAIGGFVSHCGWNSTLESIWFGVTMATWPLYAEQQLNAFELVVELRLATEIRMDYR  412

Query  1246  DGITL----VSAEDVERGVRKLMDG-DDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
                 +    V A+++E  ++KLM+  + E + KV+E SE  +   ++ GSS +SL + IE
Sbjct  413   RDFKMETNVVMADEIEGAIKKLMEEVNGERKRKVEEVSEKSRNALVEGGSSYLSLSRFIE  472

Query  1411  E  1413
             +
Sbjct  473   D  473



>ref|XP_009371512.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=482

 Score =   380 bits (976),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 203/479 (42%), Positives = 299/479 (62%), Gaps = 17/479 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VF+  P  G+LV  ++F+K L  ++  + +TVL I  P R  + +Y +S+A S+
Sbjct  1     MKKVELVFIPAPGAGHLVSALQFTKRLIDRDDRILITVLAIQSPLRTTLSAYTESIAASE  60

Query  187   GNLEFLSLPAAEPPSP--DQNRSTISFLSIWIENHEPHVRRALTKLKSD-----DDVRIA  345
               +  + +   +   P  +  +S   F++++IE H P+V++ +T L S      D +R+A
Sbjct  61    PRIRVIDVQQPQDHQPPQETYQSPEKFITLYIEGHVPNVKKIITNLVSSNANSMDSIRVA  120

Query  346   GFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYV  525
                VD FC S I VA+EL++P YL+  S A +L+ ML +P L  +     E  D   E++
Sbjct  121   ALVVDFFCVSMIYVAKELNLPSYLFMTSNAGYLALMLQLPILHEKNQVAVEESDP--EWL  178

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             IPG  +PVP    P  +       Y+     A R+RETRG+V NTF ELE++ +      
Sbjct  179   IPGIVHPVPPRVLPMALKDGSRSAYIKL---ASRFRETRGIVANTFVELETHAITLFSND  235

Query  706   NDVGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
               + PVY +GPV+D  +  A  +      + ++KWLD+Q   SVVFL  GS+GS    Q+
Sbjct  236   TRIPPVYTVGPVIDLNDDQAHSNLHQAQRDKIIKWLDDQPQKSVVFLCFGSLGSFRVEQV  295

Query  883   REIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVPQ  1059
             +EIA GLE++  RFLWS+R P   K  +P+D ++L+ VLP GF +RT GK G++CGW PQ
Sbjct  296   KEIALGLEQSEQRFLWSLRMP-SPKGTVPSDCSNLEEVLPDGFLERTNGKKGLICGWAPQ  354

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V +LAH A GGF+SHCGWNSILE+L HGVPI TWP+YAEQ LNAF+MV+ELG+A+E+  D
Sbjct  355   VEVLAHSATGGFLSHCGWNSILESLWHGVPIATWPMYAEQQLNAFRMVRELGMALEMRLD  414

Query  1240  YKDG-ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             YK G   +V A+++ER V  +M+ D EVR+KV+E  +M ++     GSS  S+GK IE+
Sbjct  415   YKTGSADMVGADEIERVVVGVMEKDSEVRKKVEEMGKMARKAVEDGGSSFASVGKFIED  473



>emb|CDP18046.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   380 bits (976),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 202/478 (42%), Positives = 299/478 (63%), Gaps = 16/478 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VFV+ P IG+LV  VE +KLL   ++ LS+TVL++  P    + SY +SL    
Sbjct  1     MKKAELVFVTVPGIGHLVSCVELAKLLVECDERLSITVLMMKQPFDSKVSSYTNSLLETP  60

Query  190   NL--EFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDM  363
             NL   +L L   EP S  Q  S +S    +I+NH+  VR  L ++ +     + G  +DM
Sbjct  61    NLHIRYLELMKEEPSS--QLSSFLSIFFRFIDNHKSCVRDVLAEISNSVSSHLGGIIIDM  118

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFE  540
             FCTS IDVA E  +P Y+++   A+ L  +  + +L D    + S + ++  E  +P + 
Sbjct  119   FCTSLIDVANEFGVPSYIFYPGGAATLGVLFQLQSLRDDLNEEVSYYENSDVELALPTYI  178

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             NPVP +     + ++     +  L  A+RYR+T+G+++NTF ELES+ + ++     + P
Sbjct  179   NPVPAKLLSSALFEKDGGVDM-VLDQAQRYRKTKGIIINTFLELESHAIQALSNDKTIPP  237

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VY +GPV++ +G    + ++   E++MKWLD Q   SVVFL  GS GS +  Q++EIA  
Sbjct  238   VYAVGPVLNLKGSNSQNQET---EMIMKWLDLQPKCSVVFLCFGSGGSFDADQVKEIAYA  294

Query  901   LERAGYRFLWSIREP-PKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE +GYRFLWS+R P PK K + P++Y +LD VLP GF  RT   G V GW PQ  +L+H
Sbjct  295   LEHSGYRFLWSLRTPSPKEKFEFPSEYENLDEVLPEGFLQRTAAVGKVIGWAPQAAVLSH  354

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD---  1248
              A+GGFVSHCGWNSILE++  GVP+ TWP+YAEQ  NAF MVK+L +AVEI  D+K    
Sbjct  355   PAVGGFVSHCGWNSILESVWCGVPVATWPLYAEQQENAFLMVKDLAMAVEIKIDFKRDFV  414

Query  1249  -GIT--LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              G++  ++SA+ +ERG++ LMD ++E+REKVKE  E  +    + GSS  SL + +E+
Sbjct  415   MGVSSEILSADVIERGIKHLMDPENEIREKVKEMKEKSRLAPSEGGSSFSSLRRFLED  472



>ref|XP_002322535.1| hypothetical protein POPTR_0016s01620g [Populus trichocarpa]
 gb|EEF04296.1| hypothetical protein POPTR_0016s01620g [Populus trichocarpa]
Length=480

 Score =   380 bits (976),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/465 (42%), Positives = 293/465 (63%), Gaps = 9/465 (2%)
 Frame = +1

Query  25    VVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASDGNLEF  201
             +VFV  P IG+LV V+EF+K L  ++ + S+T+LL++ P    + +Y++ L A+    +F
Sbjct  13    LVFVPAPGIGHLVSVMEFAKRLLERDDSFSITMLLMSPPFAHDVTTYVEKLNAAHPEFQF  72

Query  202   LSLPAAEPPS-PDQNRSTISFLSIWIENHEPHVRRALTK-LKSDDDVRIAGFFVDMFCTS  375
             L LP+  PP   D       F+S++I +H+ HV+  +   + S+  V++AG  +D+FCT+
Sbjct  73    LGLPSVTPPPLEDVLACPEHFVSVFIADHKNHVKDMIVNHVLSNKSVKLAGLVLDLFCTA  132

Query  376   FIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPVPV  555
             F+DVA++L +P Y++FAS A+FL  ML++P    +      +     + +IP + NPVP 
Sbjct  133   FVDVAKDLGVPSYIFFASGAAFLGSMLYLPYRFDK--GGVTYKPTDPDSIIPSYINPVPS  190

Query  556   ESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYPIG  735
                P  +   H+  Y  F+ HA++++E +G++VNTF ELES+ +  + G   V  VY +G
Sbjct  191   RVLPSLL--FHDGGYSTFVSHARKFKEAKGIIVNTFAELESHAVNYLNGEAGVPHVYTVG  248

Query  736   PVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAG  915
             PVVD +G +    D    E +M WLD Q   SVVFL  GS GS    Q++EIA GLE++G
Sbjct  249   PVVDHKGNSPV-ADGNQREEIMNWLDAQPQKSVVFLCFGSQGSFGVPQLKEIALGLEQSG  307

Query  916   YRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIGGF  1095
              RFLWSIR PP  +   P +  D   +LP GF  RTK  G +CGW PQV +LAHKA G F
Sbjct  308   QRFLWSIRRPPSQESLNPGEVNDFSELLPEGFLGRTKNVGFICGWAPQVEVLAHKATGAF  367

Query  1096  VSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGITLVSAE  1272
             VSHCGWNSILE+  +GVP+ TWP+Y EQ +NAFQ+VK+ G+A+E+  DY KDG  +V A+
Sbjct  368   VSHCGWNSILESTWYGVPVVTWPLYGEQQINAFQLVKDAGVAIEMKMDYRKDGGEVVKAD  427

Query  1273  DVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
              V + V+ +++G  +V+ KVK  SE  ++  ++ GSS V+   L+
Sbjct  428   QVAKAVKDVIEGASDVKSKVKAMSETGRKALLEGGSSYVAFETLV  472



>dbj|BAF96585.1| glucosyltransferase homolog [Lycium chinense]
 dbj|BAG80539.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=465

 Score =   379 bits (974),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 197/465 (42%), Positives = 295/465 (63%), Gaps = 16/465 (3%)
 Frame = +1

Query  49    IGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGNLEFLSLPAAEPP  228
             +G+LV  VE +K L  +   LS+TVL++ +P    I SY  SL+S+       L   +P 
Sbjct  1     MGHLVSTVEMAKQLVDREDQLSITVLIMTLPTETKIPSYTKSLSSNYTSRIRLLELTQPE  60

Query  229   SPDQNRST---ISFLSIWIENHEPHVRRALTKLKSD-DDVRIAGFFVDMFCTSFIDVAEE  396
             +     S    + F+S +I +++  V+ A+  + S    V++AGF +DMFCT+ IDVA +
Sbjct  61    TSVNMGSATHPMKFMSEFITSYKGRVKDAVADMFSSLSSVKLAGFVIDMFCTAMIDVAND  120

Query  397   LDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPVPVESFPPFM  576
               +P YL++ S A+ L    H  +L +Q      + D+  E +IP + NPVPV+  P  +
Sbjct  121   FGVPSYLFYTSGAAMLGLQFHFQSLISQ--NVLSYLDSESEVLIPTYINPVPVKFLPGLI  178

Query  577   SKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYPIGPVVDREG  756
                 E + + FL  A R++ET+G++VNTF E+ES+ L ++     + P+YP+GP+++  G
Sbjct  179   LDNDEYSIM-FLDLAGRFKETKGIMVNTFVEVESHALKALSDDEKIPPIYPVGPILNLGG  237

Query  757   PARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLERAGYRFLWSI  936
                 H + ++   +MKWLD Q +SSVVFL  GSMGS    Q++E+A  LE +GY+FLWS+
Sbjct  238   GNDGHGEEYDS--IMKWLDGQPNSSVVFLCFGSMGSFEEDQVKEVANALESSGYQFLWSL  295

Query  937   REPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAIGGFVSHCGW  1113
             R+PP K KL  P+++ +L+ VLP GF  RTKG+G + GW PQV IL+H ++GGFVSHCGW
Sbjct  296   RQPPPKDKLQFPSEFENLEEVLPEGFLQRTKGRGKMIGWAPQVAILSHPSVGGFVSHCGW  355

Query  1114  NSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGIT-----LVSAED  1275
             NS LE++  GVP+ TWP+YAEQ  NAFQ+VK+L +AVEI  DY KD +T     LV AE+
Sbjct  356   NSTLESVRSGVPMATWPMYAEQQSNAFQLVKDLEMAVEIKMDYRKDFMTINQPVLVKAEE  415

Query  1276  VERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             +  G+R+LMD  +++R KV++  E  +   M+ GSS V+LG  +E
Sbjct  416   IGNGIRQLMDLVNKIRAKVRKMKEKSEAAIMEGGSSYVALGNFVE  460



>dbj|BAK55748.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=477

 Score =   380 bits (975),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 199/480 (41%), Positives = 299/480 (62%), Gaps = 20/480 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M++ K++ + +P +G+L   +E +KL+  +N  LS+T L++ +P  P   + I SL +  
Sbjct  1     MEKFKLMMMVSPLMGHLTQALELAKLMLARNDQLSITALIMELPIDPDGTAKIQSLIAAT  60

Query  190   NLEFLSLPAAEPPSPDQNRSTIS---FLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVD  360
             N+E L       P    + +      F+   +E  +P VR   +K +     +++GFF+D
Sbjct  61    NVEGLHFHHLSTPEDTSDWNITHRGLFVLKLLEYQKPRVREIASKTQ-----KLSGFFID  115

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGF  537
             +  T+ IDVA+EL +P YL+  S A+FL  MLH  TL D Q    +E         +P F
Sbjct  116   LVTTTMIDVADELGVPTYLFCTSGAAFLGLMLHFQTLEDEQNQDITELVKKESHLTLPSF  175

Query  538   ENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELES-----YCLGSMFG  702
               PVPV   P   +K+   + + FL+  + YR  +G++VNTF ELES     + L S +G
Sbjct  176   VKPVPVSVLPTIATKKEFWSNV-FLKCTRDYRRAKGIMVNTFTELESTAISSFSLDSYYG  234

Query  703   GNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
              + + P+YP+GP+++R      +  S ++  +MKWLD Q  +SVVFL  GS+GS +  Q+
Sbjct  235   KSRLPPIYPVGPILNRSQIQ--NQSSEDYSALMKWLDCQPENSVVFLCFGSLGSFHLDQV  292

Query  883   REIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             +EIA G+ER G+RFLW +R+PP  K   P +Y +L+ VLP GF DRT   G V GWVPQ+
Sbjct  293   QEIAYGIERIGHRFLWVLRQPPAEKGGFPREYENLELVLPEGFLDRTASIGKVVGWVPQL  352

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              +L+H A+GGFVSHCGWNS LE++  GVPI TWPI AEQHLNAFQ+VKELG+AV+I  DY
Sbjct  353   AVLSHSAVGGFVSHCGWNSTLESIFCGVPIATWPIQAEQHLNAFQLVKELGIAVDIGLDY  412

Query  1243  ---KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                ++   LV AE VE+G+R++MDG++EVR ++KE++E  +    + GSS ++L  +I++
Sbjct  413   NKERENQALVRAEQVEKGIREIMDGENEVRMRIKEFTEKSRVAAEEGGSSYLALENIIQD  472



>emb|CDP16611.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   380 bits (975),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 201/477 (42%), Positives = 298/477 (62%), Gaps = 15/477 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA--S  183
             MK+A++VF+ +P +G+LV  VE +KLL  + + LS+TVL++ +P    + SY   L+  S
Sbjct  1     MKKAELVFIPSPGMGHLVSTVELAKLLIDRGEQLSITVLIMKLPFDKKVSSYTSMLSESS  60

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDM  363
             D  + FL L   E  S  Q+  + +FL  +I+NH+  VR  L ++ +     +AG  +DM
Sbjct  61    DSRIRFLDLKPEE--SSSQSTFSSAFLYHFIDNHKSSVRDILAEMSNSASSGLAGVVIDM  118

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIPGFE  540
             FCTS IDVA E  +P Y+++ S A+ L  +LH+ +L A   ++ + + ++  E  IP + 
Sbjct  119   FCTSMIDVANEFGVPSYIFYTSGAAMLGLVLHMQSLRADFNEDVTNYKNSDIELAIPTYI  178

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             NPVP +  P  +  +     + FL  AKRY+ET+G+++NTF ELES+ + ++     + P
Sbjct  179   NPVPAKVLPSVIFDKDAGCDM-FLNQAKRYKETKGIIINTFLELESHAVKALSNDKTIPP  237

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VY +GPV++ +G    + D+   E++MKWLDNQ  SSVVFL  GS GS +  Q++EIA  
Sbjct  238   VYAVGPVLNLKGSNGPNQDT---EMIMKWLDNQPVSSVVFLCFGSAGSFDGEQVKEIAHA  294

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             L+R+G RFLWS+R PP K K   P DY D + VLP GF   T   G V GW  QV +L+H
Sbjct  295   LQRSGVRFLWSLRRPPPKGKFQFPGDYEDPEEVLPEGFLRGTAEVGKVIGWARQVAVLSH  354

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK----  1245
              A+GGFVSHCGWNS LE++  GVP+ TWP+YAEQ  NAF MVK+LG+AVEI  D++    
Sbjct  355   PAVGGFVSHCGWNSTLESVWCGVPMATWPLYAEQQTNAFLMVKDLGMAVEIKMDFRKDFL  414

Query  1246  -DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              +   +V A  +E G+++LM+ + E R KVKE  E  +      GSS+ SL + +++
Sbjct  415   MEANEIVRAVVIENGIKQLMESESEFRNKVKEMKEKSRMALHGGGSSSDSLRRFLDD  471



>ref|XP_007016126.1| Glycosyltransferase, putative [Theobroma cacao]
 gb|EOY33745.1| Glycosyltransferase, putative [Theobroma cacao]
Length=475

 Score =   379 bits (974),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 207/478 (43%), Positives = 299/478 (63%), Gaps = 18/478 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDS--LAS  183
             MK+ +++F+  P  G+    +EF+K L H +  + VT+L +       + +Y  S   + 
Sbjct  1     MKKIELIFIPIPGTGHWASTIEFAKRLIHHDDRIWVTILSMTWFSPAFVDAYTKSHDASR  60

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL----KSDDDVRIAGF  351
                ++ + LP  +PPS D  +S   ++  +IE++ P  R A+  +     S    R+AG 
Sbjct  61    PDRIQLIDLPQVDPPSFDLLKSLEGYIYAFIESYIPAARNAVRNIVSLESSSGSGRVAGL  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
              +D FC   ID+A EL +P Y+Y+AS A+ L  ML++PT  +Q     E  D   E +IP
Sbjct  121   VLDFFCAPMIDIATELGLPSYIYYASNAASLGLMLYLPTRHSQNSSGFEITDP--EQLIP  178

Query  532   GFENPVPVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             GF NPVP+   P P  +K  +  Y  F++ A+R ++ +G++VNTF+ +E   L     G 
Sbjct  179   GFVNPVPLCVLPSPLFNK--DGGYTTFIKVAERLKDAKGIMVNTFEGIEPSALNYFLNGP  236

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
             +  P+YP+GPV+D         D      VM WLD+Q  SSV+FL  GSMGS    Q++E
Sbjct  237   N-PPIYPVGPVIDLNALPHPKLDLDQRNKVMTWLDDQPQSSVIFLCFGSMGSFGAPQLKE  295

Query  889   IATGLERAGYRFLWSIR--EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             IA GLE++GYRFLWS+R   P +S   L +  T+    LP GF ++ +G+GM+CGW PQV
Sbjct  296   IALGLEQSGYRFLWSLRFSSPLQSDAALTDKNTE--ETLPEGFLEKIQGRGMICGWAPQV  353

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              +LA+KAIGGFVSHCGWNSILE+L  GVPI TWP++AEQ LNA+ M KELGLAV +  DY
Sbjct  354   EVLANKAIGGFVSHCGWNSILESLWFGVPIVTWPMHAEQQLNAYLM-KELGLAVVMRLDY  412

Query  1243  KDGIT-LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             + G + LV A++VE+GVR +MDG  EVR+KVKE +EM ++  MK+GSS +S+G+LIE+
Sbjct  413   RLGTSDLVMADEVEKGVRLVMDGGSEVRKKVKEMAEMARKSVMKDGSSFISMGRLIED  470



>ref|XP_008393867.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Malus domestica]
 ref|XP_008367684.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Malus domestica]
Length=483

 Score =   380 bits (975),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 207/484 (43%), Positives = 304/484 (63%), Gaps = 20/484 (4%)
 Frame = +1

Query  10    MKQ-AKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLAS  183
             MKQ  K+VF+     G+L+  VE +KLL  +++ L +TVL++ +P +    ++YI SL S
Sbjct  1     MKQPXKLVFIPXAGTGHLISAVEMAKLLVSRDEKLFITVLIMKLPFESKGTEAYISSLZS  60

Query  184   DG---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAG  348
                   + F++LP A     D  +S  +F S + E+H+P+V+ A++KL     +  R+AG
Sbjct  61    SPVLSRVNFITLPQAAS-DIDTRKSPNAFRSXFXESHKPYVKDAVSKLAESESESTRVAG  119

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYV  525
             F +DM CT+  DVA +  +P Y++F SPA FL  +L+I T+ D      SEF  +  E  
Sbjct  120   FVIDMXCTTMXDVANDFGVPTYMFFTSPAGFLGLVLNIQTIRDVYGKHVSEFKGSDAELT  179

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             +P F + VP    P  +  +  D    FL +A R+RE +G+++NTF ELES+ L S+  G
Sbjct  180   LPTFVDSVPAGVLPSVLLDK--DGAKAFLGYANRFRELKGILINTFVELESHALDSLSDG  237

Query  706   NDVGPVYPIGPVVDREGPAR--WHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
                 PVYP+GP+++ +          +     +++WLD Q  SSVVFL  GSMGS    Q
Sbjct  238   K-TPPVYPVGPILNLKXSETEVGSKQAQQKSDILEWLDXQPDSSVVFLCFGSMGSFGXDQ  296

Query  880   IREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             +REIA+GLE++G+RFLWS+R+PP K  +  P+DY+D   VLP GF  RT G G V GW P
Sbjct  297   VREIASGLEQSGHRFLWSLRQPPPKGIIASPSDYSDPKAVLPEGFLXRTAGIGKVIGWAP  356

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             Q  ILAH A+GGFVSHCGWNS LE+L  GVP+  WP+YAEQ LNAF++V+ELGLAVE+  
Sbjct  357   QXAILAHPAVGGFVSHCGWNSTLESLWFGVPVAAWPVYAEQQLNAFELVRELGLAVEVNM  416

Query  1237  DYKDGI-----TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGK  1401
             +Y+  +      +V A ++E G+++LM+ D +VR++VK+ SE  K+  M  GSS  SLG+
Sbjct  417   EYRRDLYGEYPNVVKAHELEXGIKELMEKDSDVRKRVKDMSEKSKKALMVGGSSYNSLGR  476

Query  1402  LIEE  1413
              +++
Sbjct  477   FLDQ  480



>emb|CDP11256.1| unnamed protein product [Coffea canephora]
Length=473

 Score =   379 bits (973),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 198/471 (42%), Positives = 294/471 (62%), Gaps = 14/471 (3%)
 Frame = +1

Query  22    KVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA---SDGN  192
             ++VFV+ P  G++V  +EF+K LS  ++ +SVTVLL+      L  S+I  LA   S  N
Sbjct  4     ELVFVAAPGRGHIVSEIEFAKRLSEVDRGISVTVLLMKSSSLDL-DSFIQELAASVSSSN  62

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTK-LKSDDDVRIAGFFVDMFC  369
             ++F+SLP A+PP  +   S  S+ + +IE H+  V+ A+   +       +AG  +D+FC
Sbjct  63    IQFISLPKADPPPSELKSSNESYFAAYIEKHKCLVKDAIINHVLPKSGTHLAGLVIDLFC  122

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
             +S IDVA EL +P Y++  S A+FL  +L++P   + +   +EF  +  +  IP F N V
Sbjct  123   SSMIDVANELGVPSYVFCTSSAAFLGLVLYLPIRHSLI--GTEFSISDPDSSIPAFANLV  180

Query  550   PVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVYP  729
             P    P F+  +H   Y  FL H  R+++ +G ++NTF ELES+ +  +    +   VY 
Sbjct  181   PSGVLPSFLFNKH-GGYSSFLSHGTRFQKAKGFIINTFAELESHAINFLTADKESPQVYT  239

Query  730   IGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGLER  909
             +GPV++ +   +    S +   +MKWLD+Q SSSVVFL  GS+G   P Q+ EIA  L++
Sbjct  240   VGPVINLDITKKL---SESDRKIMKWLDDQPSSSVVFLCFGSIGGFEPPQLAEIAIALKQ  296

Query  910   AGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKAI  1086
             +G+RFLWS++  PPK     P  Y +   VLP GF +RTK +G+VCGW PQV IL H A+
Sbjct  297   SGHRFLWSVQPSPPKDFTVKPKVYANFSDVLPKGFLERTKDRGLVCGWAPQVEILRHHAV  356

Query  1087  GGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK--DGITL  1260
             GGFVSHCGWNSILE+L +GVPI TWP+Y EQ  NAFQ+VK+L LAVE+T DY+  +   +
Sbjct  357   GGFVSHCGWNSILESLWNGVPIATWPVYGEQQSNAFQLVKDLELAVELTLDYRFENSDEI  416

Query  1261  VSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             V A+ +E+ +  LMD ++ VR++VK+  E  ++  M  GSS +S G+ I +
Sbjct  417   VVADKIEKAINWLMDSENPVRQRVKDLGEKGRKALMDGGSSLISFGRFIAD  467



>ref|XP_009365674.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Pyrus x bretschneideri]
Length=474

 Score =   379 bits (973),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 208/480 (43%), Positives = 302/480 (63%), Gaps = 22/480 (5%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             K A++VFV  P IG+++  VE +K L  +   L +T+L++ +P   L  +   S++   N
Sbjct  3     KPAELVFVPAPGIGHIISTVEIAKQLVARADQLFITILIMKLPFDKLFANTDSSISHRIN  62

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVR--------IAG  348
               F++LP      P      +SF++ ++E+H+ HV+ A+ KL +D   +        +AG
Sbjct  63    --FINLPETLVDIP---LVFLSFVNSFVESHKIHVKEAVAKLLTDQSAQSEFKNPRVLAG  117

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYV  525
             F +D FCTS IDVA E  +P +L+F S A+ L   LH+ +L  +  K+  E  +++ E V
Sbjct  118   FVIDTFCTSMIDVANEFGVPSFLFFTSNAAMLGLWLHLASLRNEHDKDIYELINSSTELV  177

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             IP F NPVP + FP  +S +  +    FL    R+RET+G++VNTF ELE++ + S+  G
Sbjct  178   IPSFVNPVPTKLFPSELSDK--EVVAIFLDFGTRFRETKGILVNTFSELEAHAIHSLSDG  235

Query  706   NDVGPVYPIGPVVD-REGPARWHPDSWNHE-LVMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
                 PVY +GP+++ +    R  PD    +  ++ WLD+Q   SV+FL  GSMGS   AQ
Sbjct  236   K-TPPVYAVGPLLNLKSDDTRVAPDKAGEKSAILDWLDDQPPLSVLFLCFGSMGSFCEAQ  294

Query  880   IREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             ++EIA  LE +G RFLWS+R+PP K  L LP+DY D   VLP GF DRT   G V GW P
Sbjct  295   VKEIARALEHSGLRFLWSLRQPPPKGTLTLPSDYADPKAVLPEGFLDRTATTGKVLGWAP  354

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV IL+H A+GGFVSHCGWNS LE++ H VPI TWP+YAEQ  NAF+++ ELGLAVEI  
Sbjct  355   QVAILSHPAVGGFVSHCGWNSALESIWHCVPIATWPMYAEQQWNAFKLL-ELGLAVEIKM  413

Query  1237  DYK-DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DYK +   +VSAE++ERG++++M+ D + R++VKE SE  K+     GSS  SLG+ +++
Sbjct  414   DYKTESEVVVSAEEIERGIKEVMELDSDTRKRVKETSEKGKKALEFGGSSYTSLGRFVDQ  473



>ref|XP_009799026.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucose flavonoid 3-O-glucosyltransferase 
6-like [Nicotiana sylvestris]
Length=482

 Score =   379 bits (973),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 201/481 (42%), Positives = 298/481 (62%), Gaps = 25/481 (5%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-DG  189
             K+ ++ F+ +P IG+LV  VE +KLL  + + LS+TVL+I  P    + SYI S+ +   
Sbjct  5     KKIELGFIPSPGIGHLVSTVEMAKLLIAREEQLSITVLIIRWPNDNKLDSYIQSVVNFSS  64

Query  190   NLEFLSLPAAEPPSPDQNRSTISFL-----SIWIENHEPHVRRALTK-LKSDDDVRIAGF  351
              L+F+ LP        Q+ S +  L     + +I  H+P VR A+++ LKS+ +  +AG 
Sbjct  65    RLKFIRLP--------QDDSIMQLLKNNIFTSFIAGHKPAVRDAVSEILKSESNTTLAGI  116

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDA-AKEYV  525
              +D+FCTS IDVA E ++P Y+++ S A+ L    H+  L  +  K+ +++ D   K+  
Sbjct  117   VIDLFCTSMIDVANEFELPTYVFYTSGAATLGLQFHLQNLRDEFNKDITKYKDEPEKKLS  176

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             I  + NP P +  P  ++   E     FL  AKR+RET+G+++NTF ELES+ L  +   
Sbjct  177   IATYLNPFPAKCLPS-VALDTEGRSTMFLDLAKRFRETKGIMINTFLELESHALNLLSRD  235

Query  706   NDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
              ++ P+YP+GP+++  G  +      + +   KWLD+Q +SSVVFL  GS GS    Q++
Sbjct  236   KNLPPIYPVGPILNL-GNTQGENLGSSDQNTTKWLDDQPASSVVFLCFGSGGSFEIYQVK  294

Query  886   EIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             EIA  LE +G RFLWS+R PP      P+DY +L+ +LP GF +RTKG G V GW PQ+ 
Sbjct  295   EIAYALEHSGCRFLWSLRRPPTEDARFPSDYENLNEILPEGFLERTKGIGKVIGWAPQLA  354

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             IL+HK++GG VSHCGWNS LE+   GVPI TWP+YAEQ  NAFQ+VK+LG+AVEI  DY+
Sbjct  355   ILSHKSVGGSVSHCGWNSTLESTYFGVPIATWPMYAEQQANAFQLVKDLGMAVEIKMDYR  414

Query  1246  DGI------TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
               +       +V AE++E+ +R++MD D E+R KVKE  E  +   M+ GSS  S+G  I
Sbjct  415   KDMKVMGKEVIVKAEEIEKAIREIMDSDSEIRVKVKEMKEKSRAAQMEGGSSYNSIGGFI  474

Query  1408  E  1410
             +
Sbjct  475   Q  475



>ref|XP_008384820.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Malus 
domestica]
Length=496

 Score =   379 bits (974),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 207/479 (43%), Positives = 302/479 (63%), Gaps = 18/479 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VF+ +P  G+ +P ++F K L  +N  +S+T+L I       + SY  S+A S+
Sbjct  20    MKKVELVFIPSPGAGHHLPTLQFVKRLIDRNDRISITILAIQSXXPTTLSSYTKSIAASE  79

Query  187   GNLEFLSLPAAEPPSP-DQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAG  348
               + F+ +P  +   P +  +S     S++IE+H P V++ +T L      S D +R+A 
Sbjct  80    PRIRFIDVPQPQXRPPQEMYKSRAXIFSLYIESHVPSVKKIITNLVSSSANSSDSIRVAA  139

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               VD+FC S IDVA+EL+IP YL+  S   +L+FML +P L  +     E  D   ++ I
Sbjct  140   LVVDLFCVSMIDVAKELNIPSYLFLTSNXGYLAFMLXLPILHEKNQIAVEESDP--DWSI  197

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             PG  +PVP    P  ++      Y+     A R+RETRG++VNTF ELE++ + ++F  +
Sbjct  198   PGIVHPVPPRVLPXALTDGXXSAYIKL---ASRFRETRGIIVNTFVELETHAI-TLFSND  253

Query  709   DVGPV-YPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             D  P  YP+GPV+D  +G    + D    + ++KWLD+Q   SVVFL  GSMGS    Q+
Sbjct  254   DRVPXXYPVGPVIDLDDGQXHSNLDQAQRDKIIKWLDDQPQKSVVFLCFGSMGSFGAEQV  313

Query  883   REIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVPQ  1059
             +EIA GLE++G RFLWS+R P   K  +P+D ++L+ VLP GF +RT GK G++CGW PQ
Sbjct  314   KEIAXGLEQSGQRFLWSLRMP-SPKGXVPSDCSNLEEVLPDGFLERTNGKKGLICGWAPQ  372

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V  L H A GGF+SHCGWNSILE+L HGVPI TWP+YAEQ LNAF MV+ELG+A+E+  D
Sbjct  373   VEXLXHSATGGFLSHCGWNSILESLWHGVPIATWPMYAEQQLNAFXMVRELGMALEMRLD  432

Query  1240  YKDG-ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             YK G   +V A+++E  V  +M+ D EVR+KV+E  +M ++     GSS  S+G+ IE+
Sbjct  433   YKTGSADVVGADEIEXAVVGVMEKDSEVRKKVEEMGKMARKAVKDGGSSFASVGRFIED  491



>ref|XP_004304512.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Fragaria vesca subsp. vesca]
Length=488

 Score =   379 bits (973),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 197/493 (40%), Positives = 304/493 (62%), Gaps = 36/493 (7%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             + A++VF+    +G+L+  VE +KLL  ++  L +TV+++  P         DS  +D  
Sbjct  3     RAAELVFIPCAGVGHLISAVETAKLLVSRDDRLFITVVVMKTP--------FDSKGNDAC  54

Query  193   LEFLSLPA---------AEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDV---  336
             +E+    A         A+P     N +   F + +IE+H+P+VR A+T+L +       
Sbjct  55    IEYCITQASDRIKFVNVAQPDVDFINMTRSGFRNSFIESHKPYVRDAVTELLTGSSKSPT  114

Query  337   -RIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDA  510
              ++AGF +DMFCT+ IDVA E  +P Y++F   A FL  + H+  +  +   + ++  D+
Sbjct  115   PQLAGFVIDMFCTTMIDVANEFGVPTYIFFTCNAGFLGLLFHLQMIHDEYDVDIADLKDS  174

Query  511   AKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLG  690
               E ++P F NPVP++S      ++ E   +PF+ HA+R+RET+G+++NTF +LE + L 
Sbjct  175   DSELILPSFVNPVPIKSLSSVFFEKEEP--IPFVSHARRFRETKGILINTFSDLEPHALR  232

Query  691   SMFGGNDVGPVYPIGPVVDREGPAR---WHPDSWNHELVMKWLDNQLSSSVVFLTTGSMG  861
             S+    ++ PV+P+GP++  E           +     ++KWLD++L SSVVFL  GSMG
Sbjct  233   SLDSYGNIPPVFPVGPLLKEESDDNNLGGSDQALQKSEILKWLDDRLPSSVVFLCFGSMG  292

Query  862   SLNPAQIREIATGLERAGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGM  1038
             S    Q++EIA  LE++G+ FLWSIR  PPK K+  P+DY D   +LP GF  RT G G 
Sbjct  293   SFGEDQVKEIACALEQSGHSFLWSIRCPPPKEKITHPSDYADPTAILPDGFLQRTAGIGK  352

Query  1039  VCGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGL  1218
             V GW PQV +LAH A+GGFVSHCGWNS+LE++  GVPI TWP+Y+EQ +NAF+MV EL L
Sbjct  353   VIGWAPQVAVLAHPAVGGFVSHCGWNSVLESVWFGVPIATWPMYSEQQMNAFEMVVELEL  412

Query  1219  AVEITFDYK--------DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKN  1374
             AV+I+ +Y         +G  ++SA+++ERG+R++M+ D + R++VKE S M K+  M  
Sbjct  413   AVKISVEYGWDFYNTGLEGQMVLSAQEIERGIREVMEHDSDTRKRVKEMSAMSKKALMDG  472

Query  1375  GSSAVSLGKLIEE  1413
             GSS  SLG  +++
Sbjct  473   GSSYSSLGLFLDQ  485



>ref|XP_010104647.1| UDP-glycosyltransferase 71C3 [Morus notabilis]
 gb|EXC01453.1| UDP-glycosyltransferase 71C3 [Morus notabilis]
Length=468

 Score =   379 bits (972),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 206/475 (43%), Positives = 291/475 (61%), Gaps = 19/475 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MK++++VF+  P +G+LV  VE +K L  Q+  +SVT+L I +   P    +  SL  S+
Sbjct  1     MKKSELVFIPWPMVGHLVSTVEIAKRLIDQDDRISVTILCIKLWLTPFADEFTKSLVGSE  60

Query  187   GNLEFLSLPAAEPPSPDQ-NRSTISFLSIWIENHEPHVRRALTKL---KSDDDVRIAGFF  354
               ++ + +P  EPPS +   ++   +  ++ E+  P VR  L  +      + ++++G  
Sbjct  61    TRIKLIDIP--EPPSSELLIKTRKDYFYLYAESLVPQVRNTLKHIIMSSQSNSIQVSGLV  118

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPG  534
             +D FC   +DVA EL +  Y++F     FLSF LH+PT    +   SEF D+  + ++PG
Sbjct  119   LDFFCMPMLDVANELGLNSYIFFTCNLGFLSFFLHLPTCHDLI--GSEFKDSDPDLILPG  176

Query  535   FENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESY-CLGSMFGGND  711
             F NPVPV   P  +  +  D Y   L+ A+R+RET+G++VN+F ELES+  + S+     
Sbjct  177   FANPVPVRLIPAHLFTK--DGYSLMLKLAQRFRETKGILVNSFVELESHDIVESLISDGK  234

Query  712   VGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSL-NPAQIRE  888
               P+Y IGPVVD EG      D    E +M+WLD Q  SSV+FL  GS+G     +Q+ E
Sbjct  235   TPPLYMIGPVVDLEGLPHPSADQAQQENIMEWLDEQPDSSVLFLCFGSVGCFFGASQLIE  294

Query  889   IATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             IA GLER+GYRFLW            P      +   P GF +RTKG+G+VC W PQV +
Sbjct  295   IALGLERSGYRFLWCATSQK------PFRNVQEEITFPEGFLERTKGRGIVCEWAPQVEV  348

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD  1248
             LAHKA+GGFVSHCGWNSILE+L  GVPI TWPIYAEQ LNAF+MV+E GLAVE+  DYK 
Sbjct  349   LAHKAVGGFVSHCGWNSILESLWCGVPIATWPIYAEQQLNAFRMVREFGLAVELRLDYKY  408

Query  1249  GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                +V AE++E  V++LM+G+ EVR+K KE S+M +    K GSS  +LG+LI +
Sbjct  409   DRDVVMAEEIEMAVKRLMEGESEVRKKGKEMSKMARNAVAKGGSSFNALGQLIAD  463



>ref|XP_007142218.1| hypothetical protein PHAVU_008G262100g [Phaseolus vulgaris]
 gb|ESW14212.1| hypothetical protein PHAVU_008G262100g [Phaseolus vulgaris]
Length=484

 Score =   379 bits (973),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 199/471 (42%), Positives = 293/471 (62%), Gaps = 18/471 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASDG  189
             K+A ++F   P IG+L P +E ++LL + + +LS+T++ + +P  P   +YI S+ AS  
Sbjct  6     KKAGLIFFPIPGIGHLAPSLELAQLLINHHNHLSITIICMKLPHAPYSDAYIRSVTASQP  65

Query  190   NLEFLSLPAAEPPSPDQ-NRSTISFLSIWIENHEPHVRRALTK-LKSDDDVRIAGFFVDM  363
              +  + LP  EPP  +   RS   ++   ++  +PHV+  +   L S     + G  +D+
Sbjct  66    QIRAIDLPHVEPPPQELLKRSIPHYICTLLQILKPHVKATVQNILSSSHSNPVIGLVLDV  125

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFEN  543
             FC+  IDV  +L IP YL   S   FLS ML +            F D+  +++IPGF +
Sbjct  126   FCSPMIDVGNDLGIPSYLSMPSNVGFLSLMLSLQKRQV----GDVFCDSDPKWLIPGFPD  181

Query  544   PVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP-  720
             P P    P  +  + E  Y  +   A+R+++++G++VNTF ELE Y + ++  G    P 
Sbjct  182   PFPSSVMPDAVFNK-EGGYAAYYNLAQRFQDSKGIIVNTFSELEQYAIDALCDGQIQTPS  240

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             +Y +GP+++ +G    + D   H+ ++KWLD Q  SSVVFL  GS GS +P Q REIA  
Sbjct  241   IYAVGPLINFKGQPNPNLDQAQHDRILKWLDEQPDSSVVFLCFGSRGSFDPPQTREIAQA  300

Query  901   LERAGYRFLWSIREPPKS-KLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             L+R+G RFLW++R PP + K++        + +LP GF + TKG+GM+C W PQV +LAH
Sbjct  301   LQRSGVRFLWTMRSPPTTTKIE--------EGILPEGFLEWTKGRGMLCDWAPQVEVLAH  352

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGIT  1257
             KAIGGFVSHCGWNSILE+L  GVPI TWPIYAEQ LNAF+MV+E  LAVE+  DY+ G  
Sbjct  353   KAIGGFVSHCGWNSILESLWFGVPILTWPIYAEQQLNAFRMVREFRLAVELRLDYRRGSD  412

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             LV AE++E+G+++LMD D+ V +KVKE  EM ++  +  GSS  S+GKLI+
Sbjct  413   LVMAEEIEKGLKQLMDRDNMVHKKVKEMKEMARKAVLNGGSSFSSVGKLID  463



>ref|XP_003519247.1| PREDICTED: UDP-glycosyltransferase 71C3-like [Glycine max]
 gb|KHN46160.1| UDP-glycosyltransferase 71C3 [Glycine soja]
Length=466

 Score =   378 bits (970),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/469 (40%), Positives = 291/469 (62%), Gaps = 17/469 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASDG  189
             K+ +++F S P  G+L   +E ++LL   + +LS+T+L + +P  P   +YI S+ AS  
Sbjct  6     KKEELIFFSIPGSGHLPSSLELAQLLIKHHNHLSITILCMKLPYAPYSDAYIRSVTASQP  65

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
              ++ + LP  EPP  +  RS   ++  +++  +PHV+  +  + S     + G  +D+FC
Sbjct  66    QIQAIDLPQVEPPPQELLRSPPHYILTFLQTLKPHVKAIVKNISSSHSNTVVGLVIDVFC  125

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENPV  549
                IDVA +L IP YLY  S   FL+ M  +   +        F D+  ++++PG  +PV
Sbjct  126   APLIDVANDLGIPSYLYMPSNVGFLNLMFSLQKREV----GDAFNDSDPQWLVPGLPDPV  181

Query  550   PVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN-DVGPV  723
             P    P  F +K  +  Y  + + A+R+++++G++VN+F ELE Y + ++  G     P+
Sbjct  182   PSSVLPDAFFNK--QGGYATYYKLAQRFKDSKGIIVNSFSELEQYAIDALCDGQIQTPPI  239

Query  724   YPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             Y +GP+++ +G    + D   H+ ++KWLD Q  SSVVFL  GS GS  P+Q REIA  L
Sbjct  240   YAVGPLINLKGQPNQNLDQAQHDRILKWLDEQPDSSVVFLCFGSRGSFEPSQTREIALAL  299

Query  904   ERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHKA  1083
             + +G RFLWS+  PP           + + +LP GF + T+G+GM+C W PQV ILAHKA
Sbjct  300   QHSGVRFLWSMLSPPTKD--------NEERILPEGFLEWTEGRGMLCEWAPQVEILAHKA  351

Query  1084  IGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITLV  1263
             + GFVSHCGWNSILE++  GVPI TWPIYAEQ LNA++MV+E GLAVE+  DY+ G  LV
Sbjct  352   LVGFVSHCGWNSILESMWFGVPILTWPIYAEQQLNAYRMVREFGLAVELKVDYRRGSDLV  411

Query  1264  SAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
               E++E+G+++LMD D+ V +KVK+  EM ++  +  GSS +S+G+LI+
Sbjct  412   MEEEIEKGLKQLMDRDNAVHKKVKQMKEMARKAILNGGSSFISVGELID  460



>ref|XP_010033014.1| PREDICTED: UDP-glycosyltransferase 71D2-like [Eucalyptus grandis]
 gb|KCW52535.1| hypothetical protein EUGRSUZ_J01922 [Eucalyptus grandis]
Length=471

 Score =   378 bits (970),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 210/480 (44%), Positives = 301/480 (63%), Gaps = 27/480 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL-ASD  186
             MK+ +++F+  P +G+++  +EF+  L   +  +S+TVL I  P    + +Y  SL AS 
Sbjct  1     MKKPELIFIPAPGVGHVISALEFAARLLGHDPRISITVLAIKAPFSSHLDAYTKSLVASQ  60

Query  187   GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVR-----IAGF  351
               +  + LP  +PP P+  RS   +++++IE++ PHV+RA+ +++S          +AGF
Sbjct  61    PRIALIDLPPVDPPPPELLRSVEHYVTVYIESYIPHVQRAVGEIQSSRSDSGSDRSVAGF  120

Query  352   FVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIP  531
              +D FCTS IDVA+   +P Y+Y  S A FL  M H+P    Q+ + +   D   +  +P
Sbjct  121   VLDFFCTSMIDVADGFSLPSYIYLTSNAHFLDLMFHLPARHDQIGREARLSD--PDLPLP  178

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
              F NPVPV   P  +       Y  +++ A+R+R+ RG++VNTF ELE   LGS  GG+ 
Sbjct  179   NFANPVPVSVLPSAVLDGEAGGYAAYVKLARRFRDVRGIMVNTFMELERSALGSFSGGSW  238

Query  712   VGP-VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
              GP VY +GPV+D +G      D  + E + +WLD Q  SSVVFL  GS+GS +  Q++E
Sbjct  239   DGPAVYAVGPVIDPKGVPDPSLDRAHWEKIREWLDEQPPSSVVFLCFGSLGSFDADQVKE  298

Query  889   IATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             IA+G+ER+G++FLWS+R P  S+  LP            GF +R +G+G++CGW PQV +
Sbjct  299   IASGIERSGHKFLWSLR-PESSQSQLPV-----------GFLERMRGRGIICGWTPQVEV  346

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD  1248
             L H AIGGFVSHCGWNSILE+L +GVPI TWPIYAEQ LNAF MVKELGLAVE+  DYK 
Sbjct  347   LGHAAIGGFVSHCGWNSILESLWYGVPIVTWPIYAEQQLNAFTMVKELGLAVELRLDYKG  406

Query  1249  ---GITLVSAEDVERGVRKLMDGDD--EVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                G  LV AE++E+ V +LM GDD  E R+KV+E  E  +    + GSS  S+G+LI++
Sbjct  407   QGIGGHLVPAEEIEKAVGRLM-GDDAAETRKKVREMREAARNAVKEGGSSYDSIGRLIQD  465



>dbj|BAD29721.1| UDP-glucose glucosyltransferase [Catharanthus roseus]
Length=480

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 194/482 (40%), Positives = 300/482 (62%), Gaps = 25/482 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSL--AS  183
             MK+ ++V + TP IG+LV  +E +KLL+ Q++ + + +L + +     + +YI SL  AS
Sbjct  4     MKKVELVLIPTPEIGHLVSAIELAKLLTDQDEQIFIKILTMKLIFDSTVTNYIKSLSGAS  63

Query  184   DGNLEFLSLPAAE------PPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIA  345
                + F+ L   E       P+P  +R  +      +E+++ HVR  L ++ +    ++ 
Sbjct  64    TSRVSFIELSDNESSSKIVAPNPFLHRLMV------LESYKNHVRNILAEICNSSTSKLG  117

Query  346   GFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEY  522
             G  VDMFCT+ IDVA E  +P YL++ + A+ L  +LH+ +L     +N +++ D+  E 
Sbjct  118   GIIVDMFCTNMIDVANEFRVPTYLFYTTTAAMLGLVLHLQSLRDDFAQNLADYKDSISEL  177

Query  523   VIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG  702
              IP ++NPVPV   P  +  + E + + FL HAKRYRE +G+++NTF +LESY L ++  
Sbjct  178   SIPSYKNPVPVNILPSIVFDKGESSNV-FLNHAKRYREMKGIIINTFLDLESYALENLTE  236

Query  703   GNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
                + PVY +GP+++ +G    H      E++++WLD Q +SSVVFL  GS G  +  Q+
Sbjct  237   DETLPPVYAVGPILNVKGS---HNQDNEVEVILEWLDLQPNSSVVFLCFGSRGYFDKEQV  293

Query  883   REIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             +EIA  LE +GYRFLWS+R+PP S   +  ++ +L+ +LP GF  R+   G V GW PQV
Sbjct  294   KEIAYALEHSGYRFLWSLRQPP-SPGKVATEFGNLEELLPEGFFQRSAEIGKVIGWAPQV  352

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              +L+H A+GGFVSHCGWNS LE++  GVP+ TWP+YAEQ  NAFQ+VK+L +AVEI  DY
Sbjct  353   QVLSHPAVGGFVSHCGWNSTLESIWFGVPMATWPLYAEQQGNAFQLVKDLEMAVEIKIDY  412

Query  1243  KDGI-----TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
             +         +V A+++E G+R+LMD ++EVR KVKE  E  +   ++ GSS  S+   I
Sbjct  413   RKNFFASTEDIVKADEIEAGIRRLMDPENEVRNKVKEMKERSRVAIVEGGSSYTSMQWFI  472

Query  1408  EE  1413
             E+
Sbjct  473   ED  474



>emb|CDP11878.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 202/485 (42%), Positives = 306/485 (63%), Gaps = 30/485 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M++ K++ + +P +G+L   +E +KL+  +N  LS+  L++ +P  P   + I SL +  
Sbjct  1     MEKFKLLMMVSPLMGHLAQALELAKLMLARNNQLSIIALIMELPIDPHGTARIQSLIAAT  60

Query  190   NLE---FLSLPAAEPPSPDQNRSTISFLSI-WIENHEPHVRRALTKLKSDDDVRIAGFFV  357
             N+E   F  LP  E  S D N +     ++  +E  +PHVR   +K +     +  GF +
Sbjct  61    NVEGLHFHHLPTPEDTS-DWNITHRGLFTLKLLEYQKPHVRAIASKTQ-----KFCGFLI  114

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAK---EYVI  528
             D+  T+ IDVA+EL +P Y++F S A+FL  MLH  TL+ +  +N +  D  K     ++
Sbjct  115   DLVSTTMIDVADELGVPTYIFFTSGAAFLGLMLHFQTLEDE--QNQDISDLVKGESHLIL  172

Query  529   PGFENPVPVESFPPFMS-KRHEDTYLPFLQHAKRYRETRGVVVNTFKELES-----YCLG  690
             P F  PVP+   P   + K +  T++  L+  + YR  +G++VNTF +LES     + L 
Sbjct  173   PIFAKPVPIGVLPAMATQKEYWSTFV--LKWTRDYRRAKGIIVNTFSDLESNAISSFSLD  230

Query  691   SMFGGNDVGPVYPIGPVVDREGPARWHPDSW-NHELVMKWLDNQLSSSVVFLTTGSMGSL  867
             S +G + + P++P+GP+++R   ++ H  S  ++  +MKWLD Q  +SVVFL  GS+ S 
Sbjct  231   SYYGKSSLPPIFPVGPILNR---SQIHTQSSEDYSAMMKWLDCQPKNSVVFLCFGSLASF  287

Query  868   NPAQIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCG  1047
             +P Q++EIA G+ER+G+RFLW +R+PP +K   P DY +L+ VLP GF DRT   G V G
Sbjct  288   HPDQVQEIAYGIERSGHRFLWVLRQPPATKGGFPRDYENLELVLPEGFLDRTASIGKVVG  347

Query  1048  WVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVE  1227
             WVPQ+ +L+H A+ GFVSHCGWNS LE++  GVPI  WP+ AEQ LNAFQ+VKELG+AVE
Sbjct  348   WVPQLAVLSHSAVRGFVSHCGWNSTLESIFCGVPIAAWPVQAEQQLNAFQLVKELGIAVE  407

Query  1228  ITFDY---KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLG  1398
             I+ DY   K+   LV AE VE+G+R++MD ++EVR +VKE+SE  +    + GSS  +LG
Sbjct  408   ISLDYKQQKENHALVRAEQVEKGIREIMDVENEVRIRVKEFSEKSRLATKEGGSSYFALG  467

Query  1399  KLIEE  1413
              LI++
Sbjct  468   NLIQD  472



>dbj|BAI65915.1| UDP-sugar:glycosyltransferase [Anthriscus sylvestris]
Length=485

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/477 (41%), Positives = 295/477 (62%), Gaps = 13/477 (3%)
 Frame = +1

Query  16    QAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG--  189
             + +++F+  P IG+LV  VE +KLL  ++Q +S+++L+        ++++I +L  D   
Sbjct  2     RVELIFIPAPEIGHLVAAVELAKLLVRRDQRISISMLIQKKASDSGVEAFIQNLKKDDPD  61

Query  190   NLEFLSLPAAEPPSPDQNRST--ISFLSIWIENHEPHVRRALTK-LKSDDDVRIAGFFVD  360
              +EF+ +PA +  +  + RS    SFL  ++ N    VR  +T+ LK  +   + GF +D
Sbjct  62    RIEFVDIPALDETTMTELRSLPPTSFLEAFVSNQRTLVRDIVTEILKRSETPELGGFVLD  121

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGF  537
             MF T  I VA + ++P Y +F S A+FL+ M +   L D +  + S +  +  E  +PGF
Sbjct  122   MFTTPMIQVANDFNVPAYAFFTSGAAFLNVMFYAQDLKDNKNFEISGYKGSDIELSVPGF  181

Query  538   ENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVG  717
              N VP +  P  +        L  +  A+  R+T+ + VNT  ELE++ + S+    ++ 
Sbjct  182   SNLVPAKGLPSVILDEGGSAML--INIARSLRKTKAIFVNTVMELEAHAIKSLKDDGNIP  239

Query  718   PVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIAT  897
              +Y +GP++  E       +  ++E +M WLD+Q SSSVVFL  GS GS N  Q++EIA 
Sbjct  240   AIYHVGPLISFEKGEPTSQNKKSNEDIMSWLDSQASSSVVFLCFGSRGSFNTEQVKEIAC  299

Query  898   GLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
              LE +G+RFLWS+R     K +LP DY D + VLP GF +RT G G V GW PQVTIL+H
Sbjct  300   ALELSGHRFLWSLRRSSNEKRELPKDYEDYNEVLPEGFLERTSGIGKVIGWAPQVTILSH  359

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGIT  1257
              A+GGFVSHCGWNS LE++  GVPI TWPIYAEQ  NAFQ+VKELGLAVEI  DY++ I 
Sbjct  360   PAVGGFVSHCGWNSTLESIWCGVPIATWPIYAEQQTNAFQLVKELGLAVEIKLDYRNDII  419

Query  1258  -----LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                  +V+AE++E G+R+LM+G+ E+R KVK   ++C++  ++ GSS  SLG+ I++
Sbjct  420   GDISPIVTAEEIECGIRRLMNGEGEMRNKVKTMKDVCRKAIVEGGSSYSSLGQFIQD  476



>ref|XP_006428807.1| hypothetical protein CICLE_v10011659mg [Citrus clementina]
 ref|XP_006480616.1| PREDICTED: UDP-glycosyltransferase 71C4-like [Citrus sinensis]
 gb|ESR42047.1| hypothetical protein CICLE_v10011659mg [Citrus clementina]
Length=468

 Score =   377 bits (969),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/469 (42%), Positives = 296/469 (63%), Gaps = 8/469 (2%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A+++FV +P IG+LV  +EF+K L+ ++  +SVT+L + +   P + +Y  SL +D 
Sbjct  1     MKKAELIFVPSPGIGHLVSTLEFAKHLTDRDDRISVTLLSMKLAVAPWVDAYAKSL-TDS  59

Query  190   NLEFLSLPAAEPPSPDQ---NRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVD  360
                   +       P      +S   FLS+ +E+H P+V+  ++   +   +++ G  +D
Sbjct  60    QPRICIIDLPPVDPPLPDVLKKSPEYFLSLVVESHLPNVKNIVSSRANSGSLQVTGLVLD  119

Query  361   MFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFE  540
              FC S +D+A+EL +P Y++  S   FL  ML++PT   ++  ++ F  +  E +IPG  
Sbjct  120   FFCVSMVDIAKELSLPSYIFLTSNLGFLGLMLYLPTRQDRI--STVFESSDHELLIPGIT  177

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             +PVPV   P  +  + +  +   ++ A+R+++  G++VNTF ELE Y + + F G+   P
Sbjct  178   SPVPVCVLPSCLFNK-DGGHATLVKLAQRFKDVDGIIVNTFHELEPYAVNA-FSGDLNPP  235

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             +Y +GPV+  +       D   ++ + +WLD+   SSVVFL  GS GS + AQ++EIA G
Sbjct  236   LYTVGPVLHLKSQPNPDLDEAQYQKIFQWLDDLAESSVVFLCFGSSGSFDVAQVKEIAIG  295

Query  901   LERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             LER+GY FLWS+R          + Y   + V P GF +R KG+GM+CGWVPQV ILAHK
Sbjct  296   LERSGYNFLWSLRVSCPKDEASAHRYVTNNGVFPEGFLERIKGRGMICGWVPQVEILAHK  355

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGITL  1260
             AIGGFVSHCGWNSILE+L +GVPI TWPIYAEQ LNAF+MVKE GLA+++  DY+ G  L
Sbjct  356   AIGGFVSHCGWNSILESLWYGVPIATWPIYAEQQLNAFRMVKEQGLALDLRLDYRVGSDL  415

Query  1261  VSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
             V A D+E  VR LMDG+ ++R+K KE +E+ ++  M+ GSS  S+G+ +
Sbjct  416   VMACDIESAVRCLMDGESKIRKKGKEMAEISRKSLMEGGSSFNSIGQFV  464



>ref|NP_001280899.1| anthocyanidin 3-O-glucosyltransferase 2-like [Malus domestica]
 gb|ACZ44835.1| glycosyltransferase [Malus domestica]
Length=477

 Score =   378 bits (970),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 212/479 (44%), Positives = 310/479 (65%), Gaps = 18/479 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK+ ++VF+ +P  G+ +P ++F K L  +N  +S+T+L I       + SY  S+A S+
Sbjct  1     MKKVELVFIPSPGAGHHLPTLQFVKRLIDRNDRISITILAIQSYFPTTLSSYTKSIAASE  60

Query  187   GNLEFLSLPA-AEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAG  348
               + F+ +P   + P  +  +S     S++IE+H P V++ +T L      S D +R+A 
Sbjct  61    PRIRFIDVPQPQDRPPQEMYKSRAQIFSLYIESHVPSVKKIITNLVSSSANSSDSIRVAA  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               VD+FC S IDVA+EL+IP YL+  S A +L+FMLH+P L  +     E  D   ++ I
Sbjct  121   LVVDLFCVSMIDVAKELNIPSYLFLTSNAGYLAFMLHLPILHEKNQIAVEESDP--DWSI  178

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             PG  +PVP    P  ++      Y+     A R+RETRG++VNTF ELE++ + ++F  +
Sbjct  179   PGIVHPVPPRVLPAALTDGRLSAYIKL---ASRFRETRGIIVNTFVELETHAI-TLFSND  234

Query  709   D-VGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             D V PVYP+GPV+D  +G    + D    + ++KWLD+Q   SVVFL  GSMGS    Q+
Sbjct  235   DRVPPVYPVGPVIDLDDGQEHSNLDQAQRDKIIKWLDDQPQKSVVFLCFGSMGSFGAEQV  294

Query  883   REIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVPQ  1059
             +EIA GLE++G RFLWS+R P    + +P+D ++L+ VLP GF +RT GK G++CGW PQ
Sbjct  295   KEIAVGLEQSGQRFLWSLRMPSPKGI-VPSDCSNLEEVLPDGFLERTNGKKGLICGWAPQ  353

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V ILAH A GGF+SHCGWNSILE+L HGVPI TWP+YAEQ LNAF+MV+ELG+A+E+  D
Sbjct  354   VEILAHSATGGFLSHCGWNSILESLWHGVPIATWPMYAEQQLNAFRMVRELGMALEMRLD  413

Query  1240  YKDG-ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             YK G   +V A+++E+ V  +M+ D EVR+KV+E  +M ++     GSS  S+G+ IE+
Sbjct  414   YKAGSADVVGADEIEKAVVGVMEKDSEVRKKVEEMGKMARKAVKDGGSSFASVGRFIED  472



>ref|XP_011002388.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 6-like [Populus 
euphratica]
Length=511

 Score =   379 bits (973),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 213/483 (44%), Positives = 305/483 (63%), Gaps = 22/483 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDS-LAS  183
             MK A++VF+  P IG+ V  VE +KLL  +++ LS+T L++       + +SY DS +A+
Sbjct  30    MKNAELVFIPAPIIGHFVSAVEVAKLLVERDERLSITFLVMKSSLSTNIARSYNDSVIAA  89

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAG  348
              G + F+ LP  E    D N S+  F+S+ IE  +PHV+  ++KL      S D  R+AG
Sbjct  90    CGRIRFIHLPEVEL---DPNLSSRFFISL-IEAQKPHVKEEVSKLVIESESSPDSPRLAG  145

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFM---LHIPTLDAQVPKN-SEFGDAAK  516
             F +DMF TS IDVA E  +P Y++F S A+FL+ +    +I  L  ++  + +EF ++  
Sbjct  146   FVLDMFSTSIIDVANEFGVPSYVFFTSAAAFLACLGTTFYIQALHDELKVDPTEFKNSDV  205

Query  517   EYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSM  696
             E V+P   +P P +  P   S   +D    FL+  +R+RE +G++VNTF ELES+ + S 
Sbjct  206   ELVMPCLASPFPAKVLPS--SVLGKDLLPLFLRLVRRFREAKGIMVNTFYELESHTINSF  263

Query  697   FGGNDVGPVYPIGPVVDREGPARWHPDSWN--HELVMKWLDNQLSSSVVFLTTGSMGSLN  870
               GN   PVYP+GP+++  G            H  +M+WLD+Q SSSVV+L  GS+GS  
Sbjct  264   SDGN-YPPVYPVGPLLNLNGHEHDVVSDRKDIHRDIMQWLDHQPSSSVVYLCFGSLGSFG  322

Query  871   PAQIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCG  1047
               Q++EIA GLE++G+RFLWS+R+PP   K++ P+DY +   VLP GF DRT   G + G
Sbjct  323   VEQVKEIACGLEQSGHRFLWSLRQPPPNGKMEAPSDYVNPAEVLPEGFLDRTSEIGKIIG  382

Query  1048  WVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVE  1227
             W PQV ILAH +IGGFVSHCGWNS LE++   VPI TWP+YAEQ  NAF M+ E GLA E
Sbjct  383   WAPQVDILAHPSIGGFVSHCGWNSTLESIWFDVPIATWPLYAEQQFNAFLMIVEFGLATE  442

Query  1228  ITFDYK-DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKL  1404
             I  +Y+ D   +V AE++E+G+R LM+ D + REK+KE SE  ++  M +GSS   LG L
Sbjct  443   IQVNYRMDACQIVRAEEIEKGIRGLMEIDLKKREKLKEISESSRKALMNDGSSYTWLGHL  502

Query  1405  IEE  1413
             I++
Sbjct  503   IQD  505



>gb|ACU21214.1| unknown [Glycine max]
Length=469

 Score =   377 bits (969),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 203/471 (43%), Positives = 292/471 (62%), Gaps = 21/471 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYI-DSLASDG  189
             K A+++ + +P IG+L   +EF++LL +++  LSVT+L I  P  P   SYI  +LAS  
Sbjct  9     KNAELILIPSPGIGHLTSSLEFAQLLINRDNRLSVTILCIKFPFTPFADSYIRTALASQP  68

Query  190   NLEFLSLPAAEPPSPDQN-RSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
              ++ + LP  EPP  +    S   ++  ++E+ +PHVR  +  + S     + G  +D+F
Sbjct  69    KIKLIDLPLVEPPPRELAFNSPEHYIWTFMESLKPHVRAIMQNILSHP---VVGLVLDIF  125

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENP  546
               S +DV +EL IP Y++  S  +F +FML + +   +      F D+  +  IPGF +P
Sbjct  126   TMSMVDVGDELGIPSYMFMTSNVAFTAFMLFLLSRRME----DVFSDSDPDLSIPGFPDP  181

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF--GGNDVGP  720
             VP  S  P  +   +  Y  + + AKR+ +T+G++VN+F ELE Y + ++   G +   P
Sbjct  182   VP-PSVLPDAAFNKDGGYATYYKLAKRFMDTKGIIVNSFSELEQYAIDALSEEGQSRTPP  240

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VY +GP++D +G    + D   H+ V+KWLD Q  SSVVFL  GSMG   P+Q REIA  
Sbjct  241   VYAVGPLIDLKGQPNPNLDQAQHDKVLKWLDEQPGSSVVFLCFGSMGGFGPSQTREIALA  300

Query  901   LERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSD-RTKGKGMVCGWVPQVTILAH  1077
             L+ +G RFLW++R PP S         + D  LP GF +   +GKGMVCGW PQV +LAH
Sbjct  301   LQGSGLRFLWAMRSPPTSD--------NADRTLPEGFLEWMEEGKGMVCGWAPQVEVLAH  352

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGIT  1257
             KAIGGFVSHCGWNSILE+L  GVPI TWPIYAEQ LNAF MV+   LAVE+  DY+ G  
Sbjct  353   KAIGGFVSHCGWNSILESLWFGVPILTWPIYAEQQLNAFWMVRGYELAVELKVDYRRGSD  412

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             LV AE++E+G+++LMDGD+ V + VKE  E  +   +  GSS +++GKLI+
Sbjct  413   LVMAEEIEKGLKQLMDGDNVVHKNVKEMKEKARNAVLTGGSSYIAVGKLID  463



>ref|NP_001240903.1| UDP-glycosyltransferase 71D1-like [Glycine max]
 gb|ACM45956.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Glycine 
max]
 gb|KHN46159.1| UDP-glycosyltransferase 71D1 [Glycine soja]
Length=469

 Score =   377 bits (969),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 203/471 (43%), Positives = 292/471 (62%), Gaps = 21/471 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYI-DSLASDG  189
             K A+++ + +P IG+L   +EF++LL +++  LSVT+L I  P  P   SYI  +LAS  
Sbjct  9     KNAELILIPSPGIGHLTSSLEFAQLLINRDNRLSVTILCIKFPFTPFADSYIRTALASQP  68

Query  190   NLEFLSLPAAEPPSPDQN-RSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMF  366
              ++ + LP  EPP  +    S   ++  ++E+ +PHVR  +  + S     + G  +D+F
Sbjct  69    KIKLIDLPLVEPPPRELALNSPEHYIWTFMESLKPHVRAIMQNILSHP---VVGLVLDIF  125

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGFENP  546
               S +DV +EL IP Y++  S  +F +FML + +   +      F D+  +  IPGF +P
Sbjct  126   TMSMVDVGDELGIPSYMFMTSNVAFTAFMLFLLSRRME----DVFSDSDPDLSIPGFPDP  181

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF--GGNDVGP  720
             VP  S  P  +   +  Y  + + AKR+ +T+G++VN+F ELE Y + ++   G +   P
Sbjct  182   VP-PSVLPDAAFNKDGGYATYYKLAKRFMDTKGIIVNSFSELEQYAIDALSEEGQSRTPP  240

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VY +GP++D +G    + D   H+ V+KWLD Q  SSVVFL  GSMG   P+Q REIA  
Sbjct  241   VYAVGPLIDLKGQPNPNLDQAQHDKVLKWLDEQPGSSVVFLCFGSMGGFGPSQTREIALA  300

Query  901   LERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSD-RTKGKGMVCGWVPQVTILAH  1077
             L+ +G RFLW++R PP S         + D  LP GF +   +GKGMVCGW PQV +LAH
Sbjct  301   LQGSGLRFLWAMRSPPTSD--------NADRTLPEGFLEWMEEGKGMVCGWAPQVEVLAH  352

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGIT  1257
             KAIGGFVSHCGWNSILE+L  GVPI TWPIYAEQ LNAF MV+   LAVE+  DY+ G  
Sbjct  353   KAIGGFVSHCGWNSILESLWFGVPILTWPIYAEQQLNAFWMVRGYELAVELKVDYRRGSD  412

Query  1258  LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
             LV AE++E+G+++LMDGD+ V + VKE  E  +   +  GSS +++GKLI+
Sbjct  413   LVMAEEIEKGLKQLMDGDNVVHKNVKEMKEKARNAVLTGGSSYIAVGKLID  463



>ref|XP_009347883.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3 [Pyrus x bretschneideri]
Length=474

 Score =   377 bits (968),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 211/480 (44%), Positives = 305/480 (64%), Gaps = 22/480 (5%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             K A +VFV    IG++   VE +K L  ++  L +T+L++ +P   L  +   S++    
Sbjct  3     KPAVLVFVPGLGIGHIRSTVEIAKQLVARDDQLFITILIMKLPFDKLFTNTDSSISH--R  60

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVR--------IAG  348
             + F++LP      P       SF++ +IE+H+ HV+ A+TKL +D  V+        + G
Sbjct  61    INFVNLPETLVDIP---LVFPSFVNPFIESHKIHVKEAVTKLLTDLSVQSESKNPRVLGG  117

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYV  525
             F +DMFCTS IDVA E  +P +L++ S A+ L F LH+ +L  +  K+  E  +++ E V
Sbjct  118   FVIDMFCTSMIDVANEFGVPSFLFYTSSAAMLGFWLHLASLRNEHDKDIYELINSSTELV  177

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             IP F NPVP + FP  +S +  +    FL    R+RET+G++VNTF +LE++ + S+  G
Sbjct  178   IPSFINPVPTKLFPGELSDK--EAVAIFLDFGTRFRETKGILVNTFSDLEAHAIHSLSDG  235

Query  706   NDVGPVYPIGPVVDREGP-ARWHPDSWNHEL-VMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
                 PVYP+GP+++++    R  PD    +  ++ WLD+Q   SV+FL  GSMGS   AQ
Sbjct  236   K-TPPVYPVGPLLNQKSDDTRVAPDKAREKSDILDWLDDQPPLSVLFLCFGSMGSFCEAQ  294

Query  880   IREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVP  1056
             ++EIA  LE +G RFLWS+R+PP K  L LP+DY D   VLP GF DRT   G V GW P
Sbjct  295   VKEIARALEHSGLRFLWSLRQPPPKGTLTLPSDYADPKAVLPEGFLDRTATTGKVLGWAP  354

Query  1057  QVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITF  1236
             QV IL+H A+GGFVSHCGWNS LE++ HGVPI TWP+YAEQ  NAF+++ ELGLAVEI  
Sbjct  355   QVAILSHPAVGGFVSHCGWNSALESIWHGVPIATWPMYAEQQSNAFELL-ELGLAVEIKM  413

Query  1237  DYK-DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             DYK +   +VSAE++ERG++++M+ D + R++VKE SE  K+     GSS  SLG+ I++
Sbjct  414   DYKTESEVVVSAEEIERGIKEVMELDSDTRKRVKETSEKGKKALEFGGSSYSSLGRFIDQ  473



>ref|XP_010044907.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW88550.1| hypothetical protein EUGRSUZ_A00926 [Eucalyptus grandis]
Length=473

 Score =   377 bits (968),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 210/479 (44%), Positives = 295/479 (62%), Gaps = 26/479 (5%)
 Frame = +1

Query  16    QAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD--G  189
             ++++VF+ +P +G+LV +VE +KLL  ++  LS+TVL++  P    I SYI+SL +    
Sbjct  4     KSELVFIPSPGLGHLVSMVETAKLLVDRDDRLSLTVLIMKFPFDSEIDSYIESLTASVAA  63

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
              + F+ LP  +  SP    S ++FL  ++E+H+ +VR A+ +L      R+AG  +DM C
Sbjct  64    RIRFVLLPR-QSHSP--TTSGMAFLHHFVESHKANVREAVAELSVRGSPRLAGLVLDMIC  120

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENP  546
             TS IDVA E  IP Y++F S A  L  MLH+ +L D Q    +    +  E   PG  NP
Sbjct  121   TSMIDVAVEFGIPSYMFFTSGAGILGVMLHLQSLRDEQHMDPTRLKGSDAELDFPGLANP  180

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSM--FGGNDVGP  720
             +P   F P      ED  + FL  A RYRET+G++VNTF ELE   + ++   G      
Sbjct  181   LPAAKFLPLEVFMEEDCRI-FLDFALRYRETKGILVNTFAELEPRAMDALPSLGAP---A  236

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VY +GP+++         +S     ++ WLD Q ++SVVFL  GS G  +  Q +EIA  
Sbjct  237   VYSVGPILN------ITDESKKGFEILDWLDQQPNASVVFLCFGSRGYFDEHQAKEIAHA  290

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LE++ YRFLWS+R+PP K K + P DY D   VLP GF +RT G G V GW PQV +LAH
Sbjct  291   LEQSRYRFLWSLRQPPAKGKQEAPRDYVDPAEVLPEGFLNRTAGVGRVIGWAPQVAVLAH  350

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGIT  1257
              AIGGFVSHCGWNS LE++  GVP+  WP YAEQ  NAFQ+V+ELGLAVEI  DY+  + 
Sbjct  351   PAIGGFVSHCGWNSTLESIWFGVPVAAWPQYAEQQFNAFQLVRELGLAVEIKMDYRRDLV  410

Query  1258  -----LVSAEDVERGVRKLMDGDD--EVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                  +V A ++ERG+RKLM+G++  E R+KVKE SE  ++V M+ GSS + + + IE+
Sbjct  411   KGSDGVVKANEIERGIRKLMEGEEAGERRKKVKEVSEKSRKVLMEGGSSYLCMARFIED  469



>dbj|BAF75895.1| tetrahydroxychalcone 2'-glucosyltransferase [Cyclamen persicum]
Length=482

 Score =   377 bits (968),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 204/479 (43%), Positives = 299/479 (62%), Gaps = 14/479 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASD-  186
             M++A++ F+  P  G+LVP+VE +K L+ +++ +SVTV ++ +P +  + SY  SL S+ 
Sbjct  1     MERAELAFIPIPGAGHLVPMVELAKALTTRDERISVTVFIMEVPFQSKLNSYTQSLLSNP  60

Query  187   --GNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVR--IAGFF  354
                 + F+ L   EP + D      SF   W+ +     +  +    S D  R  +A F 
Sbjct  61    PPSRVRFVHLTLDEPTTEDIRSKPGSF---WLLDLIQINKSRVKDFYSSDSTRYELAAFV  117

Query  355   VDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIP  531
             VDMFC+ F +VA E  +P Y++F S A FLS M ++  + D Q    +EF D+  E  IP
Sbjct  118   VDMFCSQFAEVASEFGVPDYVFFTSNAYFLSLMFYLQAIQDYQNRDIAEFKDSDVELSIP  177

Query  532   GFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGND  711
             GF NPVP +  P     + +   L F+   ++ R+T+G++ NTF+E ESY +  +   + 
Sbjct  178   GFMNPVPTKVLPHVAFDKEKGGALFFVDVPRKLRKTKGILANTFEEFESYTIKCLAEDDK  237

Query  712   VGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
             V P+Y IGPV++ +   +    D   +E +M WLD Q S+SVVFL  GSMG+    Q+ E
Sbjct  238   VPPIYTIGPVLNLKAETSNDQKDLVQYEEIMAWLDCQPSTSVVFLCFGSMGTFEAEQVVE  297

Query  889   IATGLERAGYRFLWSIREPPKSKLDLP-NDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             IAT LE +G+RFLWS+R PP      P +DY +L  VLP GF DRTK  G V GW PQ  
Sbjct  298   IATALEHSGHRFLWSLRRPPPEGKKEPPSDYENLSDVLPEGFLDRTKEVGKVIGWAPQTA  357

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-  1242
             +L+H A+GGF+SHCGWNSI+E+L  GVPI TWP+YAEQ +NAF+MVKEL LAVEI+ DY 
Sbjct  358   VLSHPAVGGFISHCGWNSIMESLWFGVPIATWPLYAEQQINAFEMVKELQLAVEISLDYK  417

Query  1243  KDGITLVSAEDVERGVRKLMDGDD--EVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             K+   +++AE++ERG+++LMDG++  E+++KVK  SE  +    + GSS  ++G+ IEE
Sbjct  418   KENHAILTAEEIERGIKQLMDGNESVEIKKKVKAMSEKSRSAVEEGGSSYAAVGRFIEE  476



>gb|KDP38835.1| hypothetical protein JCGZ_04992 [Jatropha curcas]
Length=471

 Score =   376 bits (966),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 202/481 (42%), Positives = 297/481 (62%), Gaps = 29/481 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPL-----IQSYIDS  174
             M+ A +VFV  P IG+L+  VE ++LL +++Q  S++ L++ +          IQS+  S
Sbjct  1     MENAHLVFVPHPVIGHLISTVEVARLLLNRDQRFSISFLIMKLSSSDFKINNYIQSFTAS  60

Query  175   LASDGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDVRIAG  348
              A    ++F+ LP        ++ + IS  + +I+  +PHV+  ++K+     D  R+AG
Sbjct  61    NALPSRIQFIDLP--------KDEAQISDFTSFIQRQKPHVKDVVSKIIQSKSDSPRLAG  112

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYV  525
             F +DM C   IDVA E  +P Y+YF S A+FL F LH+ ++ D Q    +E  +   E  
Sbjct  113   FVLDMCCAEMIDVANEFGVPSYIYFTSSAAFLGFSLHVQSIHDEQKVDPAELMNPGAELA  172

Query  526   IPGFENPVPVESFP-PFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFG  702
             I    NP P ++ P   + K   D++L ++   +R++E +G++VNTF ELESY + S   
Sbjct  173   ISCLANPFPAKAMPYALLRKEWLDSWLDYV---RRFKEAKGIMVNTFLELESYAVESFSS  229

Query  703   GNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
                   VYP+GP+++         DS   + +M+WLD Q  +SVVFL  GSMGS N  Q+
Sbjct  230   DGKTPKVYPVGPILNVGS----DEDSNKQQEIMQWLDTQPPTSVVFLCFGSMGSFNVDQV  285

Query  883   REIATGLERAGYRFLWSIREPPKSKLDL---PNDYTDLDHVLPPGFSDRTKGKGMVCGWV  1053
             +EIA  +E +G+RFLWS+R P  S +DL   P+DY +L  VLP GF DRT G G V GW 
Sbjct  286   KEIACAVEHSGHRFLWSLRRP-SSNVDLFEPPSDYANLQEVLPEGFLDRTVGIGRVIGWA  344

Query  1054  PQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEIT  1233
              Q  ILAH A+GGFVSHCGWNS+LE++ +GVPI TWP+Y+EQ + AF+MV EL LAVEI 
Sbjct  345   QQEAILAHPAVGGFVSHCGWNSVLESIWYGVPIATWPMYSEQQVIAFEMVIELQLAVEIK  404

Query  1234  FDYKDGI-TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
              DY+ G   +VS++++ERG+R +M+ D E R+KVK+ SE C+      GSS +SLG +I+
Sbjct  405   MDYRMGSEVIVSSDEIERGIRCVMEHDSERRKKVKKMSEKCRMALKDGGSSFISLGFMIK  464

Query  1411  E  1413
             +
Sbjct  465   D  465



>ref|XP_010648215.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 6-like [Vitis 
vinifera]
Length=481

 Score =   377 bits (967),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 202/477 (42%), Positives = 297/477 (62%), Gaps = 14/477 (3%)
 Frame = +1

Query  7     IMKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMP-QRPLIQSYIDSLAS  183
             +MK+ +++FV  P IG+LV  VEF+KLL  ++   SVT+L++ +P +   + +YI S+++
Sbjct  1     MMKKMELIFVPVPAIGHLVSTVEFAKLLVGRDDRFSVTLLIMKLPMEHSAVTNYIHSVSA  60

Query  184   D--GNLEFLSLPAAEPPSPDQNRSTIS---FLSIWIENHEPHVRRALTKLKSDDDVRIAG  348
                G++ F+ LP  +  S + N S+ S   F    I   +P VR A+ +L   +  ++AG
Sbjct  61    SLSGSIRFVHLPEPDSDSSNSNPSSSSPSVFFHNIIAKQKPLVRDAVHQLTRSESGQLAG  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYV  525
                DM C S +DVA EL +P Y++F S A+ L+ + H+ TL D Q    +EF D+  E V
Sbjct  121   IVFDMICPSIVDVANELGVPSYVFFTSSAACLALLFHLQTLKDHQGVDVTEFADSDAELV  180

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             +PGF N VP    P     +     + FL   +R+RE +G++VNTF ELES+ + S   G
Sbjct  181   VPGFVNSVPARVLPATAVDKEGGGSMDFLNRVRRFREAKGILVNTFVELESHVINSFVDG  240

Query  706   NDVGPVYPIGPVVDREGPARWHPDSWNHEL-VMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
                 P+Y +GP+++         DS   +L V++WLD+Q +SSVVFL  GS+G+ +  QI
Sbjct  241   T-TPPIYTVGPLLNLHNANHQKQDS---DLDVIQWLDDQPTSSVVFLCFGSVGAFHMDQI  296

Query  883   REIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             +EIA GLE +G+RFLW++R PP K K+ +P DY + + VLP GF DRT   G + GW PQ
Sbjct  297   KEIAIGLENSGHRFLWTLRRPPPKGKIAMPTDYVNFEEVLPEGFLDRTSKIGKIIGWAPQ  356

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
               ILAH AIGGFVSHCGWNS LE++ +GVP+ TWP+YAEQ LNAFQ+VKEL + VEI  D
Sbjct  357   TAILAHSAIGGFVSHCGWNSTLESIWYGVPVATWPMYAEQQLNAFQIVKELEIGVEIRLD  416

Query  1240  Y-KDGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
             Y KD   +V+A+++E  +R LM+  ++++    +  E C     + GS   SL +LI
Sbjct  417   YKKDTSDIVNAQEIESRIRSLMEDSNDIKTNRAKMKEKCVTALTEGGSLDSSLQRLI  473



>ref|XP_006353731.1| PREDICTED: putative UDP-glucose flavonoid 3-O-glucosyltransferase 
3-like [Solanum tuberosum]
Length=476

 Score =   376 bits (966),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 201/481 (42%), Positives = 304/481 (63%), Gaps = 24/481 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLIN--MPQRPLIQSYIDSLAS  183
             M + ++V V TP+IG+LVP  +F++ L  +++ L VT+L+I    P    I ++I  ++S
Sbjct  1     MSKFELVCVPTPSIGHLVPFCKFAEKLVDRDERLYVTILIIRPPTPWGSTIDAFIKRISS  60

Query  184   --DGN-LEFLSLPAAEPPSPDQ-NRSTISFLSIWIENHEPHVRRALTKLKS----DDDVR  339
               +GN + +++L   EPPS ++  +S   ++S+ I N+ P V+ A+   KS    D + +
Sbjct  61    APEGNRIRYITLAQIEPPSSEELAKSVEKYISLLIANYRPIVKDAIISNKSWPDTDSNPK  120

Query  340   IAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKE  519
             I G  +DMFCTS IDVA ELDIP YL+F S A+FL F+ ++   D Q  +  EF  +  +
Sbjct  121   IIGLVIDMFCTSMIDVANELDIPSYLFFTSGAAFLGFLFYLSVWDEQFGR--EFNPSDGD  178

Query  520   YVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMF  699
               I  + +PVP +  P F   +  + Y  F  H  R++ET+G+++NT +E ES+ + S+ 
Sbjct  179   LNIAAYAHPVPSKFLPTFSFVK--EGYDSFHNHGVRFKETKGILINTVEEFESHAVNSLA  236

Query  700   GGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQ  879
                ++ PVY +G + + E            E +MKWLD Q  SSV+FL  GS G   P Q
Sbjct  237   SDPELPPVYTVGFLFNIEAQNGKGNSKSEDEEIMKWLDQQPPSSVLFLCFGSAGIFEPPQ  296

Query  880   IREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQ  1059
             + +IA GLER+G  FLWSIR    +      + T L+ +LP GF +RTK +G+VCGW PQ
Sbjct  297   LIQIAIGLERSGVSFLWSIRPLVDA------ETTKLEEMLPEGFLERTKNRGIVCGWAPQ  350

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V ILAHKA G FVSHCGWNS +E++ HGVPI TWP+YAEQH+NAFQ+V++L +AVE+T +
Sbjct  351   VEILAHKATGAFVSHCGWNSTIESVWHGVPIVTWPLYAEQHINAFQLVRDLEVAVELTLN  410

Query  1240  YK----DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
             Y+    D   +V AE++E+ +R +MD ++ +R++VK+  E+C+   M+ GSS +SLG+ I
Sbjct  411   YRMHDSDHREIVKAEEMEKAIRHIMDRENPLRKRVKDMGEICRNALMEGGSSFISLGRFI  470

Query  1408  E  1410
             E
Sbjct  471   E  471



>ref|XP_006373628.1| hypothetical protein POPTR_0016s01600g [Populus trichocarpa]
 gb|ERP51425.1| hypothetical protein POPTR_0016s01600g [Populus trichocarpa]
Length=476

 Score =   376 bits (966),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 199/477 (42%), Positives = 298/477 (62%), Gaps = 16/477 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-D  186
             MK+ ++VFV  P  G+LVP V+ +K++  +N +  +T+L I+ P    I    +SLAS  
Sbjct  1     MKKTQLVFVPAPGFGHLVPAVQLAKMVLERNDSFLITMLAIHNPFDGGISKNTESLASIH  60

Query  187   GNLEFLSLPAAEPPSPDQNRST--ISFLSIWIENHEPHVRRALTKL-KSDDDVRIAGFFV  357
               + F+ +P   P  P +  +    S  + +I +H+  V+  +  L  + +   IA   V
Sbjct  61    TEIRFIEIPETIPAPPPEALAVGPASAYTSYINDHKTLVKDTIVNLVMTHNPAPIASVVV  120

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGF  537
             DMFCT+FIDVA+EL +P ++++ S A+FL+ ML++   D +     +F     +Y+IP +
Sbjct  121   DMFCTAFIDVAKELGVPSHVFYTSNAAFLATMLYLS--DREDKGEPKFSPTDPDYIIPCY  178

Query  538   ENPVPVESFPPFMSKRHEDT-YLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
              NPVP    P      H D  Y  F  H ++++E+ G++VNTF E ES+ + ++   +D+
Sbjct  179   SNPVPYRVMPLL----HTDVEYEAFANHGRQFKESNGIIVNTFSEAESHAVSALLARDDI  234

Query  715   GPVYPIGP-VVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREI  891
              P++ +GP ++  +G +    D+   + ++KWLD+Q   SVVFL  GS G  + AQ++EI
Sbjct  235   PPIFNVGPLIIHHKGKSLSGSDAVKRDEILKWLDDQPEKSVVFLCFGSRGCFDEAQLKEI  294

Query  892   ATGLERAGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             A GLER+G RFLWS+R +P K KL   + + +   +LP GF +RTK  GM+CGW PQV I
Sbjct  295   AIGLERSGQRFLWSVRLKPSKGKLQ-ASIFDNYGEILPQGFLERTKNIGMLCGWAPQVEI  353

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD  1248
             LAHKA+G FVSHCGWNS LEAL + VPI TWP+YAEQH NAFQ+VK+LGLAVE+T D++ 
Sbjct  354   LAHKAVGAFVSHCGWNSTLEALWYAVPIITWPLYAEQHTNAFQLVKDLGLAVELTLDFRG  413

Query  1249  G--ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                   V AE + + V+ +M+   E+R K KE SEM K+  M+ GSS V+LG LI++
Sbjct  414   DCPTDFVKAEVITKAVKTMMEQGGELRNKAKETSEMAKKAVMEGGSSYVALGNLIDQ  470



>emb|CDP16155.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   376 bits (966),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 197/488 (40%), Positives = 304/488 (62%), Gaps = 34/488 (7%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+ +++F+  P +G+L   VEF KLL +++++LS+  ++I++     + ++++   +D 
Sbjct  1     MKKTELLFIPGPGMGHLASAVEFGKLLINRDEHLSIVYIIIDLSYNTGVDAFMEPQLTDA  60

Query  190   N--LEFLSLP-------AAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL--KSDDDV  336
                + F+++P         EP S ++N   +      I   +P VR A+  +  K++ D 
Sbjct  61    YSCIRFVNIPYQIDSSDHQEPKSKNRNVVAVEL----INRQKPLVRDAVLDIISKANSDR  116

Query  337   RIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAA  513
              IAG  VDMFC   IDVA+E ++P Y++F S A FL  MLH+ +L  +  ++ + + D+ 
Sbjct  117   EIAGIVVDMFCVGMIDVAQEFELPSYMFFTSSAGFLGLMLHVQSLHDEYNEDITHYKDSD  176

Query  514   KEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGS  693
              E ++P F NPVP +  P  M  ++  +    +  A+R  E +G++VNTF ELESY + S
Sbjct  177   AELLVPSFSNPVPAKVLPTTMLDKNWGS-AAVVTSARRMLEVKGIIVNTFHELESYAIKS  235

Query  694   MFG-GNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLN  870
             + G    +  +YPIGP+++      W  +S   + +M WLD Q S SVVFL  GS+GS +
Sbjct  236   LSGQAGKIPRIYPIGPIIN------W--NSKQDDGIMSWLDTQPSCSVVFLCFGSLGSFS  287

Query  871   PAQIREIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCG  1047
               Q++EIA  LE +  RFLWS+R+PP K ++D P+ Y + + VLP GF  RT G G V G
Sbjct  288   CEQVKEIAVALEHSRCRFLWSLRQPPAKGEIDAPSAYANPEEVLPEGFLQRTSGVGKVIG  347

Query  1048  WVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVE  1227
             W PQ+ +L+H A+GGFVSHCGWNSILE+L  GVPI  WP+YAEQ  NAF++V ELG+AVE
Sbjct  348   WAPQMAVLSHPAVGGFVSHCGWNSILESLWAGVPIAAWPMYAEQQTNAFEVVAELGIAVE  407

Query  1228  ITFDYKDGITL-----VSAEDVERGVRKLM--DGDDEVREKVKEYSEMCKRVWMKNGSSA  1386
             I  DY++   +     VSA+++E G+++LM     DE+REKVK+  E+C++  ++ GSS 
Sbjct  408   IKMDYRNDANMESKIIVSADEIENGIKRLMMDRNKDEIREKVKDLKEICRQAIVEEGSSY  467

Query  1387  VSLGKLIE  1410
             +SL  LIE
Sbjct  468   ISLAHLIE  475



>ref|XP_008384818.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Malus 
domestica]
Length=481

 Score =   376 bits (965),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 215/479 (45%), Positives = 309/479 (65%), Gaps = 18/479 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA-SD  186
             MK  ++VF+ +P  G+LVP ++F+K L  +N  +S+T+L I       + SY  S+A S+
Sbjct  1     MKXVELVFIPSPGAGHLVPTLQFAKRLIDRNDRISITILAIQSSFPTTLSSYTKSIAXSE  60

Query  187   GNLEFLSLPAAEP-PSPDQNRSTISFLSIWIENHEPHVRRALTKL-----KSDDDVRIAG  348
               + F+ +P  +  P  +  +S   F S++IE+H P V++ +T L      S D + ++ 
Sbjct  61    PRIRFIDVPQPQDRPPQEMYKSRAKFFSLYIESHVPSVKKIITNLVSSSSNSSDSIXVSA  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               VD FC S IDVA+EL+IP YL+  S A +L+FMLH+P L  +     E  D   E+ I
Sbjct  121   LVVDFFCVSMIDVAKELNIPSYLFLTSNAGYLAFMLHLPILHEKXQIAVEESDP--EWSI  178

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             PG  +PVP   FP  ++      Y+     A R+RETRG++ NTF ELE++ + ++F  +
Sbjct  179   PGIVHPVPPRVFPVALTDGSCSAYIKL---ASRFRETRGIISNTFVELETHAI-TLFSND  234

Query  709   D-VGPVYPIGPVVD-REGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQI  882
             D V PVYP+GPV+D  +G A    D    + ++KWLD+Q   SVVFL  GSMGS    Q+
Sbjct  235   DRVPPVYPVGPVIDLDDGQAHSSLDQAQRDKIIKWLDDQPQKSVVFLCFGSMGSFRAEQV  294

Query  883   REIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGK-GMVCGWVPQ  1059
             ++IA GLE++G RFLWS+R P   K  +P+D ++L+ VLP GF +RT GK G++CGW PQ
Sbjct  295   KKIALGLEQSGQRFLWSLRMP-SPKGTVPSDCSNLEEVLPDGFLERTNGKXGLICGWAPQ  353

Query  1060  VTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFD  1239
             V ILAH A GGF+SHCGWNSILE+L HGVPI TWP+YAEQ LNAF+MV+ELG+A+E+  D
Sbjct  354   VXILAHSATGGFLSHCGWNSILESLWHGVPIATWPMYAEQQLNAFRMVRELGMALEMRLD  413

Query  1240  YKDG-ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
             YK G   +V A+++ER V  +M+ D EVR+KV+E  ++ ++     GSS  S G+ IE+
Sbjct  414   YKTGSADVVGADEIERAVVGVMEKDSEVRKKVEEMGKLARKAVKDGGSSFASAGRFIED  472



>ref|XP_009788068.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nicotiana 
sylvestris]
Length=469

 Score =   375 bits (963),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 203/479 (42%), Positives = 293/479 (61%), Gaps = 27/479 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPL-------IQSYI  168
             MK+A++VFV  P IG+LVP  +F+  L + ++ L +T+++I  PQ P        IQ + 
Sbjct  1     MKKAELVFVPAPGIGHLVPTCQFAVNLLNLDEQLCITMIIIR-PQAPFDVGIDAYIQRFS  59

Query  169   DSLASDGNLEFLSLPAAE-PPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIA  345
              + A D  + F+ LP  E PP  +  +S  +F S+ I +++P V+ A+   K  +   I 
Sbjct  60    SNTAVDHRIRFIKLPQVELPPLEEFTKSMENFFSLLISSYKPLVKDAIINNKHSNTT-IV  118

Query  346   GFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYV  525
             G  +DMFC+S IDVA EL IP Y++F S + FL F+L++    +Q     EF     +  
Sbjct  119   GLVIDMFCSSMIDVANELGIPPYIFFTSGSGFLGFVLYLSVWHSQ--HGREFSLTDPDLD  176

Query  526   IPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGG  705
             +P + N VP    P F   +  + Y  F+ H  R++ET+G+++NTF ELES+ + S+   
Sbjct  177   MPSYANLVPSNVLPTFAFNK--EGYAAFMNHGARFKETKGILINTFAELESHAVNSLASD  234

Query  706   NDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
              ++ PVY IGP +D  G         N E VMKWL++Q  SSV+FL  GSMG+L   Q++
Sbjct  235   PELPPVYTIGPHLDLAGQKSRED---NKEEVMKWLEDQPPSSVLFLCFGSMGTLEVPQLQ  291

Query  886   EIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVT  1065
             E+A  LE++G RFLWSI+ P      L ++Y   D +LP GF  RTK +GMVCGW PQV 
Sbjct  292   ELANALEQSGVRFLWSIKMP------LGSEYGKFDELLPEGFLSRTKDRGMVCGWAPQVH  345

Query  1066  ILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK  1245
             +L HKA  GFVSHCGWNS LE L HGVP+ TWP++ EQ +NAFQMVK+L LAVE+  DY+
Sbjct  346   VLTHKATAGFVSHCGWNSTLETLWHGVPMVTWPLHGEQQINAFQMVKDLELAVELRMDYR  405

Query  1246  DGIT----LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
              G      +V AE++E  +R +MD ++ VR++VKE  +  + V M+ GSS VSL   ++
Sbjct  406   MGKISDGGIVRAEEIENAIRCIMDSENPVRKRVKEMRDKSREVLMEGGSSFVSLRHFLK  464



>ref|XP_009804833.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   375 bits (963),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 194/478 (41%), Positives = 295/478 (62%), Gaps = 21/478 (4%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLIN--MPQRPLIQSYIDSLAS  183
             M + ++VFV  P +G+LV   +F++ L  ++Q L +T+L+I    P    I  Y+   +S
Sbjct  1     MSKLELVFVPAPAVGHLVSTCKFAEHLLSKDQRLCITILIIRPPAPWDAGIDVYMKRSSS  60

Query  184   D---GNLEFLSLPAAEPPSPDQ-NRSTISFLSIWIENHEPHVRRALTKLK-SDDDVRIAG  348
                   + +++LP  EPPS D+  +S  ++ S+ I +H P V+ A+   K  D + +  G
Sbjct  61    TPEGSRIRYITLPRVEPPSSDKLEKSLENYFSLLIASHRPLVKEAIISNKWPDSNPKTIG  120

Query  349   FFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVI  528
               +DMFC+S IDVA EL IP YL+F S A FL F+ ++     +  +  EF  +  +  I
Sbjct  121   LVIDMFCSSMIDVANELGIPSYLFFTSGAGFLGFLFYLSVWHEKFGR--EFNKSDSDLNI  178

Query  529   PGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGN  708
             P + NPVP +  P F   +  + +  F +H  R++ET+G+++NT  E E++ + ++    
Sbjct  179   PAYANPVPSKVLPMFAFNK--EGFNSFREHGVRFKETKGILINTVAEFENHAVNALASNP  236

Query  709   DVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIRE  888
             ++ PVY +G +VD EG       +  +E +MKWLD Q  SSV+FL  GS G   P Q+ E
Sbjct  237   ELPPVYTVGFLVDLEGQKTKGNSNIEYEEIMKWLDQQPPSSVIFLCFGSSGIFEPPQLIE  296

Query  889   IATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTI  1068
             +A  LE++G  FLWSIR P      + ++Y  L+ +LP GF +RTK KG+VCGW PQ+ I
Sbjct  297   MAIALEQSGVSFLWSIRRP------VDDEYAKLEEILPEGFLERTKNKGIVCGWAPQIDI  350

Query  1069  LAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYK-  1245
             LAHKA G FVSHCGWNS LE+L HGVPI TWP+YAEQ +NAFQ+V++L +AVE+  DYK 
Sbjct  351   LAHKATGAFVSHCGWNSTLESLWHGVPIVTWPLYAEQQINAFQLVRDLEMAVELRLDYKM  410

Query  1246  ---DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
                D   +V AE++E+ +R +MD ++ VR++VK+  E+C+   M+ GSS  S+ + +E
Sbjct  411   RGSDRGEIVKAEEMEKAIRCIMDRENPVRKRVKDLGEICRNALMEGGSSFNSIERFVE  468



>ref|XP_006353732.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Solanum tuberosum]
Length=484

 Score =   375 bits (964),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/487 (41%), Positives = 298/487 (61%), Gaps = 30/487 (6%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS--  183
             M + ++VFV  P+IG+LV + +F++ L  +++ L VT+L+I  P    I +YI   ++  
Sbjct  1     MSKLELVFVPVPSIGHLVSICKFAEKLVSRDERLYVTILIIRPPWDASIDAYIKRSSASA  60

Query  184   ---------DGNLEFLSLPAAEPPSPDQNRSTI-SFLSIWIENHEPHVRRALTKLKS---  324
                         + +++L   EPPS ++   +I +++S+ I ++ P V+ A+   KS   
Sbjct  61    SGGTSLDVWGSRIRYITLAQIEPPSSEEGAKSIENYISLLIASYRPIVKDAIISNKSWPD  120

Query  325   -DDDVRIAGFFVDMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEF  501
              D + +I G  +DMFCTS IDVA ELDIP YL+  S A FL F+L++     Q  +  EF
Sbjct  121   TDSNPKIIGLVIDMFCTSMIDVANELDIPSYLFLTSGAGFLGFLLYLSVWHDQFGR--EF  178

Query  502   GDAAKEYVIPGFENPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESY  681
               +  + +I    +PVP +  P F   +  + Y  F  H  R++ET+G+++NT +E ES+
Sbjct  179   NRSDGDLIIAANAHPVPSKVLPTFAFVK--EGYNSFRNHGVRFKETKGILINTVEEFESH  236

Query  682   CLGSMFGGNDVGPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMG  861
              + S+    ++ PVY +G ++D E            E +MKWLD Q  SSV+FL  GS G
Sbjct  237   AVNSLASDPELPPVYTVGFLLDIEAQNAKGNSKSEDEEIMKWLDQQPPSSVLFLCFGSAG  296

Query  862   SLNPAQIREIATGLERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMV  1041
                P Q+ E+A  LER+G RFLWSIR P      L  + T L+  LP GF +RTK +G+V
Sbjct  297   IFEPPQLIEMAIALERSGVRFLWSIRLP------LDAETTKLEETLPEGFLERTKNRGIV  350

Query  1042  CGWVPQVTILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLA  1221
             C W PQV ILAHKA G FVSHCGWNS +E+L HGVPI TWP+YAEQH+NAFQ+VK+L +A
Sbjct  351   CRWAPQVNILAHKATGAFVSHCGWNSTIESLWHGVPIVTWPLYAEQHINAFQLVKDLEMA  410

Query  1222  VEITFDYK----DGITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAV  1389
             VE+T DY+    D   +V AE++E+ +R +MD ++ +R++VK+  E+C++   + GSS +
Sbjct  411   VELTLDYRMHDSDHREIVKAEEMEKVIRSIMDSENLLRKRVKDMGEICRKALTEGGSSFI  470

Query  1390  SLGKLIE  1410
             SLG+  E
Sbjct  471   SLGRFAE  477



>ref|XP_006429783.1| hypothetical protein CICLE_v10011522mg [Citrus clementina]
 gb|ESR43023.1| hypothetical protein CICLE_v10011522mg [Citrus clementina]
Length=507

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 212/482 (44%), Positives = 297/482 (62%), Gaps = 22/482 (5%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             MK+A++VF+ TP  G+LV  VE +K+L  +++ +S+TVL+I +P    + +Y +SL +  
Sbjct  29    MKKAELVFIPTPGAGHLVSTVEMAKILVDRDERISITVLIIKLPFDNKVAAYTESLVASN  88

Query  190   ---NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLK-SDDDVRIAGFFV  357
                 ++F+ LP  +  SP   +   S L    E+ + HV+ A+ KL  S D   +AGF +
Sbjct  89    LPSRIKFIILPD-DNQSPPPGKVPYSSL----ESKKTHVKEAVAKLTGSPDSPTLAGFVL  143

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGF  537
             DMFC   +DVA+EL +P Y++F S A+ L   L+   L  Q    +E  D+  E  +P  
Sbjct  144   DMFCMCMVDVADELRVPSYVFFTSSAASLGSFLNGQALYDQNKLTTELIDSGAELQVPTL  203

Query  538   ENPVPVESFPPFMSKRHEDTYLPFL-QHAKRYRETRGVVVNTFKELESYCLGSMFGGN-D  711
              N +P    P   S   +  +  FL   A+RYR  +G++VNTF+ELE Y + S + G   
Sbjct  204   LNSIPARLLP---SSYFDKEWAEFLFGQARRYRVVKGIMVNTFEELEPYAVKSFYDGKIK  260

Query  712   VGPVYPIGPVVDREGPA-RWHPDSWNHEL-VMKWLDNQLSSSVVFLTTGSMGSLNPAQIR  885
             + PVY +GPVV+  G      P     +  VM WLD+Q  SSVVFL  GS G  +  Q R
Sbjct  261   IPPVYAVGPVVNITGDNYALGPGGIEKKAEVMAWLDDQPESSVVFLCFGSRGCFDVDQAR  320

Query  886   EIATGLERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQV  1062
             EIA  LE+ G+RFLWS+R+ P + K ++P+DY DL  VLP GF DRT   G V GW PQV
Sbjct  321   EIAHALEQCGHRFLWSLRQAPTEDKNEMPSDYADLKGVLPEGFLDRTAEIGKVIGWAPQV  380

Query  1063  TILAHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY  1242
              +L+H A+GGFVSHCGWNS LE++  GVPI TWP+YAEQ  NAFQ+V ELGLAVEI  DY
Sbjct  381   AVLSHPAVGGFVSHCGWNSTLESIRFGVPIATWPMYAEQQANAFQLVIELGLAVEIKMDY  440

Query  1243  KDGI-----TLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLI  1407
             +  I     T+V+AE++ERG++ LM+ + E+R++VKE SE   R  M  GSS  SLG+ I
Sbjct  441   RKDILNKIPTMVTAEEIERGIKCLMNPESEIRKRVKEMSEKAGRAVMDGGSSFSSLGRFI  500

Query  1408  EE  1413
             ++
Sbjct  501   DD  502



>ref|XP_011001000.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Populus 
euphratica]
Length=475

 Score =   375 bits (962),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 194/476 (41%), Positives = 297/476 (62%), Gaps = 15/476 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-D  186
             MK+ ++VFV  P  G+LV  V+ +K++  +N +  +T+L I+ P    I    +SLAS  
Sbjct  1     MKKTQLVFVPAPGFGHLVSAVQLAKMVLERNDSFLITMLAISNPFDGTISKNTESLASIH  60

Query  187   GNLEFLSLPAAEPPSPDQNR--STISFLSIWIENHEPHVRRALTKL-KSDDDVRIAGFFV  357
               + F+ +P   P  P +    S  S  + +I +H+  V+  +  L  + +   IA   V
Sbjct  61    TEIRFIEIPETIPAPPPEALAVSPASAFTSYISDHKTLVKDTIVNLVMAHNPAPIASVVV  120

Query  358   DMFCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNSEFGDAAKEYVIPGF  537
             DMFCT+FIDV++EL +P ++++ S A++L+  L++   D +     +F     +Y+IP +
Sbjct  121   DMFCTAFIDVSKELGVPSHVFYTSDAAYLAMTLYLS--DREDKGEPKFSPTDPDYIIPCY  178

Query  538   ENPVPVESFPPFMSKRHEDT-YLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDV  714
              NPVP    P      H D  Y  F    ++++++ G++VNTF E ES+ + ++   +D+
Sbjct  179   SNPVPYRVMPLL----HTDVEYEAFANQGRKFKDSNGIIVNTFSEAESHAVSALLARDDI  234

Query  715   GPVYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIA  894
              P++ +GP++D +G      D+   + ++KWLD+Q   SVVFL  GS G  + AQ++EIA
Sbjct  235   PPIFNVGPLIDHKGKGLSGSDAVKRDEILKWLDDQPEKSVVFLCFGSGGGFDEAQLKEIA  294

Query  895   TGLERAGYRFLWSIR-EPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTIL  1071
              GLER+G+RFLWSIR +P K KL   + + +   +LP GF +RTK  GM+CGW PQV IL
Sbjct  295   IGLERSGHRFLWSIRLKPSKGKLQ-ASFFDNYGEILPQGFLERTKNIGMLCGWAPQVEIL  353

Query  1072  AHKAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDG  1251
             AHKA+G FVSHCGWNS LE L + VPI TWP+YAEQH+NAFQ+VK+LGLAVE+T D++  
Sbjct  354   AHKAVGAFVSHCGWNSTLETLWYAVPIITWPLYAEQHMNAFQLVKDLGLAVELTLDFRRD  413

Query  1252  --ITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                  V+AE + + V+ +M+   ++R K KE SEM K+  M+ GSS V+LG LI++
Sbjct  414   CPTAFVTAEVITKAVKTMMEQGGKLRNKAKETSEMAKKAVMEGGSSYVALGNLIDQ  469



>emb|CDP19043.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   375 bits (962),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 194/477 (41%), Positives = 296/477 (62%), Gaps = 16/477 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLA--S  183
             MK+ ++VF+ +  +G+L   VE +KLL  +N++LS+TVL++  P    + S  DS A  S
Sbjct  11    MKKPELVFIPSAGMGHLASTVELAKLLIDRNEHLSITVLIMKFPFETKVISNTDSQAEAS  70

Query  184   DGNLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDM  363
             D ++ F+ L   E  S  Q  S   FL  +IE+H+  VR  L ++ S     +AG  +DM
Sbjct  71    DSSIRFVELTKDE--SASQTASPSLFLYQFIEDHKSRVRDVLAEISSSASFDLAGIVIDM  128

Query  364   FCTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN-SEFGDAAKEYVIPGFE  540
             FCTS IDVA E  +P Y+++ S A+ L  + H+ +L     ++ ++F ++  E  +P + 
Sbjct  129   FCTSMIDVANEFGVPSYVFYTSGAAMLGLVFHLQSLRDDFKEDVTDFENSKVELAVPTYI  188

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             N VPV+  P  +  +       FL  AKRYRET+G++VNTF ELES+ + ++     + P
Sbjct  189   NLVPVKVLPSGLFDKEGGNM--FLNQAKRYRETKGIIVNTFLELESHAIQALSNDKTIPP  246

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VY +GPV++ +G    + ++   E++MKWLD Q   SVVFL  GS G  +  Q++EIA  
Sbjct  247   VYAVGPVLNLKGSNGQNQET---EIIMKWLDLQPDCSVVFLCFGSEGCFDGDQVKEIAYA  303

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LER+GY FLWS+R PP K K + P +Y + + VLP GF  RT   G V GW PQ  +L+H
Sbjct  304   LERSGYPFLWSLRRPPPKGKFESPGEYENPEEVLPDGFLQRTAEVGKVIGWAPQAAVLSH  363

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKD---  1248
              A+GGFVSHCGWNS LE++ + VP+ TWP++AEQ +NAFQM+K+ G+AVEI  D+K    
Sbjct  364   PAVGGFVSHCGWNSTLESVWYSVPMATWPLHAEQQVNAFQMLKDFGMAVEIKMDFKKKFL  423

Query  1249  --GITLVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
                  +V+A+ +E+ ++ LMD ++E+R+KVK   E  +    + G+S+ SLG  +++
Sbjct  424   EPSTEIVAADVIEKAIKHLMDPENEIRKKVKGMKEKSRLALNEGGASSASLGSFLDD  480



>ref|XP_009609115.1| PREDICTED: anthocyanidin 3-O-glucosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=482

 Score =   374 bits (961),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 197/480 (41%), Positives = 299/480 (62%), Gaps = 20/480 (4%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDGN  192
             K+ ++VF+ +P +G++   VE SKL+   N+ LS+++L++  P    +Q Y+ SL+S   
Sbjct  4     KKPELVFIPSPGLGHVASAVEISKLILDTNERLSISLLIMKHPADFGVQPYLQSLSSHSR  63

Query  193   LEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFCT  372
             L F+ +      + +   +   FL  +++ H+  VR  +    +++     GF +DMFC 
Sbjct  64    LHFVDVSIDSKTAAELLSNKDRFLYDFVDGHKSKVREYVRSNITNNSC--CGFVLDMFCI  121

Query  373   SFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKNS----EFGDAAKEYVIPGFE  540
             S IDVA E  +P Y++F S  +FL+  LH   L +   ++     ++ ++ +E  I GF+
Sbjct  122   SMIDVANEFGVPSYIFFTSATAFLALSLHFEALRSNANEDEISKYDYSESNEELSILGFK  181

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             N  P +  P  +      + L +    +R++ET+G+++NTF ELES+ L S+     V  
Sbjct  182   NQYPAKILPRPVKSITPSSIL-YFDGIRRFKETKGIIINTFAELESFALQSLSNAKVVKQ  240

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             +YPI PV + E      P++   E ++KWLD+Q  SSV+FL  G++GS  P Q+REIA  
Sbjct  241   IYPIHPVANSE-EGDNKPET---ESIIKWLDDQPKSSVLFLCFGTLGSFEPEQVREIAIA  296

Query  901   LERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAH  1077
             LER+G+RFLWS+R PP K K+++P +Y + + VLP GF DRT G G V GW PQVT+L+H
Sbjct  297   LERSGHRFLWSLRRPPPKGKVEMPRNYENSEEVLPEGFLDRTNGIGKVVGWAPQVTVLSH  356

Query  1078  KAIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-----  1242
              A+GGFVSHCGWNS+LE++C GVPI  WP+YAEQ +NAF +VKEL LAVEI  DY     
Sbjct  357   LAVGGFVSHCGWNSVLESVCCGVPIAAWPLYAEQQMNAFLLVKELELAVEIRMDYVKDFE  416

Query  1243  -KDGITLVSAEDVERGVRKLM-DGDD-EVREKVKEYSEMCKRVWMKNGSSAVSLGKLIEE  1413
              K+ + +V+AE++E  +RKLM DG++ EVR+KVKE  +  +    + GSS  SL  LIE+
Sbjct  417   GKNPVDIVTAEEIEGAIRKLMADGEENEVRKKVKEMQKKSRIAMEEGGSSYTSLRLLIED  476



>ref|XP_006358963.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 6-like 
[Solanum tuberosum]
Length=483

 Score =   374 bits (961),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 195/477 (41%), Positives = 297/477 (62%), Gaps = 16/477 (3%)
 Frame = +1

Query  13    KQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLAS-DG  189
             K+ +++F+ +P IG+LV  VE +KLL  + +N+S+TVL+I  P    + SYI SL +   
Sbjct  5     KKIELIFIPSPGIGHLVSTVEMAKLLITREKNMSITVLIIQSPHDNKLPSYIQSLTNFSS  64

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKL-KSDDDVRIAGFFVDMF  366
             +L+F+ LP  +  +  Q R +  F S +I  H+P VR  + ++ KS  ++ +AG  +D+F
Sbjct  65    SLKFIQLPQDD--TVLQLRKSNLFTS-FIPAHKPAVRDVVAEIIKSQSNITLAGIVIDLF  121

Query  367   CTSFIDVAEELDIPCYLYFASPASFLSFMLHIPTLDAQVPKN--SEFGDAAKEYVIPGFE  540
             CTS IDVA E ++P Y+++   A+ L    H+ +L     +N  +   D   E  I  + 
Sbjct  122   CTSMIDVANEFELPTYVFYTCGAAPLGLQFHMQSLSDDFGRNITNYKDDPEAELSISTYF  181

Query  541   NPVPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGP  720
             NP P +  P  M  +   + +  L   +R+RET+G+++NTF EL+S+ + S+    ++ P
Sbjct  182   NPFPAKCLPSVMLDKEGGSTM-CLDLTRRFRETKGIMINTFLELDSHAINSLSRDKNIPP  240

Query  721   VYPIGPVVDREGPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATG  900
             VYP+GPV +     +    S + + +MKWLD+Q  SSVVFL  GS GS    Q++EI   
Sbjct  241   VYPVGPVFNLNS-VQGENLSSSDQNIMKWLDDQPPSSVVFLCFGSGGSFTVEQVKEITYA  299

Query  901   LERAGYRFLWSIREPPKSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             LE +G RFLW++R+PP+    LP DY + + VLP GF  RT+G G V GW PQ+ IL+H+
Sbjct  300   LENSGCRFLWTLRQPPQKDARLPGDYENFEEVLPEGFLQRTQGIGKVIGWAPQLAILSHR  359

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDYKDGIT-  1257
             A+GGFVSHCGWNS LE++  GVP+ TWP+YAEQ  NAFQ+VK+L +AVEI  DY+   T 
Sbjct  360   AVGGFVSHCGWNSTLESIYFGVPMATWPMYAEQQANAFQLVKDLEMAVEIKMDYRKEPTG  419

Query  1258  ------LVSAEDVERGVRKLMDGDDEVREKVKEYSEMCKRVWMKNGSSAVSLGKLIE  1410
                   +V AE++E+ +R+LMD ++++R KV+E  E  +   M+ GSS  S+G  I+
Sbjct  420   TMGQEVIVKAEEIEKAIRELMDPENKIRMKVREMKEKSRATTMEGGSSYTSIGGFIQ  476



>emb|CAN67922.1| hypothetical protein VITISV_030049 [Vitis vinifera]
Length=465

 Score =   374 bits (959),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 197/442 (45%), Positives = 279/442 (63%), Gaps = 14/442 (3%)
 Frame = +1

Query  10    MKQAKVVFVSTPTIGNLVPVVEFSKLLSHQNQNLSVTVLLINMPQRPLIQSYIDSLASDG  189
             M+Q ++VFV +P IG+L   VE +KLL+ +++ +SVTV ++  P     +S     +   
Sbjct  1     MEQTELVFVPSPGIGHLAATVEIAKLLTQRDRRVSVTVFIMKFP----FESNGGMTSDSD  56

Query  190   NLEFLSLPAAEPPSPDQNRSTISFLSIWIENHEPHVRRALTKLKSDDDVRIAGFFVDMFC  369
             ++  ++LP+ E  S   +     FL+ +++ H P VR A+ +L   + VR AGF +DMFC
Sbjct  57    SIRCVTLPSVEISSGXMSPGV--FLTEFVKAHIPLVRDAVHELTRSNSVRXAGFVIDMFC  114

Query  370   TSFIDVAEELDIPCYLYFASPASFLSFMLHIPTL-DAQVPKNSEFGDAAKEYVIPGFENP  546
             T  IDVA+E  +P YL+F S A+FL FM H+  L D +    +EF D+     +P + N 
Sbjct  115   TPMIDVADEFGVPSYLFFTSSAAFLGFMFHLQFLHDYKGLDFNEFKDSDAVLEVPSYVNS  174

Query  547   VPVESFPPFMSKRHEDTYLPFLQHAKRYRETRGVVVNTFKELESYCLGSMFGGNDVGPVY  726
             VP + FP  M  +        L H +R+++ +G++VNTF ELE + + S F G +  PVY
Sbjct  175   VPGKVFPSVMFDKEGGGTEMLLHHTRRFKQVKGIMVNTFIELEPHAIQS-FSGCNARPVY  233

Query  727   PIGPVVDRE-GPARWHPDSWNHELVMKWLDNQLSSSVVFLTTGSMGSLNPAQIREIATGL  903
             P+GP+++ + G      D+     +M WLD+Q  SSVVFL  GSMGS    QI+EIA GL
Sbjct  234   PVGPLLNIQVGSGGAQQDA---NAIMSWLDDQPPSSVVFLCFGSMGSFGVDQIKEIAHGL  290

Query  904   ERAGYRFLWSIREPP-KSKLDLPNDYTDLDHVLPPGFSDRTKGKGMVCGWVPQVTILAHK  1080
             E +G RFLWS+R+PP K ++  P+DY ++  VLP GF  R  G G V GW PQV +LAH 
Sbjct  291   EHSGQRFLWSLRQPPQKGRMGFPSDYANVKEVLPEGFLHRMAGTGKVIGWAPQVAVLAHP  350

Query  1081  AIGGFVSHCGWNSILEALCHGVPIGTWPIYAEQHLNAFQMVKELGLAVEITFDY-KDGIT  1257
             AIGGFVSHCGWNSILE++ +GVPI  WP+YAEQ +NAFQMVK LGL  EI  DY KD   
Sbjct  351   AIGGFVSHCGWNSILESIWYGVPIAAWPMYAEQQINAFQMVKXLGLVXEIKIDYNKDSGY  410

Query  1258  LVSAEDVERGVRKLMDGDDEVR  1323
             +VSA ++E G++ LM+ ++E R
Sbjct  411   IVSAREIENGLKNLMNMNNEAR  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3780637393212