BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82169_g1_i1 len=125 path=[103:0-124]

Length=125
                                                                      Score     E

ref|XP_006370928.1|  hypothetical protein POPTR_0019s01840g           60.1    4e-09   
ref|XP_006370929.1|  legumin family protein                           60.1    5e-09   
gb|AAS67036.1|  11S seed storage globulin                             58.9    1e-08   Chenopodium quinoa
gb|ABI94735.1|  11S seed storage globulin A                           58.9    1e-08   Chenopodium quinoa
gb|AFJ04523.1|  glutelin type-A 3 precursor                           58.9    1e-08   
ref|XP_004493780.1|  PREDICTED: legumin A-like                        58.9    1e-08   
gb|ABI94736.1|  11S seed storage globulin B                           58.5    1e-08   Chenopodium quinoa
gb|AAS67037.1|  11S seed storage globulin                             58.5    2e-08   Chenopodium quinoa
ref|XP_006370927.1|  hypothetical protein POPTR_0019s01830g           57.4    4e-08   
ref|XP_011046347.1|  PREDICTED: legumin B-like                        57.4    4e-08   
ref|XP_010679302.1|  PREDICTED: legumin A-like                        57.4    4e-08   
emb|CAA73615.1|  legumin                                              54.7    4e-08   Cicer arietinum [garbanzo]
ref|XP_002522725.1|  conserved hypothetical protein                   53.9    6e-08   Ricinus communis
emb|CAA67879.1|  legumin precursor                                    56.6    7e-08   Quercus robur [English oak]
emb|CAA83677.1|  legumin A                                            56.2    1e-07   Vicia sativa [spring vetch]
ref|XP_004493779.1|  PREDICTED: legumin-like                          55.8    1e-07   
ref|XP_006370926.1|  legumin family protein                           55.8    2e-07   
ref|XP_011046348.1|  PREDICTED: legumin B-like                        55.8    2e-07   
emb|CAA86824.1|  legumin A precursor                                  55.5    2e-07   Vicia narbonensis
gb|ADN39438.1|  11S globulin isoform 2                                55.5    2e-07   
ref|XP_006369779.1|  hypothetical protein POPTR_0001s31540g           55.1    2e-07   
gb|ADN39437.1|  11S globulin isoform 1                                55.5    2e-07   
gb|ABB60055.1|  11S globulin precursor isoform 4                      55.1    3e-07   Sesamum indicum [beniseed]
ref|XP_010265035.1|  PREDICTED: 11S globulin subunit beta-like        55.1    3e-07   
sp|Q9SMJ4.1|LEG_CICAR  RecName: Full=Legumin; AltName: Full=Alpha...  55.1    3e-07   Cicer arietinum [garbanzo]
ref|XP_011083024.1|  PREDICTED: legumin B-like                        54.7    3e-07   
sp|P15838.1|LEGA2_PEA  RecName: Full=Legumin A2; Contains: RecNam...  54.7    4e-07   Pisum sativum [garden pea]
gb|ABM66807.1|  11S globulin                                          54.7    4e-07   Amaranthus hypochondriacus [prince's feather]
pdb|3KSC|A  Chain A, Crystal Structure Of Pea Prolegumin, An 11s ...  54.3    4e-07   
emb|CAA26720.1|  legumin                                              54.3    5e-07   Pisum sativum [garden pea]
sp|P02857.1|LEGA_PEA  RecName: Full=Legumin A; Contains: RecName:...  54.3    5e-07   Pisum sativum [garden pea]
emb|CAA10722.1|  legA class precursor                                 54.3    5e-07   Pisum sativum [garden pea]
ref|XP_002533466.1|  glutelin type-A 3 precursor, putative            54.3    6e-07   Ricinus communis
pdb|3QAC|A  Chain A, Structure Of Amaranth 11s Proglobulin Seed S...  53.9    6e-07   
gb|KDP40337.1|  hypothetical protein JCGZ_02335                       53.9    7e-07   
ref|XP_011080043.1|  PREDICTED: legumin B-like                        53.9    7e-07   
gb|KEH23930.1|  legumin A2                                            53.9    7e-07   
emb|CAA57633.1|  11S globulin seed storage protein                    53.9    7e-07   Amaranthus hypochondriacus [prince's feather]
ref|XP_010272923.1|  PREDICTED: legumin type B-like                   52.0    8e-07   
emb|CAA38758.1|  legumin A2 primary translation product               53.9    8e-07   Vicia faba var. minor [tick bean]
gb|KEH23931.1|  legumin A2                                            53.5    9e-07   
ref|XP_002539761.1|  hypothetical protein RCOM_2131030                51.6    1e-06   Ricinus communis
gb|ABB77213.1|  11S globulin-like protein                             53.1    1e-06   Actinidia chinensis
ref|NP_001235810.1|  glycinin G2 precursor                            52.8    2e-06   
gb|AHA36627.1|  Cor a 9 allergen                                      52.8    2e-06   
ref|XP_009624043.1|  PREDICTED: legumin A-like                        52.8    2e-06   
ref|XP_009803568.1|  PREDICTED: legumin A-like                        52.8    2e-06   
gb|KHN10743.1|  Glycinin G2                                           52.8    2e-06   
ref|XP_002524198.1|  legumin B precursor, putative                    52.8    2e-06   Ricinus communis
ref|XP_010272888.1|  PREDICTED: legumin B-like                        52.8    2e-06   
emb|CAA26575.1|  unnamed protein product                              52.8    2e-06   Glycine max [soybeans]
gb|KHN02503.1|  Glycinin G3                                           52.8    2e-06   
sp|P11828.1|GLYG3_SOYBN  RecName: Full=Glycinin G3; Contains: Rec...  52.8    2e-06   Glycine max [soybeans]
ref|NP_001236840.1|  glycinin A1bB2-784 precursor                     52.8    2e-06   
ref|XP_002524606.1|  legumin A precursor, putative                    52.4    2e-06   Ricinus communis
dbj|BAC55937.1|  glycinin A1bB2-445                                   52.4    2e-06   Glycine max [soybeans]
pir||S11003  glycinin G3 precursor - soybean                          52.4    2e-06
ref|XP_002524604.1|  legumin A precursor, putative                    52.4    2e-06   Ricinus communis
gb|KHN10744.1|  Glycinin G1                                           52.4    2e-06   
ref|XP_002524605.1|  legumin A precursor, putative                    52.4    3e-06   Ricinus communis
gb|KDP40339.1|  hypothetical protein JCGZ_02337                       52.0    3e-06   
gb|ABK80751.1|  11S globulin precursor isoform 1A                     52.0    3e-06   Ficus pumila var. awkeotsang [jelly fig]
gb|AIA57958.1|  beta-globulin B2                                      52.0    3e-06   
ref|XP_010097607.1|  Legumin A                                        51.6    4e-06   
pdb|1UD1|A  Chain A, Crystal Structure Of Proglycinin Mutant C88s     51.6    4e-06   
pdb|1FXZ|A  Chain A, Crystal Structure Of Soybean Proglycinin A1a...  51.6    5e-06   
ref|XP_011004057.1|  PREDICTED: legumin A-like                        51.6    5e-06   
gb|ACT53401.1|  mutant glycinin subunit A1aB1b                        51.2    5e-06   Glycine max [soybeans]
sp|P04776.2|GLYG1_SOYBN  RecName: Full=Glycinin G1; Contains: Rec...  51.6    5e-06   Glycine max [soybeans]
ref|XP_002307645.2|  legumin family protein                           51.2    5e-06   Populus trichocarpa [western balsam poplar]
gb|ACT53400.1|  mutant glycinin subunit A1aB1b                        51.2    5e-06   Glycine max [soybeans]
prf||1309256A  Glycinin A1aBx                                         51.6    5e-06
ref|XP_009766463.1|  PREDICTED: 11S globulin seed storage protein...  51.2    5e-06   
ref|XP_004152050.1|  PREDICTED: legumin A-like                        51.2    5e-06   
ref|XP_004162393.1|  PREDICTED: legumin J-like                        50.8    6e-06   
ref|NP_001235827.1|  glycinin G1 precursor                            51.2    6e-06   
ref|XP_009624040.1|  PREDICTED: 11S globulin seed storage protein...  51.2    6e-06   
ref|XP_009624045.1|  PREDICTED: 11S globulin seed storage protein...  51.2    6e-06   
ref|XP_009761684.1|  PREDICTED: 11S globulin seed storage protein...  50.8    8e-06   
gb|KGN57905.1|  hypothetical protein Csa_3G384800                     50.8    8e-06   
gb|ACB55490.1|  Pis v 5.0101 allergen 11S globulin precusor           50.8    9e-06   Pistacia vera [pistachio]
gb|AAF05770.1|AF193433_1  glutelin                                    50.4    9e-06   Elaeis guineensis
gb|ABW86979.1|  11S legumin protein                                   50.8    1e-05   Carya illinoinensis [pecan]
ref|XP_004167380.1|  PREDICTED: legumin A-like                        49.3    1e-05   
ref|XP_008447425.1|  PREDICTED: legumin A-like                        50.4    1e-05   
ref|XP_004141669.1|  PREDICTED: LOW QUALITY PROTEIN: 11S globulin...  50.4    1e-05   
ref|XP_008462393.1|  PREDICTED: legumin B-like                        50.4    1e-05   
gb|ABW86978.1|  11S legumin protein                                   50.4    1e-05   Carya illinoinensis [pecan]
gb|KGN45554.1|  hypothetical protein Csa_7G452090                     50.4    1e-05   
ref|XP_004155945.1|  PREDICTED: 11S globulin subunit beta-like        50.4    1e-05   
ref|XP_009761685.1|  PREDICTED: legumin A-like                        50.4    1e-05   
ref|XP_009624041.1|  PREDICTED: legumin A-like                        50.4    1e-05   
gb|EYU46455.1|  hypothetical protein MIMGU_mgv1a005708mg              50.4    1e-05   
gb|AAN76862.1|AF453947_1  allergen Ana o 2                            50.1    1e-05   Anacardium occidentale [maranon]
emb|CDP79024.1|  edestin 1                                            50.4    1e-05   
ref|XP_010111924.1|  Legumin A                                        50.1    1e-05   
emb|CDP79023.1|  edestin 1                                            50.1    1e-05   
emb|CDP79026.1|  edestin 1                                            50.1    1e-05   
ref|XP_009783514.1|  PREDICTED: 11S globulin seed storage protein...  50.1    1e-05   
gb|AEO27678.1|  seed storage protein legumin B                        50.1    1e-05   
gb|AAT39430.1|  glycinin                                              50.1    2e-05   Arachis hypogaea [goober]
gb|ADQ53859.1|  Ara h 3 allergen                                      50.1    2e-05   
gb|ABI17154.1|  iso-Ara h3                                            50.1    2e-05   Arachis hypogaea [goober]
ref|NP_001291327.1|  legumin B-like precursor                         50.1    2e-05   
ref|XP_002524195.1|  legumin B precursor, putative                    49.7    2e-05   Ricinus communis
emb|CAA64761.1|  legumin-like protein                                 49.7    2e-05   Asarum europaeum
ref|XP_006351693.1|  PREDICTED: 11S globulin seed storage protein...  49.7    2e-05   
emb|CAA47808.1|  minor legumin                                        47.4    2e-05   Pisum sativum [garden pea]
ref|XP_008353191.1|  PREDICTED: LOW QUALITY PROTEIN: legumin type...  49.7    2e-05   
gb|ABK80752.1|  11S globulin precursor isoform 1B                     49.7    2e-05   Ficus pumila var. awkeotsang [jelly fig]
gb|AEO27680.1|  seed storage protein legumin B                        49.7    2e-05   
sp|P09800.1|LEGB_GOSHI  RecName: Full=Legumin B; AltName: Full=Be...  49.7    2e-05   Gossypium hirsutum [American cotton]
gb|ABK92181.1|  11S seed storage globulin precursor B2                48.9    2e-05   Arachis hypogaea [goober]
ref|XP_010279433.1|  PREDICTED: legumin A-like                        49.7    2e-05   
ref|XP_004152049.1|  PREDICTED: 11S globulin subunit beta-like        49.7    2e-05   
ref|XP_010671027.1|  PREDICTED: legumin B-like                        49.7    2e-05   
emb|CAR78996.1|  legumin storage protein 5                            49.7    2e-05   Lotus japonicus
gb|AEB33709.1|  conglutin alpha 1                                     49.7    2e-05   
gb|AEO27681.1|  seed storage protein legumin B                        49.7    2e-05   
ref|XP_009354982.1|  PREDICTED: legumin type B-like                   49.3    3e-05   
gb|AAL73404.1|AF449424_1  11S globulin-like protein                   49.3    3e-05   Corylus avellana [European hazelnut]
gb|EPS62256.1|  hypothetical protein M569_12535                       49.3    3e-05   
ref|XP_008372197.1|  PREDICTED: LOW QUALITY PROTEIN: legumin A-like   49.3    3e-05   
sp|Q647H2.1|AHY3_ARAHY  RecName: Full=Arachin Ahy-3; Contains: Re...  49.3    3e-05   Arachis hypogaea [goober]
ref|XP_010045998.1|  PREDICTED: legumin A-like                        49.3    3e-05   
ref|XP_010326169.1|  PREDICTED: LOW QUALITY PROTEIN: 11S globulin...  49.3    3e-05   
ref|XP_006351695.1|  PREDICTED: 11S globulin seed storage protein...  48.9    3e-05   
ref|XP_009603583.1|  PREDICTED: 11S globulin subunit beta-like        49.3    3e-05   
emb|CDY68429.1|  BnaCnng58970D                                        46.6    4e-05   
ref|XP_002532028.1|  legumin A precursor, putative                    48.9    4e-05   Ricinus communis
emb|CAA32455.1|  storage protein                                      48.1    4e-05   Vicia faba var. minor [tick bean]
dbj|BAJ78781.1|  cruciferin storage protein                           46.2    4e-05   
emb|CAA70334.1|  pre-pro-legumin                                      48.9    4e-05   Sagittaria sagittifolia [Old World arrowhead]
ref|XP_011026325.1|  PREDICTED: 11S globulin seed storage protein...  47.0    4e-05   
gb|ABK92180.1|  11S seed storage globulin precursor B1                48.1    5e-05   Arachis hypogaea [goober]
ref|XP_004247523.1|  PREDICTED: 11S globulin seed storage protein...  48.5    5e-05   
ref|XP_004493872.1|  PREDICTED: glycinin G4-like                      48.9    5e-05   
emb|CAA81262.1|  legumin; legumin-related high molecular weight p...  48.9    5e-05   Vicia faba var. minor [tick bean]
emb|CAA81285.1|  legumin; legumin-related high molecular weight p...  46.2    5e-05   Vicia faba var. minor [tick bean]
gb|KDP26533.1|  hypothetical protein JCGZ_17691                       48.5    5e-05   
gb|AEO27679.1|  seed storage protein legumin B                        48.5    5e-05   
ref|XP_008447426.1|  PREDICTED: legumin A-like                        48.5    5e-05   
ref|XP_002278201.1|  PREDICTED: cruciferin CRU1-like                  48.5    6e-05   Vitis vinifera
gb|KHG07690.1|  Legumin B                                             48.5    6e-05   
ref|XP_009777915.1|  PREDICTED: 11S globulin subunit beta-like        48.5    6e-05   
ref|XP_010253026.1|  PREDICTED: glutelin type-A 1-like                48.1    6e-05   
pir||S26688  legumin K - garden pea                                   48.5    6e-05
gb|KFK31664.1|  hypothetical protein AALP_AA6G142800                  48.5    6e-05   
ref|XP_010928048.1|  PREDICTED: glutelin type-A 3-like                48.1    6e-05   
ref|XP_009405244.1|  PREDICTED: glutelin type-A 2-like                48.1    7e-05   
gb|AAF19607.1|  legumin-like protein                                  48.1    7e-05   Perilla frutescens [beefsteak-mint]
ref|XP_004495101.1|  PREDICTED: legumin J-like isoform X2             48.1    7e-05   
ref|XP_009603582.1|  PREDICTED: 11S globulin subunit beta-like        48.1    7e-05   
emb|CBI37121.3|  unnamed protein product                              48.1    7e-05   
ref|XP_006354542.1|  PREDICTED: legumin B-like                        48.1    8e-05   
ref|XP_004495100.1|  PREDICTED: legumin J-like isoform X1             48.1    8e-05   
ref|XP_006480087.1|  PREDICTED: LOW QUALITY PROTEIN: legumin A-like   47.8    8e-05   
ref|XP_008805230.1|  PREDICTED: LOW QUALITY PROTEIN: glutelin typ...  48.1    8e-05   
ref|XP_006443837.1|  hypothetical protein CICLE_v10023766mg           47.8    8e-05   
ref|XP_010262323.1|  PREDICTED: glutelin type-B 5-like                48.1    8e-05   
gb|KDO60493.1|  hypothetical protein CISIN_1g046186mg                 47.8    8e-05   
ref|XP_010928127.1|  PREDICTED: glutelin type-A 1-like                48.1    8e-05   
gb|AAW29810.1|  seed storage protein                                  48.1    8e-05   Juglans regia
ref|XP_002278346.1|  PREDICTED: legumin A-like                        47.8    9e-05   Vitis vinifera
ref|XP_010262494.1|  PREDICTED: legumin B-like                        47.4    9e-05   
ref|XP_006279080.1|  hypothetical protein CARUB_v100127390mg          45.4    9e-05   
ref|XP_010046000.1|  PREDICTED: 11S globulin seed storage protein...  47.8    9e-05   
ref|XP_010555095.1|  PREDICTED: cruciferin PGCRURSE5                  47.8    9e-05   
gb|AIA57957.1|  beta-globulin B1                                      47.8    9e-05   
ref|XP_010940966.1|  PREDICTED: glutelin type-A 3-like                47.4    9e-05   
ref|XP_010253028.1|  PREDICTED: legumin B-like                        47.4    1e-04   
gb|EYU18320.1|  hypothetical protein MIMGU_mgv1a008983mg              47.4    1e-04   
ref|XP_009763876.1|  PREDICTED: legumin B-like                        47.8    1e-04   
emb|CAA47809.1|  legumin (minor small)                                47.8    1e-04   Pisum sativum [garden pea]
ref|XP_003590691.1|  Legumin                                          47.4    1e-04   
gb|KGN61596.1|  hypothetical protein Csa_2G174130                     47.4    1e-04   
ref|XP_003590689.1|  Legumin                                          47.8    1e-04   
gb|KDO57580.1|  hypothetical protein CISIN_1g048197mg                 47.4    1e-04   
ref|XP_003590690.1|  Legumin                                          47.8    1e-04   
ref|XP_003590687.1|  Legumin B                                        47.8    1e-04   
gb|EYU46456.1|  hypothetical protein MIMGU_mgv1a005966mg              47.4    1e-04   
ref|XP_003590686.1|  Legumin B                                        47.8    1e-04   
pdb|1UCX|A  Chain A, Crystal Structure Of Proglycinin C12g Mutant     47.4    1e-04   
ref|XP_009630003.1|  PREDICTED: legumin B-like                        47.4    1e-04   
emb|CAA83674.1|  legumin B                                            47.4    1e-04   Vicia sativa [spring vetch]
ref|XP_009765013.1|  PREDICTED: legumin B-like                        47.4    1e-04   
ref|XP_003590688.1|  Legumin B                                        47.4    1e-04   
ref|XP_010482688.1|  PREDICTED: 12S seed storage protein CRB-like     47.4    1e-04   
ref|XP_003590684.1|  Legumin B                                        47.4    1e-04   
ref|XP_002530185.1|  11S globulin subunit beta precursor, putative    47.4    1e-04   Ricinus communis
sp|P05190.1|LEGB4_VICFA  RecName: Full=Legumin type B; Contains: ...  47.4    1e-04   Vicia faba [broad bean]
gb|EYU46457.1|  hypothetical protein MIMGU_mgv1a005966mg              47.0    1e-04   
emb|CDY18193.1|  BnaC05g02160D                                        47.4    1e-04   
ref|NP_001289909.1|  uncharacterized protein LOC104754510 precursor   47.4    1e-04   
ref|XP_009765011.1|  PREDICTED: legumin B-like                        47.4    1e-04   
emb|CDX89858.1|  BnaA10g02240D                                        47.4    1e-04   
sp|P33522.1|CRU4_BRANA  RecName: Full=Cruciferin CRU4; AltName: F...  47.0    2e-04   Brassica napus [oilseed rape]
ref|XP_010935905.1|  PREDICTED: glutelin type-A 3-like isoform X2     47.0    2e-04   
ref|XP_010457405.1|  PREDICTED: 12S seed storage protein CRB isof...  47.0    2e-04   
ref|NP_001289908.1|  12S seed storage protein CRB precursor           47.0    2e-04   
ref|XP_009119353.1|  PREDICTED: cruciferin CRU4                       47.0    2e-04   
ref|XP_010935904.1|  PREDICTED: glutelin type-B 5-like isoform X1     47.0    2e-04   
ref|XP_006303676.1|  hypothetical protein CARUB_v10011751mg           47.0    2e-04   
gb|AAA32778.1|  12S storage protein CRB                               47.0    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171884.1|  cruciferin 2                                        47.0    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889479.1|  hypothetical protein ARALYDRAFT_470363           47.0    2e-04   
sp|P05692.1|LEGJ_PEA  RecName: Full=Legumin J; Contains: RecName:...  47.0    2e-04   Pisum sativum [garden pea]
gb|AAM93157.1|  trypsin inhibitor                                     45.8    2e-04   Arachis hypogaea [goober]
gb|AEB33711.1|  conglutin alpha 3                                     47.0    2e-04   
ref|XP_010257107.1|  PREDICTED: glutelin type-B 5-like                47.0    2e-04   
gb|KFK29566.1|  hypothetical protein AALP_AA7G151400                  47.0    2e-04   
ref|XP_010248272.1|  PREDICTED: legumin type B-like                   46.6    2e-04   
ref|XP_004289947.1|  PREDICTED: glycinin G4-like                      47.0    2e-04   
gb|ABK80755.1|  11S globulin precursor isoform 3B                     47.0    2e-04   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_010263163.1|  PREDICTED: 11S globulin subunit beta-like        47.0    2e-04   
gb|KDP26530.1|  hypothetical protein JCGZ_17688                       47.0    2e-04   
ref|XP_004246943.1|  PREDICTED: 12S seed storage protein CRA1-like    46.6    2e-04   
ref|XP_009354949.1|  PREDICTED: cruciferin CRU1-like                  47.0    2e-04   
gb|ABL14271.1|  arachin 7                                             45.4    2e-04   Arachis hypogaea [goober]
ref|XP_006857275.1|  hypothetical protein AMTR_s00067p00022330        46.6    2e-04   
ref|NP_001275797.1|  citrin precursor                                 46.6    2e-04   
ref|XP_006420239.1|  hypothetical protein CICLE_v10004854mg           46.6    2e-04   
ref|XP_004289945.1|  PREDICTED: 12S seed storage protein CRU1-like    46.6    2e-04   
ref|XP_006420240.1|  hypothetical protein CICLE_v10004854mg           46.6    3e-04   
ref|XP_004289944.1|  PREDICTED: legumin A-like                        46.6    3e-04   
emb|CAA64762.1|  legumin-like protein                                 46.6    3e-04   Asarum europaeum
gb|AAB24084.1|  legumin propolypeptide alpha chain                    45.8    3e-04   
ref|NP_001291328.1|  uncharacterized protein LOC105171779 precursor   46.2    3e-04   
ref|NP_001291336.1|  11S globulin seed storage protein 2 precursor    46.2    3e-04   
gb|KFK42731.1|  hypothetical protein AALP_AA1G032400                  46.2    3e-04   
gb|AGE34644.1|  11S globulin isoform 3                                46.2    3e-04   
pir||JC2097  legumin type B alpha chain precursor (clone LeB4, B4...  45.8    3e-04
gb|AAM93194.1|AF525749_1  castanin                                    46.2    3e-04   Castanea crenata [Japanese chestnut]
gb|AAC63045.1|  glycinin                                              46.2    3e-04   Arachis hypogaea [goober]
ref|XP_006420241.1|  hypothetical protein CICLE_v10004871mg           46.2    3e-04   
ref|XP_004247735.1|  PREDICTED: 11S globulin subunit beta             46.2    3e-04   
ref|XP_010025835.1|  PREDICTED: legumin B-like                        46.2    3e-04   
gb|AAR02860.1|  storage protein                                       46.2    3e-04   Arachis hypogaea [goober]
emb|CDY14908.1|  BnaA02g22500D                                        46.2    3e-04   
sp|P33524.2|CRU2_BRANA  RecName: Full=Cruciferin BnC2; AltName: F...  46.2    3e-04   Brassica napus [oilseed rape]
gb|AAM46958.1|AF510854_1  allergen Arah3/Arah4                        46.2    4e-04   Arachis hypogaea [goober]
emb|CDY22309.1|  BnaA06g36310D                                        46.2    4e-04   
emb|CDY65916.1|  BnaC07g48660D                                        46.2    4e-04   
ref|XP_009123931.1|  PREDICTED: cruciferin BnC2                       46.2    4e-04   
gb|AAU21490.1|  arachin Ahy-1                                         46.2    4e-04   Arachis hypogaea [goober]
gb|ACH91862.1|  arachin Arah3 isoform                                 46.2    4e-04   Arachis hypogaea [goober]
emb|CCW28732.1|  putative arachin                                     46.2    4e-04   
ref|XP_009101736.1|  PREDICTED: cruciferin BnC1                       46.2    4e-04   
pdb|3C3V|A  Chain A, Crystal Structure Of Peanut Major Allergen A...  46.2    4e-04   
gb|AAW56067.1|  arachin Ahy-4                                         46.2    4e-04   Arachis hypogaea [goober]
gb|AFQ32291.1|  12S seed storage protein                              45.8    4e-04   
gb|AAA32988.1|  cruciferin precursor                                  45.8    4e-04   Brassica napus [oilseed rape]
gb|ABL14270.1|  arachin 6                                             46.2    4e-04   Arachis hypogaea [goober]
sp|P11090.1|CRUA_BRANA  RecName: Full=Cruciferin; AltName: Full=1...  45.8    4e-04   Brassica napus [oilseed rape]
sp|P33523.2|CRU1_BRANA  RecName: Full=Cruciferin BnC1; AltName: F...  45.8    4e-04   Brassica napus [oilseed rape]
ref|XP_010087056.1|  hypothetical protein L484_012301                 43.1    4e-04   
ref|XP_008364259.1|  PREDICTED: legumin A-like                        46.2    4e-04   
gb|AEO27675.1|  seed storage protein legumin A                        45.8    4e-04   
emb|CAA57848.1|  legumin precursor                                    45.8    4e-04   Magnolia salicifolia
gb|AEO27674.1|  seed storage protein legumin A                        45.8    4e-04   
gb|AIO11048.1|  11S globulin                                          45.8    4e-04   
gb|EYU17920.1|  hypothetical protein MIMGU_mgv1a006934mg              45.8    4e-04   
ref|XP_010679299.1|  PREDICTED: 11S globulin seed storage protein...  45.8    4e-04   
gb|KHG13642.1|  Legumin A                                             45.8    4e-04   
emb|CAA38757.1|  N-terminal incomplete legumin A1 pre-pro-polypep...  45.8    4e-04   Vicia faba var. minor [tick bean]
dbj|BAC80213.1|  cruciferin                                           45.8    4e-04   Brassica napus [oilseed rape]
pdb|3KGL|A  Chain A, Crystal Structure Of Procruciferin, 11s Glob...  45.8    5e-04   
ref|XP_010671026.1|  PREDICTED: 13S globulin seed storage protein...  45.8    5e-04   
ref|XP_010026826.1|  PREDICTED: 11S globulin subunit beta-like        45.8    5e-04   
emb|CBI37119.3|  unnamed protein product                              45.4    5e-04   
gb|AAD47382.1|  glycinin                                              45.8    5e-04   Arachis hypogaea [goober]
ref|XP_002306851.2|  hypothetical protein POPTR_0005s24580g           45.4    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006356113.1|  PREDICTED: legumin B-like                        45.4    5e-04   
ref|XP_010652369.1|  PREDICTED: legumin A-like                        45.4    6e-04   
ref|XP_004234041.1|  PREDICTED: legumin B-like                        45.4    6e-04   
gb|ABD14346.1|  cruciferin-like protein                               45.4    6e-04   Brassica napus [oilseed rape]
ref|XP_010111925.1|  Legumin A                                        45.4    7e-04   
ref|XP_007050296.1|  Legumin A, putative                              45.4    7e-04   
gb|AAU21491.1|  arachin Ahy-2                                         45.4    7e-04   Arachis hypogaea [goober]
gb|AAG01363.1|  Gly1                                                  45.4    7e-04   
ref|XP_008447427.1|  PREDICTED: 13S globulin seed storage protein...  45.1    7e-04   
gb|ABU42022.1|  11S globulin                                          45.1    8e-04   
gb|ABG73110.1|  Pis v 2.0201 allergen 11S globulin precusor           45.1    8e-04   
ref|XP_006403137.1|  hypothetical protein EUTSA_v10003429mg           45.1    8e-04   
gb|ABK80754.1|  11S globulin precursor isoform 3A                     45.1    9e-04   
ref|XP_006403138.1|  hypothetical protein EUTSA_v10003387mg           45.1    9e-04   
emb|CAI83773.2|  legumin-like protein                                 45.1    9e-04   
gb|KGN57908.1|  hypothetical protein Csa_3G386810                     45.1    0.001   
ref|XP_010481774.1|  PREDICTED: 12S seed storage protein CRA1-like    44.7    0.001   
gb|ABG73109.1|  Pis v 2.0101 allergen11S globulin precusor            44.7    0.001   



>ref|XP_006370928.1| hypothetical protein POPTR_0019s01840g [Populus trichocarpa]
 gb|ERP48725.1| hypothetical protein POPTR_0019s01840g [Populus trichocarpa]
Length=494

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q +ECQL  INALEP   I +E G TE WD NDEQFQC G
Sbjct  42   QQSECQLQRINALEPARRIKSEAGVTEIWDENDEQFQCAG  81



>ref|XP_006370929.1| legumin family protein [Populus trichocarpa]
 gb|ERP48726.1| legumin family protein [Populus trichocarpa]
Length=493

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q +ECQL  INALEP   I +E G TE WD NDEQFQC G
Sbjct  42   QQSECQLQRINALEPARRIKSEAGVTEIWDENDEQFQCAG  81



>gb|AAS67036.1| 11S seed storage globulin [Chenopodium quinoa]
Length=480

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  + ALEPT+ I AEGG TE WD  D+QFQC G
Sbjct  33   QGNECQIDRLTALEPTNRIQAEGGLTEVWDTQDQQFQCSG  72



>gb|ABI94735.1| 11S seed storage globulin A [Chenopodium quinoa]
Length=480

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  + ALEPT+ I AEGG TE WD  D+QFQC G
Sbjct  33   QGNECQIDRLTALEPTNRIQAEGGLTEVWDTQDQQFQCSG  72



>gb|AFJ04523.1| glutelin type-A 3 precursor, partial [Vernicia fordii]
Length=498

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            SQ +ECQL  INA+EP+ +I +E G T+ WD NDEQFQC G
Sbjct  38   SQQDECQLERINAVEPSRSIQSEAGVTDVWDENDEQFQCAG  78



>ref|XP_004493780.1| PREDICTED: legumin A-like [Cicer arietinum]
Length=518

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQL H+NALEP + I +EGG  E W+PN+ QF+C G
Sbjct  27   QQNECQLEHLNALEPDNRIESEGGLIETWNPNNRQFRCAG  66



>gb|ABI94736.1| 11S seed storage globulin B [Chenopodium quinoa]
Length=479

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  + ALEPT  I AEGG TE WD  D+QFQC G
Sbjct  33   QGNECQIDRLTALEPTHRIQAEGGLTEVWDTQDQQFQCSG  72



>gb|AAS67037.1| 11S seed storage globulin [Chenopodium quinoa]
Length=479

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  + ALEPT  I AEGG TE WD  D+QFQC G
Sbjct  33   QGNECQIDRLTALEPTYRIQAEGGLTEVWDTQDQQFQCSG  72



>ref|XP_006370927.1| hypothetical protein POPTR_0019s01830g [Populus trichocarpa]
 gb|ERP48724.1| hypothetical protein POPTR_0019s01830g [Populus trichocarpa]
Length=495

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQ+  INALEP   I +E G TE WD NDEQFQC G
Sbjct  45   ECQIDRINALEPARKIRSEAGVTEIWDENDEQFQCAG  81



>ref|XP_011046347.1| PREDICTED: legumin B-like [Populus euphratica]
Length=495

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQ+  INALEP   I +E G TE WD NDEQFQC G
Sbjct  45   ECQIDRINALEPARKIRSEAGVTEIWDENDEQFQCAG  81



>ref|XP_010679302.1| PREDICTED: legumin A-like [Beta vulgaris subsp. vulgaris]
Length=475

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
             Q N+CQ   + ALEPT+ I AEGG TE WD  D+QFQC G
Sbjct  31   KQGNQCQFDRLTALEPTNRIQAEGGLTEVWDTQDQQFQCSG  71



>emb|CAA73615.1| legumin [Cicer arietinum]
Length=132

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + NECQL H+NALEP + I +EGG  E W+P+++QF+C G
Sbjct  27   EQNECQLEHLNALEPDNRIKSEGGLIETWNPSNKQFRCAG  66



>ref|XP_002522725.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39576.1| conserved hypothetical protein [Ricinus communis]
Length=111

 Score = 53.9 bits (128),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q  +CQLS INA EP+    +E G TE WD ND+QFQC G
Sbjct  41   QQYQCQLSRINAAEPSRRFQSEAGLTEIWDENDQQFQCVG  80



>emb|CAA67879.1| legumin precursor [Quercus robur]
Length=488

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
             Q N+CQL  ++ALEP   I AEGG  E WDPND+QFQC G
Sbjct  32   RQFNQCQLDRLDALEPNHRIEAEGGVIESWDPNDKQFQCVG  72



>emb|CAA83677.1| legumin A [Vicia sativa]
Length=498

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCG  121
            SQ NECQL  INALEP + I +EGG  E W+PN+ QF+C 
Sbjct  26   SQQNECQLERINALEPDNRIESEGGLIETWNPNNRQFRCA  65



>ref|XP_004493779.1| PREDICTED: legumin-like [Cicer arietinum]
Length=499

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + NECQL H+NALEP + I +EGG  E W+P+++QF+C G
Sbjct  27   EQNECQLEHLNALEPDNRIKSEGGLIETWNPSNKQFRCAG  66



>ref|XP_006370926.1| legumin family protein [Populus trichocarpa]
 gb|ERP48723.1| legumin family protein [Populus trichocarpa]
Length=495

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQ+  INALEP   + +E G TE WD ND+QFQC G
Sbjct  45   ECQIDRINALEPARKVRSEAGVTEIWDENDDQFQCAG  81



>ref|XP_011046348.1| PREDICTED: legumin B-like [Populus euphratica]
Length=491

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +N +CQL  INALEP   I +E G T+ WD ND+QFQC G
Sbjct  39   RNFQCQLQKINALEPARRIKSEAGVTDIWDENDKQFQCAG  78



>emb|CAA86824.1| legumin A precursor [Vicia narbonensis]
Length=482

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            SQ NECQL  ++ALEP + I +EGG  E W+PN+ QF+C G
Sbjct  26   SQQNECQLERLDALEPDNRIESEGGLIETWNPNNRQFRCAG  66



>gb|ADN39438.1| 11S globulin isoform 2 [Castanea sativa]
Length=529

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q N CQL  ++ALEP + I AE G  E WDPND QFQC G
Sbjct  31   QFNRCQLDRLDALEPNNRIKAEAGVIESWDPNDRQFQCVG  70



>ref|XP_006369779.1| hypothetical protein POPTR_0001s31540g, partial [Populus trichocarpa]
 gb|ERP66348.1| hypothetical protein POPTR_0001s31540g, partial [Populus trichocarpa]
Length=470

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQ   INALEP     +E G TE WD ND+QFQC G
Sbjct  44   NECQFDRINALEPARKFRSEAGVTEIWDENDQQFQCAG  81



>gb|ADN39437.1| 11S globulin isoform 1 [Castanea sativa]
Length=530

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q N CQL  ++ALEP + I AE G  E WDPND QFQC G
Sbjct  31   QFNRCQLDRLDALEPNNRIKAEAGVIESWDPNDRQFQCVG  70



>gb|ABB60055.1| 11S globulin precursor isoform 4 [Sesamum indicum]
Length=469

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q  +C++S INA EPT  I AEGG +EFWD N ++FQC G
Sbjct  27   QQGQCRISRINAQEPTRRIQAEGGVSEFWDHNSDEFQCAG  66



>ref|XP_010265035.1| PREDICTED: 11S globulin subunit beta-like [Nelumbo nucifera]
Length=674

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q +ECQ+S+++ALEP+  I AE G  E WD N+EQFQC G
Sbjct  44   QQSECQISNLDALEPSRRIEAEAGHLEIWDHNNEQFQCAG  83



>sp|Q9SMJ4.1|LEG_CICAR RecName: Full=Legumin; AltName: Full=Alpha-amylase inhibitor; 
Short=CLAI; Contains: RecName: Full=Legumin alpha chain; Contains: 
RecName: Full=Legumin beta chain; Flags: Precursor [Cicer 
arietinum]
 emb|CAB60140.1| legumin, alpha and beta subunit [Cicer arietinum]
Length=496

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQL H+NAL+P + I +EGG  E W+P+++QF C G
Sbjct  27   QQNECQLEHLNALKPDNRIKSEGGLIETWNPSNKQFACAG  66



>ref|XP_011083024.1| PREDICTED: legumin B-like [Sesamum indicum]
Length=460

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q  +C++S INA EPT  I AEGG +EFWD N ++FQC G
Sbjct  27   QQGQCRISRINAQEPTRRIQAEGGVSEFWDHNSDEFQCAG  66



>sp|P15838.1|LEGA2_PEA RecName: Full=Legumin A2; Contains: RecName: Full=Legumin A2 
alpha chain; AltName: Full=Legumin A2 acidic chain; Contains: 
RecName: Full=Legumin A2 beta chain; AltName: Full=Legumin 
A2 basic chain; Flags: Precursor [Pisum sativum]
 emb|CAA35056.1| legumin [Pisum sativum]
Length=520

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP + I +EGG  E W+PN++QF+C G
Sbjct  30   NECQLERLNALEPDNRIESEGGLIETWNPNNKQFRCAG  67



>gb|ABM66807.1| 11S globulin [Amaranthus hypochondriacus]
Length=487

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  + ALEPT+ I AE G TE WD N+++F+C G
Sbjct  32   QGNECQIDRLTALEPTNRIQAEAGLTEVWDSNEQEFRCAG  71



>pdb|3KSC|A Chain A, Crystal Structure Of Pea Prolegumin, An 11s Seed Globulin 
From Pisum Sativum L.
 pdb|3KSC|B Chain B, Crystal Structure Of Pea Prolegumin, An 11s Seed Globulin 
From Pisum Sativum L.
 pdb|3KSC|C Chain C, Crystal Structure Of Pea Prolegumin, An 11s Seed Globulin 
From Pisum Sativum L.
 pdb|3KSC|D Chain D, Crystal Structure Of Pea Prolegumin, An 11s Seed Globulin 
From Pisum Sativum L.
 pdb|3KSC|E Chain E, Crystal Structure Of Pea Prolegumin, An 11s Seed Globulin 
From Pisum Sativum L.
 pdb|3KSC|F Chain F, Crystal Structure Of Pea Prolegumin, An 11s Seed Globulin 
From Pisum Sativum L.
Length=496

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQL  ++ALEP + I +EGG  E W+PN++QF+C G
Sbjct  6    QQNECQLERLDALEPDNRIESEGGLIETWNPNNKQFRCAG  45



>emb|CAA26720.1| legumin [Pisum sativum]
Length=507

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQL  ++ALEP + I +EGG  E W+PN++QF+C G
Sbjct  27   QQNECQLERLDALEPDNRIESEGGLIETWNPNNKQFRCAG  66



>sp|P02857.1|LEGA_PEA RecName: Full=Legumin A; Contains: RecName: Full=Legumin A alpha 
chain; AltName: Full=Legumin A acidic chain; Contains: RecName: 
Full=Legumin A beta chain; AltName: Full=Legumin A basic 
chain; Flags: Precursor [Pisum sativum]
Length=517

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQL  ++ALEP + I +EGG  E W+PN++QF+C G
Sbjct  27   QQNECQLERLDALEPDNRIESEGGLIETWNPNNKQFRCAG  66



>emb|CAA10722.1| legA class precursor [Pisum sativum]
Length=517

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQL  ++ALEP + I +EGG  E W+PN++QF+C G
Sbjct  27   QQNECQLERLDALEPDNRIESEGGLIETWNPNNKQFRCAG  66



>ref|XP_002533466.1| glutelin type-A 3 precursor, putative [Ricinus communis]
 gb|EEF28918.1| glutelin type-A 3 precursor, putative [Ricinus communis]
Length=497

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q ++CQL+ INA+EP+    +E G TE WD ND+QFQC G
Sbjct  41   QQDQCQLNRINAVEPSRRFQSEAGLTEIWDENDQQFQCVG  80



>pdb|3QAC|A Chain A, Structure Of Amaranth 11s Proglobulin Seed Storage Protein 
From Amaranthus Hypochondriacus L.
Length=465

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  + ALEPT+ I AE G TE WD N+++F+C G
Sbjct  10   QGNECQIDRLTALEPTNRIQAERGLTEVWDSNEQEFRCAG  49



>gb|KDP40337.1| hypothetical protein JCGZ_02335 [Jatropha curcas]
Length=508

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            SQ + C+L  INA+EP+  I +E G T+ WD NDEQF+C G
Sbjct  42   SQQDACRLERINAVEPSRRIQSEAGVTDIWDENDEQFRCAG  82



>ref|XP_011080043.1| PREDICTED: legumin B-like [Sesamum indicum]
Length=464

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q  ECQ+  INA EP+ ++ AEGG TEFWD  +++FQC G
Sbjct  27   QQGECQIRSINAREPSYSLQAEGGVTEFWDFKNDEFQCAG  66



>gb|KEH23930.1| legumin A2 [Medicago truncatula]
Length=525

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP + I +EGG  E W+PN+ QF+C G
Sbjct  33   NECQLEQLNALEPDNRIESEGGIIETWNPNNRQFRCAG  70



>emb|CAA57633.1| 11S globulin seed storage protein [Amaranthus hypochondriacus]
Length=501

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  + ALEPT+ I AE G TE WD N+++F+C G
Sbjct  46   QGNECQIDRLTALEPTNRIQAERGLTEVWDSNEQEFRCAG  85



>ref|XP_010272923.1| PREDICTED: legumin type B-like [Nelumbo nucifera]
Length=218

 Score = 52.0 bits (123),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + ++CQL +++ALEP   + AE G  E+WD ND+QFQC G
Sbjct  39   EKSKCQLYNLDALEPFRRVEAEAGLIEYWDQNDDQFQCAG  78



>emb|CAA38758.1| legumin A2 primary translation product [Vicia faba var. minor]
Length=500

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCG  121
            SQ NECQL  ++ALEP + I +EGG  E W+PN+ QF+C 
Sbjct  26   SQQNECQLERLDALEPDNRIESEGGLIETWNPNNRQFRCA  65



>gb|KEH23931.1| legumin A2 [Medicago truncatula]
Length=531

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP + I +EGG  E W+PN+ QF+C G
Sbjct  36   NECQLEQLNALEPDNRIESEGGIIETWNPNNRQFRCAG  73



>ref|XP_002539761.1| hypothetical protein RCOM_2131030 [Ricinus communis]
 gb|EEF22622.1| hypothetical protein RCOM_2131030 [Ricinus communis]
Length=193

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQL+ +NA EP + I +E G  E W+PN +QFQC G
Sbjct  28   QQNECQLNRLNAFEPDNRIQSEAGTIESWNPNHDQFQCAG  67



>gb|ABB77213.1| 11S globulin-like protein [Actinidia chinensis]
Length=462

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q  ECQ+  +NA EP   I AE G TEFWD  D+QFQC G
Sbjct  34   QKGECQIQRLNAQEPQQRIQAEAGVTEFWDWTDDQFQCAG  73



>ref|NP_001235810.1| glycinin G2 precursor [Glycine max]
 sp|P04405.2|GLYG2_SOYBN RecName: Full=Glycinin G2; Contains: RecName: Full=Glycinin A2 
subunit; Contains: RecName: Full=Glycinin B1a subunit; Flags: 
Precursor [Glycine max]
 emb|CAA33216.1| glycinin subunit G2 [Glycine max]
 dbj|BAA00154.1| glycinin A2B1a subunit [Glycine max]
 gb|AAB23210.1| glycinin G2 subunit [soybeans, Peptide, 485 aa]
 emb|CAA68460.1| glycinin [Glycine max]
 dbj|BAC78523.1| proglycinin A2B1 [Glycine max]
 prf||1402179A glycinin A2B1a
Length=485

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +Q NECQ+  +NAL+P + I +EGG+ E W+PN++ FQC G
Sbjct  23   AQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAG  63



>gb|AHA36627.1| Cor a 9 allergen [Corylus avellana]
Length=514

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            EC L  +NALEPT+ I AE G  E WD ND+QFQC G
Sbjct  37   ECNLDRLNALEPTNRIEAEAGQIESWDHNDQQFQCAG  73



>ref|XP_009624043.1| PREDICTED: legumin A-like [Nicotiana tomentosiformis]
Length=475

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQL+ ++  EPT  I AE G TE WDPN++QFQC G
Sbjct  31   ECQLNRLSPQEPTVRIQAEAGVTELWDPNNQQFQCAG  67



>ref|XP_009803568.1| PREDICTED: legumin A-like [Nicotiana sylvestris]
Length=475

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQL+ ++  EPT  I AE G TE WDPN++QFQC G
Sbjct  31   ECQLNRLSPQEPTVRIQAEAGVTELWDPNNQQFQCAG  67



>gb|KHN10743.1| Glycinin G2 [Glycine soja]
Length=526

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +Q NECQ+  +NAL+P + I +EGG+ E W+PN++ FQC G
Sbjct  23   AQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAG  63



>ref|XP_002524198.1| legumin B precursor, putative [Ricinus communis]
 gb|AAF73007.1|AF262998_1 legumin-like protein [Ricinus communis]
 gb|EEF38213.1| legumin B precursor, putative [Ricinus communis]
Length=476

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQL+ + ALEP   I  E G  E W+PN +QFQC G
Sbjct  29   QGNECQLNKLYALEPDKRIQTEAGLVESWNPNRDQFQCAG  68



>ref|XP_010272888.1| PREDICTED: legumin B-like [Nelumbo nucifera]
Length=500

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +  +C++ +++ALEPT  I AE G  E+WD N+EQFQC G
Sbjct  42   EQRQCRIDNLDALEPTHQIEAEAGLIEYWDENNEQFQCAG  81



>emb|CAA26575.1| unnamed protein product [Glycine max]
 prf||1109177A glycinin A2B1A precursor
Length=485

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +Q NECQ+  +NAL+P + I +EGG+ E W+PN++ FQC G
Sbjct  23   AQQNECQIQKLNALKPGNRIESEGGFIETWNPNNKPFQCAG  63



>gb|KHN02503.1| Glycinin G3 [Glycine soja]
Length=481

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG+ E W+PN++ FQC G
Sbjct  27   QQNECQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAG  66



>sp|P11828.1|GLYG3_SOYBN RecName: Full=Glycinin G3; Contains: RecName: Full=Glycinin A 
subunit; Contains: RecName: Full=Glycinin B subunit; Flags: 
Precursor [Glycine max]
 emb|CAA33217.1| glycinin subunit G3 [Glycine max]
Length=481

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG+ E W+PN++ FQC G
Sbjct  27   QQNECQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAG  66



>ref|NP_001236840.1| glycinin A1bB2-784 precursor [Glycine max]
 dbj|BAC55938.1| glycinin A1bB2-784 [Glycine max]
Length=482

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG+ E W+PN++ FQC G
Sbjct  27   QQNECQIQRLNALKPGNRIESEGGFIETWNPNNKPFQCAG  66



>ref|XP_002524606.1| legumin A precursor, putative [Ricinus communis]
 gb|EEF37814.1| legumin A precursor, putative [Ricinus communis]
Length=478

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQL+ +NA EP + I +E G  E W+PN +QFQC G
Sbjct  28   QQNECQLNRLNAFEPDNRIQSEAGTIESWNPNHDQFQCAG  67



>dbj|BAC55937.1| glycinin A1bB2-445 [Glycine max]
Length=481

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG+ E W+PN++ FQC G
Sbjct  27   QQNECQIQRLNALKPGNRIESEGGFIETWNPNNKPFQCAG  66



>pir||S11003 glycinin G3 precursor - soybean
 gb|AAB23211.1| glycinin G3 subunit [soybeans, Peptide, 484 aa]
Length=484

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG+ E W+PN++ FQC G
Sbjct  27   QQNECQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAG  66



>ref|XP_002524604.1| legumin A precursor, putative [Ricinus communis]
 gb|EEF37812.1| legumin A precursor, putative [Ricinus communis]
Length=475

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NEC++  INA EP S I +E G  E WDPN +QF+C G
Sbjct  29   QQNECRIDRINAREPDSRIQSEAGTIESWDPNHDQFRCAG  68



>gb|KHN10744.1| Glycinin G1 [Glycine soja]
Length=496

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG+ E W+PN++ FQC G
Sbjct  27   QQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAG  66



>ref|XP_002524605.1| legumin A precursor, putative [Ricinus communis]
 gb|EEF37813.1| legumin A precursor, putative [Ricinus communis]
Length=508

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQL+ +NA EP + I +E G  E W+PN +QFQC G
Sbjct  58   QQNECQLNRLNAFEPDNRIQSEAGTIESWNPNHDQFQCAG  97



>gb|KDP40339.1| hypothetical protein JCGZ_02337 [Jatropha curcas]
Length=448

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +Q ++C+L ++NA EP+ +  +E G TE WD NDEQFQC G
Sbjct  42   AQQDQCRLDNLNAAEPSRSFQSEAGVTEVWDENDEQFQCTG  82



>gb|ABK80751.1| 11S globulin precursor isoform 1A [Ficus pumila var. awkeotsang]
Length=510

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + NECQ  ++ ALEP + I AE G  E WDP+ EQFQC G
Sbjct  37   RQNECQFDNLQALEPDTRIQAEAGLIESWDPDHEQFQCAG  76



>gb|AIA57958.1| beta-globulin B2 [Jatropha curcas]
Length=478

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +Q ++C+L ++NA EP+ +  +E G TE WD NDEQFQC G
Sbjct  42   AQQDQCRLDNLNAAEPSRSFQSEAGVTEVWDENDEQFQCTG  82



>ref|XP_010097607.1| Legumin A [Morus notabilis]
 gb|EXC43199.1| Legumin A [Morus notabilis]
Length=480

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + NECQ   + ALEP S I AE G  E W+PN +QFQC G
Sbjct  80   RQNECQFDRLQALEPDSRIKAEAGVIESWNPNHDQFQCAG  119



>pdb|1UD1|A Chain A, Crystal Structure Of Proglycinin Mutant C88s
 pdb|1UD1|B Chain B, Crystal Structure Of Proglycinin Mutant C88s
 pdb|1UD1|C Chain C, Crystal Structure Of Proglycinin Mutant C88s
Length=476

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG  E W+PN++ FQC G
Sbjct  8    QQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAG  47



>pdb|1FXZ|A Chain A, Crystal Structure Of Soybean Proglycinin A1ab1b Homotrimer
 pdb|1FXZ|B Chain B, Crystal Structure Of Soybean Proglycinin A1ab1b Homotrimer
 pdb|1FXZ|C Chain C, Crystal Structure Of Soybean Proglycinin A1ab1b Homotrimer
Length=476

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG  E W+PN++ FQC G
Sbjct  8    QQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAG  47



>ref|XP_011004057.1| PREDICTED: legumin A-like [Populus euphratica]
Length=480

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +CQL  +NAL+P + I +E G TE WDPN +QFQC G
Sbjct  37   QCQLDRLNALKPGNRIKSEAGETESWDPNHDQFQCAG  73



>gb|ACT53401.1| mutant glycinin subunit A1aB1b [Glycine max]
Length=386

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG  E W+PN++ FQC G
Sbjct  27   QQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAG  66



>sp|P04776.2|GLYG1_SOYBN RecName: Full=Glycinin G1; Contains: RecName: Full=Glycinin A1a 
subunit; Contains: RecName: Full=Glycinin Bx subunit; Flags: 
Precursor [Glycine max]
 emb|CAA33215.1| glycinin subunit G1 [Glycine max]
 gb|AAA33966.1| glycinin A-1a-B-x subunit [Glycine max]
 gb|AAB23209.1| glycinin G1 subunit [soybeans, Peptide, 495 aa]
 dbj|BAC78522.1| proglycinin A1aB1b subunit [Glycine max]
Length=495

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG  E W+PN++ FQC G
Sbjct  27   QQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAG  66



>ref|XP_002307645.2| legumin family protein [Populus trichocarpa]
 gb|EEE94641.2| legumin family protein [Populus trichocarpa]
Length=479

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +CQL  +NAL+P + I +E G TE WDPN +QFQC G
Sbjct  37   QCQLDRLNALKPGNRIKSEAGETESWDPNHDQFQCAG  73



>gb|ACT53400.1| mutant glycinin subunit A1aB1b [Glycine max]
Length=386

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG  E W+PN++ FQC G
Sbjct  27   QQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAG  66



>prf||1309256A Glycinin A1aBx
Length=495

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG  E W+PN++ FQC G
Sbjct  27   QQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAG  66



>ref|XP_009766463.1| PREDICTED: 11S globulin seed storage protein 2-like [Nicotiana 
sylvestris]
Length=489

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +C+L+ + A +PT+ I +EGG TE WD N+EQFQC G
Sbjct  47   QCRLTRLTASQPTNRIESEGGVTELWDENEEQFQCAG  83



>ref|XP_004152050.1| PREDICTED: legumin A-like [Cucumis sativus]
Length=479

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+  EC+L  ++ALEP+  I AEGG  E WDP+ E F+C G
Sbjct  40   SRYRECRLDRLDALEPSRRIEAEGGIIEMWDPSHEMFRCAG  80



>ref|XP_004162393.1| PREDICTED: legumin J-like [Cucumis sativus]
Length=353

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+  EC+L  + ALEP+  I AEGG  E WDP+ E F+C G
Sbjct  40   SRYRECRLDMLEALEPSRRIEAEGGVIEMWDPSHEMFRCAG  80



>ref|NP_001235827.1| glycinin G1 precursor [Glycine max]
 emb|CAA26723.1| unnamed protein product [Glycine max]
Length=495

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ+  +NAL+P + I +EGG  E W+PN++ FQC G
Sbjct  27   QQNECQIQKLNALKPGNRIESEGGLIETWNPNNKPFQCAG  66



>ref|XP_009624040.1| PREDICTED: 11S globulin seed storage protein 2-like [Nicotiana 
tomentosiformis]
Length=490

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ++  +C+L+ + A +PT+ I +EGG TE WD N+EQFQC G
Sbjct  43   TEAQQCRLTRLTASQPTNRIESEGGVTELWDENEEQFQCAG  83



>ref|XP_009624045.1| PREDICTED: 11S globulin seed storage protein 2-like [Nicotiana 
tomentosiformis]
Length=488

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +C+L+ + A +PT+ I +EGG TE WD N+EQFQC G
Sbjct  45   QCRLTRLTASQPTNRIESEGGVTELWDENEEQFQCAG  81



>ref|XP_009761684.1| PREDICTED: 11S globulin seed storage protein 2-like [Nicotiana 
sylvestris]
Length=489

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ++  +C+L+ + A +PT+ I +EGG TE WD N+EQFQC G
Sbjct  43   TEAQQCRLTRLTASQPTNRIESEGGVTELWDENEEQFQCAG  83



>gb|KGN57905.1| hypothetical protein Csa_3G384800 [Cucumis sativus]
Length=501

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+  EC+L  ++ALEP+  I AEGG  E WDP+ E F+C G
Sbjct  40   SRYRECRLDRLDALEPSRRIEAEGGIIEMWDPSHEMFRCAG  80



>gb|ACB55490.1| Pis v 5.0101 allergen 11S globulin precusor [Pistacia vera]
Length=473

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQ+  ++ALEP + +  E G  E WDPN EQF+C G
Sbjct  31   NECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAG  68



>gb|AAF05770.1|AF193433_1 glutelin [Elaeis guineensis]
Length=368

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S  NEC++  +NALEPT  + +E G T+++D ++EQF+C G
Sbjct  40   STRNECRIERLNALEPTRTVRSEAGMTDYFDEDNEQFRCAG  80



>gb|ABW86979.1| 11S legumin protein [Carya illinoinensis]
Length=505

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +CQL+ ++ALEPT+ I AE G  E WDPN +Q QC G
Sbjct  36   QCQLNRLDALEPTNRIEAEAGVIESWDPNHQQLQCAG  72



>ref|XP_004167380.1| PREDICTED: legumin A-like, partial [Cucumis sativus]
Length=222

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+  EC+L  ++ALEP+  I AEGG  E WDP+ E F+C G
Sbjct  40   SRYRECRLDRLDALEPSRRIEAEGGIIEMWDPSHEMFRCAG  80



>ref|XP_008447425.1| PREDICTED: legumin A-like [Cucumis melo]
Length=500

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+  EC+L  ++ALEP+  I AEGG  E WDP+ E F+C G
Sbjct  39   SRYRECRLDRLDALEPSRRIEAEGGVIEMWDPSHEMFRCAG  79



>ref|XP_004141669.1| PREDICTED: LOW QUALITY PROTEIN: 11S globulin subunit beta-like 
[Cucumis sativus]
Length=475

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            C L ++ A EP   I AE G+TE W+PN+E+FQC G
Sbjct  49   CHLENLRAEEPARRIEAEAGYTELWEPNNEEFQCAG  84



>ref|XP_008462393.1| PREDICTED: legumin B-like [Cucumis melo]
Length=476

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            C L ++ A EP   I AE G+TE W+PN+E+FQC G
Sbjct  49   CHLENLRAEEPARRIEAEAGYTELWEPNNEEFQCAG  84



>gb|ABW86978.1| 11S legumin protein [Carya illinoinensis]
Length=505

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +CQL+ ++ALEPT+ I AE G  E WDPN +Q QC G
Sbjct  36   QCQLNRLDALEPTNRIEAEAGVIESWDPNHQQLQCAG  72



>gb|KGN45554.1| hypothetical protein Csa_7G452090 [Cucumis sativus]
Length=476

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            C L ++ A EP   I AE G+TE W+PN+E+FQC G
Sbjct  49   CHLENLRAEEPARRIEAEAGYTELWEPNNEEFQCAG  84



>ref|XP_004155945.1| PREDICTED: 11S globulin subunit beta-like [Cucumis sativus]
Length=476

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            C L ++ A EP   I AE G+TE W+PN+E+FQC G
Sbjct  49   CHLENLRAEEPARRIEAEAGYTELWEPNNEEFQCAG  84



>ref|XP_009761685.1| PREDICTED: legumin A-like [Nicotiana sylvestris]
Length=473

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQL+ ++  EPT+ I AE G TE WD N++QFQC G
Sbjct  31   ECQLNRLSPQEPTTRIQAEAGVTELWDQNNQQFQCAG  67



>ref|XP_009624041.1| PREDICTED: legumin A-like [Nicotiana tomentosiformis]
Length=473

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQL+ ++  EPT+ I AE G TE WD N++QFQC G
Sbjct  31   ECQLNRLSPQEPTTRIQAEAGVTELWDQNNQQFQCAG  67



>gb|EYU46455.1| hypothetical protein MIMGU_mgv1a005708mg [Erythranthe guttata]
Length=473

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q  ECQ+ +INA EP+ +I AE G T+FWD  +++FQC G
Sbjct  29   QKGECQIGNINAQEPSYSIRAEAGETQFWDFKNDEFQCAG  68



>gb|AAN76862.1|AF453947_1 allergen Ana o 2 [Anacardium occidentale]
Length=457

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q +ECQ+  ++ALEP + +  E G  E WDPN EQF+C G
Sbjct  21   QQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAG  60



>emb|CDP79024.1| edestin 1 [Cannabis sativa]
Length=511

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q N+CQ+  I A EP + + AE G  E W+PN  QFQC G
Sbjct  38   QQNQCQIDRIEAREPDTRVEAEAGLIESWNPNHNQFQCAG  77



>ref|XP_010111924.1| Legumin A [Morus notabilis]
 gb|EXC31958.1| Legumin A [Morus notabilis]
Length=490

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + NECQL  + A EP   + +EGG  E W+PN EQFQC G
Sbjct  31   RQNECQLDRLEAREPDHRVQSEGGLFESWNPNHEQFQCAG  70



>emb|CDP79023.1| edestin 1 [Cannabis sativa]
 emb|CDP79025.1| edestin 1 [Cannabis sativa]
Length=511

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q N+CQ+  I A EP + + AE G  E W+PN  QFQC G
Sbjct  38   QQNQCQIDRIEAREPDTRVEAEAGLIESWNPNHNQFQCAG  77



>emb|CDP79026.1| edestin 1 [Cannabis sativa]
Length=511

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q N+CQ+  I A EP + + AE G  E W+PN  QFQC G
Sbjct  38   QQNQCQIDRIEAREPDTRVEAEAGLIESWNPNHSQFQCAG  77



>ref|XP_009783514.1| PREDICTED: 11S globulin seed storage protein 2-like [Nicotiana 
sylvestris]
Length=489

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +C+L+ + A +PT+ I +EGG TE WD N+EQFQC G
Sbjct  47   QCRLTRLTASQPTNRIESEGGVTELWDENEEQFQCAG  83



>gb|AEO27678.1| seed storage protein legumin B, partial [Gossypium herbaceum]
Length=494

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            CQ+ ++NAL+P     +E G TEFWD N+EQFQC G
Sbjct  33   CQIQNLNALQPKHRFRSEAGETEFWDQNEEQFQCAG  68



>gb|AAT39430.1| glycinin, partial [Arachis hypogaea]
Length=510

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQ   +NA  P + I +EGG+ E W+PN+++FQC G
Sbjct  28   NECQFQRLNAQRPDNRIESEGGYIETWNPNNQEFQCAG  65



>gb|ADQ53859.1| Ara h 3 allergen [Arachis hypogaea]
Length=512

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQ   +NA  P + I +EGG+ E W+PN+++FQC G
Sbjct  30   NECQFQRLNAQRPDNRIESEGGYIETWNPNNQEFQCAG  67



>gb|ABI17154.1| iso-Ara h3 [Arachis hypogaea]
Length=512

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQ   +NA  P + I +EGG+ E W+PN+++FQC G
Sbjct  30   NECQFQRLNAQRPDNRIESEGGYIETWNPNNQEFQCAG  67



>ref|NP_001291327.1| legumin B-like precursor [Sesamum indicum]
 gb|ABB60054.1| 11S globulin precursor isoform 3 [Sesamum indicum]
Length=491

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    NNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
              ECQ+  + A +P+S + +E G TEFWD N+E+FQC G
Sbjct  47   KTECQVQQLTARQPSSRLQSEAGVTEFWDANNEEFQCAG  85



>ref|XP_002524195.1| legumin B precursor, putative [Ricinus communis]
 gb|EEF38210.1| legumin B precursor, putative [Ricinus communis]
Length=476

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q N CQL+ + ALEP   I  E G  E W+PN +QFQC G
Sbjct  29   QGNGCQLNKLYALEPDKRIQTEAGLVESWNPNRDQFQCAG  68



>emb|CAA64761.1| legumin-like protein [Asarum europaeum]
Length=458

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ++C++ H++A  P+  I +EGG TE W+ N+EQFQC G
Sbjct  37   HQCRIQHLSASRPSQRIESEGGVTELWNQNEEQFQCAG  74



>ref|XP_006351693.1| PREDICTED: 11S globulin seed storage protein 2-like [Solanum 
tuberosum]
Length=477

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +Q  +C+L  +   +P+  I +EGG+TE WD N+EQFQC G
Sbjct  39   TQAQQCRLQRLTGSQPSDRIESEGGFTELWDENEEQFQCAG  79



>emb|CAA47808.1| minor legumin [Pisum sativum]
Length=139

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL +INALEP   + +E G TE W+PN+ + +C G
Sbjct  31   NQCQLDNINALEPDHRVESEAGLTETWNPNNPELKCAG  68



>ref|XP_008353191.1| PREDICTED: LOW QUALITY PROTEIN: legumin type B-like, partial 
[Malus domestica]
Length=433

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQ + + + EP + I +E G TE W+PND+QFQC G
Sbjct  29   NECQFNQLQSREPDNQIQSEAGLTESWNPNDQQFQCAG  66



>gb|ABK80752.1| 11S globulin precursor isoform 1B [Ficus pumila var. awkeotsang]
Length=508

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQ  ++ ALEP + I AE G  E W+P+ EQFQC G
Sbjct  41   NECQFDNLQALEPDTRIQAEAGLIESWNPDHEQFQCAG  78



>gb|AEO27680.1| seed storage protein legumin B, partial [Gossypium hirsutum]
Length=494

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            CQL ++NAL+P     +E G TEFWD N++QFQC G
Sbjct  33   CQLQNLNALQPKHRFRSEAGETEFWDQNEDQFQCAG  68



>sp|P09800.1|LEGB_GOSHI RecName: Full=Legumin B; AltName: Full=Beta-globulin B; AltName: 
Full=LEGB-C134; Contains: RecName: Full=Legumin B acidic 
chain; Contains: RecName: Full=Legumin B basic chain; Flags: 
Precursor [Gossypium hirsutum]
 gb|AAA33070.1| vicilin precursor [Gossypium hirsutum]
 gb|AAD09844.1| legumin B [Gossypium hirsutum]
 prf||1306412C storage protein C134
Length=516

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            CQL ++NAL+P     +E G TEFWD N++QFQC G
Sbjct  50   CQLQNLNALQPKHRFRSEAGETEFWDQNEDQFQCAG  85



>gb|ABK92181.1| 11S seed storage globulin precursor B2 [Arachis hypogaea]
Length=277

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            EC+L H++ +EPT  + +EGG  EFWD   +Q QC G
Sbjct  32   ECRLEHLSVMEPTKRVESEGGVAEFWDDKSQQLQCIG  68



>ref|XP_010279433.1| PREDICTED: legumin A-like [Nelumbo nucifera]
Length=645

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q +ECQ+++++ALEP+  I AE G  E WD N+EQF+C G
Sbjct  46   QQSECQINNLDALEPSRRIEAEAGRLEIWDGNNEQFRCAG  85



>ref|XP_004152049.1| PREDICTED: 11S globulin subunit beta-like [Cucumis sativus]
 gb|KGN57907.1| hypothetical protein Csa_3G386310 [Cucumis sativus]
Length=494

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+  EC+L  + ALEP+  I AEGG  E WDP+ E F+C G
Sbjct  40   SRYRECRLDMLEALEPSRRIEAEGGVIEMWDPSHEMFRCAG  80



>ref|XP_010671027.1| PREDICTED: legumin B-like [Beta vulgaris subsp. vulgaris]
Length=516

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQ-FQCGG  124
            N+CQ++ ++A EPT  + AE G TE WDPND+Q FQC G
Sbjct  56   NDCQINQLSAAEPTIRLQAEAGVTEIWDPNDQQEFQCVG  94



>emb|CAR78996.1| legumin storage protein 5 [Lotus japonicus]
Length=476

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NAL+P + I +E G+ E W+P + QF+C G
Sbjct  31   NECQLERLNALKPDNRIESEAGYIETWNPTNNQFRCAG  68



>gb|AEB33709.1| conglutin alpha 1 [Lupinus angustifolius]
Length=506

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NECQ   +NALEP +++ +E G  E W+PN++Q +C G
Sbjct  27   QQNECQFQRLNALEPDNSVKSEAGTIETWNPNNDQLRCAG  66



>gb|AEO27681.1| seed storage protein legumin B, partial [Gossypium raimondii]
Length=494

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            CQL ++NAL+P     +E G TEFWD N++QFQC G
Sbjct  33   CQLQNLNALQPKHRFRSEAGETEFWDQNEDQFQCAG  68



>ref|XP_009354982.1| PREDICTED: legumin type B-like [Pyrus x bretschneideri]
Length=516

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQ   + + EP + I +E G TE W+PND+QFQC G
Sbjct  29   NECQFDQLQSREPDNQIQSEAGLTESWNPNDQQFQCAG  66



>gb|AAL73404.1|AF449424_1 11S globulin-like protein [Corylus avellana]
Length=515

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            EC L  +NALEPT+ I AE    E WD ND+QFQC G
Sbjct  37   ECNLDRLNALEPTNRIEAEACQIESWDHNDQQFQCAG  73



>gb|EPS62256.1| hypothetical protein M569_12535, partial [Genlisea aurea]
Length=476

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q  EC++  I   EPT    AEGG TEFWD N+++F+C G
Sbjct  12   QQGECRIDRIETREPTYRFEAEGGVTEFWDHNEQEFRCAG  51



>ref|XP_008372197.1| PREDICTED: LOW QUALITY PROTEIN: legumin A-like [Malus domestica]
Length=455

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQ + + + EP + I  E G TE W+PND+QFQC G
Sbjct  29   NECQFNQLQSREPDNQIQXEAGLTESWNPNDQQFQCAG  66



>sp|Q647H2.1|AHY3_ARAHY RecName: Full=Arachin Ahy-3; Contains: RecName: Full=Arachin 
Ahy-3 chain alpha; Contains: RecName: Full=Arachin Ahy-3 chain 
beta; Flags: Precursor [Arachis hypogaea]
 gb|AAU21492.1| arachin Ahy-3 [Arachis hypogaea]
Length=484

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQ   +NA  P + I +EGG+ E W+PN+++FQC G
Sbjct  30   NECQFQRLNAQRPDNCIESEGGYIETWNPNNQEFQCAG  67



>ref|XP_010045998.1| PREDICTED: legumin A-like [Eucalyptus grandis]
 gb|KCW84737.1| hypothetical protein EUGRSUZ_B01551 [Eucalyptus grandis]
Length=503

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            EC++  ++ALEPT+ I  E G  E WDPN E FQC G
Sbjct  39   ECRIDRLDALEPTNRIQCEAGVVESWDPNHEMFQCAG  75



>ref|XP_010326169.1| PREDICTED: LOW QUALITY PROTEIN: 11S globulin seed storage protein 
2-like [Solanum lycopersicum]
Length=478

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +Q  +C+L  I   +P+  I +EGG++E WD N+EQFQC G
Sbjct  39   TQAQQCRLQRIAGCQPSDRIESEGGFSELWDENEEQFQCAG  79



>ref|XP_006351695.1| PREDICTED: 11S globulin seed storage protein 2-like [Solanum 
tuberosum]
Length=481

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +Q  +C+L  +   +P+  I +EGG+TE WD N+EQFQC G
Sbjct  42   TQAQQCRLQRLTGSQPSQRIESEGGFTELWDENEEQFQCVG  82



>ref|XP_009603583.1| PREDICTED: 11S globulin subunit beta-like [Nicotiana tomentosiformis]
Length=521

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            EC++  +NA EPT    +E G TEFWD N+E+F+C G
Sbjct  49   ECRIQSLNAREPTYKFDSEAGTTEFWDRNNEEFECAG  85



>emb|CDY68429.1| BnaCnng58970D, partial [Brassica napus]
Length=119

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  + AE G  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSG  65



>ref|XP_002532028.1| legumin A precursor, putative [Ricinus communis]
 gb|EEF30344.1| legumin A precursor, putative [Ricinus communis]
Length=461

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  ++ALEP + I  + G  E W+PN  QFQC G
Sbjct  26   NECQLDRLDALEPDNRIQCDAGMVEVWNPNHGQFQCAG  63



>emb|CAA32455.1| storage protein [Vicia faba var. minor]
Length=308

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL +INALEP   + +EGG TE W+PN  + +C G
Sbjct  31   NQCQLDNINALEPDHRVESEGGLTETWNPNHPELRCTG  68



>dbj|BAJ78781.1| cruciferin storage protein [Brassica rapa]
Length=94

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  + AE G  E WD +  Q +C G
Sbjct  15   NECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSG  52



>emb|CAA70334.1| pre-pro-legumin [Sagittaria sagittifolia]
Length=794

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +2

Query  5    QNNEC-QLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q+ EC +L  +NALEP+  + +EGG++EFWD N++Q QC G
Sbjct  31   QSEECARLDRLNALEPSMQVQSEGGFSEFWDQNEDQLQCAG  71



>ref|XP_011026325.1| PREDICTED: 11S globulin seed storage protein 2-like [Populus 
euphratica]
Length=195

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+  +CQL  I+  +P+  + ++GG TE WDP ++QFQC G
Sbjct  26   SEAQQCQLRKISTSKPSHRMRSQGGVTEIWDPEEDQFQCAG  66



>gb|ABK92180.1| 11S seed storage globulin precursor B1 [Arachis hypogaea]
Length=305

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
             +C    + ALEPT  + +EGG+TE+WD  ++QFQC G
Sbjct  27   TKCSFDKLVALEPTKRVESEGGFTEYWDSKNDQFQCVG  64



>ref|XP_004247523.1| PREDICTED: 11S globulin seed storage protein 2-like [Solanum 
lycopersicum]
Length=481

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +Q  +C+L  +   +P+  I +EGG+TE WD N+EQFQC G
Sbjct  42   TQAQQCRLQRLTGSQPSQRIESEGGYTEVWDENEEQFQCVG  82



>ref|XP_004493872.1| PREDICTED: glycinin G4-like [Cicer arietinum]
Length=541

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+ NECQL  I+ALEP + I +E G TE WD N  + +C G
Sbjct  35   SEFNECQLDSIDALEPDNRIESEAGLTEIWDANHPELRCAG  75



>emb|CAA81262.1| legumin; legumin-related high molecular weight polypeptide [Vicia 
faba var. minor]
Length=564

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL  INALEP   + +E G TE W+PN  + QC G
Sbjct  29   NKCQLDSINALEPDHRVESEAGLTETWNPNHPELQCAG  66



>emb|CAA81285.1| legumin; legumin-related high molecular weight polypeptide [Vicia 
faba var. minor]
Length=126

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL  INALEP   + ++ G TE W+PN  + QC G
Sbjct  29   NKCQLDSINALEPDHRVESQAGLTETWNPNHPELQCAG  66



>gb|KDP26533.1| hypothetical protein JCGZ_17691 [Jatropha curcas]
Length=472

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/41 (44%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ++  +C L  I   +P+  I +EGG TE WDP+++QFQC G
Sbjct  30   TEAQQCHLQRITTTQPSHRIDSEGGETEIWDPSEDQFQCAG  70



>gb|AEO27679.1| seed storage protein legumin B, partial [Gossypium arboreum]
Length=494

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            CQ+ ++N L+P     +E G TEFWD N+EQFQC G
Sbjct  33   CQIQNLNTLQPKHRFRSEAGETEFWDQNEEQFQCAG  68



>ref|XP_008447426.1| PREDICTED: legumin A-like [Cucumis melo]
Length=496

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+  EC+L  + A+EP+  I AEGG  E WDP+ E F+C G
Sbjct  41   SRYRECRLDKLEAVEPSRRIEAEGGVIEMWDPSHEMFRCAG  81



>ref|XP_002278201.1| PREDICTED: cruciferin CRU1-like [Vitis vinifera]
Length=508

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q  EC++S +NA  P++ I +E G TE +D N+EQFQC G
Sbjct  27   QQKECRISRLNAQRPSNRIQSEAGVTEVFDHNNEQFQCAG  66



>gb|KHG07690.1| Legumin B [Gossypium arboreum]
Length=516

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            CQ+ ++N L+P     +E G TEFWD N+EQFQC G
Sbjct  50   CQIQNLNTLQPKHRFRSEAGETEFWDQNEEQFQCAG  85



>ref|XP_009777915.1| PREDICTED: 11S globulin subunit beta-like [Nicotiana sylvestris]
Length=518

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            EC++  +NA EPT    +E G TEFWD N+E+F+C G
Sbjct  49   ECRIQSLNAREPTYKFDSEAGTTEFWDRNNEEFECAG  85



>ref|XP_010253026.1| PREDICTED: glutelin type-A 1-like [Nelumbo nucifera]
Length=359

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + N C++ +++ALEPT    AE G+ E WD N+ QFQC G
Sbjct  176  EQNRCRVENLDALEPTRRREAEAGFVEEWDENNNQFQCAG  215



>pir||S26688 legumin K - garden pea
Length=500

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL +INALEP   + +E G TE W+PN+ + +C G
Sbjct  31   NQCQLDNINALEPDHRVESEAGLTETWNPNNPELKCAG  68



>gb|KFK31664.1| hypothetical protein AALP_AA6G142800 [Arabis alpina]
Length=518

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEPT  + +EGG  E WD +  Q +C G
Sbjct  45   NECQLDQLNALEPTHVLKSEGGRIEVWDHHAPQLRCSG  82



>ref|XP_010928048.1| PREDICTED: glutelin type-A 3-like [Elaeis guineensis]
Length=442

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            EC+L  +NAL+PT  + +E G TE++D  D+Q QC G
Sbjct  27   ECRLDRLNALQPTRRVESEAGVTEYFDEKDDQLQCAG  63



>ref|XP_009405244.1| PREDICTED: glutelin type-A 2-like [Musa acuminata subsp. malaccensis]
Length=468

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + C++  ++ALEPT  +P+E G+TE+ D N EQF+C G
Sbjct  41   SRCRIERLSALEPTMRVPSEAGFTEYVDQNHEQFRCAG  78



>gb|AAF19607.1| legumin-like protein [Perilla frutescens]
Length=471

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+N +C++  I+A++P   I +EGG TE WD  + QFQC G
Sbjct  35   SRNQQCRIQRISAVQPHHQIQSEGGLTELWDEMEAQFQCAG  75



>ref|XP_004495101.1| PREDICTED: legumin J-like isoform X2 [Cicer arietinum]
Length=502

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL  INALEP   + +E G TE W+PN  + QC G
Sbjct  34   NQCQLDSINALEPDHRVESEAGLTETWNPNHPELQCAG  71



>ref|XP_009603582.1| PREDICTED: 11S globulin subunit beta-like [Nicotiana tomentosiformis]
Length=496

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQ+  +NA EPT    +E G  EFWD   EQF+C G
Sbjct  51   ECQIERLNAQEPTRRFESEAGVIEFWDATHEQFECAG  87



>emb|CBI37121.3| unnamed protein product [Vitis vinifera]
Length=461

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q  EC++S +NA  P++ I +E G TE +D N+EQFQC G
Sbjct  27   QQKECRISRLNAQRPSNRIQSEAGVTEVFDHNNEQFQCAG  66



>ref|XP_006354542.1| PREDICTED: legumin B-like [Solanum tuberosum]
Length=489

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +C++S +NA EPT    +E G TEFWD N E+F+C G
Sbjct  26   DCRISSLNAREPTYKFNSEAGTTEFWDRNSEEFECAG  62



>ref|XP_004495100.1| PREDICTED: legumin J-like isoform X1 [Cicer arietinum]
Length=532

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL  INALEP   + +E G TE W+PN  + QC G
Sbjct  34   NQCQLDSINALEPDHRVESEAGLTETWNPNHPELQCAG  71



>ref|XP_006480087.1| PREDICTED: LOW QUALITY PROTEIN: legumin A-like [Citrus sinensis]
Length=436

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q N+CQ++++ ALEP + +  E G  E WDP  EQFQC G
Sbjct  31   QPNDCQINNLEALEPNNRVECEAGVVETWDPGHEQFQCAG  70



>ref|XP_008805230.1| PREDICTED: LOW QUALITY PROTEIN: glutelin type-A 3-like [Phoenix 
dactylifera]
Length=470

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + +EC++  +NALEPT  + +E G TE++D N+ QF+C G
Sbjct  39   EQSECRVEKLNALEPTREVRSEAGVTEYYDQNNAQFECAG  78



>ref|XP_006443837.1| hypothetical protein CICLE_v10023766mg [Citrus clementina]
 gb|ESR57077.1| hypothetical protein CICLE_v10023766mg [Citrus clementina]
Length=434

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q N+CQ++++ ALEP + +  E G  E WDP  EQFQC G
Sbjct  31   QPNDCQINNLEALEPNNRVECEAGVVETWDPGHEQFQCAG  70



>ref|XP_010262323.1| PREDICTED: glutelin type-B 5-like [Nelumbo nucifera]
Length=473

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
             ECQL   +ALEP++ I +EGG TE+W+ N++Q  C G
Sbjct  46   RECQLQDFSALEPSTRIESEGGVTEYWEENNQQLNCAG  83



>gb|KDO60493.1| hypothetical protein CISIN_1g046186mg [Citrus sinensis]
Length=436

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q N+CQ++++ ALEP + +  E G  E WDP  EQFQC G
Sbjct  27   QPNDCQINNLEALEPNNRVECEAGVVETWDPGHEQFQCAG  66



>ref|XP_010928127.1| PREDICTED: glutelin type-A 1-like [Elaeis guineensis]
Length=560

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            EC+L  +NAL+PT  + +E G TE++D  D+Q QC G
Sbjct  145  ECRLDRLNALQPTRRVESEAGVTEYFDEKDDQLQCAG  181



>gb|AAW29810.1| seed storage protein [Juglans regia]
Length=507

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  23   LSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            L+ ++ALEPT+ I AE G  E WDPN++QFQC G
Sbjct  38   LNRLDALEPTNRIEAEAGVIESWDPNNQQFQCAG  71



>ref|XP_002278346.1| PREDICTED: legumin A-like [Vitis vinifera]
Length=500

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NEC +S + A +P++ I +E G TE +D N+EQFQC G
Sbjct  28   QQNECSISRLTAQKPSNRIQSEAGVTEVFDHNNEQFQCAG  67



>ref|XP_010262494.1| PREDICTED: legumin B-like [Nelumbo nucifera]
Length=347

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQL   +ALEP + I +EGG TE+W+ N++Q +C G
Sbjct  47   ECQLQDFSALEPNTRIESEGGTTEYWEENNQQLKCAG  83



>ref|XP_006279080.1| hypothetical protein CARUB_v100127390mg, partial [Capsella rubella]
 gb|EOA11978.1| hypothetical protein CARUB_v100127390mg, partial [Capsella rubella]
Length=94

 Score = 45.4 bits (106),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  + +E G  E WD +  Q +C G
Sbjct  28   NECQLEQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSG  65



>ref|XP_010046000.1| PREDICTED: 11S globulin seed storage protein 2-like [Eucalyptus 
grandis]
 gb|KCW84739.1| hypothetical protein EUGRSUZ_B01553 [Eucalyptus grandis]
Length=491

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S+  +C+L  I A +P   I +EGG TE W  +DEQFQC G
Sbjct  31   SEAQQCRLQRIRATQPDERIESEGGVTELWSEDDEQFQCAG  71



>ref|XP_010555095.1| PREDICTED: cruciferin PGCRURSE5 [Tarenaya hassleriana]
Length=472

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    NNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
             NEC+L +++ALEPT  IP E G  E+WD    Q +C G
Sbjct  32   RNECELDNLDALEPTDTIPCEAGRIEYWDHTHPQLRCAG  70



>gb|AIA57957.1| beta-globulin B1 [Jatropha curcas]
Length=508

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            SQ + C+   INA+EP+  I +E G T+ WD ND+QF+C G
Sbjct  42   SQQDACRHECINAVEPSRRIQSEAGVTDIWDENDKQFRCAG  82



>ref|XP_010940966.1| PREDICTED: glutelin type-A 3-like [Elaeis guineensis]
Length=347

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S   EC++  +NALEPT  + +E G T+++D ++EQF+C G
Sbjct  40   STRKECRIEKLNALEPTRTVRSEAGITDYFDEDNEQFRCAG  80



>ref|XP_010253028.1| PREDICTED: legumin B-like [Nelumbo nucifera]
Length=374

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQ+  ++ALEP + I +EGG TE+W+ N++Q +C G
Sbjct  47   ECQVQDLSALEPNTRIESEGGVTEYWEENNQQLKCAG  83



>gb|EYU18320.1| hypothetical protein MIMGU_mgv1a008983mg [Erythranthe guttata]
Length=356

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    NNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
              +C++  + A EPT  + +E G TEFWD N++QFQC G
Sbjct  47   RTDCRVDRLTAQEPTIRLDSEAGRTEFWDRNNQQFQCAG  85



>ref|XP_009763876.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=496

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQ+  +NA EPT    +E G  EFWD   EQF+C G
Sbjct  51   ECQIERLNAQEPTRRFESEAGVIEFWDATHEQFECAG  87



>emb|CAA47809.1| legumin (minor small) [Pisum sativum]
Length=566

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL  INALEP   + +E G TE W+PN  + +C G
Sbjct  31   NQCQLDTINALEPDHRVESEAGLTETWNPNHPELKCAG  68



>ref|XP_003590691.1| Legumin [Medicago truncatula]
Length=451

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL++INALEP   +  E G TE W+PN  + QC G
Sbjct  29   NQCQLNNINALEPDHRVEHEAGLTETWNPNHPELQCAG  66



>gb|KGN61596.1| hypothetical protein Csa_2G174130 [Cucumis sativus]
Length=487

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            C L ++ A +P   I AEGG+TE W+PN E+ QC G
Sbjct  63   CHLENLRAQDPVRRIEAEGGFTELWEPNSEELQCAG  98



>ref|XP_003590689.1| Legumin [Medicago truncatula]
 gb|AES60940.1| legumin storage protein [Medicago truncatula]
Length=569

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL++INALEP   +  E G TE W+PN  + QC G
Sbjct  29   NQCQLNNINALEPDHRVEHEAGLTETWNPNHPELQCAG  66



>gb|KDO57580.1| hypothetical protein CISIN_1g048197mg [Citrus sinensis]
Length=480

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQC  118
            C +  +NALEP   + +E G TEFWD NDEQ QC
Sbjct  45   CNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQC  78



>ref|XP_003590690.1| Legumin [Medicago truncatula]
Length=554

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL++INALEP   +  E G TE W+PN  + QC G
Sbjct  29   NQCQLNNINALEPDHRVEHEAGLTETWNPNHPELQCAG  66



>ref|XP_003590687.1| Legumin B [Medicago truncatula]
Length=552

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL++INALEP   +  E G TE W+PN  + QC G
Sbjct  29   NQCQLNNINALEPDHRVEHEAGLTETWNPNHPELQCAG  66



>gb|EYU46456.1| hypothetical protein MIMGU_mgv1a005966mg [Erythranthe guttata]
Length=463

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S   +C+   + A +PT  I +EGG TE WD N  QFQC G
Sbjct  31   SDQQQCRFQRLTAAQPTQRIESEGGTTELWDENHHQFQCAG  71



>ref|XP_003590686.1| Legumin B [Medicago truncatula]
 gb|AES60937.1| glycinin G4 [Medicago truncatula]
Length=553

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL++INALEP   +  E G TE W+PN  + QC G
Sbjct  29   NQCQLNNINALEPDHRVEHEAGLTETWNPNHPELQCAG  66



>pdb|1UCX|A Chain A, Crystal Structure Of Proglycinin C12g Mutant
 pdb|1UCX|B Chain B, Crystal Structure Of Proglycinin C12g Mutant
 pdb|1UCX|C Chain C, Crystal Structure Of Proglycinin C12g Mutant
Length=476

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q NE Q+  +NAL+P + I +EGG  E W+PN++ FQC G
Sbjct  8    QQNEGQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAG  47



>ref|XP_009630003.1| PREDICTED: legumin B-like [Nicotiana tomentosiformis]
Length=500

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    NNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
              EC++  +NA EPT    +E G TEFWD   EQF+C G
Sbjct  47   RTECRIERLNAQEPTRRFESEAGVTEFWDHTQEQFECAG  85



>emb|CAA83674.1| legumin B [Vicia sativa]
Length=485

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL +INALEP   + +E G TE W+PN  + +C G
Sbjct  36   NQCQLHNINALEPDHRVESEAGLTETWNPNHPELRCAG  73



>ref|XP_009765013.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=499

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    NNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
              EC++  +NA EPT    +E G TEFWD   EQF+C G
Sbjct  47   RTECRIERLNAQEPTRRFESEAGVTEFWDHTQEQFECAG  85



>ref|XP_003590688.1| Legumin B [Medicago truncatula]
Length=430

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL++INALEP   +  E G TE W+PN  + QC G
Sbjct  29   NQCQLNNINALEPDHRVEHEAGLTETWNPNHPELQCAG  66



>ref|XP_010482688.1| PREDICTED: 12S seed storage protein CRB-like [Camelina sativa]
Length=471

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSQVIQSEGGRIEVWDHHAPQLRCSG  65



>ref|XP_003590684.1| Legumin B [Medicago truncatula]
 gb|AES60935.1| legumin storage protein [Medicago truncatula]
Length=583

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL++INALEP   +  E G TE W+PN  + QC G
Sbjct  29   NQCQLNNINALEPDHRVEHEAGLTETWNPNHPELQCAG  66



>ref|XP_002530185.1| 11S globulin subunit beta precursor, putative [Ricinus communis]
 gb|EEF32199.1| 11S globulin subunit beta precursor, putative [Ricinus communis]
Length=480

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + ++CQL  I + EP+    +E G TE WD NDEQF C G
Sbjct  39   RQDQCQLRRITSAEPSRRFQSEAGVTEIWDENDEQFHCVG  78



>sp|P05190.1|LEGB4_VICFA RecName: Full=Legumin type B; Contains: RecName: Full=Legumin 
type B alpha chain; AltName: Full=Legumin type B acidic chain; 
Contains: RecName: Full=Legumin type B beta chain; AltName: 
Full=Legumin type B basic chain; Flags: Precursor [Vicia 
faba]
 emb|CAA27313.1| legumin B [Vicia faba]
Length=484

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+C+L +INALEP   + +E G TE W+PN  + +C G
Sbjct  31   NQCRLDNINALEPDHRVESEAGLTETWNPNHPELRCAG  68



>gb|EYU46457.1| hypothetical protein MIMGU_mgv1a005966mg [Erythranthe guttata]
Length=347

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S   +C+   + A +PT  I +EGG TE WD N  QFQC G
Sbjct  31   SDQQQCRFQRLTAAQPTQRIESEGGTTELWDENHHQFQCAG  71



>emb|CDY18193.1| BnaC05g02160D [Brassica napus]
Length=457

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  27   NECQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSG  64



>ref|NP_001289909.1| uncharacterized protein LOC104754510 precursor [Camelina sativa]
 gb|AFQ32294.1| 12S seed storage protein [Camelina sativa]
Length=458

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSQVIQSEGGRIEVWDHHAPQLRCSG  65



>ref|XP_009765011.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=499

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    NNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
              EC++  +NA EPT    +E G TEFWD   EQF+C G
Sbjct  47   RTECRIERLNAQEPTRRFESEAGVTEFWDHTQEQFECAG  85



>emb|CDX89858.1| BnaA10g02240D [Brassica napus]
Length=470

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  40   NECQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSG  77



>sp|P33522.1|CRU4_BRANA RecName: Full=Cruciferin CRU4; AltName: Full=11S globulin; AltName: 
Full=12S storage protein; Contains: RecName: Full=Cruciferin 
CRU4 alpha chain; Contains: RecName: Full=Cruciferin 
CRU4 beta chain; Flags: Precursor [Brassica napus]
Length=465

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  27   NECQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSG  64



>ref|XP_010935905.1| PREDICTED: glutelin type-A 3-like isoform X2 [Elaeis guineensis]
Length=444

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            EC+L  +N L+PT  + +E G TE++D  D+Q QC G
Sbjct  32   ECRLDRLNTLQPTRRVESEAGVTEYFDEKDDQLQCAG  68



>ref|XP_010457405.1| PREDICTED: 12S seed storage protein CRB isoform X1 [Camelina 
sativa]
Length=456

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSQVIQSEGGRIEVWDHHAPQLRCSG  65



>ref|NP_001289908.1| 12S seed storage protein CRB precursor [Camelina sativa]
 gb|AFQ32288.1| 12S seed storage protein [Camelina sativa]
Length=456

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSQVIQSEGGRIEVWDHHAPQLRCSG  65



>ref|XP_009119353.1| PREDICTED: cruciferin CRU4 [Brassica rapa]
Length=464

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  27   NECQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSG  64



>ref|XP_010935904.1| PREDICTED: glutelin type-B 5-like isoform X1 [Elaeis guineensis]
Length=451

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            EC+L  +N L+PT  + +E G TE++D  D+Q QC G
Sbjct  32   ECRLDRLNTLQPTRRVESEAGVTEYFDEKDDQLQCAG  68



>ref|XP_006303676.1| hypothetical protein CARUB_v10011751mg [Capsella rubella]
 gb|EOA36574.1| hypothetical protein CARUB_v10011751mg [Capsella rubella]
Length=458

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSQVIQSEGGRIEVWDHHAPQLRCSG  65



>gb|AAA32778.1| 12S storage protein CRB [Arabidopsis thaliana]
 emb|CAA32494.1| 12S seed storage protein [Arabidopsis thaliana]
Length=455

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSG  65



>ref|NP_171884.1| cruciferin 2 [Arabidopsis thaliana]
 sp|P15456.2|CRU2_ARATH RecName: Full=12S seed storage protein CRB; AltName: Full=Cruciferin 
2; Short=AtCRU2; AltName: Full=Cruciferin B; AltName: 
Full=Legumin-type globulin storage protein CRU2; Contains: 
RecName: Full=12S seed storage protein CRB alpha chain; AltName: 
Full=12S seed storage protein CRB acidic chain; Contains: 
RecName: Full=12S seed storage protein CRB beta chain; AltName: 
Full=12S seed storage protein CRB basic chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD10680.1| 12S seed storage protein [Arabidopsis thaliana]
 gb|AAM13004.1| 12S seed storage protein [Arabidopsis thaliana]
 gb|AAP81800.1| At1g03880 [Arabidopsis thaliana]
 gb|AEE27628.1| cruciferin 2 [Arabidopsis thaliana]
Length=455

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSG  65



>ref|XP_002889479.1| hypothetical protein ARALYDRAFT_470363 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65738.1| hypothetical protein ARALYDRAFT_470363 [Arabidopsis lyrata subsp. 
lyrata]
Length=455

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  I +EGG  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSQIIKSEGGRIEVWDHHAPQLRCSG  65



>sp|P05692.1|LEGJ_PEA RecName: Full=Legumin J; Contains: RecName: Full=Legumin J alpha 
chain; AltName: Full=Legumin J acidic chain; Contains: RecName: 
Full=Legumin J beta chain; AltName: Full=Legumin J basic 
chain; Flags: Precursor [Pisum sativum]
 emb|CAA30067.1| legumin [Pisum sativum]
Length=503

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+CQL  INALEP   + +E G TE W+PN  + +C G
Sbjct  31   NQCQLDSINALEPDHRVESEAGLTETWNPNHPELKCAG  68



>gb|AAM93157.1| trypsin inhibitor [Arachis hypogaea]
Length=219

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N CQ   +NA  P + I +EGG+ E W+PN+++F+C G
Sbjct  32   NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAG  69



>gb|AEB33711.1| conglutin alpha 3 [Lupinus angustifolius]
Length=585

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP + I +EGG TE W+ N  + +C G
Sbjct  30   NECQLDRLNALEPDNRIESEGGVTETWNSNKPELRCAG  67



>ref|XP_010257107.1| PREDICTED: glutelin type-B 5-like [Nelumbo nucifera]
Length=474

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + N C++ +++ALEPT    AE G+ E WD N+ QFQC G
Sbjct  4    EQNRCRVENLDALEPTRRREAEAGFVEEWDENNNQFQCAG  43



>gb|KFK29566.1| hypothetical protein AALP_AA7G151400 [Arabis alpina]
Length=503

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  + +EGG  E WD +  Q +C G
Sbjct  33   NECQLDQLNALEPSHVLKSEGGRIEVWDHHAPQLRCSG  70



>ref|XP_010248272.1| PREDICTED: legumin type B-like, partial [Nelumbo nucifera]
Length=380

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            CQ+ +++ALEP+    AEGG+ E WD N+ QFQC G
Sbjct  1    CQVDNLDALEPSRRREAEGGFVEEWDENNNQFQCAG  36



>ref|XP_004289947.1| PREDICTED: glycinin G4-like [Fragaria vesca subsp. vesca]
Length=505

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            SQ NEC L+ I A EP + I  E G  E WD N + FQC G
Sbjct  30   SQQNECMLNRIQAREPDNRIETEAGRIESWDYNQDDFQCAG  70



>gb|ABK80755.1| 11S globulin precursor isoform 3B [Ficus pumila var. awkeotsang]
Length=487

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            + +ECQL+ + A EP + +  EGG  E W+PN EQFQC G
Sbjct  31   RQDECQLNRLEAREPDNRLQCEGGLLESWNPNHEQFQCVG  70



>ref|XP_010263163.1| PREDICTED: 11S globulin subunit beta-like [Nelumbo nucifera]
Length=517

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N C+  +++ALEPT    AE G+ E WD N+ QFQC G
Sbjct  45   NRCRFENLDALEPTRRREAEAGFVEEWDENNNQFQCAG  82



>gb|KDP26530.1| hypothetical protein JCGZ_17688 [Jatropha curcas]
Length=491

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            Q ++C+L  I ALEP + I +E G  E W+P+ +QFQC G
Sbjct  37   QQHQCRLDRIEALEPDTRIQSEAGTIESWNPSRDQFQCAG  76



>ref|XP_004246943.1| PREDICTED: 12S seed storage protein CRA1-like [Solanum lycopersicum]
Length=474

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  23   LSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            L+ +N +EPT  I AE G TE WD N++QFQC G
Sbjct  34   LNRLNPMEPTVRIQAEAGVTELWDKNNQQFQCAG  67



>ref|XP_009354949.1| PREDICTED: cruciferin CRU1-like [Pyrus x bretschneideri]
Length=577

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL+ + A EP++ I AE G  E W+ ND+ FQC G
Sbjct  32   NECQLNQLQAREPSNNIRAEAGQIETWNHNDDDFQCAG  69



>gb|ABL14271.1| arachin 7, partial [Arachis hypogaea]
Length=207

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N CQ   +NA  P + I +EGG+ E W+PN+++F+C G
Sbjct  30   NACQFQRLNAQRPDNLIESEGGYIETWNPNNQEFECAG  67



>ref|XP_006857275.1| hypothetical protein AMTR_s00067p00022330 [Amborella trichopoda]
 gb|ERN18742.1| hypothetical protein AMTR_s00067p00022330 [Amborella trichopoda]
Length=486

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            S   +C+++ I+ + PT  I +EGG TE WD + ++FQC G
Sbjct  31   SDAQQCRMNRISGIRPTRVIRSEGGITELWDEDRDEFQCAG  71



>ref|NP_001275797.1| citrin precursor [Citrus sinensis]
 gb|AAB52963.1| citrin [Citrus sinensis]
Length=486

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCG  121
            C + ++NALEP   + +E G TEFWD N+EQ QC 
Sbjct  48   CNIQNLNALEPRQKVESEAGVTEFWDQNNEQLQCA  82



>ref|XP_006420239.1| hypothetical protein CICLE_v10004854mg [Citrus clementina]
 gb|ESR33479.1| hypothetical protein CICLE_v10004854mg [Citrus clementina]
Length=478

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCG  121
            C + ++NALEP   + +E G TEFWD N+EQ QC 
Sbjct  47   CNIQNLNALEPRQKVESEAGVTEFWDQNNEQLQCA  81



>ref|XP_004289945.1| PREDICTED: 12S seed storage protein CRU1-like [Fragaria vesca 
subsp. vesca]
Length=563

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            SQ NECQL  + A EP + I  E G  E WD N + FQC G
Sbjct  30   SQRNECQLDQLQAREPDNRIETEAGRIESWDYNQDDFQCAG  70



>ref|XP_006420240.1| hypothetical protein CICLE_v10004854mg [Citrus clementina]
 gb|ESR33480.1| hypothetical protein CICLE_v10004854mg [Citrus clementina]
Length=485

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCG  121
            C + ++NALEP   + +E G TEFWD N+EQ QC 
Sbjct  47   CNIQNLNALEPRQKVESEAGVTEFWDQNNEQLQCA  81



>ref|XP_004289944.1| PREDICTED: legumin A-like [Fragaria vesca subsp. vesca]
Length=499

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            SQ NEC L+ I A EP + I  E G  E WD N + FQC G
Sbjct  28   SQQNECMLNQIQAREPDNRIETEAGRIESWDYNQDDFQCAG  68



>emb|CAA64762.1| legumin-like protein [Asarum europaeum]
Length=462

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +C++  ++A  P+  I +EGG TE WD N+EQFQC G
Sbjct  34   QCRIQQLSASRPSRRIESEGGVTELWDENEEQFQCAG  70



>gb|AAB24084.1| legumin propolypeptide alpha chain [beans, Peptide Partial, 281 
aa]
Length=281

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+C+L +INALEP   + +E G TE W+PN  + +C G
Sbjct  9    NQCRLDNINALEPDHRVESEAGLTETWNPNHPELRCAG  46



>ref|NP_001291328.1| uncharacterized protein LOC105171779 precursor [Sesamum indicum]
 gb|AAK15087.1|AF240004_1 11S globulin [Sesamum indicum]
Length=497

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +C++  + A EPT    +E G TEFWD N++QF+C G
Sbjct  48   DCRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAG  84



>ref|NP_001291336.1| 11S globulin seed storage protein 2 precursor [Sesamum indicum]
 sp|Q9XHP0.1|11S2_SESIN RecName: Full=11S globulin seed storage protein 2; AltName: Full=11S 
globulin seed storage protein II; AltName: Full=Alpha-globulin; 
Contains: RecName: Full=11S globulin seed storage 
protein 2 acidic chain; AltName: Full=11S globulin seed storage 
protein II acidic chain; Contains: RecName: Full=11S globulin 
seed storage protein 2 basic chain; AltName: Full=11S 
globulin seed storage protein II basic chain; Flags: Precursor 
[Sesamum indicum]
 gb|AAD42944.1|AF091842_1 11S globulin precursor [Sesamum indicum]
Length=459

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/41 (44%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    SQNNECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +Q  +C+   I+  +P+  I +EGG TE WD   EQFQC G
Sbjct  29   TQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAG  69



>gb|KFK42731.1| hypothetical protein AALP_AA1G032400 [Arabis alpina]
Length=455

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP   I +EGG  E WD    Q +C G
Sbjct  28   NECQLDQLNALEPFQVIKSEGGRIEVWDHRAPQLRCSG  65



>gb|AGE34644.1| 11S globulin isoform 3 [Castanea sativa]
Length=531

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  23   LSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            L  ++ALEP + I AE G  E WDPND QFQC G
Sbjct  37   LDRLDALEPNNRIKAEAGVIESWDPNDRQFQCVG  70



>pir||JC2097 legumin type B alpha chain precursor (clone LeB4, B4) - tick 
bean
Length=290

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N+C+L +INALEP   + +E G TE W+PN  + +C G
Sbjct  31   NQCRLDNINALEPDHRVESEAGLTETWNPNHPELRCAG  68



>gb|AAM93194.1|AF525749_1 castanin [Castanea crenata]
Length=542

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  23   LSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            L  ++ALEP + I AE G TE WDPN++QFQC G
Sbjct  38   LDSLDALEPNNRIEAEAGVTEAWDPNNKQFQCVG  71



>gb|AAC63045.1| glycinin [Arachis hypogaea]
Length=507

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N CQ   +NA  P + I +EGG+ E W+PN+++F+C G
Sbjct  7    NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAG  44



>ref|XP_006420241.1| hypothetical protein CICLE_v10004871mg [Citrus clementina]
 gb|ESR33481.1| hypothetical protein CICLE_v10004871mg [Citrus clementina]
Length=480

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  17   CQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQC  118
            C +  +NALEP   + +E G TEFWD ND+Q QC
Sbjct  45   CNIQDLNALEPQQRVESEAGVTEFWDQNDDQLQC  78



>ref|XP_004247735.1| PREDICTED: 11S globulin subunit beta [Solanum lycopersicum]
Length=509

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            +C++S ++A EPT    +E G TEFWD N E+F+C G
Sbjct  46   DCRISSLSAREPTYKFNSEAGTTEFWDRNSEEFECAG  82



>ref|XP_010025835.1| PREDICTED: legumin B-like [Eucalyptus grandis]
 gb|KCW57368.1| hypothetical protein EUGRSUZ_H00153 [Eucalyptus grandis]
Length=501

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +2

Query  14   ECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            ECQ+  +N LEP+  I AE G +E WD ++ Q QC G
Sbjct  43   ECQIERLNTLEPSRRIEAEAGVSELWDEDEGQLQCAG  79



>gb|AAR02860.1| storage protein [Arachis hypogaea]
Length=536

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N CQ   +NA  P + I +EGG+ E W+PN+++F+C G
Sbjct  30   NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAG  67



>emb|CDY14908.1| BnaA02g22500D [Brassica napus]
Length=462

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  + AE G  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSG  65



>sp|P33524.2|CRU2_BRANA RecName: Full=Cruciferin BnC2; AltName: Full=11S globulin; AltName: 
Full=12S storage protein; Contains: RecName: Full=Cruciferin 
BnC2 subunit alpha; Contains: RecName: Full=Cruciferin 
BnC2 subunit beta; Flags: Precursor [Brassica napus]
 emb|CAA41985.1| cruciferin storage protein [Brassica napus]
Length=496

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  + AE G  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSG  65



>gb|AAM46958.1|AF510854_1 allergen Arah3/Arah4 [Arachis hypogaea]
Length=538

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N CQ   +NA  P + I +EGG+ E W+PN+++F+C G
Sbjct  30   NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAG  67



>emb|CDY22309.1| BnaA06g36310D [Brassica napus]
Length=462

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  + AE G  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSG  65



>emb|CDY65916.1| BnaC07g48660D [Brassica napus]
Length=456

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  + AE G  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSG  65



>ref|XP_009123931.1| PREDICTED: cruciferin BnC2 [Brassica rapa]
Length=491

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  + AE G  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSG  65



>gb|AAU21490.1| arachin Ahy-1 [Arachis hypogaea]
Length=536

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N CQ   +NA  P + I +EGG+ E W+PN+++F+C G
Sbjct  30   NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAG  67



>gb|ACH91862.1| arachin Arah3 isoform [Arachis hypogaea]
Length=530

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N CQ   +NA  P + I +EGG+ E W+PN+++F+C G
Sbjct  30   NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAG  67



>emb|CCW28732.1| putative arachin [Arachis duranensis]
Length=530

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N CQ   +NA  P + I +EGG+ E W+PN+++F+C G
Sbjct  30   NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAG  67



>ref|XP_009101736.1| PREDICTED: cruciferin BnC1 [Brassica rapa]
Length=485

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            NECQL  +NALEP+  + AE G  E WD +  Q +C G
Sbjct  28   NECQLDQLNALEPSHVLKAEAGRIEVWDHHAPQLRCSG  65



>pdb|3C3V|A Chain A, Crystal Structure Of Peanut Major Allergen Ara H 3
Length=510

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N CQ   +NA  P + I +EGG+ E W+PN+++F+C G
Sbjct  10   NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAG  47



>gb|AAW56067.1| arachin Ahy-4 [Arachis hypogaea]
 gb|ABF93402.1| arachin Ahy-4 [Arachis hypogaea]
Length=531

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  11   NECQLSHINALEPTSAIPAEGGWTEFWDPNDEQFQCGG  124
            N CQ   +NA  P + I +EGG+ E W+PN+++F+C G
Sbjct  30   NACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAG  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 529750811642