BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82165_g1_i1 len=956 path=[934:0-955]

Length=956
                                                                      Score     E

ref|XP_004235733.1|  PREDICTED: oleosin 1-like                          144   6e-38   
ref|XP_006341651.1|  PREDICTED: oleosin 1-like                          142   9e-37   
ref|XP_009767218.1|  PREDICTED: oleosin 1                               138   6e-36   
ref|XP_009601383.1|  PREDICTED: oleosin 1                               135   1e-34   
ref|XP_007036421.1|  Oleosin family protein                             130   4e-33   
ref|XP_010262686.1|  PREDICTED: oleosin 1-like                          130   5e-33   
ref|XP_002273242.2|  PREDICTED: oleosin 18.2 kDa                        132   8e-33   Vitis vinifera
gb|AAX49393.1|  OLE-5                                                   127   8e-32   Coffea canephora [robusta coffee]
ref|XP_003524510.1|  PREDICTED: oleosin 1-like                          126   2e-31   
ref|XP_010037341.1|  PREDICTED: oleosin 1-like                          126   3e-31   
ref|XP_006440904.1|  hypothetical protein CICLE_v10022589mg             125   4e-31   
emb|CBI15408.3|  unnamed protein product                                128   1e-30   
ref|XP_010110789.1|  Oleosin 16 kDa                                     123   2e-30   
ref|XP_006494251.1|  PREDICTED: oleosin 1-like                          124   2e-30   
ref|XP_004508582.1|  PREDICTED: oleosin 1-like                          121   2e-29   
ref|XP_007209683.1|  hypothetical protein PRUPE_ppa012323mg             120   4e-29   
ref|XP_008244042.1|  PREDICTED: oleosin 1-like                          120   4e-29   
ref|XP_004299241.1|  PREDICTED: oleosin 16 kDa-like                     119   8e-29   
ref|XP_011077446.1|  PREDICTED: oleosin 1                               116   1e-27   
ref|XP_003609083.1|  Oleosin                                            115   1e-27   
gb|KDP20078.1|  hypothetical protein JCGZ_05847                         115   1e-27   
ref|XP_002511984.1|  Oleosin, putative                                  115   2e-27   Ricinus communis
ref|XP_008360893.1|  PREDICTED: oleosin 1-like                          113   2e-26   
ref|XP_002317928.1|  glycine-rich family protein                        112   3e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010695618.1|  PREDICTED: oleosin 1-like                          112   4e-26   
ref|XP_008364644.1|  PREDICTED: oleosin 1-like                          112   5e-26   
ref|XP_009346735.1|  PREDICTED: oleosin 1-like                          112   5e-26   
ref|XP_009337467.1|  PREDICTED: oleosin 1-like                          112   5e-26   
ref|XP_011010368.1|  PREDICTED: oleosin 1-like                          110   1e-25   
ref|XP_007155152.1|  hypothetical protein PHAVU_003G177800g             108   7e-25   
ref|XP_010924760.1|  PREDICTED: oleosin 1-like                          106   5e-24   
ref|XP_003549810.1|  PREDICTED: oleosin 1-like                          105   7e-24   
ref|XP_006596702.1|  PREDICTED: oleosin 1-like                          103   2e-23   
ref|XP_008810983.1|  PREDICTED: oleosin 1-like                          103   4e-23   
ref|XP_002441561.1|  hypothetical protein SORBIDRAFT_09g029350          101   2e-22   Sorghum bicolor [broomcorn]
ref|XP_008800936.1|  PREDICTED: oleosin 1-like                          101   3e-22   
ref|XP_010924186.1|  PREDICTED: oleosin 1-like                          101   3e-22   
gb|ABK40507.1|  pollen oleosin                                        99.8    1e-21   Lilium longiflorum [Easter lily]
ref|XP_009392929.1|  PREDICTED: oleosin 1-like                        99.8    1e-21   
gb|AIC74543.1|  oleosin-G                                             97.1    5e-21   
gb|EYU28276.1|  hypothetical protein MIMGU_mgv1a015478mg              95.5    3e-20   
ref|XP_008453362.1|  PREDICTED: oleosin 1                             95.5    3e-20   
ref|XP_006393322.1|  hypothetical protein EUTSA_v10011990mg           94.7    7e-20   
ref|XP_010465964.1|  PREDICTED: oleosin 1-like                        93.6    2e-19   
ref|XP_010507004.1|  PREDICTED: oleosin 1-like                        93.6    2e-19   
gb|AFG55839.1|  hypothetical protein 2_3802_02                        91.7    2e-19   
ref|XP_009147923.1|  PREDICTED: oleosin 16 kDa-like                   92.4    4e-19   
ref|XP_004961136.1|  PREDICTED: oleosin 16 kDa-like                   92.0    6e-19   
ref|XP_009107324.1|  PREDICTED: oleosin 16 kDa-like                   91.3    1e-18   
gb|AFG55837.1|  hypothetical protein 2_3802_02                        89.7    1e-18   
ref|XP_010506995.1|  PREDICTED: oleosin 1-like                        91.7    1e-18   
gb|KFK39208.1|  hypothetical protein AALP_AA3G213400                  90.9    1e-18   
gb|KFK36050.1|  hypothetical protein AALP_AA4G071400                  90.9    2e-18   
ref|XP_006842689.1|  hypothetical protein AMTR_s00147p00069460        90.9    2e-18   
ref|NP_188487.1|  Oleosin family protein                              90.1    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002862467.1|  hypothetical protein ARALYDRAFT_497429           90.1    3e-18   
ref|XP_004154931.1|  PREDICTED: oleosin 16 kDa-like                   88.6    7e-18   
emb|CDX99345.1|  BnaC05g34600D                                        89.0    8e-18   
ref|XP_006406591.1|  hypothetical protein EUTSA_v10021947mg           89.0    8e-18   
ref|XP_004138225.1|  PREDICTED: oleosin 16 kDa-like                   88.2    1e-17   
emb|CDY62847.1|  BnaA06g03370D                                        93.2    1e-17   
ref|XP_009145881.1|  PREDICTED: oleosin 1-like                        87.8    2e-17   
ref|XP_010500440.1|  PREDICTED: oleosin 16 kDa-like                   87.8    2e-17   
ref|XP_006306473.1|  hypothetical protein CARUB_v10012438mg           87.0    4e-17   
ref|XP_009404978.1|  PREDICTED: oleosin 1-like                        86.7    5e-17   
emb|CDX92248.1|  BnaA05g21590D                                        86.7    5e-17   
emb|CDY51173.1|  BnaC06g02430D                                        90.5    7e-17   
ref|XP_010461720.1|  PREDICTED: oleosin 16 kDa-like                   86.3    7e-17   
ref|XP_010479327.1|  PREDICTED: oleosin 16 kDa-like                   84.7    2e-16   
ref|XP_006300117.1|  hypothetical protein CARUB_v10016346mg           84.3    3e-16   
ref|XP_002891470.1|  hypothetical protein ARALYDRAFT_474043           83.6    6e-16   
ref|NP_175329.1|  Oleosin-like protein                                83.2    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006655620.1|  PREDICTED: oleosin 16 kDa-like                   82.0    9e-16   
emb|CDY06745.1|  BnaA10g05240D                                        82.8    1e-15   
gb|ACI87763.1|  putative oleosin                                      80.5    1e-15   Cupressus sempervirens
emb|CDX82338.1|  BnaA03g34830D                                        82.0    2e-15   
emb|CDX75969.1|  BnaC03g40520D                                        82.0    2e-15   
ref|XP_009136039.1|  PREDICTED: oleosin 1-like                        82.0    2e-15   
gb|AIA08667.1|  putative oleosin protein                              80.9    4e-15   
gb|ACA30297.1|  putative oleosin                                      80.1    4e-15   Cupressus sempervirens
emb|CDY18527.1|  BnaA01g26680D                                        79.3    2e-14   
ref|XP_009112642.1|  PREDICTED: oleosin 1-like                        78.6    4e-14   
gb|ACG37867.1|  oleosin Bn-V                                          77.0    8e-14   Zea mays [maize]
ref|NP_001152711.1|  oleosin Bn-V                                     75.1    6e-13   Zea mays [maize]
ref|XP_010548141.1|  PREDICTED: oleosin 1-like                        74.7    8e-13   
ref|XP_009608158.1|  PREDICTED: oleosin 16.4 kDa-like                 73.6    1e-12   
ref|XP_009763151.1|  PREDICTED: oleosin 16.4 kDa-like                 72.8    2e-12   
ref|NP_001056403.1|  Os05g0576700                                     70.9    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002275496.1|  PREDICTED: oleosin 1                             69.3    6e-11   Vitis vinifera
gb|KHN05978.1|  hypothetical protein glysoja_046115                   66.6    9e-11   
gb|EEE64794.1|  hypothetical protein OsJ_19650                        69.7    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003527133.2|  PREDICTED: oleosin Bn-V-like                     67.0    7e-10   
ref|XP_007012203.1|  Oleosin                                          65.5    1e-09   
ref|XP_010047300.1|  PREDICTED: oleosin 1                             64.7    3e-09   
ref|XP_003565870.1|  PREDICTED: oleosin 16 kDa-like                   65.1    3e-09   
ref|NP_001237482.1|  uncharacterized protein LOC100306353             64.3    3e-09   
ref|XP_010109129.1|  Oleosin 1                                        63.5    7e-09   
ref|XP_010536555.1|  PREDICTED: oleosin 18.5 kDa-like                 63.2    8e-09   
ref|XP_002966097.1|  hypothetical protein SELMODRAFT_28429            63.2    8e-09   
ref|XP_010551164.1|  PREDICTED: oleosin 16 kDa-like                   63.2    9e-09   
emb|CDP05381.1|  unnamed protein product                              62.8    9e-09   
ref|XP_009778273.1|  PREDICTED: oleosin 1-like                        62.4    2e-08   
gb|AAO65960.1|  oleosin                                               62.4    2e-08   Corylus avellana [European hazelnut]
gb|ABQ57397.1|  oleosin L-isoform                                     62.4    2e-08   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_009601962.1|  PREDICTED: oleosin 1-like                        62.4    2e-08   
ref|XP_006450748.1|  hypothetical protein CICLE_v10009815mg           62.0    2e-08   
gb|AFR46652.1|  oleosin1                                              62.0    2e-08   
ref|XP_004488373.1|  PREDICTED: major oleosin NAP-II-like             61.6    2e-08   
gb|AAU21501.1|  oleosin 3                                             62.0    3e-08   Arachis hypogaea [goober]
gb|AHI54563.1|  OleIII                                                61.6    3e-08   
gb|AAZ20277.1|  oleosin 2                                             61.6    3e-08   Arachis hypogaea [goober]
gb|ACH85188.1|  main allergen 15 kDa oleosin                          61.6    3e-08   Sesamum indicum [beniseed]
ref|XP_010555609.1|  PREDICTED: oleosin Bn-III-like                   61.6    3e-08   
gb|AAD42942.1|AF091840_1  15 kDa oleosin                              61.6    3e-08   Sesamum indicum [beniseed]
ref|XP_010038411.1|  PREDICTED: oleosin 1-like                        61.2    4e-08   
ref|XP_002281746.1|  PREDICTED: oleosin 1                             61.2    5e-08   Vitis vinifera
ref|XP_003591653.1|  Oleosin                                          61.2    5e-08   
gb|ABB01617.1|  oleosin low molecular weight isoform                  60.8    6e-08   Linum usitatissimum
gb|ABF57563.1|  OleIII                                                60.5    6e-08   Camellia oleifera [abura-tsubaki]
ref|XP_009404312.1|  PREDICTED: oleosin 16 kDa-like                   60.5    7e-08   
ref|XP_003556321.1|  PREDICTED: oleosin 1-like isoform 1              60.5    9e-08   
gb|AAZ20276.1|  oleosin 1                                             60.1    9e-08   Arachis hypogaea [goober]
gb|ABB01618.1|  oleosin low molecular weight isoform                  60.1    1e-07   Linum usitatissimum
gb|AAX49390.1|  OLE-2                                                 60.1    1e-07   Coffea canephora [robusta coffee]
ref|XP_002516493.1|  Oleosin, putative                                61.2    1e-07   Ricinus communis
gb|KFK32534.1|  hypothetical protein AALP_AA6G255700                  59.7    1e-07   
ref|XP_004146901.1|  PREDICTED: oleosin 18.5 kDa-like                 59.7    2e-07   
ref|XP_011076526.1|  PREDICTED: oleosin 1-like                        60.8    2e-07   
ref|XP_008453870.1|  PREDICTED: oleosin 1-like                        59.3    2e-07   
gb|ABB01620.1|  oleosin low molecular weight isoform                  59.3    2e-07   Linum usitatissimum
ref|XP_006421522.1|  hypothetical protein CICLE_v10006168mg           59.3    2e-07   
gb|AFP19885.1|  14.3 kDa oleosin                                      59.3    2e-07   
ref|XP_006490018.1|  PREDICTED: oleosin 1-like                        59.3    2e-07   
gb|EPS62608.1|  oleosin                                               59.3    2e-07   
gb|ABB01619.1|  oleosin low molecular weight isoform                  59.3    2e-07   Linum usitatissimum
ref|XP_006357933.1|  PREDICTED: oleosin 1-like                        59.3    2e-07   
ref|XP_003631370.1|  PREDICTED: oleosin 1                             58.9    2e-07   
ref|XP_004307777.1|  PREDICTED: oleosin 1-like                        59.3    2e-07   
ref|XP_011019556.1|  PREDICTED: oleosin 1-like                        60.5    2e-07   
ref|XP_008444982.1|  PREDICTED: oleosin 1-like                        58.5    3e-07   
gb|ADB03184.1|  oleosin I                                             58.5    3e-07   Vernicia fordii [tung oil tree]
ref|XP_006413337.1|  hypothetical protein EUTSA_v10027215mg           58.9    3e-07   
ref|XP_004240765.1|  PREDICTED: oleosin 1                             58.5    3e-07   
gb|ACH91012.1|  oleosin isoform OLE500a                               57.4    4e-07   Cocos nucifera
ref|XP_009606946.1|  PREDICTED: oleosin 1-like                        58.2    4e-07   
ref|XP_006853752.1|  hypothetical protein AMTR_s00056p00188310        58.2    5e-07   
ref|XP_010433682.1|  PREDICTED: oleosin 18.5 kDa                      58.5    5e-07   
ref|XP_002869688.1|  hypothetical protein ARALYDRAFT_492319           58.5    5e-07   
gb|AET74077.1|  oleosin                                               58.2    5e-07   
ref|XP_010438923.1|  PREDICTED: oleosin 18.5 kDa-like                 58.5    5e-07   
gb|KHN23715.1|  hypothetical protein glysoja_046821                   56.2    6e-07   
emb|CDX77269.1|  BnaC08g03140D                                        57.8    6e-07   
gb|ABF57560.1|  OleII                                                 57.8    6e-07   Camellia oleifera [abura-tsubaki]
ref|XP_004956407.1|  PREDICTED: oleosin Zm-I-like                     58.2    6e-07   
sp|Q96543.1|OLE16_BROSE  RecName: Full=Oleosin 16 kDa                 58.2    7e-07   Bromus secalinus [cheat]
emb|CDY08967.1|  BnaC08g11970D                                        58.2    8e-07   
gb|KFK29003.1|  hypothetical protein AALP_AA7G076700                  58.2    8e-07   
gb|EYU20173.1|  hypothetical protein MIMGU_mgv1a015301mg              57.8    8e-07   
ref|XP_002309527.2|  hypothetical protein POPTR_0006s25150g           58.2    9e-07   Populus trichocarpa [western balsam poplar]
gb|EPS60535.1|  hypothetical protein M569_14267                       57.4    9e-07   
gb|ABW90150.2|  oleosin 3                                             57.4    1e-06   Jatropha curcas
ref|XP_009109224.1|  PREDICTED: oleosin 18.5 kDa                      57.8    1e-06   
sp|P29109.1|OLEO5_BRANA  RecName: Full=Oleosin Bn-V; Short=BnV        57.8    1e-06   Brassica napus [oilseed rape]
emb|CDY03377.1|  BnaC01g17050D                                        57.4    1e-06   
ref|XP_007218565.1|  hypothetical protein PRUPE_ppa012948mg           57.4    1e-06   
emb|CAA57995.1|  low molecular weight oleosin                         57.4    1e-06   Hordeum vulgare [barley]
ref|XP_006285813.1|  hypothetical protein CARUB_v10007289mg           57.8    1e-06   
dbj|BAJ85423.1|  predicted protein                                    57.4    1e-06   
ref|NP_194244.1|  oleosin 1                                           57.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234447.1|  PREDICTED: oleosin 1                             57.0    1e-06   
ref|XP_009764678.1|  PREDICTED: oleosin 1-like                        57.0    1e-06   
gb|KDP34143.1|  hypothetical protein JCGZ_07714                       57.0    1e-06   
gb|ACG69521.1|  oleosin S3-9                                          57.4    2e-06   Brassica napus [oilseed rape]
ref|XP_011026733.1|  PREDICTED: oleosin 1-like                        56.6    2e-06   
gb|ACG69520.1|  oleosin S3-8                                          57.4    2e-06   Brassica napus [oilseed rape]
ref|XP_002297927.1|  Oleosin 18.5 kDa family protein                  56.2    2e-06   Populus trichocarpa [western balsam poplar]
gb|ACG69514.1|  oleosin S3-2                                          57.0    2e-06   Brassica napus [oilseed rape]
ref|XP_002511014.1|  Oleosin 2                                        56.2    2e-06   Ricinus communis
gb|ACG69518.1|  oleosin S3-6                                          57.0    2e-06   Brassica napus [oilseed rape]
gb|ACG69513.1|  oleosin S3-1                                          57.0    2e-06   Brassica napus [oilseed rape]
ref|XP_009137499.1|  PREDICTED: oleosin 18.5 kDa-like                 57.0    2e-06   
ref|XP_006371868.1|  hypothetical protein POPTR_0018s04820g           56.2    2e-06   
gb|AAA33481.1|  major protein L3                                      56.2    3e-06   Zea mays [maize]
gb|AET74076.1|  oleosin                                               55.8    3e-06   
ref|XP_003580271.1|  PREDICTED: oleosin 16 kDa                        56.2    3e-06   
sp|P29110.1|OLEO3_BRANA  RecName: Full=Oleosin Bn-III; Short=BnIII    56.6    3e-06   Brassica napus [oilseed rape]
gb|ACF82134.1|  unknown                                               55.8    3e-06   Zea mays [maize]
ref|XP_002971609.1|  hypothetical protein SELMODRAFT_95560            55.8    3e-06   
ref|XP_008357299.1|  PREDICTED: oleosin 1-like                        55.8    3e-06   
ref|XP_002965728.1|  hypothetical protein SELMODRAFT_84903            55.8    4e-06   
gb|KHN18226.1|  Oleosin 16 kDa                                        55.8    4e-06   
sp|P29111.1|OLEO2_BRANA  RecName: Full=Major oleosin NAP-II           55.8    4e-06   Brassica napus [oilseed rape]
emb|CDY34345.1|  BnaA01g14480D                                        55.8    4e-06   
ref|XP_008376368.1|  PREDICTED: oleosin 1-like                        55.5    5e-06   
ref|XP_002971301.1|  hypothetical protein SELMODRAFT_94635            55.1    6e-06   
gb|AAD41080.1|AF147758_1  oleosin                                     53.9    6e-06   Elaeis guineensis
gb|AAC02239.1|  16 kDa oleosin                                        55.1    6e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010693742.1|  PREDICTED: oleosin 1-like                        55.1    6e-06   
ref|XP_003526464.2|  PREDICTED: oleosin 1-like                        55.8    6e-06   
ref|NP_001053473.1|  Os04g0546500                                     55.1    6e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002448279.1|  hypothetical protein SORBIDRAFT_06g024350        55.1    6e-06   Sorghum bicolor [broomcorn]
ref|XP_008780784.1|  PREDICTED: oleosin 16 kDa-like                   54.7    7e-06   
gb|ACG69516.1|  oleosin S3-4                                          55.5    7e-06   Brassica napus [oilseed rape]
gb|ACG69515.1|  oleosin S3-3                                          55.5    7e-06   Brassica napus [oilseed rape]
gb|ACP27621.1|  L-oleosin                                             54.7    7e-06   Coix lacryma-jobi
ref|XP_010668835.1|  PREDICTED: oleosin 16 kDa                        55.1    7e-06   
emb|CDX77021.1|  BnaC04g38160D                                        54.3    9e-06   
ref|XP_002961506.1|  hypothetical protein SELMODRAFT_403436           54.3    9e-06   
ref|XP_010919722.1|  PREDICTED: oleosin 16 kDa-like                   54.3    9e-06   
ref|XP_008786272.1|  PREDICTED: oleosin 16 kDa-like                   54.3    9e-06   
ref|XP_007038271.1|  Oleosin 1                                        54.3    9e-06   
gb|ACG69517.1|  oleosin S3-5                                          55.1    1e-05   Brassica napus [oilseed rape]
gb|ABD14345.1|  oleosin-like protein                                  54.7    1e-05   Brassica napus [oilseed rape]
ref|XP_009362716.1|  PREDICTED: oleosin 1-like                        53.9    1e-05   
gb|AAW70038.1|  oleosin-like protein                                  54.3    1e-05   Brassica rapa
ref|XP_009787078.1|  PREDICTED: oleosin 14.9 kDa-like                 53.1    1e-05   
ref|XP_002304591.1|  Oleosin 18.5 kDa family protein                  53.9    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002966712.1|  hypothetical protein SELMODRAFT_407827           54.3    1e-05   
ref|NP_001105338.1|  oleosin Zm-I                                     53.9    1e-05   Zea mays [maize]
gb|ACG48556.1|  oleosin 16 kDa                                        55.1    2e-05   Zea mays [maize]
ref|XP_007144224.1|  hypothetical protein PHAVU_007G138300g           53.5    2e-05   
ref|XP_010546531.1|  PREDICTED: oleosin 1                             53.5    2e-05   
gb|EEC77750.1|  hypothetical protein OsI_16870                        53.5    2e-05   Oryza sativa Indica Group [Indian rice]
gb|KHG16380.1|  Oleosin 1                                             53.1    2e-05   
ref|XP_009138898.1|  PREDICTED: oleosin Bn-III                        54.3    2e-05   
ref|XP_002970414.1|  hypothetical protein SELMODRAFT_18324            52.8    2e-05   
gb|AAF76238.1|AF273023_1  oleosin                                     53.1    2e-05   Elaeis guineensis
emb|CAE02016.3|  OSJNBa0079A21.14                                     54.3    3e-05   
ref|XP_009610907.1|  PREDICTED: oleosin 1-like                        52.8    3e-05   
ref|NP_001236098.1|  16.5 kDa oleosin                                 53.1    3e-05   
ref|XP_002878899.1|  hypothetical protein ARALYDRAFT_901265           52.8    4e-05   
ref|XP_011022366.1|  PREDICTED: oleosin 1-like                        52.4    4e-05   
ref|XP_004501216.1|  PREDICTED: oleosin 1-like                        52.4    4e-05   
ref|XP_009370420.1|  PREDICTED: oleosin 1-like                        52.4    5e-05   
gb|AFK45755.1|  unknown                                               52.4    5e-05   
ref|XP_006367465.1|  PREDICTED: oleosin 1-like                        52.0    5e-05   
ref|XP_004148427.1|  PREDICTED: oleosin 16 kDa-like                   52.0    6e-05   
ref|XP_009140712.1|  PREDICTED: oleosin 1                             52.0    6e-05   
ref|XP_010934129.1|  PREDICTED: oleosin 16 kDa-like                   53.1    6e-05   
ref|XP_010275437.1|  PREDICTED: oleosin 1-like                        51.6    7e-05   
ref|XP_006653640.1|  PREDICTED: ethylene-responsive transcription...  53.5    8e-05   
ref|XP_004241990.1|  PREDICTED: oleosin 1-like                        51.6    8e-05   
ref|XP_009771392.1|  PREDICTED: oleosin 1-like                        51.2    9e-05   
ref|XP_002975381.1|  hypothetical protein SELMODRAFT_18412            51.2    9e-05   
ref|XP_002987365.1|  hypothetical protein SELMODRAFT_18396            51.2    9e-05   
ref|XP_010472616.1|  PREDICTED: oleosin 14.9 kDa-like                 51.6    1e-04   
ref|XP_002980923.1|  hypothetical protein SELMODRAFT_18574            50.4    1e-04   
ref|XP_010417366.1|  PREDICTED: oleosin 1-like                        51.2    1e-04   
ref|XP_009372826.1|  PREDICTED: oleosin 1-like                        51.2    1e-04   
gb|AAL40177.1|L76464_1  oleosin                                       50.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003603568.1|  Oleosin                                          51.2    1e-04   
ref|XP_006295714.1|  hypothetical protein CARUB_v10024833mg           50.8    2e-04   
gb|EYU19479.1|  hypothetical protein MIMGU_mgv1a015669mg              50.8    2e-04   
ref|XP_009609885.1|  PREDICTED: oleosin 18.2 kDa-like                 50.8    2e-04   
ref|XP_007137146.1|  hypothetical protein PHAVU_009G103600g           51.6    2e-04   
ref|XP_004245807.1|  PREDICTED: oleosin 1-like                        50.4    2e-04   
gb|AAB22715.1|  oleosin=alkaline protein                              48.9    2e-04   
gb|EYU41696.1|  hypothetical protein MIMGU_mgv1a023338mg              50.1    2e-04   
ref|NP_180160.2|  Oleosin-like protein                                50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAC42242.1|  oleosin                                               50.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AGT63296.1|  oleosin                                               50.1    3e-04   
ref|XP_010429602.1|  PREDICTED: oleosin 14.9 kDa-like                 49.7    3e-04   
ref|XP_001766397.1|  predicted protein                                49.7    3e-04   
gb|AAO22794.1|  putative oleosin protein                              50.1    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244394.1|  PREDICTED: oleosin 16 kDa                        49.3    5e-04   
ref|XP_011081346.1|  PREDICTED: oleosin 1-like                        48.5    8e-04   
ref|XP_010497916.1|  PREDICTED: oleosin 1-like                        47.8    0.001   
ref|XP_009796414.1|  PREDICTED: oleosin 1-like                        48.5    0.001   



>ref|XP_004235733.1| PREDICTED: oleosin 1-like [Solanum lycopersicum]
Length=165

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 131/166 (79%), Gaps = 9/166 (5%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            MAD Q    + QRLP R+   +  P  SFLR+ Q+H   PNS+QL GF TL++SGGILL 
Sbjct  1    MADQQPNYGRPQRLPTRSSGFNTTP--SFLRKLQEHV--PNSTQLVGFLTLIISGGILLL  56

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
            LTGLTLT  ILGLIFFTPL+LISSP+W+P+GTVLFIAIAG LSVC FG+A + +LSWLYR
Sbjct  57   LTGLTLTTIILGLIFFTPLVLISSPIWVPVGTVLFIAIAGFLSVCGFGVATLASLSWLYR  116

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            Y RGFHPPGSDR DYARSRI DTA+HVKDYA   GGYLH  +KVKD
Sbjct  117  YIRGFHPPGSDRVDYARSRIADTASHVKDYAREYGGYLH--SKVKD  160



>ref|XP_006341651.1| PREDICTED: oleosin 1-like [Solanum tuberosum]
Length=209

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 130/168 (77%), Gaps = 8/168 (5%)
 Frame = +2

Query  173  QMADLQSIPAQNQRLPPRAM-IASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggil  349
            +MAD Q    + QR P R+    S +   SFLR+ Q+H   PNS+QL GF TL++SGGIL
Sbjct  41   KMADQQPNYGRQQRPPTRSSGFNSNMTTPSFLRKLQEHV--PNSTQLVGFLTLIISGGIL  98

Query  350  lfltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWL  529
            L LTGLTLTA ILGLIFFTPL+LISSP+W+P+GTVLFIAIAG LSVC FG+A +  LSWL
Sbjct  99   LLLTGLTLTAIILGLIFFTPLVLISSPIWVPVGTVLFIAIAGFLSVCGFGVATLAFLSWL  158

Query  530  YRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            YRY RG HPPGSDR DYARSRI DTA+HVKDYA   GGYLH  NKVKD
Sbjct  159  YRYIRGLHPPGSDRVDYARSRIADTASHVKDYAREYGGYLH--NKVKD  204



>ref|XP_009767218.1| PREDICTED: oleosin 1 [Nicotiana sylvestris]
Length=165

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 128/166 (77%), Gaps = 9/166 (5%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            MA+ Q  P+  +     A   S V   SFLR+ Q+H   PNS+QL GF TL++SG ILL 
Sbjct  1    MAEQQ--PSYGRPQTRSAGFNSNVTTPSFLRKLQEHV--PNSTQLVGFLTLIISGAILLL  56

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
            LTG TLTA ILGLIFFTPL+LISSP+W+P+GTVLFIAIAG LSVC FG+A + +LSWLYR
Sbjct  57   LTGFTLTAIILGLIFFTPLVLISSPIWVPVGTVLFIAIAGFLSVCGFGVASLASLSWLYR  116

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            Y+RGFHPPGSDR DYARSRI DTA+HVKDYA   GGYLH  +KVKD
Sbjct  117  YFRGFHPPGSDRVDYARSRIADTASHVKDYAREYGGYLH--SKVKD  160



>ref|XP_009601383.1| PREDICTED: oleosin 1 [Nicotiana tomentosiformis]
Length=165

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 129/166 (78%), Gaps = 9/166 (5%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            MA+ Q  P+  +     A   S +   SFLR+ Q++   PNS+QL GF TL++SG ILL 
Sbjct  1    MAEQQ--PSYGRPQTRSAGFNSNITTPSFLRKLQENV--PNSTQLVGFLTLIISGAILLL  56

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
            LTGLTLTA ILG+IFFTPL+LISSP+W+P+GTVLFIAIAG LSVC FG+A + +LSWLYR
Sbjct  57   LTGLTLTAIILGIIFFTPLVLISSPIWVPVGTVLFIAIAGFLSVCGFGVASLASLSWLYR  116

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            Y+RGFHPPGSDR DYARSRI DTA+HVKDYA   GGYLH  +KVKD
Sbjct  117  YFRGFHPPGSDRVDYARSRIADTASHVKDYAREYGGYLH--SKVKD  160



>ref|XP_007036421.1| Oleosin family protein [Theobroma cacao]
 gb|EOY20922.1| Oleosin family protein [Theobroma cacao]
Length=163

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 121/159 (76%), Gaps = 9/159 (6%)
 Frame = +2

Query  197  PAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltlt  376
            P+Q QR  PR    +   A++FL++FQ HA  PNS+QL GF TL VS  IL+ LTGLT+T
Sbjct  6    PSQ-QRAAPRPNPTASA-ASTFLQKFQAHA--PNSAQLLGFLTLFVSASILITLTGLTVT  61

Query  377  atilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHP  556
            A ILGL+ F PLI+ISSP+WIP+GTVLF+ +AG LS C FG+ V+  LSW+YRY+RG HP
Sbjct  62   AAILGLVIFMPLIVISSPIWIPVGTVLFVTVAGFLSACGFGLVVMAALSWMYRYFRGMHP  121

Query  557  PGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            PGSDR DYARSRI DTA+HVKDYA   GGYL   +KVKD
Sbjct  122  PGSDRVDYARSRIYDTASHVKDYAMEYGGYLQ--SKVKD  158



>ref|XP_010262686.1| PREDICTED: oleosin 1-like [Nelumbo nucifera]
Length=165

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 124/150 (83%), Gaps = 7/150 (5%)
 Frame = +2

Query  224  RAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilgliff  403
            R ++ +     +FLRR QDHA  PNS+QL GF TLV+SGGILL LTGLTLTAT+LGLIFF
Sbjct  15   RNVLRTSSGCETFLRRLQDHA--PNSTQLVGFLTLVISGGILLLLTGLTLTATVLGLIFF  72

Query  404  tplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYA  583
            TPLI+ISSP+W+P GT+LF++IAGLLS+C FG+AV+   SWLY+Y+RG+HPPGSDR DYA
Sbjct  73   TPLIVISSPIWVPAGTILFVSIAGLLSMCGFGVAVLAGASWLYKYFRGWHPPGSDRVDYA  132

Query  584  RSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            RSRI DTANH+KDYA   GGYL   +KV+D
Sbjct  133  RSRIADTANHMKDYAREYGGYLQ--SKVRD  160



>ref|XP_002273242.2| PREDICTED: oleosin 18.2 kDa [Vitis vinifera]
Length=254

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 128/166 (77%), Gaps = 13/166 (8%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            MAD  S   Q QR PPR       P ++FLRR  DHA  PNS+Q  GF  L+VSG ILLF
Sbjct  94   MADRHSGSGQTQR-PPRP-----TPGSAFLRRLHDHA--PNSTQFIGFLALIVSGCILLF  145

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
            LTGLT+TAT++GLIFFTPLIL+SSP+W+P GTVLF+A AG LS+C FG+AV+  LSW+Y+
Sbjct  146  LTGLTITATVIGLIFFTPLILLSSPIWVPAGTVLFLAAAGFLSMCGFGLAVLAGLSWIYK  205

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            Y+RG++PPGS RFDYARSRI DTA+HVKDYA   GGYL   +KVKD
Sbjct  206  YFRGWNPPGSGRFDYARSRIADTASHVKDYAREYGGYLQ--SKVKD  249



>gb|AAX49393.1| OLE-5 [Coffea canephora]
Length=167

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 124/166 (75%), Gaps = 7/166 (4%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            MAD Q+ P Q Q  P     ++      FLR+  +HA  PNS+QL GF TLV+SGGILL 
Sbjct  1    MADHQASPGQPQWPPRPTTTSTAGATTLFLRKMHEHA--PNSTQLIGFLTLVISGGILLL  58

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
            LTGLTLTAT+LGLIFF PLI+ISSP+W+P G++LF+ IAGLLS   FG+A +   SWLYR
Sbjct  59   LTGLTLTATVLGLIFFAPLIIISSPIWVPAGSILFVIIAGLLSFFGFGVAAMAAFSWLYR  118

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            Y+RGFHPPGSDR DYARSRI +TA+ VKDYA   GGYLHG  KVKD
Sbjct  119  YFRGFHPPGSDRVDYARSRIANTASQVKDYAREYGGYLHG--KVKD  162



>ref|XP_003524510.1| PREDICTED: oleosin 1-like [Glycine max]
Length=163

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 120/168 (71%), Gaps = 15/168 (9%)
 Frame = +2

Query  176  MADLQSIPAQNQRL--PPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggil  349
            MAD    PAQ  R   PP ++      +A+FL++ QD A  PNS+QL G   L+V+  + 
Sbjct  1    MADQYPSPAQAHRATAPPPSL------SAAFLQKLQDRA--PNSTQLAGILPLLVTASVF  52

Query  350  lfltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWL  529
            L LTGLT+   +LGLIFF PLI++SSP+W+P GT+LFI  AG LSVC FG+A++  LSW+
Sbjct  53   LLLTGLTVAGAVLGLIFFLPLIIVSSPVWVPAGTLLFIVTAGFLSVCGFGVALVAALSWM  112

Query  530  YRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            YRY+RG HPPGSDR DYARSRI DTA+HVKDYA   GGYL   +KVKD
Sbjct  113  YRYFRGLHPPGSDRVDYARSRIYDTASHVKDYAREYGGYLQ--SKVKD  158



>ref|XP_010037341.1| PREDICTED: oleosin 1-like [Eucalyptus grandis]
 gb|KCW49047.1| hypothetical protein EUGRSUZ_K02651 [Eucalyptus grandis]
Length=168

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 121/167 (72%), Gaps = 8/167 (5%)
 Frame = +2

Query  176  MADLQSIPAQNQRLP-PRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggill  352
            MAD  S PAQ QR P P     +  P   FL++  +HA  PNS+QL GF +L+VSGGILL
Sbjct  1    MADRHSSPAQVQRAPRPTDAAPAATPGGVFLQKLHEHA--PNSAQLLGFLSLLVSGGILL  58

Query  353  fltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLY  532
             LTGLT+T T++GLI FTP+I+ISSP+W+P+G  LF+   G LSVC F I  +  +SWLY
Sbjct  59   LLTGLTVTGTVIGLILFTPIIIISSPIWVPLGVALFVTAVGFLSVCGFSITTLAGMSWLY  118

Query  533  RYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            RY RGFHPPGSD+ DYAR+RI DTA HVKDYA   GGYLH  +K+KD
Sbjct  119  RYIRGFHPPGSDQADYARNRIFDTARHVKDYAREYGGYLH--SKLKD  163



>ref|XP_006440904.1| hypothetical protein CICLE_v10022589mg [Citrus clementina]
 gb|ESR54144.1| hypothetical protein CICLE_v10022589mg [Citrus clementina]
Length=166

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 129/166 (78%), Gaps = 8/166 (5%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            M+D+++ P  +QR   R   ++   + S LRRFQ HA  PNSSQL GF TL VSG ILL 
Sbjct  1    MSDVRN-PTIHQRPSSRLNNSNINSSNSLLRRFQTHA--PNSSQLIGFLTLFVSGSILLL  57

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
            L GLT+TATILGLIFF PL+++SSP+W+PIGT+LFIA+AG LSVC FG+AV+  LSW+YR
Sbjct  58   LIGLTVTATILGLIFFAPLLILSSPIWVPIGTILFIAVAGFLSVCGFGVAVLAGLSWMYR  117

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            Y+ G HPPGS+RFDYARSRI DTA+HVKDYA   GGYL   +KVKD
Sbjct  118  YFNGMHPPGSNRFDYARSRIYDTASHVKDYAREYGGYLQ--SKVKD  161



>emb|CBI15408.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 123/159 (77%), Gaps = 10/159 (6%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            MAD  S   Q QR PPR       P ++FLRR  DHA  PNS+Q  GF  L+VSG ILLF
Sbjct  1    MADRHSGSGQTQR-PPRP-----TPGSAFLRRLHDHA--PNSTQFIGFLALIVSGCILLF  52

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
            LTGLT+TAT++GLIFFTPLIL+SSP+W+P GTVLF+A AG LS+C FG+AV+  LSW+Y+
Sbjct  53   LTGLTITATVIGLIFFTPLILLSSPIWVPAGTVLFLAAAGFLSMCGFGLAVLAGLSWIYK  112

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLHGGN  652
            Y+RG++PPGS RFDYARSRI DTA+HVKDYA  Y  GGN
Sbjct  113  YFRGWNPPGSGRFDYARSRIADTASHVKDYAREY--GGN  149



>ref|XP_010110789.1| Oleosin 16 kDa [Morus notabilis]
 gb|EXC28054.1| Oleosin 16 kDa [Morus notabilis]
Length=156

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 114/157 (73%), Gaps = 13/157 (8%)
 Frame = +2

Query  203  QNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltat  382
            QN R P         PA SFLRR Q+HA  PNS+QL GF TL+VSG ILL L G T+TAT
Sbjct  5    QNNRQP------QSRPAGSFLRRLQEHA--PNSTQLMGFLTLIVSGAILLLLPGATVTAT  56

Query  383  ilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPG  562
            +LG IF TPLI++SSP+W+P   VLF   AG L  C FG+AV+  L+W+YRY+RG HPPG
Sbjct  57   VLGFIFLTPLIVVSSPIWVPAAFVLFFVAAGFLLFCGFGVAVVGGLAWIYRYFRGLHPPG  116

Query  563  SDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            SDRFDYAR++I DTA+HVKDYA   GGYL   +KVKD
Sbjct  117  SDRFDYARNQIYDTASHVKDYAREYGGYLQ--SKVKD  151



>ref|XP_006494251.1| PREDICTED: oleosin 1-like [Citrus sinensis]
 gb|KDO37079.1| hypothetical protein CISIN_1g047028mg [Citrus sinensis]
Length=166

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 8/166 (5%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            M+D+++ P  +QR   R   ++   + S LRR Q HA  PNS+QL GF TL+VSG ILL 
Sbjct  1    MSDVRN-PTIHQRPSSRLNNSNINSSNSLLRRLQTHA--PNSTQLIGFLTLLVSGSILLL  57

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
            L GLT+TATILGLIFF PL+++SSP+W+PIGT+LFIA+AG LSVC FG+AV+  LSW+YR
Sbjct  58   LIGLTVTATILGLIFFAPLLILSSPIWVPIGTILFIAVAGFLSVCGFGVAVLAGLSWMYR  117

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            Y+ G HPPGS+RFDYARSRI DTA+HVKDYA   GGYL   +KVKD
Sbjct  118  YFNGMHPPGSNRFDYARSRIYDTASHVKDYAREYGGYLQ--SKVKD  161



>ref|XP_004508582.1| PREDICTED: oleosin 1-like [Cicer arietinum]
Length=166

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 119/166 (72%), Gaps = 8/166 (5%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            MADL    A  QR  P     S   +A+FL+R  D  +APNS+QL G  TL+V+G ILL 
Sbjct  1    MADLNQSSAYTQR--PTTTATSSSSSAAFLKRLHD-LHAPNSTQLVGILTLLVTGSILLL  57

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
             TGLT++AT++ +IFF+PLI++SSP+W+P GT  F+  AG LS+C FG+  +   SWLYR
Sbjct  58   FTGLTVSATVISIIFFSPLIIVSSPIWVPAGTFFFLLTAGFLSMCGFGLVAVAAFSWLYR  117

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            YYRG HPPGSDRFDYAR+RI DTA+HVKDYA   GGYL   +KVKD
Sbjct  118  YYRGLHPPGSDRFDYARNRIYDTASHVKDYAREYGGYLQ--SKVKD  161



>ref|XP_007209683.1| hypothetical protein PRUPE_ppa012323mg [Prunus persica]
 gb|EMJ10882.1| hypothetical protein PRUPE_ppa012323mg [Prunus persica]
Length=174

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 113/141 (80%), Gaps = 7/141 (5%)
 Frame = +2

Query  251  AASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissp  430
            A++FLRR Q HA  PNS+QL GF TL+VSG ILL LTGLT+TATILGLI  TPLI+ISSP
Sbjct  33   ASTFLRRLQGHA--PNSTQLVGFLTLLVSGAILLLLTGLTVTATILGLILVTPLIIISSP  90

Query  431  lwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            +W+P+G +LF+ +AG +S+C FG A     SW+YRY++G HPPGSDR DYARSRI DTA+
Sbjct  91   IWVPVGALLFLTVAGFVSMCGFGAAAAAVSSWMYRYFKGMHPPGSDRVDYARSRIYDTAS  150

Query  611  HVKDYA---GGYLHGGNKVKD  664
            HVKDYA   GGYLH  +KVKD
Sbjct  151  HVKDYAREYGGYLH--SKVKD  169



>ref|XP_008244042.1| PREDICTED: oleosin 1-like [Prunus mume]
Length=174

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 114/141 (81%), Gaps = 7/141 (5%)
 Frame = +2

Query  251  AASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissp  430
            A++FLRR Q HA  PNS+QL GF TL+VSG ILL LTGLT+TATILGLI FTPLI+ISSP
Sbjct  33   ASTFLRRLQGHA--PNSTQLVGFLTLLVSGAILLLLTGLTVTATILGLILFTPLIIISSP  90

Query  431  lwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            +W+P+G +LF+ +AG +S+C FG A +   SW+YRY +G HPPGSDR DYARSRI DTA+
Sbjct  91   IWVPVGALLFLTVAGFVSMCGFGAATVAVSSWMYRYLKGMHPPGSDRVDYARSRIYDTAS  150

Query  611  HVKDYA---GGYLHGGNKVKD  664
            HVKDYA   GGYLH  +KVKD
Sbjct  151  HVKDYAREYGGYLH--SKVKD  169



>ref|XP_004299241.1| PREDICTED: oleosin 16 kDa-like [Fragaria vesca subsp. vesca]
Length=168

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 113/141 (80%), Gaps = 7/141 (5%)
 Frame = +2

Query  251  AASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissp  430
              SFL + Q H   PNS+QL G  TL+VSGGILL LTG+T+T T+LGLIFFTP++++SSP
Sbjct  27   GGSFLSKLQSHV--PNSTQLIGLLTLLVSGGILLLLTGITITVTVLGLIFFTPILIVSSP  84

Query  431  lwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            +W+P+GTVLF+A AG +S+C FG A +  LSW+YRY++G HPPGSDR DYARSRI DTA+
Sbjct  85   IWVPLGTVLFLATAGFVSMCGFGAAAVGGLSWMYRYFKGMHPPGSDRVDYARSRIYDTAS  144

Query  611  HVKDYA---GGYLHGGNKVKD  664
            HVKDYA   GGYLH  +KVKD
Sbjct  145  HVKDYAKEYGGYLH--SKVKD  163



>ref|XP_011077446.1| PREDICTED: oleosin 1 [Sesamum indicum]
Length=156

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 7/139 (5%)
 Frame = +2

Query  257  SFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplw  436
            SFL++ ++HA  PNS+QL G  TLV+SGGILL LTGLTLTAT+LGLIFF PLILISSP+W
Sbjct  17   SFLQKLREHA--PNSTQLVGLATLVISGGILLLLTGLTLTATVLGLIFFAPLILISSPIW  74

Query  437  ipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHV  616
            +P+GT++FI IAG LS   FG+AV+ ++SWLYRY+RGFHPPG+DR DYAR+RI DTA  V
Sbjct  75   VPVGTLIFITIAGSLSFLGFGVAVVASVSWLYRYFRGFHPPGADRVDYARTRIADTAGQV  134

Query  617  KDYA---GGYLHGGNKVKD  664
            KDYA   GGYLH  ++VKD
Sbjct  135  KDYAREYGGYLH--SRVKD  151



>ref|XP_003609083.1| Oleosin [Medicago truncatula]
 ref|XP_003609116.1| Oleosin [Medicago truncatula]
 gb|AES91280.1| oleosin [Medicago truncatula]
Length=151

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 108/139 (78%), Gaps = 5/139 (4%)
 Frame = +2

Query  257  SFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplw  436
            +FLR+ QD+ ++PNS+QL G  TL+V+G I L LTGLT+ AT++ LIFF+PLI++SSP+W
Sbjct  10   TFLRKLQDNLHSPNSTQLAGLLTLLVTGSIFLLLTGLTVAATVVSLIFFSPLIIVSSPIW  69

Query  437  ipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHV  616
            +P GT LF+  AG LS+C FG+  +   SW YRY+RG HPPGSDR DYAR+R+ DTA+HV
Sbjct  70   VPAGTFLFLLAAGFLSMCGFGVVAVAASSWFYRYFRGLHPPGSDRVDYARNRLYDTASHV  129

Query  617  KDYA---GGYLHGGNKVKD  664
            KDYA   GGYL   +KVKD
Sbjct  130  KDYAREYGGYLQ--SKVKD  146



>gb|KDP20078.1| hypothetical protein JCGZ_05847 [Jatropha curcas]
Length=163

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 119/160 (74%), Gaps = 12/160 (8%)
 Frame = +2

Query  209  QRLPPR-----AMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltl  373
             R PP+     +  ++ V  ++FLR+ + HA  PNS+QL G  TL+++G ILL L GLT+
Sbjct  3    DRTPPQRPSRFSAASTTVNGSTFLRKLRAHA--PNSTQLVGLLTLLITGSILLLLAGLTV  60

Query  374  tatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFH  553
            TAT+L LIFF PLI+ISSP+WIP+   LFI++AG LS+C F  AV+  LSW+YRY+RG +
Sbjct  61   TATVLALIFFAPLIVISSPIWIPVAIFLFISVAGFLSICGFAAAVVGGLSWIYRYFRGLN  120

Query  554  PPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            PPGSDRFDYARSRI DTA+HVKDYA   GGYL   +KVKD
Sbjct  121  PPGSDRFDYARSRIYDTASHVKDYAREYGGYLQ--SKVKD  158



>ref|XP_002511984.1| Oleosin, putative [Ricinus communis]
 gb|EEF50653.1| Oleosin, putative [Ricinus communis]
Length=169

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 119/167 (71%), Gaps = 13/167 (8%)
 Frame = +2

Query  182  DLQSIPAQNQRLPPRAMIASGVP---AASFLRRFQDHAYAPNSSQLFGFFTLVVSggill  352
            D  S PAQ    P R   ++  P    ++FLR+ Q HA  PNS+Q  G  TL++SG ILL
Sbjct  5    DRASNPAQR---PTRTATSNATPNNHVSTFLRKLQSHA--PNSTQFMGILTLLISGSILL  59

Query  353  fltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLY  532
             L G+T+TA ++GL+FFTPLI++SSP+W PIG +LF A AG  SVC F +A I  LSW+Y
Sbjct  60   LLIGITVTALVMGLVFFTPLIIVSSPIWFPIGVLLFFAAAGFFSVCGFLVATIGGLSWMY  119

Query  533  RYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            RYYRG HPPGSDRFDYARSRI DTA+HVKDYA   GGYL   +KVKD
Sbjct  120  RYYRGMHPPGSDRFDYARSRIYDTASHVKDYAREYGGYLQ--SKVKD  164



>ref|XP_008360893.1| PREDICTED: oleosin 1-like [Malus domestica]
Length=171

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 110/138 (80%), Gaps = 7/138 (5%)
 Frame = +2

Query  260  FLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplwi  439
            FLR+ Q HA  PNS+QL GF TL+VSG ILL LTGLT+TAT+LGL+ FTP+I+ISSP+W+
Sbjct  33   FLRKLQGHA--PNSTQLVGFLTLLVSGAILLLLTGLTVTATVLGLVIFTPIIIISSPIWV  90

Query  440  piGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVK  619
            P+G +L + +   +S+C FG A +  LSW+YRY++G HPPGSDR DYARSRI DTA+HVK
Sbjct  91   PLGAILVLTVGFFVSMCGFGAAAVAGLSWMYRYFKGMHPPGSDRVDYARSRIYDTASHVK  150

Query  620  DYA---GGYLHGGNKVKD  664
            DYA   GGYLH  +KVKD
Sbjct  151  DYAREYGGYLH--SKVKD  166



>ref|XP_002317928.1| glycine-rich family protein [Populus trichocarpa]
 gb|EEE96148.1| glycine-rich family protein [Populus trichocarpa]
Length=164

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 107/141 (76%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  AASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissp  430
             ++FLR+ Q H    NSSQL G  TL++SG ILL LT +T+T ++LGL   TPLI+ISSP
Sbjct  22   GSTFLRKLQVH-IGSNSSQLVGLLTLIISGSILLLLTVITVTGSVLGLTLLTPLIIISSP  80

Query  431  lwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            +WIPIG VLF  +AG LS C FG+AV+  LSW+Y+Y+RG +PPGSD+ DYAR+RI DTA+
Sbjct  81   IWIPIGIVLFFVVAGFLSFCGFGLAVVAGLSWVYKYFRGLNPPGSDQVDYARNRIYDTAS  140

Query  611  HVKDYA---GGYLHGGNKVKD  664
            HVKDYA   GGYL   +KVKD
Sbjct  141  HVKDYAREYGGYLQ--SKVKD  159



>ref|XP_010695618.1| PREDICTED: oleosin 1-like [Beta vulgaris subsp. vulgaris]
Length=160

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = +2

Query  257  SFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplw  436
            +FLRR QD +  PNSSQL GF TL +SGGILL LTGLTLTA +L  IFF P+I++SSP W
Sbjct  21   TFLRRIQDTS--PNSSQLIGFLTLAISGGILLLLTGLTLTAIVLAFIFFAPIIILSSPFW  78

Query  437  ipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHV  616
            +PI   + + + G LS+C FG+A +  LSW YRYYRG HPPGSDRFDYAR+RI  TA  V
Sbjct  79   LPIAVFILVPLVGFLSLCGFGVAALAALSWFYRYYRGLHPPGSDRFDYARNRIATTAREV  138

Query  617  KDYA---GGYLHGGNKVKD  664
            KDYA   GGYLH  +KVKD
Sbjct  139  KDYAREYGGYLH--SKVKD  155



>ref|XP_008364644.1| PREDICTED: oleosin 1-like [Malus domestica]
Length=170

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 123/169 (73%), Gaps = 10/169 (6%)
 Frame = +2

Query  176  MADLQSIPAQNQ---RLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggi  346
            MAD    PAQ Q   R P  +   +   A++FLR+ Q    APNS+QL GF TL+VSG I
Sbjct  1    MADRHQNPAQTQQQQRAPRHSNHNTPTNASTFLRKLQ--GSAPNSTQLVGFLTLLVSGAI  58

Query  347  llfltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSW  526
            LL LTGLT+TAT+LG++FFTPLI++SSP+W+P+G +L +     +S+C FG A +  LSW
Sbjct  59   LLLLTGLTVTATVLGVMFFTPLIIVSSPIWVPLGIILVLTAGFFVSMCGFGAAAVAGLSW  118

Query  527  LYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            +YRY++G HPPGSDR DYARSRI DTA+HVKDYA   GGYLH  +KVKD
Sbjct  119  MYRYFKGMHPPGSDRVDYARSRIYDTASHVKDYAREYGGYLH--SKVKD  165



>ref|XP_009346735.1| PREDICTED: oleosin 1-like [Pyrus x bretschneideri]
Length=170

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 123/169 (73%), Gaps = 10/169 (6%)
 Frame = +2

Query  176  MADLQSIPAQNQ---RLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggi  346
            MAD    PAQ Q   R P  +   +   A++FLR+ Q    APNS+QL GF TL+VSG I
Sbjct  1    MADRHQNPAQTQQQQRAPRHSNHNTPTNASTFLRKLQ--GSAPNSAQLVGFLTLLVSGAI  58

Query  347  llfltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSW  526
            LL LTGLT+TAT+LG+IFFTPLI++SSP+W+P+G VL +     +S+C FG A +  LSW
Sbjct  59   LLLLTGLTVTATVLGVIFFTPLIIVSSPIWVPLGIVLVLTAGFFVSMCGFGAAAVAGLSW  118

Query  527  LYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            +YRY++G HPPGSDR DYARSRI DTA+HVKDYA   GGYLH  +KVKD
Sbjct  119  MYRYFKGMHPPGSDRVDYARSRIYDTASHVKDYAREYGGYLH--SKVKD  165



>ref|XP_009337467.1| PREDICTED: oleosin 1-like [Pyrus x bretschneideri]
Length=172

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 109/138 (79%), Gaps = 7/138 (5%)
 Frame = +2

Query  260  FLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplwi  439
            FLR+ Q HA  PNS+QL GF TL+VSG ILL LTGLT+TAT+LGLI FTP+I+ISSP+W+
Sbjct  34   FLRKLQGHA--PNSTQLVGFLTLLVSGAILLLLTGLTVTATVLGLIIFTPIIIISSPIWV  91

Query  440  piGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVK  619
            P+G VL +     +S+C FG A +  LSW+YRY++G HPPGSDR DYARSRI DTA+HVK
Sbjct  92   PLGAVLVLTAGFFVSMCGFGAAAVAGLSWMYRYFKGMHPPGSDRVDYARSRIYDTASHVK  151

Query  620  DYA---GGYLHGGNKVKD  664
            DYA   GGYLH  +KVKD
Sbjct  152  DYAREYGGYLH--SKVKD  167



>ref|XP_011010368.1| PREDICTED: oleosin 1-like [Populus euphratica]
 ref|XP_011013404.1| PREDICTED: oleosin 1-like [Populus euphratica]
Length=176

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 107/141 (76%), Gaps = 6/141 (4%)
 Frame = +2

Query  251  AASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissp  430
             ++FLR+ Q H    NSSQL G  TL++SG +LL LTG+T+T ++LGL   TPLI+ISSP
Sbjct  34   GSTFLRKLQVHV-GSNSSQLVGLLTLIISGSVLLLLTGITVTGSVLGLTLLTPLIIISSP  92

Query  431  lwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            +WIP+G VLF  +AG LS C FG+AV+  LSW+Y+Y+ G +PPGSD+ DYAR+RI DTA+
Sbjct  93   IWIPMGIVLFFVVAGFLSFCGFGLAVVAGLSWVYKYFTGLNPPGSDQVDYARNRIYDTAS  152

Query  611  HVKDYA---GGYLHGGNKVKD  664
            HVKDYA   GGYL   +KVKD
Sbjct  153  HVKDYAREYGGYLQ--SKVKD  171



>ref|XP_007155152.1| hypothetical protein PHAVU_003G177800g [Phaseolus vulgaris]
 gb|AGV54349.1| oleosin 16 kDa-like protein [Phaseolus vulgaris]
 gb|ESW27146.1| hypothetical protein PHAVU_003G177800g [Phaseolus vulgaris]
Length=160

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 112/166 (67%), Gaps = 14/166 (8%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            MAD    PAQ Q   P         +A+FLR+ QD A  PNS+ L G  TL+V+  + L 
Sbjct  1    MADQYPRPAQAQAQTPSL-------SAAFLRKLQDRA--PNSAHLGGILTLLVTASVFLL  51

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
            L GLTLT  +LGLIFFTPLI++SSP+W+P   +LF+  AG  S C F +A++  LSW+YR
Sbjct  52   LAGLTLTGAVLGLIFFTPLIIVSSPVWVPASILLFVITAGFFSACGFVVALVAALSWMYR  111

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            Y+RG HPPGSD+ DYARSRI DTA+HVKD A   GGYL   +KVKD
Sbjct  112  YFRGLHPPGSDQVDYARSRIYDTASHVKDCAREYGGYLQ--SKVKD  155



>ref|XP_010924760.1| PREDICTED: oleosin 1-like [Elaeis guineensis]
Length=159

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 7/139 (5%)
 Frame = +2

Query  257  SFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplw  436
            + LRR QD A  P S+Q+ GF TLV+SGGILL LTGLTLT T+ GL+FF P+IL++SP+W
Sbjct  20   ALLRRLQDRA--PTSTQVVGFLTLVISGGILLLLTGLTLTGTVAGLVFFGPIILLTSPIW  77

Query  437  ipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHV  616
             P+  V+F+AIAG LS C FG+AV+   +WLYRY+ G HP GSDR DYARSR+ DTA+H+
Sbjct  78   FPVAAVVFLAIAGFLSFCGFGVAVVAGATWLYRYFSGRHPLGSDRVDYARSRVADTASHM  137

Query  617  KDYA---GGYLHGGNKVKD  664
            KDYA   GGYLH  +++KD
Sbjct  138  KDYAREYGGYLH--SRLKD  154



>ref|XP_003549810.1| PREDICTED: oleosin 1-like [Glycine max]
Length=156

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 106/141 (75%), Gaps = 7/141 (5%)
 Frame = +2

Query  251  AASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissp  430
            +A+FLR+ QD    PNS+QL    TL+++  +LL LTGLT+   +LGLIFF PLI++SSP
Sbjct  15   SAAFLRKLQDRG--PNSTQLACILTLLLTASVLLLLTGLTVAGAVLGLIFFLPLIIVSSP  72

Query  431  lwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            +W+P GT LFI  A  LSVC FG+A++  LSW+Y Y+RG HPPGSDR DYARSRI DTA+
Sbjct  73   VWVPAGTFLFIVTAAFLSVCGFGVALVAVLSWMYHYFRGLHPPGSDRVDYARSRIYDTAS  132

Query  611  HVKDYA---GGYLHGGNKVKD  664
            HVKDYA   GGYL   +KVKD
Sbjct  133  HVKDYAREYGGYLQ--SKVKD  151



>ref|XP_006596702.1| PREDICTED: oleosin 1-like, partial [Glycine max]
Length=152

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 5/76 (7%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            GT++FI  AG LSVC FG+A++  LSW+YRY+RG HPPGSDR DYAR+RI DTA+HVKDY
Sbjct  74   GTLVFIVTAGFLSVCGFGVALVAALSWMYRYFRGLHPPGSDRVDYARTRIYDTASHVKDY  133

Query  626  A---GGYLHGGNKVKD  664
            A    GYL   +KVKD
Sbjct  134  ARDYRGYLQ--SKVKD  147



>ref|XP_008810983.1| PREDICTED: oleosin 1-like [Phoenix dactylifera]
Length=159

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 104/138 (75%), Gaps = 7/138 (5%)
 Frame = +2

Query  260  FLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplwi  439
             LRR QD A  P S+Q+ GF TLV+SGGILL LTGLTLT T+  L+FF P+IL++SP+W 
Sbjct  21   LLRRLQDRA--PTSTQVVGFLTLVISGGILLLLTGLTLTGTVAALVFFGPIILLTSPIWF  78

Query  440  piGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVK  619
            P+  V+FI+IAG LS C FG+A +   +WLYRY+ G HP GSDR D ARSRI DTA+H+K
Sbjct  79   PVAAVIFISIAGFLSFCGFGVAAVAGATWLYRYFSGRHPVGSDRVDSARSRIADTASHMK  138

Query  620  DYA---GGYLHGGNKVKD  664
            DYA   GGYLH  +++KD
Sbjct  139  DYAREYGGYLH--SRMKD  154



>ref|XP_002441561.1| hypothetical protein SORBIDRAFT_09g029350 [Sorghum bicolor]
 gb|EES19991.1| hypothetical protein SORBIDRAFT_09g029350 [Sorghum bicolor]
Length=167

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 101/141 (72%), Gaps = 7/141 (5%)
 Frame = +2

Query  251  AASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissp  430
            +A+ LRR Q HA  PNS+Q+ GF TL+VSG +LL LTGLTLT  ++ L+F  P+ L++SP
Sbjct  26   SATLLRRVQTHA--PNSTQVVGFLTLLVSGAVLLLLTGLTLTGAVVALVFLGPIALLTSP  83

Query  431  lwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            +W+PI   LF+  A  LS C F +A +   +W+YRY+ G HP G+DR DYARSRI DTA+
Sbjct  84   IWVPIAVALFVLTAAALSACGFVVAALAVGTWMYRYFTGRHPVGADRVDYARSRIADTAS  143

Query  611  HVKDYA---GGYLHGGNKVKD  664
            HVKDYA   GGYLH  N+ KD
Sbjct  144  HVKDYAREYGGYLH--NRSKD  162



>ref|XP_008800936.1| PREDICTED: oleosin 1-like [Phoenix dactylifera]
Length=159

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 108/151 (72%), Gaps = 9/151 (6%)
 Frame = +2

Query  221  PRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglif  400
            PRA   +  P  + LR  Q H  APNS+Q+ G  TLV+SG ILL LTG+TLT T+ GL+F
Sbjct  10   PRAQRTA--PGQALLR--QLHGRAPNSTQVIGLLTLVISGAILLLLTGVTLTGTVAGLVF  65

Query  401  ftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDY  580
            F P+IL++SP+W PI  V+F+AIAG LSVC  GIA +   +WLYRY+ G HP GSDR DY
Sbjct  66   FGPIILLTSPIWFPIAAVIFMAIAGFLSVCGVGIASVAGATWLYRYFSGRHPVGSDRVDY  125

Query  581  ARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            ARSRI DTA+ +KDYA   GGYL   ++VKD
Sbjct  126  ARSRIADTASQMKDYAREYGGYLQ--SRVKD  154



>ref|XP_010924186.1| PREDICTED: oleosin 1-like [Elaeis guineensis]
Length=159

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 103/142 (73%), Gaps = 5/142 (4%)
 Frame = +2

Query  248  PAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpliliss  427
            PA+      Q H+ APNS+Q+ G  TLV+SG ILL LTG+TLT T+ GL+FF P+IL++S
Sbjct  15   PASGHAILRQLHSRAPNSTQVVGLLTLVISGAILLLLTGVTLTGTVAGLVFFGPVILLTS  74

Query  428  plwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTA  607
            P+W P+  V+F+AIAG LSVC FG+      +WLYRY+ G HP GSDR DYARSRI DTA
Sbjct  75   PIWFPVAAVIFMAIAGFLSVCGFGVVAAAGATWLYRYFSGRHPVGSDRVDYARSRIADTA  134

Query  608  NHVKDYA---GGYLHGGNKVKD  664
            + +KDYA   GGYL   N+VKD
Sbjct  135  SQMKDYAREYGGYLQ--NRVKD  154



>gb|ABK40507.1| pollen oleosin [Lilium longiflorum]
Length=169

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 7/146 (5%)
 Frame = +2

Query  236  ASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpli  415
            ASG   ++ LRR QDH   PNS+QL GF TL++SGGILL LTGLT T+  +G + F PLI
Sbjct  23   ASGGACSNLLRRIQDHV--PNSTQLVGFLTLLISGGILLLLTGLTATSAAMGFVLFAPLI  80

Query  416  lissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRI  595
            L++SP+WIP+ T+ F+  AG LS C FG+A +   +WLYRY  G HP GS+R DYARSRI
Sbjct  81   LLTSPVWIPLVTIFFLLTAGFLSTCGFGVAALAGGTWLYRYLSGRHPLGSERVDYARSRI  140

Query  596  VDTANHVKDYA---GGYLHGGNKVKD  664
             DTA+HVKDYA   GGYL   ++VKD
Sbjct  141  ADTASHVKDYAREYGGYLQ--SRVKD  164



>ref|XP_009392929.1| PREDICTED: oleosin 1-like [Musa acuminata subsp. malaccensis]
Length=166

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 112/167 (67%), Gaps = 10/167 (6%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPA-ASFLRRFQDHAYAPNSSQLFGFFTLVVSggill  352
            MA+ Q+ P       P+   A+G P   S +RR Q+ A  PNS+Q+ GF T VVSG ILL
Sbjct  1    MAERQAGPGVAPSTRPQ--WATGPPGRTSLVRRLQEQA--PNSTQVIGFLTFVVSGAILL  56

Query  353  fltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLY  532
             LTGLTLT  ++ LIFF P+IL+SSP+W+P   V+F+A   +LS C  G+AV+   SWLY
Sbjct  57   LLTGLTLTGAVMALIFFGPIILLSSPIWVPAVFVMFVATVVVLSACGLGVAVLAGSSWLY  116

Query  533  RYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            RY+ G HP GSDR DYARSRI DTA HVKDYA    GYL   ++VKD
Sbjct  117  RYFMGRHPMGSDRVDYARSRIADTATHVKDYAREYSGYLK--SRVKD  161



>gb|AIC74543.1| oleosin-G [Pinus massoniana]
Length=138

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 100/137 (73%), Gaps = 7/137 (5%)
 Frame = +2

Query  263  LRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplwip  442
            +++  DH   PN +Q+ GF TL VSG +LLFLTGLTLT T++GL+  TP+++  SP+ IP
Sbjct  1    MQKIHDHT--PNPTQILGFITLFVSGAVLLFLTGLTLTGTVVGLVVLTPVLIFFSPILIP  58

Query  443  iGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD  622
            + TVLF+A+AG LS   FG+A +  +SWLY Y +G HPPG+D+ DYAR RI DTA HVKD
Sbjct  59   LATVLFVAVAGFLSAGGFGLAALSAISWLYNYIKGRHPPGADQIDYARMRIADTATHVKD  118

Query  623  YA---GGYLHGGNKVKD  664
            YA   GGYL   +K++D
Sbjct  119  YAREYGGYLQ--SKIQD  133



>gb|EYU28276.1| hypothetical protein MIMGU_mgv1a015478mg [Erythranthe guttata]
Length=156

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = +2

Query  239  SGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplil  418
            S     S +++ ++HA  PNS+QL G  TLVVSGGILL L GLTLTAT+L LIFF PLIL
Sbjct  11   SSTAGGSIMQKLREHA--PNSTQLAGLATLVVSGGILLLLAGLTLTATVLSLIFFAPLIL  68

Query  419  issplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIV  598
            ISSP+W PIG ++FI ++G LS   FG+A +   SWLYRY+RGF P GS+RF++AR+RI 
Sbjct  69   ISSPIWFPIGVLIFIVVSGFLSFLGFGVAAVAAASWLYRYFRGFQPVGSNRFEFARTRIA  128

Query  599  DTANHVKDYA---GGYLHGGNKVKD  664
            DTA  +KDYA   GGYLH   KVKD
Sbjct  129  DTAGQMKDYAREYGGYLHA--KVKD  151



>ref|XP_008453362.1| PREDICTED: oleosin 1 [Cucumis melo]
Length=150

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 102/141 (72%), Gaps = 7/141 (5%)
 Frame = +2

Query  251  AASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissp  430
            AA+ LRR Q HA  PNS QL GF TL +S  IL+FLTGLTLTA +L  IF TP +L++SP
Sbjct  9    AATLLRRIQHHA--PNSPQLLGFLTLFISASILIFLTGLTLTAAVLAFIFLTPFLLLTSP  66

Query  431  lwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            +W+P+   LF+A AG+LS+    +A     SW Y+Y++G HPPGSDR +YARSRI DTA+
Sbjct  67   IWLPVAFFLFLATAGVLSLAGLALATAAGCSWAYKYFKGMHPPGSDRLEYARSRIYDTAS  126

Query  611  HVKDYA---GGYLHGGNKVKD  664
            HVKDYA   GGYL   +KVKD
Sbjct  127  HVKDYAREYGGYLQ--SKVKD  145



>ref|XP_006393322.1| hypothetical protein EUTSA_v10011990mg [Eutrema salsugineum]
 gb|ESQ30608.1| hypothetical protein EUTSA_v10011990mg [Eutrema salsugineum]
Length=166

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 7/139 (5%)
 Frame = +2

Query  248  PAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpliliss  427
            P AS LR+ Q HA    S QLFGF    +SGGILL LTG+T+TA++LG I F P+I+ISS
Sbjct  30   PIASLLRQLQPHA-PSYSGQLFGFLAFFISGGILLLLTGITVTASVLGFIAFLPIIIISS  88

Query  428  plwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTA  607
            P+W      LF+ + G LS+  F       +SW+YRYY+G HP GSD+ DYARSRI DTA
Sbjct  89   PIW----IPLFLLVTGFLSLAGFVFGTAAVVSWMYRYYKGMHPIGSDQVDYARSRIYDTA  144

Query  608  NHVKDYAGGYLHGGNKVKD  664
             HVKDYAGGY HG  K+KD
Sbjct  145  AHVKDYAGGYFHG--KLKD  161



>ref|XP_010465964.1| PREDICTED: oleosin 1-like [Camelina sativa]
Length=168

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 11/152 (7%)
 Frame = +2

Query  218  PPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilgli  397
            P    +++G P ASF+ + + H+  P SSQLFG+  L++S GILLFL G+++TA +LG I
Sbjct  20   PTSTNVSNGGPIASFVHQLRSHS--PTSSQLFGYLALLISSGILLFLLGVSVTAAVLGFI  77

Query  398  fftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFD  577
             F PLI+ISSP+WIP    +F+ + G L+V  F +  +  +SW YRY+RG HP GS++ D
Sbjct  78   VFLPLIVISSPIWIP----VFVLVGGFLTVSGFLVGTVAVVSWTYRYFRGMHPVGSNQMD  133

Query  578  YARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            YARSRI DTA+HVKDYA   GGY HG  + KD
Sbjct  134  YARSRIYDTASHVKDYAREYGGYFHG--RAKD  163



>ref|XP_010507004.1| PREDICTED: oleosin 1-like [Camelina sativa]
Length=168

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 11/152 (7%)
 Frame = +2

Query  218  PPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilgli  397
            P    +++G P ASF+ + + H+  P SSQLFG+  L++S GILLFL G+++TA +LG I
Sbjct  20   PTSTNVSNGGPIASFVHQLRSHS--PTSSQLFGYLALLISSGILLFLLGVSVTAAVLGFI  77

Query  398  fftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFD  577
             F PLI+ISSP+WIP    +F+ + G L+V  F +  +  +SW YRY+RG HP GS++ D
Sbjct  78   VFLPLIVISSPIWIP----VFVLVGGFLTVSGFLVGTVAVVSWTYRYFRGMHPVGSNQMD  133

Query  578  YARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            YARSRI DTA+HVKDYA   GGY HG  + KD
Sbjct  134  YARSRIYDTASHVKDYAREYGGYFHG--RAKD  163



>gb|AFG55839.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55840.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55842.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55844.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55845.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55846.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55849.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55850.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
Length=102

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 5/75 (7%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TVLF+A+AG LS   FG+A +  +SWLY Y +G HPPG+D+ DYAR RI DTA+HVKDYA
Sbjct  25   TVLFVAVAGFLSAGGFGLAALSAISWLYNYIKGRHPPGADQIDYARMRIADTASHVKDYA  84

Query  629  ---GGYLHGGNKVKD  664
               GGYL   +K++D
Sbjct  85   REYGGYLQ--SKIQD  97



>ref|XP_009147923.1| PREDICTED: oleosin 16 kDa-like [Brassica rapa]
Length=161

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 104/162 (64%), Gaps = 12/162 (7%)
 Frame = +2

Query  179  ADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPN-SSQLFGFFTLVVSggillf  355
            +D+Q  P       PR+   +  P ASFLR+ Q  A  PN S QLFG     +SGGILL 
Sbjct  3    SDIQHRPVYGSTTVPRSTNINN-PVASFLRQLQSKA--PNHSGQLFGLLAFFISGGILLL  59

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVC--TFGIAVILTLSWL  529
            LTG+T+TA +LG I F P+I+ISSP+W      LF+ + G LS+    FG A ++  SW 
Sbjct  60   LTGITVTAFVLGFIAFLPIIIISSPIW----IPLFLLVTGFLSLAGMVFGTAALI--SWT  113

Query  530  YRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLHGGNK  655
            YRY++G HP GSD+ DYARSRI DTA HVKDYAGGY HG  K
Sbjct  114  YRYFKGMHPVGSDQVDYARSRIFDTAAHVKDYAGGYFHGKQK  155



>ref|XP_004961136.1| PREDICTED: oleosin 16 kDa-like [Setaria italica]
Length=166

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 98/138 (71%), Gaps = 5/138 (4%)
 Frame = +2

Query  251  AASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissp  430
            +A+ LRR Q HA  PNS+Q+ GF TL+VSG +LL LTGLTLT  ++ L+F  P+ L++SP
Sbjct  25   SATLLRRVQTHA--PNSTQVVGFLTLLVSGAVLLLLTGLTLTGAVVALVFLGPIALLTSP  82

Query  431  lwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            +W+P+     +  A  LS C F +A +   +W+YRY+ G HP G+DR DYARSRI DTA+
Sbjct  83   IWVPVAVAAAVLAAVALSACGFAVAALAAGTWMYRYFTGRHPVGADRMDYARSRIADTAS  142

Query  611  HVKDYA---GGYLHGGNK  655
            HVKDYA   GGYLHG +K
Sbjct  143  HVKDYAREYGGYLHGRSK  160



>ref|XP_009107324.1| PREDICTED: oleosin 16 kDa-like [Brassica rapa]
Length=166

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 108/169 (64%), Gaps = 14/169 (8%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIAS------GVPAASFLRRFQDHAYAPNSSQLFGFFTLVVS  337
            MAD  S P+  Q+ P  + IA         P ASFLR+ Q  +   +S Q FG     +S
Sbjct  1    MADRTS-PSHIQQRPYGSTIAPPRGNNINHPIASFLRQLQSQS-PEHSRQRFGLLVFFIS  58

Query  338  ggillfltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILT  517
            GGILL LTG+T+TA +LG I F P+I+ISSP+W      LF+ + G LSV  F  +  + 
Sbjct  59   GGILLLLTGITVTAFVLGFIAFLPIIIISSPIW----IPLFLLVTGFLSVAGFLFSTAVV  114

Query  518  LSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLHGGNKVKD  664
            +SW+YRY++G HP GS++ DYARSRI DTA HVKDYAGGY HG  K+KD
Sbjct  115  MSWMYRYFKGMHPVGSEQVDYARSRIYDTAAHVKDYAGGYFHG--KLKD  161



>gb|AFG55837.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55838.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55841.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55843.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55847.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55848.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
 gb|AFG55851.1| hypothetical protein 2_3802_02, partial [Pinus taeda]
Length=102

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 5/74 (7%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA-  628
            VLF+A+AG LS   FG+A +  +SWLY Y +G HPPG+D+ DYAR RI DTA+HVKDYA 
Sbjct  26   VLFVAVAGFLSAGGFGLAALSAISWLYNYIKGRHPPGADQIDYARMRIADTASHVKDYAR  85

Query  629  --GGYLHGGNKVKD  664
              GGYL   +K++D
Sbjct  86   EYGGYLQ--SKIQD  97



>ref|XP_010506995.1| PREDICTED: oleosin 1-like [Camelina sativa]
Length=182

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 11/151 (7%)
 Frame = +2

Query  221  PRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglif  400
            P +   S  P ASF+ + + H+  P SSQLFG+  L++S GILLFL G+++TA +LG I 
Sbjct  35   PTSTNVSNGPIASFVHQLRSHS--PTSSQLFGYLALLISSGILLFLLGVSVTAAVLGFIV  92

Query  401  ftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDY  580
            F PLI+ISSP+WIP    +F+ + G L+V  F +  +  +SW YRY+RG HP GS++ DY
Sbjct  93   FLPLIVISSPIWIP----IFVLVGGFLTVSGFLVGTVAVVSWTYRYFRGMHPVGSNQMDY  148

Query  581  ARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            ARSRI DTA+HVKDYA   GGY HG  + KD
Sbjct  149  ARSRIYDTASHVKDYAREYGGYFHG--RAKD  177



>gb|KFK39208.1| hypothetical protein AALP_AA3G213400 [Arabis alpina]
Length=164

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = +2

Query  239  SGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplil  418
            S  P AS LR+ Q H+  P S+Q+FGF  L +S GILLFL G T  AT LG I F PLI+
Sbjct  23   SNSPIASLLRQLQSHS--PTSTQVFGFLALFISSGILLFLLGATAIATALGFIAFLPLIV  80

Query  419  issplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIV  598
            +SSP+WIP    +F+ + G L+V    + V+  +SW YRY+RG HP GSD+ DYARSRI 
Sbjct  81   LSSPIWIP----VFVLVGGFLTVTGSLLGVVALVSWTYRYFRGMHPVGSDQMDYARSRIY  136

Query  599  DTANHVKDYA---GGYLHGGNKVKD  664
            DTA+HVKDYA   GGY HG  + KD
Sbjct  137  DTASHVKDYAREYGGYFHG--RAKD  159



>gb|KFK36050.1| hypothetical protein AALP_AA4G071400 [Arabis alpina]
Length=169

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            LF  + G LS+  F +     +SW YRYY+G HP GSD+ DYARSRI DTA HVKDYAGG
Sbjct  97   LFFLVTGFLSLAGFLVGTAAVVSWTYRYYKGMHPVGSDQVDYARSRIYDTAAHVKDYAGG  156

Query  635  YLHGGNKVKD  664
            Y HG  KVKD
Sbjct  157  YFHG--KVKD  164



>ref|XP_006842689.1| hypothetical protein AMTR_s00147p00069460 [Amborella trichopoda]
 gb|ERN04364.1| hypothetical protein AMTR_s00147p00069460 [Amborella trichopoda]
Length=168

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 7/138 (5%)
 Frame = +2

Query  260  FLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplwi  439
            F++R Q+HA  PNS+Q+ G  TLV+SG ILL LTGLTL AT +GLI  TPL+L+SSP+WI
Sbjct  30   FIQRLQEHA--PNSTQVIGLLTLVISGAILLLLTGLTLAATTVGLIVITPLVLLSSPVWI  87

Query  440  piGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVK  619
            P+   L +A +G ++V  FG+AV+  L+W+YRY +G HP GSDR DYAR R+ DTA+ +K
Sbjct  88   PVLAFLGVAASGFVAVTGFGLAVLGGLTWMYRYIKGRHPVGSDRVDYARMRLTDTASQMK  147

Query  620  DYA---GGYLHGGNKVKD  664
            DYA    GYL G  KVKD
Sbjct  148  DYARDYRGYLQG--KVKD  163



>ref|NP_188487.1| Oleosin family protein [Arabidopsis thaliana]
 dbj|BAB02215.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO42120.1| putative oleosin [Arabidopsis thaliana]
 gb|AAO50491.1| putative oleosin [Arabidopsis thaliana]
 gb|AEE76118.1| Oleosin family protein [Arabidopsis thaliana]
Length=166

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = +2

Query  239  SGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplil  418
            S  P +SF  + + H+  P SSQLFGF  L +S GILLFL G+++TA +LG I F PLI+
Sbjct  25   SNSPISSFFHQLRSHS--PTSSQLFGFLALFISTGILLFLLGVSVTAAVLGFIVFLPLII  82

Query  419  issplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIV  598
            ISSP+W      +F+ + G L+V  F +  +  +SW YRY+RG HP GS++ DYARSRI 
Sbjct  83   ISSPIW----IPVFVVVGGFLTVSGFLVGTVALVSWTYRYFRGMHPVGSNQMDYARSRIY  138

Query  599  DTANHVKDYA---GGYLHGGNKVKD  664
            DTA+HVKDYA   GGY HG  + KD
Sbjct  139  DTASHVKDYAREYGGYFHG--RAKD  161



>ref|XP_002862467.1| hypothetical protein ARALYDRAFT_497429 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002885263.1| hypothetical protein ARALYDRAFT_479362 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38725.1| hypothetical protein ARALYDRAFT_497429 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61522.1| hypothetical protein ARALYDRAFT_479362 [Arabidopsis lyrata subsp. 
lyrata]
Length=165

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 97/145 (67%), Gaps = 11/145 (8%)
 Frame = +2

Query  239  SGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplil  418
            S  P AS   + + H+  P SSQLFGF  L +S GILLFL G+++TA +LG I F PLI+
Sbjct  26   SNSPIASVFHQLRSHS--PTSSQLFGFLALFISSGILLFLLGVSVTAAVLGFIVFLPLII  83

Query  419  issplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIV  598
            ISSP+W      +F+ + G L+V  F +  +  LSW YRY+RG HP GS++ DYARSRI 
Sbjct  84   ISSPIW----IPVFVLVGGFLTVSGFLVGTVTVLSWTYRYFRGMHPVGSNQMDYARSRIY  139

Query  599  DTANHVKDYA---GGYLHGGNKVKD  664
            DTA+HVKDYA   GGY HG  + KD
Sbjct  140  DTASHVKDYAREYGGYFHG--RAKD  162



>ref|XP_004154931.1| PREDICTED: oleosin 16 kDa-like [Cucumis sativus]
Length=150

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 100/140 (71%), Gaps = 7/140 (5%)
 Frame = +2

Query  254  ASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilisspl  433
            AS LRR Q HA  PNS QL GF TL +S  IL+FLTGLTLTA +L  IF TP +L++SP+
Sbjct  10   ASLLRRIQYHA--PNSPQLLGFLTLFISASILIFLTGLTLTAAVLAFIFLTPFLLLTSPI  67

Query  434  wipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANH  613
            W+P+   LF+A AG+LS+    +A    LSW Y+Y++G HPPGSDR +YA  RI DTA+H
Sbjct  68   WLPVAFFLFLATAGILSLAGLALATAAGLSWAYKYFKGMHPPGSDRLEYASRRIYDTASH  127

Query  614  VKDYA---GGYLHGGNKVKD  664
            VKDYA   GGYL   +KVKD
Sbjct  128  VKDYAREYGGYLQ--SKVKD  145



>emb|CDX99345.1| BnaC05g34600D [Brassica napus]
Length=165

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 97/142 (68%), Gaps = 11/142 (8%)
 Frame = +2

Query  248  PAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpliliss  427
            P AS +R  + H+  P SSQLFGF  L +SGGILLFL G+T+T   +G + F PLI+ISS
Sbjct  27   PYASLIRLLRSHS--PTSSQLFGFLALFISGGILLFLLGVTVTVVGIGFVVFLPLIIISS  84

Query  428  plwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTA  607
            P+WIP    +FI + G LSV  F +  +  +SW YRY+RG HP GSD+ DYAR RI DTA
Sbjct  85   PVWIP----VFIGVGGFLSVAGFLVGTLAVVSWAYRYFRGRHPVGSDQMDYARGRIYDTA  140

Query  608  NHVKDYA---GGYLHGGNKVKD  664
            +HVKDYA   GGY HG  + KD
Sbjct  141  SHVKDYAREYGGYFHG--RAKD  160



>ref|XP_006406591.1| hypothetical protein EUTSA_v10021947mg [Eutrema salsugineum]
 gb|ESQ48044.1| hypothetical protein EUTSA_v10021947mg [Eutrema salsugineum]
Length=165

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 95/140 (68%), Gaps = 11/140 (8%)
 Frame = +2

Query  254  ASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilisspl  433
            AS LR  + H+  P SSQLFGF  L +S GILLFL G+T TAT +  I F P+I++SSP+
Sbjct  29   ASLLRLLRSHS--PTSSQLFGFLALFISTGILLFLLGVTATATTIAFIVFLPVIIVSSPI  86

Query  434  wipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANH  613
            WIP    +F+ + G L+V  F +  +  + W YRY+RG HP GSD+ DYARSRI DTA+H
Sbjct  87   WIP----IFVIVVGFLTVTGFLVGTVAVVLWTYRYFRGMHPVGSDQMDYARSRIYDTASH  142

Query  614  VKDYA---GGYLHGGNKVKD  664
            VKDYA   GGY HG  + KD
Sbjct  143  VKDYAREYGGYFHG--RAKD  160



>ref|XP_004138225.1| PREDICTED: oleosin 16 kDa-like [Cucumis sativus]
 gb|KGN63794.1| hypothetical protein Csa_1G015860 [Cucumis sativus]
Length=150

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 100/140 (71%), Gaps = 7/140 (5%)
 Frame = +2

Query  254  ASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilisspl  433
            AS LRR Q HA  PNS QL GF TL +S  IL+FLTGLTLTA +L  IF TP +L++SP+
Sbjct  10   ASLLRRIQYHA--PNSPQLLGFLTLFISASILIFLTGLTLTAAVLAFIFLTPFLLLTSPI  67

Query  434  wipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANH  613
            W+P+   LF+A AG+LS+    +A    LSW Y+Y++G HPPGSDR +YA  RI DTA+H
Sbjct  68   WLPVAFFLFLATAGVLSLAGLALATAAGLSWAYKYFKGMHPPGSDRLEYASRRIYDTASH  127

Query  614  VKDYA---GGYLHGGNKVKD  664
            VKDYA   GGYL   +KVKD
Sbjct  128  VKDYAREYGGYLQ--SKVKD  145



>emb|CDY62847.1| BnaA06g03370D [Brassica napus]
Length=517

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 107/162 (66%), Gaps = 12/162 (7%)
 Frame = +2

Query  179  ADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPN-SSQLFGFFTLVVSggillf  355
            +D+Q  P       PR+   +  P ASFLR+ Q  + APN S QLFG     +SGGILL 
Sbjct  359  SDIQHRPVYGSTTVPRSTNINN-PVASFLRQLQ--SKAPNHSGQLFGLLAFFISGGILLL  415

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVC--TFGIAVILTLSWL  529
            LTG+T+TA +LG I F P+I+ISSP+W      LF+ ++G LS+    FG A ++  SW 
Sbjct  416  LTGITVTAFVLGFIAFLPIIIISSPIW----IPLFLLVSGFLSLAGMVFGTAALI--SWT  469

Query  530  YRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLHGGNK  655
            YRY++G HP GSD+ DYARSRI DTA HVKDYAGGY+HG  K
Sbjct  470  YRYFKGMHPVGSDQVDYARSRIFDTAAHVKDYAGGYIHGKQK  511



>ref|XP_009145881.1| PREDICTED: oleosin 1-like [Brassica rapa]
Length=165

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 11/142 (8%)
 Frame = +2

Query  248  PAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpliliss  427
            P AS LR  + H+  P SSQLFG   L +SGGILLFL G+T+TA  +G + F PLI+ISS
Sbjct  27   PYASLLRLLRSHS--PTSSQLFGLLALFISGGILLFLLGVTVTAVGIGFVVFLPLIIISS  84

Query  428  plwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTA  607
            P+WIP    +FI + G LSV  F +  +  +SW YRY+RG HP GSD+ DYAR RI DTA
Sbjct  85   PVWIP----VFIGVGGFLSVAGFLVGTLAVVSWAYRYFRGRHPVGSDQMDYARGRIYDTA  140

Query  608  NHVKDYA---GGYLHGGNKVKD  664
            +HVKDYA   GGY HG  + KD
Sbjct  141  SHVKDYAREYGGYFHG--RAKD  160



>ref|XP_010500440.1| PREDICTED: oleosin 16 kDa-like [Camelina sativa]
Length=169

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            LF+ + G LS+  F  A  + +SWLYRY++G HP GSD+ DYARSRI DTA HVKDYAGG
Sbjct  97   LFLLVTGFLSLAGFLFATGVVVSWLYRYFKGMHPIGSDQVDYARSRIYDTAAHVKDYAGG  156

Query  635  YLHGGNKVKD  664
            Y H  + +KD
Sbjct  157  YFH--STLKD  164



>ref|XP_006306473.1| hypothetical protein CARUB_v10012438mg [Capsella rubella]
 gb|EOA39371.1| hypothetical protein CARUB_v10012438mg [Capsella rubella]
Length=171

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            LFI + G LS+  F  A    ++WLYRY++G HP GSD+ DYARSRI DTA HVKDYAGG
Sbjct  99   LFILVTGFLSLAGFLFATGAFVTWLYRYFKGMHPIGSDQVDYARSRIHDTAAHVKDYAGG  158

Query  635  YLHGGNK  655
            Y HG  K
Sbjct  159  YFHGTLK  165



>ref|XP_009404978.1| PREDICTED: oleosin 1-like [Musa acuminata subsp. malaccensis]
Length=168

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 7/139 (5%)
 Frame = +2

Query  257  SFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplw  436
            S LRR Q HA  P+S+Q+ GF TLV+SG ILL L GLTL   +LGL FF P++L++SP+W
Sbjct  29   SLLRRLQGHA--PSSNQVVGFLTLVISGCILLVLAGLTLAGAVLGLTFFGPIVLLTSPMW  86

Query  437  ipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHV  616
            +P+G V+F+  A +LS C FG+A +   SWLY Y+ G  P GSDR D ARSRI D  + V
Sbjct  87   VPVGFVMFVVSAAVLSACGFGVAALAGASWLYNYFMGRQPAGSDRVDCARSRIADGPSDV  146

Query  617  KDYA---GGYLHGGNKVKD  664
             DYA   GGY    ++VKD
Sbjct  147  TDYAREHGGYAR--SRVKD  163



>emb|CDX92248.1| BnaA05g21590D [Brassica napus]
Length=165

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 11/142 (8%)
 Frame = +2

Query  248  PAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpliliss  427
            P AS +R  + H+  P SSQLFG   L +SGGILLFL GLT+TA  +G + F PLI+ISS
Sbjct  27   PYASLVRLLRSHS--PTSSQLFGLLALFISGGILLFLLGLTVTAVGIGFVVFLPLIIISS  84

Query  428  plwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTA  607
            P+WIP    +FI + G LSV  F +  +  +SW YRY+RG HP GSD+ DYAR RI DTA
Sbjct  85   PVWIP----VFIGVGGFLSVAGFLVGTLAVVSWAYRYFRGRHPVGSDQMDYARGRIYDTA  140

Query  608  NHVKDYA---GGYLHGGNKVKD  664
            +HVKDYA   GGY HG  + KD
Sbjct  141  SHVKDYAREYGGYFHG--RAKD  160



>emb|CDY51173.1| BnaC06g02430D [Brassica napus]
Length=517

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 103/161 (64%), Gaps = 10/161 (6%)
 Frame = +2

Query  179  ADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfl  358
            +D+Q  P       PR+   +  P ASFLR+ Q  A   +S QLFG     +SGGILL L
Sbjct  359  SDIQHRPVYGSTTVPRSTNINN-PVASFLRQLQSKARN-HSGQLFGLLAFFISGGILLLL  416

Query  359  tgltltatilglifftplilissplwipiGTVLFIAIAGLLSVC--TFGIAVILTLSWLY  532
            TG+T+TA +LG I F P+I+ISSP+W      LF+ + G LS+    FG A ++  SW Y
Sbjct  417  TGITVTAFVLGFIAFLPIIIISSPIW----IPLFLLVTGFLSLAGMVFGTAALI--SWTY  470

Query  533  RYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLHGGNK  655
            RY++G HP GSD+ DYARSRI DTA HVKDYAGGY HG  K
Sbjct  471  RYFKGMHPVGSDQVDYARSRIFDTAAHVKDYAGGYFHGKQK  511



>ref|XP_010461720.1| PREDICTED: oleosin 16 kDa-like [Camelina sativa]
Length=169

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            LF+ + G LS+  F  A    +SWLYRY++G HP GSD+ DYARSRI DTA HVKDYAGG
Sbjct  97   LFLLVTGFLSLAGFLFATGAVVSWLYRYFKGMHPIGSDQVDYARSRIHDTAAHVKDYAGG  156

Query  635  YLHGGNKVKD  664
            Y H  + +KD
Sbjct  157  YFH--STLKD  164



>ref|XP_010479327.1| PREDICTED: oleosin 16 kDa-like [Camelina sativa]
Length=169

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            LF+ + G LS+  F  A    +SWLYRY++G HP GSD+ DYARSRI +TA HVKDYAGG
Sbjct  97   LFLLVTGFLSLAGFLFATGAVVSWLYRYFKGMHPIGSDQVDYARSRIHETAAHVKDYAGG  156

Query  635  YLHGGNKVKD  664
            Y H  + +KD
Sbjct  157  YFH--STLKD  164



>ref|XP_006300117.1| hypothetical protein CARUB_v10016346mg [Capsella rubella]
 gb|EOA33015.1| hypothetical protein CARUB_v10016346mg [Capsella rubella]
Length=166

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 11/142 (8%)
 Frame = +2

Query  248  PAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpliliss  427
            P AS + + + H+  P SSQLFGF  L +S GILL L G+++TA +LG I F PLI++SS
Sbjct  28   PIASLVHQLRSHS--PTSSQLFGFLALFISSGILLLLLGVSVTAALLGFIVFLPLIILSS  85

Query  428  plwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTA  607
            P+WIP    +F+ + G L+V  F +  +  +SW YRY+RG HP GS++ DYARSRI DTA
Sbjct  86   PIWIP----VFVLVGGFLTVSGFLVGTVAVVSWTYRYFRGMHPVGSNQMDYARSRIYDTA  141

Query  608  NHVKDYA---GGYLHGGNKVKD  664
            +HVKDYA   GGY HG  + KD
Sbjct  142  SHVKDYAREYGGYFHG--RAKD  161



>ref|XP_002891470.1| hypothetical protein ARALYDRAFT_474043 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67729.1| hypothetical protein ARALYDRAFT_474043 [Arabidopsis lyrata subsp. 
lyrata]
Length=168

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            LF+ + G LSV     A    + WLYRY++G HP GSD+ DYARSRI DTA HVKDYAGG
Sbjct  98   LFLVVTGFLSVAGSLFATGAVVLWLYRYFKGMHPLGSDQVDYARSRIHDTAAHVKDYAGG  157

Query  635  YLHGGNKVKD  664
            Y HG   +KD
Sbjct  158  YFHG--TLKD  165



>ref|NP_175329.1| Oleosin-like protein [Arabidopsis thaliana]
 gb|AAF69712.1|AC016041_17 F27J15.22 [Arabidopsis thaliana]
 dbj|BAC42839.1| putative oleosin protein [Arabidopsis thaliana]
 gb|AAO63989.1| putative oleosin [Arabidopsis thaliana]
 gb|AEE32378.1| Oleosin-like protein [Arabidopsis thaliana]
Length=169

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            LF+ + G LS+    +A    +SWLYRY++G HP  SD+ DYARSRI DTA HVKDYAGG
Sbjct  97   LFLIVTGFLSLAGLILATGAVVSWLYRYFKGMHPLRSDQVDYARSRIHDTAAHVKDYAGG  156

Query  635  YLHGGNKVKD  664
            Y HG   +KD
Sbjct  157  YFHG--TLKD  164



>ref|XP_006655620.1| PREDICTED: oleosin 16 kDa-like, partial [Oryza brachyantha]
Length=129

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = +2

Query  296  NSSQLFGFFTLVVSggillfltgltltatilglifftplilissplwipiGTVLFIAIAG  475
            NS+Q+ GF TL +SG +LL LTGLTLT  ++ LIF  P+ L++SP+W+P+   LF+  A 
Sbjct  1    NSTQVVGFLTLAISGAVLLLLTGLTLTGAVVALIFLGPIALLTSPIWVPVAIALFVLAAA  60

Query  476  LLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHG  646
            +LS C F +A +   +W+YRY+ G HP G+DR DYARSRI DTA+HVKDYA   GGYLH 
Sbjct  61   VLSTCAFAVAAVAGGTWMYRYFTGRHPVGADRVDYARSRIADTASHVKDYAREYGGYLH-  119

Query  647  GNKVKD  664
             ++ KD
Sbjct  120  -SRAKD  124



>emb|CDY06745.1| BnaA10g05240D [Brassica napus]
 emb|CDX95515.1| BnaC01g34070D [Brassica napus]
Length=164

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 97/143 (68%), Gaps = 11/143 (8%)
 Frame = +2

Query  245  VPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilis  424
            +P AS LR  + H+  P SS LFGF  L++SGG+L FL G+T+TAT  G I F PLI+IS
Sbjct  25   IPYASLLRLLRYHS--PTSSHLFGFLALLISGGLLTFLLGVTVTATAFGFIAFLPLIIIS  82

Query  425  splwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDT  604
             P+W+P G+VL   + G L+V  F +  +  +SW YRY+RG H  GSD+ DYAR RI DT
Sbjct  83   GPIWLP-GSVL---VGGCLTVVGFLVGTVAIVSWTYRYFRGMHLAGSDQMDYARGRIYDT  138

Query  605  ANHVKDYA---GGYLHGGNKVKD  664
            A+HVKDYA   GGY HG  + KD
Sbjct  139  ASHVKDYAREYGGYFHG--RAKD  159



>gb|ACI87763.1| putative oleosin [Cupressus sempervirens]
Length=88

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            G +LF+   GLLS   F  AV+    W Y Y  G  PPGSD+ DYAR RIVDTANHVKDY
Sbjct  10   GALLFVTFLGLLSAGLFVAAVVFGALWFYNYLNGRRPPGSDQVDYARMRIVDTANHVKDY  69

Query  626  A---GGYLHGGNK  655
            A   GGYL G  +
Sbjct  70   AKEYGGYLQGNKQ  82



>emb|CDX82338.1| BnaA03g34830D [Brassica napus]
Length=165

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 49/73 (67%), Gaps = 5/73 (7%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA--  628
            +F+ +   LSV  F +  +   SW YRYYRG HP GSD+ DYARSRI DTA+HVKDYA  
Sbjct  90   VFVVVGVFLSVAGFLVGTLALGSWTYRYYRGMHPVGSDQMDYARSRIYDTASHVKDYARE  149

Query  629  -GGYLHGGNKVKD  664
             GGY HG  + KD
Sbjct  150  YGGYFHG--RAKD  160



>emb|CDX75969.1| BnaC03g40520D [Brassica napus]
Length=165

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 49/73 (67%), Gaps = 5/73 (7%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA--  628
            +FI +   LSV  F +  +   SW YRYYRG HP GS++ DYARSRI DTA+HVKDYA  
Sbjct  90   VFIVVGVFLSVAGFLVGTLALASWTYRYYRGMHPVGSNQMDYARSRIYDTASHVKDYARE  149

Query  629  -GGYLHGGNKVKD  664
             GGY HG  + KD
Sbjct  150  YGGYFHG--RAKD  160



>ref|XP_009136039.1| PREDICTED: oleosin 1-like [Brassica rapa]
Length=176

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 49/73 (67%), Gaps = 5/73 (7%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA--  628
            +F+ +   LSV  F +  +   SW YRYYRG HP GSD+ DYARSRI DTA+HVKDYA  
Sbjct  101  VFVVVGVFLSVAGFLVGTLALGSWTYRYYRGMHPVGSDQMDYARSRIYDTASHVKDYARE  160

Query  629  -GGYLHGGNKVKD  664
             GGY HG  + KD
Sbjct  161  YGGYFHG--RAKD  171



>gb|AIA08667.1| putative oleosin protein [Marchantia polymorpha]
Length=158

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  YAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplwipiGTVLFIA  466
            ++PN SQ+ G  T++ +  +LL + GL L    + +   TP+++  SP+ IP+ T+ F++
Sbjct  21   HSPNQSQVIGLVTIITAILLLLTIGGLLLGGAAIVVTLVTPVLVFFSPILIPLATIFFLS  80

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLHG  646
             AG++S   FG+A      WLY Y +G HP GSDR D A+SR+VDTA+H+K+ A GY+HG
Sbjct  81   TAGIVSAGGFGLAAYSASRWLYEYVKGRHPVGSDRVDAAKSRLVDTASHLKERASGYVHG  140



>gb|ACA30297.1| putative oleosin [Cupressus sempervirens]
Length=131

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            G +LF+   GLLS   F  AV+    W Y Y  G  PPGSD+ DYAR RIVDTANHVKDY
Sbjct  10   GALLFVTFLGLLSAGLFVAAVVFGALWFYNYLNGRRPPGSDQVDYARMRIVDTANHVKDY  69

Query  626  A---GGYLHGGNK  655
            A   GGYL G  +
Sbjct  70   AKEYGGYLQGNKQ  82



>emb|CDY18527.1| BnaA01g26680D [Brassica napus]
Length=164

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = +2

Query  248  PAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpliliss  427
            P  S LR  + H+  P SS LFGF  L++SG +L FL G++LTAT LG I F PLI+IS 
Sbjct  26   PYPSLLRLLRSHS--PTSSHLFGFLALLISGCLLTFLLGVSLTATALGFIAFLPLIIISG  83

Query  428  plwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTA  607
            P+W+P     F+ +   L+V  F +  +  +SW YRY+R  HP GSD+ DYAR RI DTA
Sbjct  84   PIWLPG----FVLVGRCLTVVRFLVGTVAIVSWTYRYFREMHPAGSDQMDYARGRIYDTA  139

Query  608  NHVKDYA---GGYLHGGNK  655
            +HVKDYA   GGY HG  K
Sbjct  140  SHVKDYARKYGGYFHGRAK  158



>ref|XP_009112642.1| PREDICTED: oleosin 1-like [Brassica rapa]
Length=164

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 92/142 (65%), Gaps = 11/142 (8%)
 Frame = +2

Query  248  PAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpliliss  427
            P  S LR  + H+  P +S LFGF  L++SG +L FL G++LTAT LG I F PLI+IS 
Sbjct  26   PYPSLLRLLRSHS--PTASHLFGFLALLISGCLLTFLLGVSLTATALGFIAFLPLIIISG  83

Query  428  plwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTA  607
            P+W+P     F+ +   L+V  F +  +  +SW YRY+R  HP GSD+ DYAR RI DTA
Sbjct  84   PIWLPG----FVLVGRCLTVVRFLVGTVAIVSWTYRYFREMHPAGSDQMDYARGRIYDTA  139

Query  608  NHVKDYA---GGYLHGGNKVKD  664
            +HVKDYA   GGY HG  + KD
Sbjct  140  SHVKDYARKYGGYFHG--RAKD  159



>gb|ACG37867.1| oleosin Bn-V [Zea mays]
Length=147

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 92/140 (66%), Gaps = 17/140 (12%)
 Frame = +2

Query  254  ASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilisspl  433
            A+ +RR Q  A  PNS+Q+ GF TL+VSG +LL LTG+TLT  ++ L+F  P+ L++SP+
Sbjct  17   ATLVRRVQTRA--PNSTQVVGFLTLLVSGAVLLLLTGVTLTGAVVALVFLGPIALLTSPI  74

Query  434  wipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANH  613
            W+P+  V+   +A  L V T          W+YRY+ G HP G+DR DYARSRI DTA+H
Sbjct  75   WVPVAVVISAIVAAALPVAT----------WMYRYFTGRHPVGADRVDYARSRIADTASH  124

Query  614  VKDYA---GGYLHGGNKVKD  664
            VKDYA   GGYL    + KD
Sbjct  125  VKDYAREYGGYLR--TRAKD  142



>ref|NP_001152711.1| oleosin Bn-V [Zea mays]
 gb|ACG49090.1| oleosin Bn-V [Zea mays]
 gb|AFW81207.1| oleosin Bn-V [Zea mays]
Length=157

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 96/140 (69%), Gaps = 7/140 (5%)
 Frame = +2

Query  254  ASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilisspl  433
            A+ LRR Q  A  PNS+Q+ GF TL+VSG +LL LTG+TLT  ++ L+F  P+ L++SP+
Sbjct  17   ATLLRRVQTRA--PNSTQVVGFLTLLVSGAVLLLLTGVTLTGAVVALVFLGPIALLTSPI  74

Query  434  wipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANH  613
            W+P+  V+   +A  LS C F  A +   +W+YRY+ G HP G+DR DYARSRI DTA+H
Sbjct  75   WVPVAVVISAIVAAALSACAFAAAALPVATWMYRYFTGRHPVGADRVDYARSRIADTASH  134

Query  614  VKDYA---GGYLHGGNKVKD  664
            VKDYA   GGYL    + KD
Sbjct  135  VKDYAREYGGYLR--TRAKD  152



>ref|XP_010548141.1| PREDICTED: oleosin 1-like [Tarenaya hassleriana]
Length=156

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 96/146 (66%), Gaps = 11/146 (8%)
 Frame = +2

Query  236  ASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpli  415
              G  AA+ LR+ + H   P S+QLFGF    +SGGILLFLTG+T+TA++LG I F PLI
Sbjct  14   GGGHNAAALLRQLRSHG--PTSAQLFGFLAFFISGGILLFLTGVTVTASVLGFIAFLPLI  71

Query  416  lissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRI  595
            +ISSP+W      + + + G L+V    +     +SW YRY RG HP GSD+ DYAR+RI
Sbjct  72   IISSPVW----VPVVVLVGGFLTVAGSIVGTAAVVSWTYRYLRGMHPVGSDQVDYARTRI  127

Query  596  VDTANHVKDYA---GGYLHGGNKVKD  664
             DTA HVKDYA   GGYL   ++VKD
Sbjct  128  YDTAAHVKDYAREYGGYLQ--SRVKD  151



>ref|XP_009608158.1| PREDICTED: oleosin 16.4 kDa-like [Nicotiana tomentosiformis]
Length=136

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 97/140 (69%), Gaps = 15/140 (11%)
 Frame = +2

Query  203  QNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltat  382
             +QR P R +  +     SFLR+ Q H   PNS+QL GF TLV+SGGILL LTGLTLTA 
Sbjct  12   NSQRPPLRPIHTTTHHVPSFLRKLQQHV--PNSTQLMGFLTLVISGGILLLLTGLTLTAI  69

Query  383  ilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPG  562
            ILGLIFFTPLIL+SSP+W+PIGT+LFIA++G LSVC FG +    +SW YRY++      
Sbjct  70   ILGLIFFTPLILVSSPIWVPIGTLLFIAVSGFLSVCGFGASTFAAVSWAYRYFK------  123

Query  563  SDRFDYARSRIVDTANHVKD  622
                   RSRI DTA+ +KD
Sbjct  124  -------RSRIADTASRMKD  136



>ref|XP_009763151.1| PREDICTED: oleosin 16.4 kDa-like [Nicotiana sylvestris]
Length=133

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 94/140 (67%), Gaps = 17/140 (12%)
 Frame = +2

Query  203  QNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltat  382
             N + PP   I +      FLR+ Q H   PNS+QL GF TLV+SGGILL LTGLTLTA 
Sbjct  11   HNSQRPPLRPIHTTT--HQFLRKLQQHV--PNSTQLMGFLTLVISGGILLLLTGLTLTAI  66

Query  383  ilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPG  562
            ILGLIFFTPLIL+SSP+W+P GT+LFIA++G LSVC FG +    +SW YRY++      
Sbjct  67   ILGLIFFTPLILVSSPIWVPTGTLLFIAVSGFLSVCGFGASTFAAISWAYRYFK------  120

Query  563  SDRFDYARSRIVDTANHVKD  622
                   RSRI DTA H+KD
Sbjct  121  -------RSRIADTATHMKD  133



>ref|NP_001056403.1| Os05g0576700 [Oryza sativa Japonica Group]
 gb|AAT39147.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18317.1| Os05g0576700 [Oryza sativa Japonica Group]
 gb|EAY99143.1| hypothetical protein OsI_21102 [Oryza sativa Indica Group]
 dbj|BAG88788.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98388.1| unnamed protein product [Oryza sativa Japonica Group]
Length=173

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 5/51 (10%)
 Frame = +2

Query  521  SWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            +W+YRY+ G HP G+DR DYARSRI DTA+HVKDYA   GGYLH  ++ KD
Sbjct  120  TWMYRYFTGRHPVGADRVDYARSRIADTASHVKDYAREYGGYLH--SRAKD  168



>ref|XP_002275496.1| PREDICTED: oleosin 1 [Vitis vinifera]
 emb|CAN74835.1| hypothetical protein VITISV_023324 [Vitis vinifera]
Length=146

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            GTV+F+A  G L     G+  ++ LSWLY Y  G HPPG+D+ DYAR RI + A  +K+ 
Sbjct  68   GTVIFLATTGFLFSGCCGVTALMALSWLYEYVAGKHPPGADQLDYARMRIANKARDMKER  127

Query  626  A---GGYLH  643
            A   G Y+H
Sbjct  128  AKEYGQYVH  136



>gb|KHN05978.1| hypothetical protein glysoja_046115 [Glycine soja]
Length=52

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 5/49 (10%)
 Frame = +2

Query  527  LYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            +YRY+RG HPPGSDR DYARSRI DTA+HVKDYA    GYL   +KVKD
Sbjct  1    MYRYFRGLHPPGSDRVDYARSRIYDTASHVKDYARDYRGYLQ--SKVKD  47



>gb|EEE64794.1| hypothetical protein OsJ_19650 [Oryza sativa Japonica Group]
Length=222

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 5/51 (10%)
 Frame = +2

Query  521  SWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            +W+YRY+ G HP G+DR DYARSRI DTA+HVKDYA   GGYLH  ++ KD
Sbjct  169  TWMYRYFTGRHPVGADRVDYARSRIADTASHVKDYAREYGGYLH--SRAKD  217



>ref|XP_003527133.2| PREDICTED: oleosin Bn-V-like [Glycine max]
Length=191

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = +2

Query  260  FLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplwi  439
             LR+ + H    NS+QLFG  TL+++G ILL LTGLT+  ++LGLI F PLI+++SP+WI
Sbjct  62   LLRKLRHHV--ANSNQLFGVLTLLITGSILLLLTGLTIVGSVLGLILFAPLIIVTSPIWI  119

Query  440  piGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGF-HPPGSDRFDYARSRIVDTANHV  616
            P+  VLF+  A  LS+C FGI V+  L+W+YRY++G  HPPGS+R  +A +R+ D A ++
Sbjct  120  PLCAVLFLVTAMFLSMCGFGIVVLAVLTWMYRYFKGLHHPPGSNRVSHALNRVKDRAGNL  179

Query  617  KD  622
              
Sbjct  180  NS  181



>ref|XP_007012203.1| Oleosin [Theobroma cacao]
 gb|AAM46778.1|AF466103_1 15.8 kDa oleosin [Theobroma cacao]
 gb|EOY29822.1| Oleosin [Theobroma cacao]
Length=147

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            G V+F+ I G L     G+A I  LSW+Y Y RG HPPG+D+ DYAR+ +  TA  + + 
Sbjct  69   GVVIFLVITGFLFSGGCGVAAITALSWIYNYVRGKHPPGADQLDYARNTLARTARDMTEK  128

Query  626  AGGY  637
            A  Y
Sbjct  129  AKEY  132



>ref|XP_010047300.1| PREDICTED: oleosin 1 [Eucalyptus grandis]
 gb|KCW79182.1| hypothetical protein EUGRSUZ_C00618 [Eucalyptus grandis]
Length=148

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            G  + +  AG L+   FG A +  L+W+YRY+ G HP G ++ +YAR++I DTA  VK+ 
Sbjct  70   GIAVALITAGFLASGGFGAAAVTALTWMYRYFAGKHPAGEEQVEYARAKIADTARDVKEK  129

Query  626  AGGY  637
            A  Y
Sbjct  130  AKEY  133



>ref|XP_003565870.1| PREDICTED: oleosin 16 kDa-like [Brachypodium distachyon]
Length=183

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = +2

Query  530  YRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---GGYLHGGNKVKD  664
            YRY+ G HP G+DR DYARSRI DTA HVKDYA   GGYLHG  + KD
Sbjct  133  YRYFTGRHPVGADRVDYARSRIADTATHVKDYAREYGGYLHG--RAKD  178



>ref|NP_001237482.1| uncharacterized protein LOC100306353 [Glycine max]
 gb|ACU14486.1| unknown [Glycine max]
Length=147

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLHG  646
            G L+   FG+A I  L+W+YRY  G  PPG+D+ D AR +I+D A  +KDY    + G
Sbjct  86   GFLASSGFGVAAITVLAWIYRYVTGKQPPGADQLDSARHKIMDKAREIKDYGQQQISG  143



>ref|XP_010109129.1| Oleosin 1 [Morus notabilis]
 gb|EXC21058.1| Oleosin 1 [Morus notabilis]
Length=148

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G L+   FG+A I  LSW+YRY  G HPPG+D+ D AR ++   A  +KD A
Sbjct  79   ITGFLASGGFGVAAISVLSWIYRYVTGKHPPGADQLDQARHKLASKAREMKDKA  132



>ref|XP_010536555.1| PREDICTED: oleosin 18.5 kDa-like [Tarenaya hassleriana]
Length=144

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G LS   FGIA I   SW+YRY  G HPPG+D+ D AR ++   A  +KD A
Sbjct  77   ITGFLSSGGFGIAAITVFSWIYRYVTGKHPPGADKLDSARMKLASKAQDLKDRA  130



>ref|XP_002966097.1| hypothetical protein SELMODRAFT_28429, partial [Selaginella moellendorffii]
 ref|XP_002971390.1| hypothetical protein SELMODRAFT_18413, partial [Selaginella moellendorffii]
 gb|EFJ27139.1| hypothetical protein SELMODRAFT_18413, partial [Selaginella moellendorffii]
 gb|EFJ33517.1| hypothetical protein SELMODRAFT_28429, partial [Selaginella moellendorffii]
Length=146

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 78/134 (58%), Gaps = 5/134 (4%)
 Frame = +2

Query  251  AASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissp  430
            A   +++ Q+ +  PNS Q+ G  T++    + L + G+TL  T+L L+  +P+ L+ SP
Sbjct  5    ARGMMQKIQERS--PNSKQVLGLLTIITGVVVALVIGGVTLGGTVLTLLLASPVFLLLSP  62

Query  431  lwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            + +PIG V+ +A  G LS     +     +SWLY Y RG HP G+D+ D A+ RI DTA+
Sbjct  63   VLVPIGIVIALATGGFLSASAVFVGFCSVVSWLYNYARGRHPVGADQIDAAKHRIADTAS  122

Query  611  HVKDYA---GGYLH  643
            HV + A    GYL 
Sbjct  123  HVTEKAREVTGYLQ  136



>ref|XP_010551164.1| PREDICTED: oleosin 16 kDa-like [Tarenaya hassleriana]
Length=155

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 95/142 (67%), Gaps = 11/142 (8%)
 Frame = +2

Query  248  PAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftpliliss  427
            P A  LR+ Q H   P S QLFGF  L +SGGILLFLTG+T+TA++LG I F PLI++SS
Sbjct  17   PIADLLRQLQTHV--PTSGQLFGFLALFISGGILLFLTGVTVTASVLGFIAFLPLIILSS  74

Query  428  plwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTA  607
            P+W+P    +   +   L+V    +AV+  ++W YRY RG HP GS + DYAR+RI DTA
Sbjct  75   PIWVP----MVFLLGMFLAVGGSVVAVVAVVTWTYRYLRGMHPVGSGQVDYARARIYDTA  130

Query  608  NHVKDYA---GGYLHGGNKVKD  664
             HV+ YA   GGYL   +KVKD
Sbjct  131  AHVQVYARDYGGYLQ--SKVKD  150



>emb|CDP05381.1| unnamed protein product [Coffea canephora]
Length=135

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            G  +F+ + G LS   FG+A +  LSW+YRY  G +PPG+D+ D AR ++   A  +KD 
Sbjct  60   GITVFLLVTGFLSSGGFGVAALSVLSWIYRYVTGKNPPGADQLDRARQKLALKAREMKDR  119

Query  626  AGGY  637
            A  Y
Sbjct  120  AEQY  123



>ref|XP_009778273.1| PREDICTED: oleosin 1-like [Nicotiana sylvestris]
Length=146

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ ++G L+   FG+A I  LSW+YRY  G  PPG+D+ ++AR R+   A  +KD A
Sbjct  75   IFMLVSGFLASGGFGVAAISVLSWIYRYVTGKRPPGADQLEHARHRLATKAGEMKDRA  132



>gb|AAO65960.1| oleosin [Corylus avellana]
Length=140

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G L+   FG+A +  LSW+YRY  G HPPG+D+ D+AR ++   A  +KD A
Sbjct  73   IMGFLASGGFGVAAVTVLSWIYRYVTGRHPPGADQLDHARMKLASKAREMKDRA  126



>gb|ABQ57397.1| oleosin L-isoform [Ficus pumila var. awkeotsang]
Length=153

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            L + I G L+   FG+A +  LSW+YRY  G HPPG+D+ D AR ++   A  +KD A
Sbjct  80   LGLIIIGFLASGGFGVAALTVLSWIYRYVTGKHPPGADQLDQARHKLASKAREMKDKA  137



>ref|XP_009601962.1| PREDICTED: oleosin 1-like [Nicotiana tomentosiformis]
Length=146

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ ++G L+   FG+A I  LSW+YRY  G  PPG+D+ ++AR R+   A  +KD A
Sbjct  75   IFMLVSGFLASGGFGVAAISVLSWIYRYVTGKRPPGADQLEHARHRLATKAGEMKDRA  132



>ref|XP_006450748.1| hypothetical protein CICLE_v10009815mg [Citrus clementina]
 ref|XP_006476125.1| PREDICTED: oleosin 1-like [Citrus sinensis]
 gb|ESR63988.1| hypothetical protein CICLE_v10009815mg [Citrus clementina]
 gb|KDO79938.1| hypothetical protein CISIN_1g045010mg [Citrus sinensis]
Length=146

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            +F+A  G L     G+  I  LSW+Y Y +G HPPG+D  DYAR++I D A  + + A  
Sbjct  71   VFLATVGFLVSGGCGVTAITVLSWIYSYVKGKHPPGADHLDYARTKIADKARDMTERAKE  130

Query  635  Y  637
            Y
Sbjct  131  Y  131



>gb|AFR46652.1| oleosin1 [Plukenetia volubilis]
Length=143

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAG  631
            V+F+   G     + G+A I+ L+W+Y Y  G HPPG+DR DYAR +I   A+ +K+ A 
Sbjct  65   VVFLVTCGFFFSGSCGLAAIMVLTWMYNYLTGKHPPGADRLDYARGQIARKAHDMKERAK  124

Query  632  GY  637
             Y
Sbjct  125  EY  126



>ref|XP_004488373.1| PREDICTED: major oleosin NAP-II-like [Cicer arietinum]
Length=137

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 87/147 (59%), Gaps = 10/147 (7%)
 Frame = +2

Query  176  MADLQSIPAQNQRLPPRAMIASGVPAASFLRRFQDHAYAPNSSQLFGFFTLVVSggillf  355
            MAD    P Q Q+ P    I     A+S LR      +  NS+QLFG  TL+++  I L 
Sbjct  1    MAD-NYYPTQAQK-PKPTTITIATSASSLLRN-----HVSNSTQLFGLLTLLITWAISLV  53

Query  356  ltgltltatilglifftplilissplwipiGTVLFIAIAGLLSVCTFGIAVILTLSWLYR  535
            LTGLT+  TI+GLIFF P+I++ SP+W+P   +LF+   G LS C FGI V+  L+W++R
Sbjct  54   LTGLTVIITIMGLIFFAPVIILLSPIWVPSFAILFVFTVGFLSTCGFGIVVVAILTWMFR  113

Query  536  YYRGFHPPGSDRFDYARSRIVDTANHV  616
            Y+RG HP          S+++DTA  V
Sbjct  114  YFRGLHPSAGHGLP---SKLIDTAASV  137



>gb|AAU21501.1| oleosin 3 [Arachis hypogaea]
Length=166

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            L +A  G L     G+A I  LSWLY Y  G HP GSDR DYA+  I D A  VKD A  
Sbjct  93   LALAAGGFLFSGGCGVAAIAALSWLYSYVTGKHPAGSDRLDYAKGVIADKARDVKDRAKD  152

Query  635  YLHGG  649
            Y   G
Sbjct  153  YAGAG  157



>gb|AHI54563.1| OleIII, partial [Camellia japonica]
Length=126

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G L+   FG+A I  LSW+YRY  G HPPG+D+ D AR+++   A  +KD A
Sbjct  73   IMGFLTSGGFGVAGISVLSWIYRYVTGKHPPGADQLDQARTKLASKAREMKDRA  126



>gb|AAZ20277.1| oleosin 2 [Arachis hypogaea]
Length=137

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +2

Query  452  VLFIAIAGL--LSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            V+ +A+ GL  L+   FG+A I  L+W+YRY  G HPPG+++ D AR +++  A  +KDY
Sbjct  67   VITVALLGLGFLASGGFGVAAITVLTWIYRYVTGKHPPGANQLDTARHKLMSKAREIKDY  126

Query  626  A  628
             
Sbjct  127  G  127



>gb|ACH85188.1| main allergen 15 kDa oleosin [Sesamum indicum]
Length=145

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+  AG L+   FG+A +  LSW+YRY  G HPPG+D+ + A++++   A  +KD A
Sbjct  74   IFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRA  131



>ref|XP_010555609.1| PREDICTED: oleosin Bn-III-like [Tarenaya hassleriana]
Length=144

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAG--GYL  640
            + G L+   FGIA I   SW+YRY  G HPPG+D+ D AR ++   A  +KD A   G  
Sbjct  74   VTGFLASGGFGIAAITVFSWIYRYVTGRHPPGADKLDSARLKLASKAQEMKDRAQQFGQQ  133

Query  641  HGGN  652
            H G 
Sbjct  134  HTGG  137



>gb|AAD42942.1|AF091840_1 15 kDa oleosin [Sesamum indicum]
 gb|ACH85187.1| main allergen 15 kDa oleosin [Sesamum indicum]
Length=145

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+  AG L+   FG+A +  LSW+YRY  G HPPG+D+ + A++++   A  +KD A
Sbjct  74   IFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRA  131



>ref|XP_010038411.1| PREDICTED: oleosin 1-like [Eucalyptus grandis]
 gb|KCW46234.1| hypothetical protein EUGRSUZ_K00124 [Eucalyptus grandis]
Length=149

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G L+   FG+A +  LSW+YRY  G HPPG+D+ D AR ++   A  +KD A
Sbjct  84   IMGFLASGGFGVAAVTVLSWIYRYVTGKHPPGADQLDQARMKLASKAREMKDRA  137



>ref|XP_002281746.1| PREDICTED: oleosin 1 [Vitis vinifera]
 emb|CAN69350.1| hypothetical protein VITISV_012978 [Vitis vinifera]
Length=144

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAG-  631
            +F  + G L+   FG+A +  LSW+YRY  G HPPG+D  D AR ++   A  +KD A  
Sbjct  74   VFFLVLGFLASGGFGVAAVTVLSWIYRYVTGRHPPGADHLDSARMKLASKAREMKDRAEQ  133

Query  632  -GYLHGGNK  655
             G  H G +
Sbjct  134  FGQQHTGQQ  142



>ref|XP_003591653.1| Oleosin [Medicago truncatula]
 gb|AES61904.1| oleosin [Medicago truncatula]
Length=149

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  494  FGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLHG  646
            FG+A I  L+W+YRY  G HPPG+D+ D AR ++++ A  +KDY    + G
Sbjct  95   FGVAAITVLAWIYRYVTGKHPPGADQLDTARHKLMNKAREIKDYGQQQISG  145



>gb|ABB01617.1| oleosin low molecular weight isoform [Linum usitatissimum]
 gb|ABB01622.1| oleosin low molecular weight isoform [Linum usitatissimum]
Length=155

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G L+   FG+A +  LSW+YRY  G HP G D  D ARS++   A  VKD A
Sbjct  87   ITGFLASGGFGVAAVTVLSWIYRYVTGGHPAGGDSLDQARSKLAGKAREVKDRA  140



>gb|ABF57563.1| OleIII [Camellia oleifera]
Length=140

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G L+   FG+A I  LSW+YRY  G HPPG+D+ D AR+++   A  +KD A
Sbjct  75   GFLASGGFGVAGISVLSWIYRYVTGKHPPGADQLDQARTKLASKAREMKDRA  126



>ref|XP_009404312.1| PREDICTED: oleosin 16 kDa-like [Musa acuminata subsp. malaccensis]
Length=141

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+   G L+   FG+A +  LSW+Y+Y  G HPPG+D+ D AR R+   A  +K+ A
Sbjct  75   VFLVATGFLTSGGFGLAALSVLSWMYKYLTGKHPPGADQLDQARQRLASKARDIKESA  132



>ref|XP_003556321.1| PREDICTED: oleosin 1-like isoform 1 [Glycine max]
Length=147

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLHG  646
            G L+   FG+A I  L+W+YRY  G +PPG+D+ D A  +I+D A  +KDY    + G
Sbjct  86   GFLASGGFGVAAITVLAWIYRYVTGKYPPGADQLDSAPHKIMDKAREIKDYGQQQISG  143



>gb|AAZ20276.1| oleosin 1 [Arachis hypogaea]
Length=137

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +2

Query  452  VLFIAIAGL--LSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            V+ +A+ GL  L+   FG+A I  L+W+YRY  G HPPG+++ D AR +++  A  +KD+
Sbjct  67   VITVALLGLGFLASGGFGVAAITVLTWIYRYVTGKHPPGANQLDTARHKLMGKAREIKDF  126

Query  626  A  628
             
Sbjct  127  G  127



>gb|ABB01618.1| oleosin low molecular weight isoform [Linum usitatissimum]
 gb|ABB01621.1| oleosin low molecular weight isoform [Linum usitatissimum]
Length=155

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G L+   FG+A +  LSW+YRY  G HP G+D  + ARSR+   A  VKD A
Sbjct  87   ITGFLASGGFGVAAVTVLSWIYRYVTGGHPVGADSLEQARSRLAGKAREVKDRA  140



>gb|AAX49390.1| OLE-2 [Coffea canephora]
Length=135

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            G  +F+ + G LS   FG+A +  LSW+Y Y  G +PPG+D+ D AR ++   A  +KD 
Sbjct  60   GITVFLLVTGFLSSGGFGVAALSVLSWIYGYVTGKNPPGADQLDRARQKLALKAREMKDR  119

Query  626  AGGY  637
            A  Y
Sbjct  120  AEQY  123



>ref|XP_002516493.1| Oleosin, putative [Ricinus communis]
 gb|EEF45834.1| Oleosin, putative [Ricinus communis]
Length=232

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAG  631
            V+F+  +G       G+A I++L+W+Y+Y  G HPPG+D+ DYAR +I   A+ +K+ A 
Sbjct  154  VVFLVCSGFFFSGGCGLAAIMSLTWMYKYLTGKHPPGADKLDYARGQIARKAHDMKERAK  213

Query  632  GY  637
             Y
Sbjct  214  EY  215



>gb|KFK32534.1| hypothetical protein AALP_AA6G255700 [Arabis alpina]
Length=143

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  461  IAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I  AG L    +G+A +  LSW+YRY  G HP GSDR DYARS I + A  +  YA
Sbjct  76   ILTAGFLFSGGYGVAAVTALSWIYRYVTGKHPIGSDRVDYARSMISEKAKELGHYA  131



>ref|XP_004146901.1| PREDICTED: oleosin 18.5 kDa-like [Cucumis sativus]
 ref|XP_004172267.1| PREDICTED: oleosin 18.5 kDa-like [Cucumis sativus]
 gb|KGN53169.1| hypothetical protein Csa_4G023040 [Cucumis sativus]
Length=142

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G L+   FG+A I   SW+YRY  G HPPG+D+ D AR ++   A  +KD A
Sbjct  75   IMGFLASGGFGVAGITVFSWIYRYVTGKHPPGADQLDLARHKLASKAREMKDRA  128



>ref|XP_011076526.1| PREDICTED: oleosin 1-like [Sesamum indicum]
Length=224

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+  AG L+   FG+A +  LSW+YRY  G HPPG+D+ + A++++   A  +KD A
Sbjct  153  IFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRA  210



>ref|XP_008453870.1| PREDICTED: oleosin 1-like [Cucumis melo]
Length=142

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G L+   FG+A I   SW+YRY  G HPPG+D+ D AR ++   A  +KD A
Sbjct  75   IMGFLASGGFGVAGITVFSWIYRYVTGKHPPGADQLDLARHKLASKAREMKDRA  128



>gb|ABB01620.1| oleosin low molecular weight isoform [Linum usitatissimum]
Length=142

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGY  637
            I G L+   FG+A I  LSW+YRY  G HP G+D  D AR RI   A  +KD A  +
Sbjct  75   ITGFLASGGFGVAAITVLSWIYRYVTGRHPVGADSLDQARMRITGKAREMKDRASDF  131



>ref|XP_006421522.1| hypothetical protein CICLE_v10006168mg [Citrus clementina]
 gb|ESR34762.1| hypothetical protein CICLE_v10006168mg [Citrus clementina]
 gb|KDO39225.1| hypothetical protein CISIN_1g041282mg [Citrus sinensis]
Length=144

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G L+   FG+A I  LSW+YRY  G HPPG+D+ + AR ++   A  ++D A
Sbjct  76   IMGFLASGGFGVAAISVLSWIYRYVTGGHPPGADQLEQARMKLASKAREMRDRA  129



>gb|AFP19885.1| 14.3 kDa oleosin [Jatropha curcas]
 gb|KDP22471.1| hypothetical protein JCGZ_26302 [Jatropha curcas]
Length=137

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TV  I I G L+   FG+A I  LSW+YRY  G HPPG++  D AR ++   A  +KD A
Sbjct  67   TVCLI-ITGFLASGGFGVAAISVLSWIYRYVTGKHPPGAESLDQARLKLAGKAREMKDRA  125



>ref|XP_006490018.1| PREDICTED: oleosin 1-like [Citrus sinensis]
 emb|CAA88360.1| oleosin-like protein [Citrus sinensis]
 gb|KDO40159.1| hypothetical protein CISIN_1g040357mg [Citrus sinensis]
 prf||2119230A oleosin homolog
Length=144

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G L+   FG+A I  LSW+YRY  G HPPG+D+ + AR ++   A  ++D A
Sbjct  76   IMGFLASGGFGVAAISVLSWIYRYVTGGHPPGADQLEQARMKLAGKAREMRDRA  129



>gb|EPS62608.1| oleosin [Genlisea aurea]
Length=147

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            +F+  +G L+   FG+A +  LSW++R+  G HPPG+D+ + AR R+   A  +KD A  
Sbjct  76   VFVIASGFLASGGFGVAALSVLSWIFRFVTGKHPPGADQVETARDRLAVKAKEMKDKADQ  135

Query  635  YLH  643
            + H
Sbjct  136  FGH  138



>gb|ABB01619.1| oleosin low molecular weight isoform [Linum usitatissimum]
Length=143

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +2

Query  461  IAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGY  637
            + I G L+   FG+A I  LSW+YRY  G HP G+D  D AR RI   A  +KD A  +
Sbjct  74   LVITGFLASGGFGVAAITVLSWIYRYVTGRHPVGADSLDQARMRISGKAREMKDRASDF  132



>ref|XP_006357933.1| PREDICTED: oleosin 1-like [Solanum tuberosum]
Length=148

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            LF+  +G L+   FG+A I  LSW+YRY  G  PPG+D+ + AR ++   A  +KD A
Sbjct  77   LFLLFSGFLASGGFGVAAISVLSWIYRYVTGKRPPGADQLEQARRKLATKAGEMKDKA  134



>ref|XP_003631370.1| PREDICTED: oleosin 1 [Vitis vinifera]
 emb|CAN68989.1| hypothetical protein VITISV_017729 [Vitis vinifera]
Length=133

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+A +GL++   FG++ +    WLY+Y RG HP G+DR D AR ++   A  VK+ A
Sbjct  65   VFLAASGLVASGGFGVSAVSVFLWLYKYVRGQHPVGADRLDRARDKLTGKAMEVKERA  122



>ref|XP_004307777.1| PREDICTED: oleosin 1-like [Fragaria vesca subsp. vesca]
Length=157

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 3/71 (4%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TV  I + G L+   FG+A I  LSW+Y+Y  G HPPG+D+ D AR ++   A  +KD A
Sbjct  78   TVALI-MTGFLASGGFGVAAISVLSWIYKYVTGSHPPGADKLDSARHKLAGKARDMKDRA  136

Query  629  G--GYLHGGNK  655
               G  H G +
Sbjct  137  EQFGQQHMGTE  147



>ref|XP_011019556.1| PREDICTED: oleosin 1-like [Populus euphratica]
Length=239

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            V+F+  +G       G+A I+   W+Y Y  G HPPG+D+ DYAR RI +TA  +KD A
Sbjct  161  VVFLVTSGFFFSSGCGLAAIMVSLWIYNYVTGKHPPGADKLDYARGRISETAKDMKDRA  219



>ref|XP_008444982.1| PREDICTED: oleosin 1-like [Cucumis melo]
Length=134

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TVL +A AGL    T  +  +  LSWLYRY  G  P G+++ D+A+ +IV+ A  +K+ A
Sbjct  70   TVLVLAAAGLFFSATCVVGAVAALSWLYRYMTGNQPAGAEQLDFAKDKIVEMAKEMKEKA  129

Query  629  GGYLH  643
               L+
Sbjct  130  TQELY  134



>gb|ADB03184.1| oleosin I [Vernicia fordii]
Length=137

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ + G L+   FG+A I  LSW+YRY  G  PPG++  D AR ++   A  +KD A
Sbjct  68   VFLIVTGFLASGGFGVAAISVLSWIYRYVTGKQPPGAESLDQARMKLAGKAREMKDRA  125



>ref|XP_006413337.1| hypothetical protein EUTSA_v10027215mg [Eutrema salsugineum]
 gb|ESQ54790.1| hypothetical protein EUTSA_v10027215mg [Eutrema salsugineum]
Length=176

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAG--GYL  640
            I G LS   FGIA I   SW+Y+Y  G HP GSDR D AR ++   A  +KD A   G  
Sbjct  100  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDRLDSARMKLGSKAQDLKDRAQYYGQH  159

Query  641  HGGNKVKD  664
             GG   +D
Sbjct  160  TGGEHDRD  167



>ref|XP_004240765.1| PREDICTED: oleosin 1 [Solanum lycopersicum]
Length=147

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            LF+  +G L+   FG+A +  LSW+YRY  G  PPG+D+ + AR ++   A  +KD A
Sbjct  76   LFLLFSGFLASGGFGVAAVSVLSWIYRYVTGKRPPGADQLEQARHKLATKAGEMKDKA  133



>gb|ACH91012.1| oleosin isoform OLE500a [Cocos nucifera]
Length=79

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ +AG ++   FG+A +  LSW+Y+Y  G  PPGS++ + AR+R+   A  +K+ A
Sbjct  12   VFLLVAGFVTSGGFGLAALSVLSWMYKYLTGRRPPGSEQLEQARARLASKARDIKESA  69



>ref|XP_009606946.1| PREDICTED: oleosin 1-like [Nicotiana tomentosiformis]
Length=143

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            LF  + G L+   FG+A I  LSW+YRY  G HPPG+ + +YAR ++   A  +K+ A
Sbjct  74   LFFLMFGFLASGGFGVAAISVLSWIYRYVTGRHPPGAVQLEYARDKLATKAREMKERA  131



>ref|XP_006853752.1| hypothetical protein AMTR_s00056p00188310 [Amborella trichopoda]
 gb|ERN15219.1| hypothetical protein AMTR_s00056p00188310 [Amborella trichopoda]
Length=147

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            G  +F+A+ G L    FG+A +  L+W+Y Y  G HP GSD+ D AR  +   A  +K+ 
Sbjct  70   GIAIFLAVTGFLFSGGFGVAALSALAWIYNYVTGKHPVGSDKIDRARMTLASKAKDMKEK  129

Query  626  AGGY  637
            A  Y
Sbjct  130  AKQY  133



>ref|XP_010433682.1| PREDICTED: oleosin 18.5 kDa [Camelina sativa]
 ref|XP_010448472.1| PREDICTED: oleosin 18.5 kDa [Camelina sativa]
Length=181

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+YRY  G HP GSD+ D AR ++   A  +KD   Y G  
Sbjct  104  ITGFLSSGGFGIAAITVFSWIYRYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQYYGQQ  163

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  164  HTGGEHDRD  172



>ref|XP_002869688.1| hypothetical protein ARALYDRAFT_492319 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45947.1| hypothetical protein ARALYDRAFT_492319 [Arabidopsis lyrata subsp. 
lyrata]
Length=173

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSDR D AR ++   A  +KD   Y G  
Sbjct  96   ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDRLDSARMKLGSKAQDLKDRAQYYGQQ  155

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  156  HTGGEHDRD  164



>gb|AET74077.1| oleosin [Juglans regia]
Length=139

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TV  I I G L+   FG+A +  LSW+YRY  G  PPG+++ D AR R+   A  +KD A
Sbjct  68   TVALI-ILGFLASGGFGVAAVTVLSWIYRYVTGRQPPGAEQIDQARMRLASKAREMKDRA  126



>ref|XP_010438923.1| PREDICTED: oleosin 18.5 kDa-like [Camelina sativa]
Length=181

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSDR D AR ++   A  +KD   Y G  
Sbjct  104  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDRLDSARMKLGSKAQDLKDRAQYYGQQ  163

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  164  HTGGEHDRD  172



>gb|KHN23715.1| hypothetical protein glysoja_046821 [Glycine soja]
Length=61

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  479  LSVCTFGIAVILTLSWLYRYYRGF-HPPGSDRFDYARSRIVDTANHVK  619
            LS+C FGI V+  L+W+YRY++G  HPPGS+R  +A +R+ D A ++ 
Sbjct  3    LSMCGFGIVVLAVLTWMYRYFKGLHHPPGSNRVSHALNRVKDRAGNLN  50



>emb|CDX77269.1| BnaC08g03140D [Brassica napus]
Length=140

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRI  595
            LF+ + G LSV  F  +    +SW+YRY++G HP GS++ DYARSRI
Sbjct  94   LFLLVTGFLSVAGFLFSTAAVMSWMYRYFKGMHPVGSEQVDYARSRI  140



>gb|ABF57560.1| OleII [Camellia oleifera]
 gb|AHI54564.1| OleII, partial [Camellia japonica]
Length=141

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G ++   FG+A +  LSW+YRY  G  PPG+++ DYAR ++   A  +KD A
Sbjct  73   ILGFVASGGFGLAAVSVLSWIYRYVTGKQPPGAEQLDYARMKLASKAREMKDKA  126



>ref|XP_004956407.1| PREDICTED: oleosin Zm-I-like [Setaria italica]
Length=154

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            L +  AG ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +KD A
Sbjct  87   LALMAAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKDAA  144



>sp|Q96543.1|OLE16_BROSE RecName: Full=Oleosin 16 kDa [Bromus secalinus]
 gb|AAB67992.1| oleosin [Bromus secalinus]
Length=167

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  470  AGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            AG ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +KD A
Sbjct  105  AGFVTSGGLGVAAVSVFSWMYKYLAGKHPPGADQLDHAKARLASKARDIKDAA  157



>emb|CDY08967.1| BnaC08g11970D [Brassica napus]
Length=179

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD   Y G  
Sbjct  101  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDIKDRAQYYGQQ  160

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  161  HTGGEHDRD  169



>gb|KFK29003.1| hypothetical protein AALP_AA7G076700 [Arabis alpina]
Length=194

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSDR D AR ++   A  +KD   Y G  
Sbjct  113  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDRLDSARMKLGSKAQDLKDRAHYYGQQ  172

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  173  HTGGEHDRD  181



>gb|EYU20173.1| hypothetical protein MIMGU_mgv1a015301mg [Erythranthe guttata]
Length=162

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+  +G L+   FG+A +  +SW+YRY  G HP G+D+ D AR+++   A  +KD A
Sbjct  89   IFLLGSGFLASGGFGVAALSVMSWIYRYVTGKHPVGADQLDTARTKLAGKAREMKDRA  146



>ref|XP_002309527.2| hypothetical protein POPTR_0006s25150g, partial [Populus trichocarpa]
 gb|EEE93050.2| hypothetical protein POPTR_0006s25150g, partial [Populus trichocarpa]
Length=185

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            V+F+  +G       G+A I+   W+Y Y  G HPPG+D+ DYA  RI +TA  +KD A
Sbjct  107  VVFLVASGFFFSSGCGLAAIMVSLWIYNYVTGKHPPGADKLDYAGGRIAETAKDMKDRA  165



>gb|EPS60535.1| hypothetical protein M569_14267, partial [Genlisea aurea]
Length=148

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD  622
            V F+  AG L+   F  A  ++ +W+Y Y+ G +PPG  R DYAR+RI DTA HVKD
Sbjct  78   VSFVVAAGGLAAIVFATAAAVSGAWVYSYFMGLNPPGWTRVDYARNRIADTAGHVKD  134



>gb|ABW90150.2| oleosin 3 [Jatropha curcas]
Length=137

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TV  I I G L+   FG+A I  L W+YRY  G HPPG++  D AR ++   A  +KD A
Sbjct  67   TVCLI-ITGFLASGGFGVAAIFVLFWIYRYVTGKHPPGAENLDQARLKLAGKAREMKDRA  125



>ref|XP_009109224.1| PREDICTED: oleosin 18.5 kDa [Brassica rapa]
 emb|CDY24856.1| BnaA08g14540D [Brassica napus]
Length=180

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD   Y G  
Sbjct  100  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGTKAQDIKDRAQYYGQQ  159

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  160  HTGGEHDRD  168



>sp|P29109.1|OLEO5_BRANA RecName: Full=Oleosin Bn-V; Short=BnV, partial [Brassica napus]
 emb|CAA45313.1| oleosin BN-V [Brassica napus]
Length=183

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD--YAGGYL  640
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD  Y  G  
Sbjct  98   ITGFLSSGAFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDMKDRAYYYGQQ  157

Query  641  HGGNK  655
            H G +
Sbjct  158  HTGEE  162



>emb|CDY03377.1| BnaC01g17050D [Brassica napus]
Length=170

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD   Y G  
Sbjct  93   ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQYYGQQ  152

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  153  HTGGEHDRD  161



>ref|XP_007218565.1| hypothetical protein PRUPE_ppa012948mg [Prunus persica]
 sp|Q43804.1|OLEO1_PRUDU RecName: Full=Oleosin 1 [Prunus dulcis]
 emb|CAA55008.1| oleosin [Prunus dulcis]
 gb|EMJ19764.1| hypothetical protein PRUPE_ppa012948mg [Prunus persica]
Length=148

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TV  I + G L+   FG+A +  LSW+Y+Y  G  PPG+D+ D AR ++   A  +KD A
Sbjct  74   TVALITM-GFLTSGGFGVAAVTVLSWIYKYVTGKQPPGADQLDQARHKLAGKARDIKDRA  132



>emb|CAA57995.1| low molecular weight oleosin [Hordeum vulgare subsp. vulgare]
Length=158

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            L +  AG ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +KD A
Sbjct  91   LALMSAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKDAA  148



>ref|XP_006285813.1| hypothetical protein CARUB_v10007289mg [Capsella rubella]
 gb|EOA18711.1| hypothetical protein CARUB_v10007289mg [Capsella rubella]
Length=183

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD   Y G  
Sbjct  106  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQYYGQQ  165

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  166  HTGGEHDRD  174



>dbj|BAJ85423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            L +  AG ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +KD A
Sbjct  92   LALMSAGFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKDAA  149



>ref|NP_194244.1| oleosin 1 [Arabidopsis thaliana]
 sp|P29525.1|OLEO1_ARATH RecName: Full=Oleosin 18.5 kDa [Arabidopsis thaliana]
 emb|CAA44225.1| oleosin [Arabidopsis thaliana]
 emb|CAB36756.1| oleosin, 18.5K [Arabidopsis thaliana]
 emb|CAB79423.1| oleosin, 18.5K [Arabidopsis thaliana]
 gb|AAQ22658.1| At4g25140 [Arabidopsis thaliana]
 gb|AEE85016.1| oleosin 1 [Arabidopsis thaliana]
Length=173

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD   Y G  
Sbjct  96   ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQYYGQQ  155

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  156  HTGGEHDRD  164



>ref|XP_008234447.1| PREDICTED: oleosin 1 [Prunus mume]
Length=148

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TV  I + G L+   FG+A +  LSW+Y+Y  G  PPG+D+ D AR ++   A  +KD A
Sbjct  74   TVALITM-GFLTSGGFGVAAVTVLSWIYKYVTGKQPPGADQLDQARHKLAGKARDIKDRA  132



>ref|XP_009764678.1| PREDICTED: oleosin 1-like [Nicotiana sylvestris]
Length=146

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ + G L+   FG+A I  LSW+YRY  G HPPG+ + ++AR ++   A  +K+ A
Sbjct  75   IFLLMFGFLASGGFGVAAISVLSWIYRYMTGRHPPGAVQLEHARDKLATKAREMKERA  132



>gb|KDP34143.1| hypothetical protein JCGZ_07714 [Jatropha curcas]
Length=146

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  497  GIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGY  637
            G+A I+ L+W+Y Y  G HPPG+D+ DYAR ++   A+ +K+ A  Y
Sbjct  85   GLAAIMVLTWMYNYLAGKHPPGADKIDYARGQLARKAHDIKEKAKEY  131



>gb|ACG69521.1| oleosin S3-9 [Brassica napus]
Length=186

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD--YAGGYL  640
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD  Y  G  
Sbjct  101  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDMKDRAYYYGQQ  160

Query  641  HGGNK  655
            H G +
Sbjct  161  HTGEE  165



>ref|XP_011026733.1| PREDICTED: oleosin 1-like [Populus euphratica]
Length=134

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLH  643
            G L+   FG+A I  +SW+Y Y  G HPPG+D+ + AR ++   A  +KD A  + H
Sbjct  74   GFLASGGFGVAGITAMSWIYGYVTGRHPPGADQLEQARMKLAGKAREMKDRAEQFGH  130



>gb|ACG69520.1| oleosin S3-8 [Brassica napus]
 emb|CDX92679.1| BnaC07g39370D [Brassica napus]
Length=186

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD--YAGGYL  640
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD  Y  G  
Sbjct  101  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDMKDRAYYYGQQ  160

Query  641  HGGNK  655
            H G +
Sbjct  161  HTGEE  165



>ref|XP_002297927.1| Oleosin 18.5 kDa family protein [Populus trichocarpa]
 gb|EEE82732.1| Oleosin 18.5 kDa family protein [Populus trichocarpa]
Length=134

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLH  643
            G L+   FG+A I  +SW+Y Y  G HPPGSD+ + AR ++   A  +KD A  + H
Sbjct  74   GFLASGGFGVAGITAMSWIYGYVTGRHPPGSDQLEQARIKLAVKAREMKDRAEQFGH  130



>gb|ACG69514.1| oleosin S3-2 [Brassica napus]
Length=180

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD   Y G  
Sbjct  100  ITGSLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGTKAQDIKDRAQYYGQQ  159

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  160  HTGGEHDRD  168



>ref|XP_002511014.1| Oleosin 2 [Ricinus communis]
 gb|AAR15172.1| oleosin [Ricinus communis]
 gb|EEF51616.1| Oleosin 2 [Ricinus communis]
Length=138

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  470  AGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            AG L+   FG   IL LSW+YRY  G  PPG++  D AR ++   A  +KD A
Sbjct  73   AGFLTSGGFGFGAILVLSWIYRYVTGKQPPGAESLDQARLKLAGKAREMKDRA  125



>gb|ACG69518.1| oleosin S3-6 [Brassica napus]
 emb|CDY11058.1| BnaA03g47170D [Brassica napus]
Length=183

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 3/67 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD   Y G  
Sbjct  101  ITGFLSSGGFGIAAITVFSWIYKYATGEHPKGSDKLDSARMKLGSKAQDMKDRAHYYGQQ  160

Query  638  LHGGNKV  658
              GG  V
Sbjct  161  HTGGEHV  167



>gb|ACG69513.1| oleosin S3-1 [Brassica napus]
Length=180

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD   Y G  
Sbjct  100  ITGFLSSGGFGIADITVFSWIYKYATGEHPQGSDKLDSARMKLGTKAQDIKDRAQYYGQQ  159

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  160  HTGGEHDRD  168



>ref|XP_009137499.1| PREDICTED: oleosin 18.5 kDa-like [Brassica rapa]
Length=184

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 36/68 (53%), Gaps = 3/68 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD   Y G  
Sbjct  101  ITGFLSSGGFGIAAITVFSWIYKYATGEHPKGSDKLDSARMKLGSKAQDMKDRAHYYGQQ  160

Query  638  LHGGNKVK  661
              GG  V 
Sbjct  161  HTGGEHVN  168



>ref|XP_006371868.1| hypothetical protein POPTR_0018s04820g [Populus trichocarpa]
 gb|ERP49665.1| hypothetical protein POPTR_0018s04820g [Populus trichocarpa]
Length=131

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            V+F+  +G       G+A I+ L W Y Y  G HPPG+DR DYA  +I + AN V  YA
Sbjct  65   VVFLVSSGFFFSGGCGLAAIMVLLWTYNYVTGKHPPGADRLDYATRKIAEKANSVLCYA  123



>gb|AAA33481.1| major protein L3, partial [Zea mays]
Length=147

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +KD A
Sbjct  86   GFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKDAA  137



>gb|AET74076.1| oleosin [Juglans regia]
Length=140

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TV  I I G L+   FG+A +  LSW+YRY  G  PPG+++ D AR ++   A  +KD A
Sbjct  68   TVCLI-IFGFLASGGFGVAALTVLSWIYRYMTGRQPPGTEQIDQARMKLASKAREMKDKA  126



>ref|XP_003580271.1| PREDICTED: oleosin 16 kDa [Brachypodium distachyon]
Length=161

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++RI   A  +KD A
Sbjct  100  GFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARIASKARDIKDAA  151



>sp|P29110.1|OLEO3_BRANA RecName: Full=Oleosin Bn-III; Short=BnIII [Brassica napus]
 emb|CAA43941.1| oleosin BN-III [Brassica napus]
 gb|ACG69519.1| oleosin S3-7 [Brassica napus]
 prf||2009397A oleosin
Length=195

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++   A  +KD A
Sbjct  110  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDLKDRA  163



>gb|ACF82134.1| unknown [Zea mays]
 gb|ACG24643.1| oleosin 16 kDa [Zea mays]
 tpg|DAA36592.1| TPA: oleosin1 [Zea mays]
Length=156

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +KD A
Sbjct  95   GFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKDAA  146



>ref|XP_002971609.1| hypothetical protein SELMODRAFT_95560 [Selaginella moellendorffii]
 gb|EFJ27358.1| hypothetical protein SELMODRAFT_95560 [Selaginella moellendorffii]
Length=157

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 72/124 (58%), Gaps = 3/124 (2%)
 Frame = +2

Query  281  HAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplwipiGTVLF  460
            H  +P+S+++ GF TL+    + L L G+T+    + L+  TP+ L+ SP+ +P+G ++ 
Sbjct  24   HHKSPSSNRMLGFVTLITGAIVTLVLGGVTIGGVGITLLLATPVFLLLSPVLVPLGIMVA  83

Query  461  IAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA---G  631
            + I G L   T  +     +SW+Y Y RG  P G+D+ D A+ RI DTA+HV + A    
Sbjct  84   LGIGGFLLASTVFVGFCSFVSWIYNYVRGQKPVGADKIDAAKHRIADTASHVTEKAREVT  143

Query  632  GYLH  643
            GYL 
Sbjct  144  GYLQ  147



>ref|XP_008357299.1| PREDICTED: oleosin 1-like [Malus domestica]
Length=152

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  461  IAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYL  640
            + I G L+   FG+A +  ++W+YRY  G  PPG+D+ D AR ++   A+ +KD A  ++
Sbjct  85   LIIMGFLTSSGFGVASVTVVTWIYRYATGKQPPGADQLDSARHKLARKASEMKDRAEQFI  144



>ref|XP_002965728.1| hypothetical protein SELMODRAFT_84903 [Selaginella moellendorffii]
 ref|XP_002971607.1| hypothetical protein SELMODRAFT_95913 [Selaginella moellendorffii]
 gb|EFJ27356.1| hypothetical protein SELMODRAFT_95913 [Selaginella moellendorffii]
 gb|EFJ33148.1| hypothetical protein SELMODRAFT_84903 [Selaginella moellendorffii]
Length=174

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 75/126 (60%), Gaps = 2/126 (2%)
 Frame = +2

Query  260  FLRRFQDHAYAPNSSQLFGFFTLVVSggillfltgltltatilglifftplilissplwi  439
             + R ++HA  P+S QL G  TL + G  L  + G  + ATI+ L+  TP+ L+ SP+ +
Sbjct  32   LVERVKEHA--PSSQQLIGIATLALGGLTLAAMGGAMILATIVFLVIGTPIFLLFSPILV  89

Query  440  piGTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVK  619
            P+G +  +   G+LS   F  + +  ++W+Y+Y +G HP G+D+ + AR R++DTA  + 
Sbjct  90   PLGILAIVVTGGILSTIAFVASCVAAVTWIYKYAKGRHPVGTDQIEAARHRLMDTATQMT  149

Query  620  DYAGGY  637
            + A  Y
Sbjct  150  EKAREY  155



>gb|KHN18226.1| Oleosin 16 kDa [Glycine soja]
Length=166

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 36/68 (53%), Gaps = 3/68 (4%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA-  628
            VLF+  +G L     G+A I  LSW+Y Y  G  P GSD  DYA+  + D A  VK+ A 
Sbjct  89   VLFLVASGFLFSGGCGVAAIAALSWIYNYVSGNQPAGSDTLDYAKGYLTDKARDVKERAK  148

Query  629  --GGYLHG  646
              G Y  G
Sbjct  149  DYGSYAQG  156



>sp|P29111.1|OLEO2_BRANA RecName: Full=Major oleosin NAP-II, partial [Brassica napus]
 emb|CAA41064.1| oleosin nap-II [Brassica napus]
 gb|AAB22218.2| oleosin napII, partial [Brassica napus]
Length=175

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 36/69 (52%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++      +KD   Y G  
Sbjct  98   ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  157

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  158  QTGGEDDRD  166



>emb|CDY34345.1| BnaA01g14480D [Brassica napus]
Length=170

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 36/69 (52%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++      +KD   Y G  
Sbjct  93   ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  152

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  153  QTGGEHDRD  161



>ref|XP_008376368.1| PREDICTED: oleosin 1-like [Malus domestica]
Length=148

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGY  637
            G L+   FG+A +  LSW+YRY  G HPP +D+ D AR ++   A  ++D A  Y
Sbjct  88   GFLTSGGFGVAAVTVLSWIYRYVTGRHPPDADQLDSARYKLAGKAREMRDRAEQY  142



>ref|XP_002971301.1| hypothetical protein SELMODRAFT_94635 [Selaginella moellendorffii]
 gb|EFJ27899.1| hypothetical protein SELMODRAFT_94635 [Selaginella moellendorffii]
Length=142

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            G VLF+A++G++      +A + ++SW+Y Y++G HP GSD+ + AR R++ + +   + 
Sbjct  64   GIVLFLAVSGIVITGVAFVAFLSSVSWIYNYFKGRHPVGSDKIEAARQRLLGSVHQATEK  123

Query  626  AGGY-LHGGNKVKD  664
            A  Y  + G K ++
Sbjct  124  AREYGSYAGGKAQE  137



>gb|AAD41080.1|AF147758_1 oleosin [Elaeis guineensis]
Length=83

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ + G ++    G+A +  LSWLY+Y  G   PGSD+ + AR+RI   A  VK+ A
Sbjct  16   VFLLVTGFVTSGGLGVAALSVLSWLYKYLTGKRLPGSDQLEQARARIASKARDVKESA  73



>gb|AAC02239.1| 16 kDa oleosin [Oryza sativa]
 emb|CAH67261.1| OSIGBa0101C23.13 [Oryza sativa Indica Group]
 gb|EAY95056.1| hypothetical protein OsI_16871 [Oryza sativa Indica Group]
 gb|EAZ31530.1| hypothetical protein OsJ_15670 [Oryza sativa Japonica Group]
 gb|AGH17547.1| 16KDa oleosin [Oryza sativa]
Length=148

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +K+ A
Sbjct  87   GFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKEAA  138



>ref|XP_010693742.1| PREDICTED: oleosin 1-like [Beta vulgaris subsp. vulgaris]
Length=154

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TV+ + I+G L+   FG+A +  L+W+YRY  G HPPG+D+ D AR ++       ++  
Sbjct  80   TVVLL-ISGFLASGGFGVAAVSVLAWIYRYVTGRHPPGADQLDQARMKLAGKTREAREKG  138

Query  629  GGY  637
              Y
Sbjct  139  EHY  141



>ref|XP_003526464.2| PREDICTED: oleosin 1-like [Glycine max]
Length=212

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 0/62 (0%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAG  631
            VLF+  +G L     G+A I  LSW+Y Y  G  P GSD  DYA+  + D A  VK+ A 
Sbjct  135  VLFLVASGFLFSGGCGVAAIAALSWIYNYVSGNQPAGSDTLDYAKGYLTDKARDVKERAK  194

Query  632  GY  637
             Y
Sbjct  195  DY  196



>ref|NP_001053473.1| Os04g0546500 [Oryza sativa Japonica Group]
 sp|Q42980.2|OLEO1_ORYSJ RecName: Full=Oleosin 16 kDa; AltName: Full=OSE701 [Oryza sativa 
Japonica Group]
 dbj|BAF15387.1| Os04g0546500 [Oryza sativa Japonica Group]
Length=148

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +K+ A
Sbjct  87   GFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKEAA  138



>ref|XP_002448279.1| hypothetical protein SORBIDRAFT_06g024350 [Sorghum bicolor]
 gb|EES12607.1| hypothetical protein SORBIDRAFT_06g024350 [Sorghum bicolor]
Length=160

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +KD A
Sbjct  99   GFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKDAA  150



>ref|XP_008780784.1| PREDICTED: oleosin 16 kDa-like, partial [Phoenix dactylifera]
Length=144

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ +AG ++   FG+A +  LSW+Y+Y  G  PPG D+ + AR+R+   A  +K+ A
Sbjct  82   VFLLVAGFVTSGGFGVAALSVLSWMYQYVTGRRPPGFDQLEQARARLASKARDIKESA  139



>gb|ACG69516.1| oleosin S3-4 [Brassica napus]
 prf||1803528A oleosin
Length=187

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 36/69 (52%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++      +KD   Y G  
Sbjct  110  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  169

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  170  QTGGEHDRD  178



>gb|ACG69515.1| oleosin S3-3 [Brassica napus]
Length=187

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 36/69 (52%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++      +KD   Y G  
Sbjct  110  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  169

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  170  QTGGEHDRD  178



>gb|ACP27621.1| L-oleosin [Coix lacryma-jobi]
Length=151

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G  +    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +KD A
Sbjct  90   GFATSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKDAA  141



>ref|XP_010668835.1| PREDICTED: oleosin 16 kDa [Beta vulgaris subsp. vulgaris]
Length=168

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 4/75 (5%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAG  631
            V+F+  +G +     G+A +  LSW+Y+Y  G HP G+D+ D AR RI + A  +K+ A 
Sbjct  78   VVFVIASGFVFSGGCGVAAVSALSWIYQYTTGKHPMGADQLDRARMRITNVAREIKEKAK  137

Query  632  GYL----HGGNKVKD  664
              L    H G +  D
Sbjct  138  DNLDYVQHKGQESYD  152



>emb|CDX77021.1| BnaC04g38160D [Brassica napus]
Length=145

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  470  AGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            AG L     G+A    LSW+YRY  G HP G+D+ DYAR  I D A  ++ YA
Sbjct  81   AGFLFSGGCGVAAATALSWIYRYVTGKHPMGADKVDYARVMISDKAKELEHYA  133



>ref|XP_002961506.1| hypothetical protein SELMODRAFT_403436 [Selaginella moellendorffii]
 gb|EFJ36766.1| hypothetical protein SELMODRAFT_403436 [Selaginella moellendorffii]
Length=150

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDY  625
            G VLF+A++G++      +A + ++SW+Y Y++G HP GSD+ + AR R++ + +   + 
Sbjct  68   GIVLFLAVSGIVITGAAILAFLSSVSWIYNYFKGRHPVGSDKIEAARQRLLGSVHQATEK  127

Query  626  AGGY-LHGGNKVKD  664
            A  Y  + G K ++
Sbjct  128  AREYGSYAGGKAQE  141



>ref|XP_010919722.1| PREDICTED: oleosin 16 kDa-like [Elaeis guineensis]
Length=132

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ +AG ++    G+A +  LSW+Y+Y  G  PPG ++ + AR+R+   A  +K+ A
Sbjct  65   VFLLVAGFVTAGGLGVAALSVLSWMYKYLTGRRPPGFEQLEQARARLASKARDIKESA  122



>ref|XP_008786272.1| PREDICTED: oleosin 16 kDa-like [Phoenix dactylifera]
Length=132

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ + G ++    G+A I  LSWLY+Y  G   PGS++ + AR+++   A  +KD+A
Sbjct  65   VFLLVTGFVTSGGLGVAAISVLSWLYKYLTGKRLPGSEQLEQARAQLASKARDIKDHA  122



>ref|XP_007038271.1| Oleosin 1 [Theobroma cacao]
 gb|EOY22772.1| Oleosin 1 [Theobroma cacao]
Length=138

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD  622
            + G ++   FG+A I  LSW+YRY  G HPPG+D+ D AR  +   A  + +
Sbjct  76   VTGFMASGGFGVAAITVLSWIYRYVTGGHPPGADQLDQARMTLARKAREMNE  127



>gb|ACG69517.1| oleosin S3-5 [Brassica napus]
Length=183

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR +    A  +KD   Y G  
Sbjct  101  ITGFLSSGGFGIAAITVFSWIYKYATGEHPKGSDKLDSARMKPGSKAQDMKDRAHYYGQQ  160

Query  638  LHGGNKV  658
              GG  V
Sbjct  161  HTGGEHV  167



>gb|ABD14345.1| oleosin-like protein [Brassica napus]
Length=187

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 36/69 (52%), Gaps = 3/69 (4%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD---YAGGY  637
            I G LS   FGIA +   SW+Y+Y  G HP GSD+ D AR ++      +KD   Y G  
Sbjct  110  ITGFLSSGGFGIAAVTVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQ  169

Query  638  LHGGNKVKD  664
              GG   +D
Sbjct  170  QTGGEHDRD  178



>ref|XP_009362716.1| PREDICTED: oleosin 1-like [Pyrus x bretschneideri]
Length=146

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            L + I G L+   FG+A +  L+W+YRY  G  P G+D+ D AR ++   A  +KD A
Sbjct  75   LSLIIMGFLTSGGFGVASVTVLTWIYRYVTGKQPSGADQLDSARHKLAGKAREMKDSA  132



>gb|AAW70038.1| oleosin-like protein [Brassica rapa subsp. oleifera]
Length=178

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++      +KD A
Sbjct  93   ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRA  146



>ref|XP_009787078.1| PREDICTED: oleosin 14.9 kDa-like [Nicotiana sylvestris]
Length=88

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 13/59 (22%)
 Frame = +2

Query  446  GTVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD  622
            GT+LFIA++G LSV  FG +    +SW YRY++             RSRI DTA+H+KD
Sbjct  43   GTLLFIAVSGFLSVFGFGASTFAAISWAYRYFK-------------RSRIADTASHMKD  88



>ref|XP_002304591.1| Oleosin 18.5 kDa family protein [Populus trichocarpa]
 gb|EEE79570.1| Oleosin 18.5 kDa family protein [Populus trichocarpa]
Length=134

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD  622
            +++ + G L+   FG+  I  +SW+YRY  G HPPG+++ D A  ++V  A  +K+
Sbjct  68   IYLLLMGFLASGGFGVTGITVMSWMYRYVTGRHPPGAEQLDQAGMKLVGKAREMKE  123



>ref|XP_002966712.1| hypothetical protein SELMODRAFT_407827 [Selaginella moellendorffii]
 gb|EFJ32739.1| hypothetical protein SELMODRAFT_407827 [Selaginella moellendorffii]
Length=167

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 10/67 (15%)
 Frame = +2

Query  455  LFIAIAGLLSV-CTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAG  631
            LF+   G+ +V C+        +SWLY+Y RG HPPGSD+ D  R RI ++A+H+ +   
Sbjct  85   LFVIGTGMFAVFCS-------AVSWLYQYMRGGHPPGSDKIDTVRRRIAESAHHLSEKTQ  137

Query  632  GYLHGGN  652
            G   GG+
Sbjct  138  GT--GGD  142



>ref|NP_001105338.1| oleosin Zm-I [Zea mays]
 sp|P13436.2|OLEO1_MAIZE RecName: Full=Oleosin Zm-I; AltName: Full=Lipid body-associated 
major protein; AltName: Full=Lipid body-associated protein 
L3; AltName: Full=Oleosin 16 kDa [Zea mays]
 gb|AAA68065.1| 16 kDa oleosin [Zea mays]
Length=156

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPP +D+ D+A++R+   A  VKD A
Sbjct  95   GFVTSGGLGVAALSVFSWMYKYLTGKHPPAADQLDHAKARLASKARDVKDAA  146



>gb|ACG48556.1| oleosin 16 kDa [Zea mays]
Length=233

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  494  FGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
             G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +KD A
Sbjct  102  LGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKDAA  146



>ref|XP_007144224.1| hypothetical protein PHAVU_007G138300g [Phaseolus vulgaris]
 gb|ESW16218.1| hypothetical protein PHAVU_007G138300g [Phaseolus vulgaris]
Length=138

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD  622
            TV F+++ G L+   F +  I  L+W+Y Y  G HPPG+D+ D AR ++++ A  +KD
Sbjct  77   TVAFLSL-GFLASGGFCVMAITVLAWIYGYVTGKHPPGADQLDSARDKLLNKAREIKD  133



>ref|XP_010546531.1| PREDICTED: oleosin 1 [Tarenaya hassleriana]
Length=138

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 32/63 (51%), Gaps = 0/63 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            + +  AG L     G+A    LSW+YRY  G HP G+D+ DYAR RI + A     Y   
Sbjct  69   MVVLAAGFLFSGGCGVAAATALSWIYRYVTGKHPIGADKIDYARMRIAEKAKEYGHYVQQ  128

Query  635  YLH  643
              H
Sbjct  129  KTH  131



>gb|EEC77750.1| hypothetical protein OsI_16870 [Oryza sativa Indica Group]
Length=140

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +K+ A
Sbjct  79   GFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKEAA  130



>gb|KHG16380.1| Oleosin 1 [Gossypium arboreum]
Length=131

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAG  631
            G ++   FG+A +  LSW+YRY  G HPP +D+ D A  ++   A  +KD A 
Sbjct  71   GFVASGGFGVAAVTVLSWIYRYVTGRHPPAADQLDSAGMKLASKAREMKDRAA  123



>ref|XP_009138898.1| PREDICTED: oleosin Bn-III [Brassica rapa]
Length=195

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            I G LS   FGIA I   SW+Y+Y  G HP GSD+ D AR ++      +KD A
Sbjct  110  ITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGGKVQDMKDRA  163



>ref|XP_002970414.1| hypothetical protein SELMODRAFT_18324, partial [Selaginella moellendorffii]
 ref|XP_002978493.1| hypothetical protein SELMODRAFT_18322, partial [Selaginella moellendorffii]
 gb|EFJ20479.1| hypothetical protein SELMODRAFT_18322, partial [Selaginella moellendorffii]
 gb|EFJ28544.1| hypothetical protein SELMODRAFT_18324, partial [Selaginella moellendorffii]
Length=115

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            L IA A +L      +AV+  ++WLY+Y +G  P G+++ D A++RIVDTA+ V + A
Sbjct  54   LAIAAAVVLGCLVSFLAVVAMVAWLYKYVKGRRPVGANQVDAAKNRIVDTASQVTEKA  111



>gb|AAF76238.1|AF273023_1 oleosin [Elaeis guineensis]
Length=140

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ + G ++    G+A +  LSWLY+Y  G   PGS++ + AR+R+   A  VK+ A
Sbjct  73   VFLLVTGFVTSGGLGVAALSVLSWLYKYLTGKRVPGSEQLEQARARLASKARDVKESA  130



>emb|CAE02016.3| OSJNBa0079A21.14 [Oryza sativa Japonica Group]
Length=224

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +K+ A
Sbjct  163  GFVTSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKEAA  214



>ref|XP_009610907.1| PREDICTED: oleosin 1-like [Nicotiana tomentosiformis]
Length=134

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 35/66 (53%), Gaps = 1/66 (2%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLH-  643
            +AG L+   FG        W+YRY  G HP G+ + DYAR +I   A+ VK+ A    H 
Sbjct  68   LAGFLATGGFGATASFVFYWMYRYVTGKHPIGASKIDYARDKIAHAAHDVKEKAEQLGHQ  127

Query  644  GGNKVK  661
             G ++K
Sbjct  128  AGQQIK  133



>ref|NP_001236098.1| 16.5 kDa oleosin [Glycine max]
 gb|ACO90355.1| 16.5 kDa oleosin [Glycine max]
 gb|ACU13135.1| unknown [Glycine max]
Length=165

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 35/68 (51%), Gaps = 3/68 (4%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA-  628
            VLF+  +G L     G+A I  LSW+Y Y  G  P G D  DYA+  + D A  VK+ A 
Sbjct  88   VLFLVASGFLFSGGCGVAAIAALSWIYNYVSGNQPAGYDTLDYAKGYLADKARDVKERAK  147

Query  629  --GGYLHG  646
              G Y  G
Sbjct  148  DYGSYAQG  155



>ref|XP_002878899.1| hypothetical protein ARALYDRAFT_901265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55158.1| hypothetical protein ARALYDRAFT_901265 [Arabidopsis lyrata subsp. 
lyrata]
Length=143

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  497  GIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G+A    L+W+Y+Y  G HP G+D+ DYAR RI + A  +  YA
Sbjct  85   GVAAATALTWIYKYVSGKHPMGADKVDYARMRIAEKAKELGHYA  128



>ref|XP_011022366.1| PREDICTED: oleosin 1-like [Populus euphratica]
Length=134

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKD  622
            +++ + G L    FG+  I  ++W+YRY  G HPPG+++ D A  ++V  A  +K+
Sbjct  68   VYLLLMGFLVSGGFGVTGITVMTWMYRYVTGMHPPGAEQLDQAVMKLVGKAREMKE  123



>ref|XP_004501216.1| PREDICTED: oleosin 1-like [Cicer arietinum]
Length=153

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA-  628
            +L +   G L     G+A I  LSW+Y Y  G  P GSD  DYA+  I D A  VK+ A 
Sbjct  76   ILSLIAGGFLFSGGCGVAAIAALSWIYNYVSGNRPAGSDTLDYAKGMITDKARDVKERAK  135

Query  629  --GGYLHG  646
              G Y  G
Sbjct  136  EYGNYAQG  143



>ref|XP_009370420.1| PREDICTED: oleosin 1-like [Pyrus x bretschneideri]
Length=148

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGY  637
            G L+   F +A +  LSW+YRY  G HPP +D+ D AR ++   A  ++D    Y
Sbjct  88   GFLTSGGFSVAAVTVLSWIYRYVTGKHPPDADQLDSARYKLAGKAREIRDRVEQY  142



>gb|AFK45755.1| unknown [Lotus japonicus]
Length=162

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 0/62 (0%)
 Frame = +2

Query  452  VLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAG  631
            +L +A  G +     G+A +  LSW+Y Y  G +P G D  DYAR  I D A  VK+ A 
Sbjct  84   ILSLAAGGFMFSGGCGVAAVAALSWIYNYVSGKYPAGYDTLDYARGMIADKARDVKERAK  143

Query  632  GY  637
             Y
Sbjct  144  DY  145



>ref|XP_006367465.1| PREDICTED: oleosin 1-like [Solanum tuberosum]
Length=134

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            L + + G L+   FG        W+YRY  G HP G+ + DYAR +I   AN VK+ A
Sbjct  64   LGLILGGFLASGGFGATASFVFYWMYRYVTGKHPIGATKIDYARDKIAHAANDVKEKA  121



>ref|XP_004148427.1| PREDICTED: oleosin 16 kDa-like [Cucumis sativus]
 ref|XP_004162984.1| PREDICTED: oleosin 16 kDa-like [Cucumis sativus]
 gb|KGN62791.1| hypothetical protein Csa_2G372860 [Cucumis sativus]
Length=135

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  449  TVLFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            TVL ++ AGL    T  +A +  LSWLY Y  G  P G+++ D+AR +IV+ A  +K+ A
Sbjct  70   TVLVLSAAGLFFSATCAVAAVAALSWLYSYMTGDQPVGAEQLDFARDKIVEMAKDMKEKA  129



>ref|XP_009140712.1| PREDICTED: oleosin 1 [Brassica rapa]
 emb|CDY35326.1| BnaA04g15210D [Brassica napus]
Length=146

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +2

Query  470  AGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            AG L     G+A    LSW+YRY  G HP G+D+ DYAR  I + A  +  YA
Sbjct  82   AGFLFSGGCGVAAATALSWIYRYVTGKHPMGADKVDYARMMISEKAKELGHYA  134



>ref|XP_010934129.1| PREDICTED: oleosin 16 kDa-like [Elaeis guineensis]
Length=210

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            +F+ + G ++    G+A +  LSWLY+Y  G   PGS++ + AR+R+   A  VK+ A
Sbjct  143  VFLLVTGFVTSGGLGVAALSVLSWLYKYLTGKRVPGSEQLEQARARLASKARDVKESA  200



>ref|XP_010275437.1| PREDICTED: oleosin 1-like [Nelumbo nucifera]
Length=126

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGY  637
            I G L+    G+A +  LSWLY+Y  G HPPGSD+   A  ++      +K+  G +
Sbjct  68   ITGFLTSGGLGVAGVSVLSWLYQYVTGKHPPGSDQLHQAEMKLQSAVKDMKEKVGKF  124



>ref|XP_006653640.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Oryza 
brachyantha]
Length=263

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPPG+D+ D+A++R+   A  +K+ A
Sbjct  202  GFITSGGLGVAALSVFSWMYKYLTGKHPPGADQLDHAKARLASKARDIKEAA  253



>ref|XP_004241990.1| PREDICTED: oleosin 1-like [Solanum lycopersicum]
Length=134

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            + G L+   FG        W+YRY  G HP G+ + DYAR +I   AN VK+ A
Sbjct  68   LGGFLASGGFGATASFVFYWMYRYVTGKHPIGATKIDYARDKIAHAANDVKEKA  121



>ref|XP_009771392.1| PREDICTED: oleosin 1-like [Nicotiana sylvestris]
Length=134

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 34/66 (52%), Gaps = 1/66 (2%)
 Frame = +2

Query  467  IAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGGYLH-  643
            +AG L+   FG        W+YRY  G HP G+ + DYAR +I   A  VK+ A    H 
Sbjct  68   LAGFLATGGFGATASFVFYWMYRYVTGKHPIGASKIDYARDKIAHAAYDVKEKAEQLGHQ  127

Query  644  GGNKVK  661
             G ++K
Sbjct  128  AGQQIK  133



>ref|XP_002975381.1| hypothetical protein SELMODRAFT_18412, partial [Selaginella moellendorffii]
 gb|EFJ23582.1| hypothetical protein SELMODRAFT_18412, partial [Selaginella moellendorffii]
Length=136

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (58%), Gaps = 8/66 (12%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFG--------IAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            + + +AG+++V T G        +     ++WLY Y +G HP G+D+ D  + +I DTA+
Sbjct  64   ILVPLAGIVAVGTGGFVSLSAAFVTACSAVAWLYNYVKGRHPVGADKIDAVKHKIADTAS  123

Query  611  HVKDYA  628
            HV + A
Sbjct  124  HVSEKA  129



>ref|XP_002987365.1| hypothetical protein SELMODRAFT_18396, partial [Selaginella moellendorffii]
 gb|EFJ11452.1| hypothetical protein SELMODRAFT_18396, partial [Selaginella moellendorffii]
Length=132

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (58%), Gaps = 8/66 (12%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFG--------IAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTAN  610
            + + +AG+++V T G        +     ++WLY Y +G HP G+D+ D  + +I DTA+
Sbjct  65   ILVPLAGIVAVGTGGFVSLSAAFVTACSAVAWLYNYVKGRHPVGADKIDAVKHKIADTAS  124

Query  611  HVKDYA  628
            HV + A
Sbjct  125  HVSEKA  130



>ref|XP_010472616.1| PREDICTED: oleosin 14.9 kDa-like [Camelina sativa]
Length=149

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  497  GIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G+A    L+W+YRY  G HP G+D+ DYAR RI + A  +  +A
Sbjct  94   GVAAATALTWIYRYVTGKHPVGADKVDYARMRITEKAKELGHFA  137



>ref|XP_002980923.1| hypothetical protein SELMODRAFT_18574, partial [Selaginella moellendorffii]
 gb|EFJ18108.1| hypothetical protein SELMODRAFT_18574, partial [Selaginella moellendorffii]
Length=88

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  500  IAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            IA++ T++W+YRY RG  P GS R D  +SR+++  + V D A
Sbjct  46   IALVATITWIYRYARGGRPAGSQRLDAVKSRVMEKPSQVSDKA  88



>ref|XP_010417366.1| PREDICTED: oleosin 1-like [Camelina sativa]
 ref|XP_010417367.1| PREDICTED: oleosin 1-like [Camelina sativa]
Length=148

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  497  GIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G+A    L+W+YRY  G HP G+D+ DYAR RI + A  +  +A
Sbjct  93   GVAAATALTWIYRYVTGKHPMGADKVDYARMRITEKAKELGHFA  136



>ref|XP_009372826.1| PREDICTED: oleosin 1-like [Pyrus x bretschneideri]
Length=148

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 0/61 (0%)
 Frame = +2

Query  455  LFIAIAGLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYAGG  634
            L +   G L+   F +A +  LSW+YRY  G HPP  D+ D AR ++   A  ++D    
Sbjct  82   LSLITMGFLTSGGFSVAAVTVLSWIYRYVTGKHPPDVDQLDSARYKLAGKAREIRDRVEQ  141

Query  635  Y  637
            Y
Sbjct  142  Y  142



>gb|AAL40177.1|L76464_1 oleosin [Oryza sativa]
 gb|AAC33281.1| 16 kDa oleosin isoform R16 [Oryza sativa Japonica Group]
Length=148

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +2

Query  473  GLLSVCTFGIAVILTLSWLYRYYRGFHPPGSDRFDYARSRIVDTANHVKDYA  628
            G ++    G+A +   SW+Y+Y  G HPPG+D  D+ ++R+      +K+ A
Sbjct  87   GFVTSVGLGVAALSVFSWMYKYLTGKHPPGADHLDHTKARVASKLRDIKEAA  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2070268854280