BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8215_g1_i1 len=1261 path=[1239:0-570 1810:571-1260]

Length=1261
                                                                      Score     E

ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              483   8e-167   
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like              472   2e-162   
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like              467   2e-160   
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like              466   4e-160   
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like              466   5e-160   
ref|XP_007033589.1|  Peroxidase superfamily protein                     462   1e-158   
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              462   2e-158   
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like              461   4e-158   
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like              459   2e-157   
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              459   2e-157   
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              455   7e-156   
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              451   3e-154   
gb|ACJ11762.1|  class III peroxidase                                    449   2e-153   Gossypium hirsutum [American cotton]
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              449   3e-153   
gb|ACZ51443.1|  peroxidase protein                                      448   4e-153   
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              445   7e-152   
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like              446   9e-152   
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like              444   2e-151   
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like              444   3e-151   
ref|XP_010093550.1|  Cationic peroxidase 1                              443   5e-151   
ref|XP_010066359.1|  PREDICTED: cationic peroxidase 1-like              443   6e-151   
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like              442   1e-150   
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like              442   1e-150   
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg             442   1e-150   
gb|KHN29529.1|  Cationic peroxidase 1                                   439   1e-149   
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like              438   4e-149   
ref|XP_011095107.1|  PREDICTED: cationic peroxidase 1-like              437   1e-148   
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like              436   3e-148   
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          435   7e-148   
ref|XP_008388322.1|  PREDICTED: cationic peroxidase 1-like              435   1e-147   
ref|XP_007206416.1|  hypothetical protein PRUPE_ppa018664mg             433   2e-147   
ref|XP_010066439.1|  PREDICTED: cationic peroxidase 1-like              434   3e-147   
ref|XP_010066274.1|  PREDICTED: cationic peroxidase 1-like              433   5e-147   
ref|XP_008229747.1|  PREDICTED: cationic peroxidase 1-like              432   6e-147   
gb|KHN40655.1|  Cationic peroxidase 1                                   432   2e-146   
sp|P22195.2|PER1_ARAHY  RecName: Full=Cationic peroxidase 1; AltN...    430   4e-146   Arachis hypogaea [goober]
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like              430   6e-146   
ref|XP_007140134.1|  hypothetical protein PHAVU_008G086800g             428   4e-145   
pdb|1SCH|A  Chain A, Peanut Peroxidase                                  427   5e-145   
ref|XP_004294750.1|  PREDICTED: cationic peroxidase 1-like              427   1e-144   
ref|XP_010263838.1|  PREDICTED: cationic peroxidase 1-like isofor...    426   2e-144   
ref|NP_001242089.1|  uncharacterized protein LOC100815671 precursor     426   3e-144   
ref|XP_004500339.1|  PREDICTED: cationic peroxidase 1-like              425   5e-144   
ref|XP_004492538.1|  PREDICTED: cationic peroxidase 1-like              425   7e-144   
dbj|BAM28608.1|  putative peroxidase                                    424   2e-143   
gb|AFK46186.1|  unknown                                                 423   2e-143   
ref|XP_003552299.1|  PREDICTED: cationic peroxidase 1-like              424   3e-143   
ref|XP_002285723.1|  PREDICTED: cationic peroxidase 1 isoform X1        423   3e-143   Vitis vinifera
dbj|BAA77389.1|  peroxidase 3                                           423   3e-143   Scutellaria baicalensis [Baikal skullcap]
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like              422   6e-143   
dbj|BAM28609.1|  putative peroxidase                                    422   9e-143   
ref|XP_011021015.1|  PREDICTED: cationic peroxidase 1-like              422   1e-142   
ref|XP_010685963.1|  PREDICTED: cationic peroxidase 1-like              422   4e-142   
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g             420   6e-142   
ref|XP_003623567.1|  Peroxidase                                         419   7e-142   
ref|XP_010683553.1|  PREDICTED: cationic peroxidase 1-like              420   8e-142   
ref|XP_010035984.1|  PREDICTED: cationic peroxidase 1-like              419   1e-141   
emb|CAH10840.1|  peroxidase                                             419   1e-141   Picea abies
ref|XP_010256954.1|  PREDICTED: cationic peroxidase 1-like              419   2e-141   
ref|NP_196153.1|  peroxidase 52                                         419   2e-141   Arabidopsis thaliana [mouse-ear cress]
gb|AAB02554.1|  cationic peroxidase                                     417   6e-141   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like              417   6e-141   
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444             417   9e-141   
gb|AHL39176.1|  class III peroxidase                                    417   9e-141   
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like              416   1e-140   
ref|XP_002284007.1|  PREDICTED: cationic peroxidase 1 isoform X2        416   1e-140   Vitis vinifera
ref|XP_009371986.1|  PREDICTED: cationic peroxidase 1-like isofor...    416   1e-140   
ref|XP_009371985.1|  PREDICTED: cationic peroxidase 1-like isofor...    417   1e-140   
ref|XP_003538325.1|  PREDICTED: cationic peroxidase 1-like              416   2e-140   
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              416   2e-140   
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      416   2e-140   
ref|XP_010685954.1|  PREDICTED: cationic peroxidase 1-like              416   3e-140   
ref|XP_010685962.1|  PREDICTED: cationic peroxidase 1-like              417   5e-140   
gb|AFK43134.1|  unknown                                                 414   8e-140   
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like              414   1e-139   
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           414   1e-139   
dbj|BAM28607.1|  putative peroxidase                                    414   2e-139   
gb|AII99880.1|  peroxidase                                              413   2e-139   
ref|XP_003551179.1|  PREDICTED: cationic peroxidase 1-like              413   3e-139   
ref|XP_004492537.1|  PREDICTED: cationic peroxidase 1-like              413   3e-139   
ref|XP_010264472.1|  PREDICTED: cationic peroxidase 1-like              413   3e-139   
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg             413   4e-139   
ref|XP_010664359.1|  PREDICTED: cationic peroxidase 1 isoform X3        412   4e-139   
ref|XP_010683551.1|  PREDICTED: cationic peroxidase 1-like              413   6e-139   
ref|XP_009775239.1|  PREDICTED: cationic peroxidase 1-like              412   7e-139   
ref|XP_009358287.1|  PREDICTED: cationic peroxidase 1-like              412   7e-139   
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like              412   9e-139   
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                   411   1e-138   
emb|CAH10839.1|  peroxidase                                             411   1e-138   Picea abies
ref|XP_002319407.1|  peroxidase family protein                          410   2e-138   Populus trichocarpa [western balsam poplar]
ref|XP_010543687.1|  PREDICTED: peroxidase 52                           411   2e-138   
ref|XP_010035985.1|  PREDICTED: cationic peroxidase 1-like              411   2e-138   
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       410   3e-138   
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                    411   3e-138   
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      410   3e-138   
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like              409   5e-138   
gb|KHN46100.1|  Cationic peroxidase 1                                   409   6e-138   
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      409   1e-137   
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                       409   1e-137   
ref|XP_009622973.1|  PREDICTED: cationic peroxidase 1-like              409   2e-137   
ref|XP_010552918.1|  PREDICTED: peroxidase P7-like                      408   2e-137   
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like              407   4e-137   
ref|XP_002283995.1|  PREDICTED: cationic peroxidase 1-like              407   5e-137   Vitis vinifera
gb|ABK23423.1|  unknown                                                 407   6e-137   Picea sitchensis
emb|CDY14118.1|  BnaC02g02350D                                          407   6e-137   
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       407   9e-137   
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      407   1e-136   
emb|CBI18066.3|  unnamed protein product                                404   1e-136   
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g             406   2e-136   
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like              405   3e-136   
ref|XP_009125598.1|  PREDICTED: peroxidase P7                           405   5e-136   
ref|XP_010491069.1|  PREDICTED: peroxidase 52-like                      405   6e-136   
emb|CAH10841.1|  peroxidase                                             405   6e-136   Picea abies
emb|CDY04948.1|  BnaAnng01300D                                          405   6e-136   
gb|EYU46001.1|  hypothetical protein MIMGU_mgv1a018175mg                404   1e-135   
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  404   1e-135   Ricinus communis
ref|NP_001065566.1|  Os11g0112200                                       403   2e-135   Oryza sativa Japonica Group [Japonica rice]
emb|CAH10842.1|  peroxidase                                             403   3e-135   Picea abies
ref|XP_010035986.1|  PREDICTED: cationic peroxidase 1-like              403   3e-135   
gb|KDP22793.1|  hypothetical protein JCGZ_00380                         402   3e-135   
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...    402   3e-135   Brassica rapa subsp. rapa
ref|XP_002319968.2|  peroxidase family protein                          403   4e-135   Populus trichocarpa [western balsam poplar]
dbj|BAA82306.1|  peroxidase                                             402   4e-135   Nicotiana tabacum [American tobacco]
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                       403   5e-135   
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      402   5e-135   
emb|CDX70158.1|  BnaA10g25070D                                          402   6e-135   
gb|ACT35473.1|  peroxidase 52                                           401   8e-135   Brassica rapa
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            402   1e-134   Vitis vinifera
gb|KEH34417.1|  cationic peroxidase                                     401   2e-134   
ref|NP_001057822.1|  Os06g0547400                                       401   2e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002450134.1|  hypothetical protein SORBIDRAFT_05g001030          400   2e-134   Sorghum bicolor [broomcorn]
gb|ACM47317.1|  peroxidase                                              400   3e-134   Capsicum annuum
ref|XP_009122142.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      400   3e-134   
ref|XP_008385017.1|  PREDICTED: cationic peroxidase 1-like              400   3e-134   
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             400   3e-134   
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       400   4e-134   
ref|XP_004977590.1|  PREDICTED: cationic peroxidase 1-like              400   5e-134   
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       400   5e-134   
ref|XP_003634480.1|  PREDICTED: cationic peroxidase 1                   400   5e-134   
emb|CDX98835.1|  BnaC09g50000D                                          399   8e-134   
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            399   1e-133   
gb|ABR18139.1|  unknown                                                 399   1e-133   Picea sitchensis
ref|XP_003623564.1|  Peroxidase                                         398   1e-133   
gb|AAP76387.1|  class III peroxidase                                    399   2e-133   Gossypium hirsutum [American cotton]
ref|XP_010264471.1|  PREDICTED: cationic peroxidase 1-like              398   2e-133   
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg             399   2e-133   
tpe|CAH69378.1|  TPA: class III peroxidase 136 precursor                398   3e-133   
ref|XP_009410539.1|  PREDICTED: cationic peroxidase 1-like              397   3e-133   
gb|AFR44628.1|  class III secretory peroxidase                          397   3e-133   
ref|XP_010683552.1|  PREDICTED: cationic peroxidase 1-like              398   4e-133   
gb|ACU17608.1|  unknown                                                 397   4e-133   Glycine max [soybeans]
gb|EYU41993.1|  hypothetical protein MIMGU_mgv1a010225mg                397   7e-133   
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         397   8e-133   
gb|KHG18057.1|  Peroxidase 52 -like protein                             397   9e-133   
gb|ABK21858.1|  unknown                                                 397   1e-132   Picea sitchensis
gb|AEX20390.1|  putative class III peroxidase                           394   1e-132   
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                       396   1e-132   
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                       396   1e-132   
emb|CAA62597.1|  korean-radish isoperoxidase                            396   2e-132   Raphanus sativus
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                       396   2e-132   
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      395   3e-132   
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      395   3e-132   
ref|XP_006657042.1|  PREDICTED: peroxidase P7-like                      395   3e-132   
ref|XP_007208188.1|  hypothetical protein PRUPE_ppa020902mg             395   3e-132   
gb|EYU41994.1|  hypothetical protein MIMGU_mgv1a010221mg                395   3e-132   
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             395   4e-132   
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      395   5e-132   
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      395   6e-132   
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        394   6e-132   Gossypium hirsutum [American cotton]
gb|EYU41992.1|  hypothetical protein MIMGU_mgv1a010234mg                394   7e-132   
emb|CAL25300.1|  properoxidase                                          394   1e-131   Picea abies
ref|XP_006833057.1|  hypothetical protein AMTR_s00170p00037010          394   1e-131   
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                       394   1e-131   
gb|KDP45728.1|  hypothetical protein JCGZ_17335                         394   2e-131   
ref|NP_001106040.1|  peroxidase 70 precursor                            393   2e-131   Zea mays [maize]
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor     393   2e-131   
gb|ABK25962.1|  unknown                                                 393   2e-131   Picea sitchensis
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      393   2e-131   
ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1            393   2e-131   
ref|XP_008650762.1|  PREDICTED: peroxidase 70 isoform X1                393   3e-131   
emb|CAD67479.1|  peroxidase                                             393   3e-131   Asparagus officinalis
ref|XP_007048724.1|  Peroxidase superfamily protein                     393   3e-131   
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2            392   4e-131   
gb|KDP21683.1|  hypothetical protein JCGZ_03354                         392   5e-131   
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           392   7e-131   
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                       392   9e-131   
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      391   1e-130   
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      391   1e-130   
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                      391   2e-130   
ref|XP_003602462.1|  Peroxidase                                         391   2e-130   
ref|XP_009388702.1|  PREDICTED: peroxidase P7-like                      395   2e-130   
ref|XP_002323054.1|  hypothetical protein POPTR_0016s14030g             390   2e-130   Populus trichocarpa [western balsam poplar]
ref|XP_004958680.1|  PREDICTED: peroxidase 70-like                      390   2e-130   
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           390   2e-130   
ref|XP_010925616.1|  PREDICTED: peroxidase P7-like                      390   2e-130   
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                      390   4e-130   
ref|XP_004965567.1|  PREDICTED: peroxidase 4-like                       390   4e-130   
ref|XP_007011229.1|  Peroxidase superfamily protein                     390   5e-130   
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg                390   5e-130   
ref|XP_011003587.1|  PREDICTED: cationic peroxidase 1-like              389   5e-130   
ref|XP_006470885.1|  PREDICTED: lignin-forming anionic peroxidase...    389   6e-130   
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                       389   6e-130   
ref|XP_008369323.1|  PREDICTED: peroxidase 4-like                       390   6e-130   
gb|KHG09190.1|  Peroxidase 4                                            389   7e-130   
emb|CAA59484.1|  pox1                                                   389   7e-130   Triticum aestivum [Canadian hard winter wheat]
gb|AFK41406.1|  unknown                                                 389   8e-130   
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                      389   8e-130   
ref|XP_009369543.1|  PREDICTED: peroxidase 4-like                       389   1e-129   
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      389   1e-129   
ref|XP_010228647.1|  PREDICTED: peroxidase 2-like                       389   1e-129   
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           388   2e-129   
gb|ACF08086.1|  class III peroxidase                                    388   2e-129   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009419858.1|  PREDICTED: cationic peroxidase 1-like              388   2e-129   
ref|XP_002278996.1|  PREDICTED: peroxidase 4                            387   4e-129   Vitis vinifera
ref|XP_011080738.1|  PREDICTED: peroxidase 4-like                       387   4e-129   
emb|CBI19219.3|  unnamed protein product                                392   4e-129   
ref|XP_008795235.1|  PREDICTED: peroxidase P7-like                      387   5e-129   
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      387   5e-129   
ref|XP_006470886.1|  PREDICTED: lignin-forming anionic peroxidase...    387   6e-129   
ref|XP_010261059.1|  PREDICTED: cationic peroxidase 1-like isofor...    387   6e-129   
ref|XP_007205551.1|  hypothetical protein PRUPE_ppa008607mg             387   6e-129   
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       387   6e-129   
emb|CDP13933.1|  unnamed protein product                                387   7e-129   
gb|ADN96693.1|  peroxidase 6                                            386   1e-128   
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                      386   1e-128   
ref|XP_010045401.1|  PREDICTED: peroxidase 4-like                       386   1e-128   
ref|XP_010915493.1|  PREDICTED: peroxidase P7-like                      386   1e-128   
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      386   1e-128   
emb|CAA59487.1|  peroxidase                                             385   2e-128   Triticum aestivum [Canadian hard winter wheat]
gb|ACD70388.1|  class III peroxidase                                    385   2e-128   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010685964.1|  PREDICTED: peroxidase 4-like                       385   2e-128   
ref|XP_004502855.1|  PREDICTED: peroxidase 52-like                      385   2e-128   
ref|XP_010256951.1|  PREDICTED: peroxidase 4-like                       385   2e-128   
ref|XP_002438534.1|  hypothetical protein SORBIDRAFT_10g021650          385   5e-128   Sorghum bicolor [broomcorn]
ref|XP_008374511.1|  PREDICTED: peroxidase P7-like isoform X1           384   5e-128   
gb|ACF08087.1|  class III peroxidase                                    384   5e-128   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                       384   6e-128   
gb|AAP42508.1|  anionic peroxidase swpb3                                384   6e-128   Ipomoea batatas [batate]
ref|XP_008374568.1|  PREDICTED: peroxidase 4-like                       384   6e-128   
gb|EPS58869.1|  peroxidase                                              384   7e-128   
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g             384   8e-128   
ref|XP_009419701.1|  PREDICTED: cationic peroxidase 1-like              384   8e-128   
dbj|BAC83101.1|  putative peroxidase precursor                          384   8e-128   Oryza sativa Japonica Group [Japonica rice]
gb|ACF08094.1|  class III peroxidase                                    384   9e-128   Triticum aestivum [Canadian hard winter wheat]
gb|EEC82680.1|  hypothetical protein OsI_27324                          383   1e-127   Oryza sativa Indica Group [Indian rice]
ref|XP_008364165.1|  PREDICTED: peroxidase 4-like                       383   1e-127   
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       384   1e-127   
ref|XP_006470944.1|  PREDICTED: lignin-forming anionic peroxidase...    383   1e-127   
dbj|BAK07852.1|  predicted protein                                      383   2e-127   
ref|XP_003562452.1|  PREDICTED: peroxidase 2-like                       383   2e-127   
ref|XP_010915492.1|  PREDICTED: peroxidase P7-like                      383   2e-127   
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      383   2e-127   
gb|ACU23245.1|  unknown                                                 383   3e-127   Glycine max [soybeans]
ref|XP_002438530.1|  hypothetical protein SORBIDRAFT_10g021630          383   3e-127   Sorghum bicolor [broomcorn]
ref|XP_009381203.1|  PREDICTED: peroxidase P7-like                      382   3e-127   
ref|XP_008343635.1|  PREDICTED: peroxidase 4-like                       382   3e-127   
ref|XP_006470943.1|  PREDICTED: lignin-forming anionic peroxidase...    382   3e-127   
ref|NP_001060629.1|  Os07g0677300                                       382   3e-127   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060626.1|  Os07g0676900                                       383   4e-127   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01280.1|  hypothetical protein OsI_23303                          382   4e-127   Oryza sativa Indica Group [Indian rice]
gb|KHN44724.1|  Peroxidase 4                                            382   5e-127   
dbj|BAD54117.1|  putative bacterial-induced peroxidase precursor        382   5e-127   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg                382   5e-127   
ref|XP_008374539.1|  PREDICTED: peroxidase 4-like isoform X1            382   6e-127   
dbj|BAM05634.1|  peroxidase 2                                           382   7e-127   
sp|A2YPX3.2|PER2_ORYSI  RecName: Full=Peroxidase 2; Flags: Precursor    381   7e-127   Oryza sativa Indica Group [Indian rice]
ref|NP_001167809.1|  hypothetical protein precursor                     382   7e-127   Zea mays [maize]
ref|XP_003602463.1|  Peroxidase                                         382   7e-127   
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      381   8e-127   
ref|XP_010925617.1|  PREDICTED: peroxidase P7-like                      381   8e-127   
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                       381   8e-127   
ref|XP_011033755.1|  PREDICTED: peroxidase P7-like                      381   1e-126   
gb|AAR31106.1|  peroxidase precursor                                    382   1e-126   Quercus suber [cork oak]
ref|XP_003596719.1|  Peroxidase                                         381   1e-126   
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                       381   1e-126   
gb|ABV24960.2|  putative secretory peroxidase                           381   1e-126   Catharanthus roseus [chatas]
ref|XP_008457311.1|  PREDICTED: cationic peroxidase 1-like              381   1e-126   
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                       381   1e-126   
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                       381   2e-126   
ref|XP_010915490.1|  PREDICTED: peroxidase P7-like                      380   2e-126   
dbj|BAM05635.1|  peroxidase 2                                           381   2e-126   
emb|CDP04065.1|  unnamed protein product                                380   2e-126   
emb|CDX80957.1|  BnaC03g02110D                                          380   2e-126   
gb|AAX53172.1|  peroxidase                                              380   2e-126   
ref|XP_004243276.1|  PREDICTED: peroxidase P7-like                      380   2e-126   
ref|XP_002281731.1|  PREDICTED: peroxidase P7                           380   3e-126   
gb|AAL93151.1|AF485265_1  class III peroxidase                          380   3e-126   
ref|XP_004510041.1|  PREDICTED: peroxidase 52-like                      380   4e-126   
gb|ACF08095.1|  class III peroxidase                                    380   4e-126   
ref|XP_008374993.1|  PREDICTED: peroxidase 4-like                       379   5e-126   
gb|AAR31108.1|  peroxidase precursor                                    380   5e-126   
ref|XP_002461207.1|  hypothetical protein SORBIDRAFT_02g042840          379   5e-126   
gb|KEH38859.1|  lignin biosynthetic peroxidase                          379   5e-126   
emb|CBI15847.3|  unnamed protein product                                377   6e-126   
ref|XP_010067582.1|  PREDICTED: peroxidase P7-like                      379   6e-126   
ref|XP_009404514.1|  PREDICTED: peroxidase P7-like                      379   6e-126   
ref|XP_009381205.1|  PREDICTED: peroxidase P7-like                      379   7e-126   
ref|XP_008460239.1|  PREDICTED: lignin-forming anionic peroxidase...    379   7e-126   
dbj|BAJ95101.1|  predicted protein                                      379   7e-126   
ref|NP_001057821.2|  Os06g0547100                                       380   8e-126   
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      379   8e-126   
ref|XP_009130879.1|  PREDICTED: peroxidase 52-like                      379   8e-126   
ref|XP_002517727.1|  Cationic peroxidase 1 precursor, putative          376   1e-125   
gb|KHN29528.1|  Cationic peroxidase 1                                   376   1e-125   
ref|XP_004140410.1|  PREDICTED: lignin-forming anionic peroxidase...    378   1e-125   
tpe|CAH69351.1|  TPA: class III peroxidase 109 precursor                378   1e-125   
dbj|BAD97435.1|  peroxidase                                             378   1e-125   
ref|XP_008374518.1|  PREDICTED: peroxidase P7-like isoform X2           378   2e-125   
ref|XP_009404515.1|  PREDICTED: peroxidase P7-like                      378   2e-125   
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           377   2e-125   
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                      377   2e-125   
emb|CBI19220.3|  unnamed protein product                                380   2e-125   
gb|KDP25488.1|  hypothetical protein JCGZ_20644                         377   2e-125   
emb|CAN81400.1|  hypothetical protein VITISV_038539                     377   3e-125   
ref|XP_008792262.1|  PREDICTED: peroxidase 4-like                       386   3e-125   
ref|XP_007218699.1|  hypothetical protein PRUPE_ppa008820mg             377   3e-125   
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000          377   4e-125   
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                      377   5e-125   
ref|XP_009369253.1|  PREDICTED: peroxidase 4-like                       377   6e-125   
gb|KHN40654.1|  Cationic peroxidase 1                                   374   6e-125   
ref|XP_006466288.1|  PREDICTED: peroxidase 4-like                       377   6e-125   
ref|XP_004140450.1|  PREDICTED: lignin-forming anionic peroxidase...    377   6e-125   
ref|XP_002320417.1|  peroxidase family protein                          376   6e-125   
gb|ACU82387.2|  peroxidase 1                                            376   7e-125   
emb|CDP06406.1|  unnamed protein product                                385   7e-125   
ref|XP_010922691.1|  PREDICTED: peroxidase 4-like                       376   7e-125   
ref|XP_010064225.1|  PREDICTED: cationic peroxidase 1-like              377   8e-125   
ref|XP_002461208.1|  hypothetical protein SORBIDRAFT_02g042850          376   9e-125   
ref|XP_006348978.1|  PREDICTED: peroxidase 52-like                      376   9e-125   
gb|AFK49124.1|  unknown                                                 376   1e-124   
ref|XP_008374548.1|  PREDICTED: peroxidase 4-like isoform X2            376   1e-124   
ref|XP_004487572.1|  PREDICTED: peroxidase 4-like                       376   1e-124   
ref|XP_004303193.1|  PREDICTED: peroxidase 52-like                      376   1e-124   
ref|XP_008233849.1|  PREDICTED: peroxidase 4-like                       376   1e-124   
ref|XP_011070600.1|  PREDICTED: lignin-forming anionic peroxidase...    375   2e-124   
ref|XP_009363835.1|  PREDICTED: peroxidase 4-like                       375   2e-124   
gb|EAZ01279.1|  hypothetical protein OsI_23302                          375   2e-124   
gb|KDO60611.1|  hypothetical protein CISIN_1g020951mg                   375   2e-124   
ref|XP_009410536.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    375   2e-124   
ref|XP_006658122.1|  PREDICTED: peroxidase 70-like                      375   2e-124   
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                       375   2e-124   
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                      375   3e-124   
ref|XP_009403860.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    374   3e-124   
emb|CBI22007.3|  unnamed protein product                                378   4e-124   
ref|NP_001057820.1|  Os06g0546500                                       374   4e-124   
ref|XP_008244108.1|  PREDICTED: peroxidase 4                            374   5e-124   
ref|NP_001054096.1|  Os04g0651000                                       374   6e-124   
gb|AAX44001.2|  putative secretory peroxidase                           374   6e-124   
ref|XP_002319967.2|  hypothetical protein POPTR_0013s15240g             374   7e-124   
ref|XP_004497330.1|  PREDICTED: cationic peroxidase 1-like              374   9e-124   
ref|XP_003616748.1|  Peroxidase                                         374   1e-123   
ref|XP_010915491.1|  PREDICTED: peroxidase P7-like                      373   1e-123   
ref|XP_006658123.1|  PREDICTED: peroxidase 2-like                       373   1e-123   
ref|XP_006657041.1|  PREDICTED: peroxidase 4-like                       373   1e-123   
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210          373   2e-123   
ref|XP_008790007.1|  PREDICTED: peroxidase P7-like                      372   2e-123   
ref|XP_006848008.1|  hypothetical protein AMTR_s00029p00168370          373   2e-123   
gb|ACI03401.1|  peroxidase 1                                            372   2e-123   
ref|XP_009369619.1|  PREDICTED: cationic peroxidase 1-like              382   2e-123   
ref|XP_007011215.1|  Peroxidase superfamily protein isoform 1           372   4e-123   
ref|XP_007215699.1|  hypothetical protein PRUPE_ppa008808mg             372   5e-123   
ref|NP_001060627.1|  Os07g0677100                                       371   6e-123   
ref|XP_003596717.1|  Peroxidase                                         371   8e-123   
gb|KHG25850.1|  Peroxidase 4                                            371   9e-123   
ref|XP_006658125.1|  PREDICTED: peroxidase 2-like                       370   1e-122   
ref|XP_004967085.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P...    371   1e-122   
ref|XP_004958681.1|  PREDICTED: peroxidase 2-like                       370   1e-122   
ref|XP_004145303.1|  PREDICTED: cationic peroxidase 1-like              370   2e-122   
gb|KEH34419.1|  anionic peroxidase swpb3 protein                        370   2e-122   
ref|XP_010246463.1|  PREDICTED: peroxidase P7-like                      370   2e-122   
ref|XP_006387938.1|  hypothetical protein POPTR_0466s00210g             370   2e-122   
ref|XP_003540408.1|  PREDICTED: cationic peroxidase 1                   370   2e-122   
dbj|BAJ98947.1|  predicted protein                                      370   2e-122   
ref|XP_002521867.1|  Lignin-forming anionic peroxidase precursor,...    370   3e-122   
ref|XP_006658124.1|  PREDICTED: peroxidase 2-like                       369   3e-122   
gb|KHG17773.1|  Peroxidase 52 -like protein                             370   3e-122   
ref|XP_007017044.1|  Peroxidase 68                                      379   3e-122   
gb|AFK42570.1|  unknown                                                 369   3e-122   
dbj|BAM05637.1|  peroxidase 2                                           370   4e-122   
gb|KHN44723.1|  Peroxidase 4                                            369   4e-122   
gb|EMT02792.1|  Peroxidase 52                                           369   4e-122   
ref|XP_003545648.1|  PREDICTED: peroxidase 4                            369   5e-122   
emb|CAD67478.1|  peroxidase                                             369   5e-122   
ref|XP_010264469.1|  PREDICTED: peroxidase 2-like                       369   5e-122   
ref|XP_002437128.1|  hypothetical protein SORBIDRAFT_10g021610          369   5e-122   
ref|XP_007132831.1|  hypothetical protein PHAVU_011G128200g             369   5e-122   
ref|XP_009408893.1|  PREDICTED: peroxidase P7-like                      369   5e-122   
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg             369   6e-122   
ref|XP_010067580.1|  PREDICTED: peroxidase 4-like                       369   6e-122   
gb|KHN48387.1|  Peroxidase 52                                           367   6e-122   
ref|XP_011070598.1|  PREDICTED: lignin-forming anionic peroxidase...    369   6e-122   
ref|XP_002974373.1|  hypothetical protein SELMODRAFT_101253             369   7e-122   
ref|XP_006848019.1|  hypothetical protein AMTR_s00029p00173440          369   7e-122   
ref|XP_009388701.1|  PREDICTED: peroxidase P7-like                      374   7e-122   
gb|AAA20473.1|  peroxidase                                              368   8e-122   
gb|AAC05277.1|  peroxidase FLXPER4                                      368   8e-122   
ref|XP_011070596.1|  PREDICTED: lignin-forming anionic peroxidase...    369   9e-122   
gb|KHN27952.1|  Cationic peroxidase 1                                   368   9e-122   
ref|XP_006468993.1|  PREDICTED: peroxidase 52-like                      368   1e-121   
emb|CBI18065.3|  unnamed protein product                                372   1e-121   
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                       368   1e-121   
ref|XP_007134676.1|  hypothetical protein PHAVU_010G066600g             369   1e-121   
gb|KDO63401.1|  hypothetical protein CISIN_1g020966mg                   368   1e-121   
ref|XP_006656148.1|  PREDICTED: peroxidase 4-like                       368   1e-121   
ref|XP_003596716.1|  Peroxidase                                         368   2e-121   
ref|XP_011070595.1|  PREDICTED: lignin-forming anionic peroxidase...    368   2e-121   
ref|XP_010030093.1|  PREDICTED: lignin-forming anionic peroxidase...    367   2e-121   
ref|XP_002509730.1|  Lignin-forming anionic peroxidase precursor,...    368   2e-121   
gb|EMT26112.1|  Peroxidase 52                                           374   2e-121   
ref|XP_006378807.1|  hypothetical protein POPTR_0010s24330g             367   2e-121   
gb|EMT26113.1|  Peroxidase 4                                            367   2e-121   
ref|XP_011070597.1|  PREDICTED: lignin-forming anionic peroxidase...    367   2e-121   
ref|XP_002461211.1|  hypothetical protein SORBIDRAFT_02g042870          367   2e-121   
ref|XP_008228933.1|  PREDICTED: peroxidase P7-like                      367   3e-121   
ref|XP_007149728.1|  hypothetical protein PHAVU_005G094200g             367   3e-121   
emb|CAD67477.1|  peroxidase                                             367   3e-121   
gb|AAC49819.1|  peroxidase                                              367   3e-121   
ref|XP_006378808.1|  hypothetical protein POPTR_0010s24340g             367   3e-121   
gb|KEH29224.1|  class III peroxidase                                    368   3e-121   
ref|XP_011080818.1|  PREDICTED: uncharacterized protein LOC105163979    379   5e-121   
ref|XP_003602461.1|  Peroxidase                                         367   5e-121   
ref|NP_001060628.1|  Os07g0677200                                       367   5e-121   
gb|KHG00581.1|  hypothetical protein F383_17561                         378   5e-121   
ref|XP_002509738.1|  Lignin-forming anionic peroxidase precursor,...    367   5e-121   
ref|XP_002438533.1|  hypothetical protein SORBIDRAFT_10g021640          366   5e-121   
gb|AHL39166.1|  class III peroxidase                                    366   6e-121   
ref|XP_008450825.1|  PREDICTED: peroxidase P7-like                      366   7e-121   
gb|KHN08839.1|  Cationic peroxidase 1                                   364   8e-121   
ref|XP_010689732.1|  PREDICTED: peroxidase P7-like                      366   9e-121   
ref|XP_003522012.2|  PREDICTED: cationic peroxidase 1-like              369   9e-121   
gb|AGF25269.1|  peroxidase 2                                            366   1e-120   
ref|XP_003601028.1|  Peroxidase                                         366   1e-120   
gb|KGN47223.1|  hypothetical protein Csa_6G216420                       365   1e-120   
emb|CAA46916.1|  peroxidase                                             365   1e-120   
dbj|BAK03677.1|  predicted protein                                      365   1e-120   
gb|EPS63041.1|  hypothetical protein M569_11749                         365   2e-120   
ref|XP_006848018.1|  hypothetical protein AMTR_s00029p00173190          365   2e-120   
ref|XP_004150607.1|  PREDICTED: peroxidase 4-like                       365   2e-120   
ref|XP_003592769.1|  Peroxidase                                         365   2e-120   
ref|XP_009365290.1|  PREDICTED: peroxidase P7-like                      365   2e-120   
ref|XP_009384773.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    366   3e-120   
gb|KEH29223.1|  class III peroxidase                                    365   3e-120   
ref|XP_003540000.1|  PREDICTED: peroxidase 52                           365   3e-120   
ref|XP_008381199.1|  PREDICTED: peroxidase P7-like                      366   3e-120   
ref|XP_006842568.1|  hypothetical protein AMTR_s00077p00148760          364   3e-120   
ref|XP_002448660.1|  hypothetical protein SORBIDRAFT_06g030940          365   3e-120   
ref|XP_004253400.1|  PREDICTED: peroxidase 70-like                      365   3e-120   
ref|XP_004491048.1|  PREDICTED: peroxidase 4-like                       365   3e-120   
tpg|DAA64106.1|  TPA: peroxidase J                                      364   4e-120   
ref|XP_002450133.1|  hypothetical protein SORBIDRAFT_05g001010          365   4e-120   
ref|XP_011024237.1|  PREDICTED: lignin-forming anionic peroxidase...    364   4e-120   
dbj|BAJ97638.1|  predicted protein                                      364   4e-120   
gb|AFW64595.1|  hypothetical protein ZEAMMB73_885092                    365   4e-120   
gb|AAC49818.1|  peroxidase                                              364   4e-120   
gb|EPS73958.1|  peroxidase 3                                            364   5e-120   
ref|XP_011024238.1|  PREDICTED: peroxidase 5-like                       365   5e-120   
ref|NP_001169452.1|  uncharacterized protein LOC100383323 precursor     364   6e-120   
ref|XP_004150606.1|  PREDICTED: peroxidase 4-like                       364   7e-120   
ref|XP_010087166.1|  Peroxidase 4                                       364   7e-120   
gb|ABO77632.1|  peroxidase                                              363   8e-120   
gb|AHH91638.1|  POD3 protein                                            361   1e-119   
gb|ABR23054.1|  basic peroxidase swpb4                                  363   1e-119   
ref|XP_004965566.1|  PREDICTED: peroxidase 52-like                      365   1e-119   
dbj|BAJ96564.1|  predicted protein                                      363   1e-119   
ref|XP_004172441.1|  PREDICTED: peroxidase 4-like                       363   1e-119   
gb|KGN47222.1|  hypothetical protein Csa_6G216410                       362   1e-119   
ref|XP_008455297.1|  PREDICTED: peroxidase P7-like                      362   1e-119   
ref|NP_001060631.1|  Os07g0677500                                       362   2e-119   
ref|XP_004149366.1|  PREDICTED: peroxidase 4-like                       362   2e-119   
ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                       363   2e-119   
ref|XP_010654887.1|  PREDICTED: lignin-forming anionic peroxidase...    363   2e-119   
ref|XP_004514553.1|  PREDICTED: cationic peroxidase 1-like              362   3e-119   
ref|XP_011095108.1|  PREDICTED: cationic peroxidase 1-like              362   3e-119   
gb|EEC78144.1|  hypothetical protein OsI_17703                          362   3e-119   
gb|KGN65858.1|  hypothetical protein Csa_1G533650                       362   4e-119   
gb|KDP25492.1|  hypothetical protein JCGZ_20648                         362   4e-119   
ref|NP_001147216.1|  LOC100280824 precursor                             362   4e-119   
emb|CAN73051.1|  hypothetical protein VITISV_015511                     361   4e-119   
ref|XP_002467656.1|  hypothetical protein SORBIDRAFT_01g031740          362   4e-119   
ref|XP_004505714.1|  PREDICTED: lignin-forming anionic peroxidase...    361   5e-119   
gb|AAY89058.1|  class III peroxidase                                    362   5e-119   
ref|XP_002311022.2|  hypothetical protein POPTR_0008s02340g             361   6e-119   
ref|XP_011032836.1|  PREDICTED: lignin-forming anionic peroxidase...    361   6e-119   
gb|EPS67864.1|  hypothetical protein M569_06908                         361   6e-119   
ref|XP_006652927.1|  PREDICTED: peroxidase 2-like                       361   6e-119   
ref|XP_004958684.1|  PREDICTED: peroxidase 2-like                       361   6e-119   
emb|CAJ86184.1|  H0212B02.16                                            362   7e-119   
ref|XP_011070599.1|  PREDICTED: lignin-forming anionic peroxidase...    361   7e-119   
ref|XP_004951344.1|  PREDICTED: peroxidase 70-like                      361   7e-119   
gb|AAB48184.1|  peroxidase precursor                                    361   7e-119   
ref|XP_007131640.1|  hypothetical protein PHAVU_011G030200g             361   8e-119   
ref|XP_004958682.1|  PREDICTED: peroxidase 2-like                       360   8e-119   
gb|KDP22794.1|  hypothetical protein JCGZ_00381                         360   8e-119   
ref|XP_008465299.1|  PREDICTED: peroxidase 4-like                       361   9e-119   
dbj|BAJ86726.1|  predicted protein                                      360   9e-119   
gb|EEC82681.1|  hypothetical protein OsI_27325                          360   1e-118   
gb|ADC42135.1|  lignin biosynthetic peroxidase                          360   1e-118   
gb|AFW86738.1|  peroxidase 52 isoform 1                                 360   1e-118   
ref|XP_002269145.1|  PREDICTED: lignin-forming anionic peroxidase       361   1e-118   
ref|XP_002450132.1|  hypothetical protein SORBIDRAFT_05g001000          361   1e-118   



>ref|XP_006349568.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=316

 Score =   483 bits (1243),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 237/293 (81%), Positives = 264/293 (90%), Gaps = 1/293 (0%)
 Frame = -1

Query  1102  LSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANF  923
             LSANFYS++CPN LS+I+TAV +AV+SEARMGASLLRLHFHDCFVNGCDAS+LLDDT+NF
Sbjct  24    LSANFYSSSCPNVLSVIKTAVNSAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDTSNF  83

Query  922   TGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLL  743
             TGE++AGPN  SIRG +VID IKTQ+E SC G+VSCADI+AVAARDSVV LGGPSW +LL
Sbjct  84    TGEKTAGPNSGSIRGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGPSWTVLL  143

Query  742   GRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRS  566
             GRRDSTTAS SAANS       SLS LIS+FSNKG +AREMVALSGSHTIGQA+C+ FR+
Sbjct  144   GRRDSTTASLSAANSNLPGPTSSLSALISSFSNKGLTAREMVALSGSHTIGQARCTTFRT  203

Query  565   RIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQ  386
             R+YNE NINASFAT +KANCPQSGGDNNL+PLD T+PTSFDNAY+KNLQ QKGLLHSDQ 
Sbjct  204   RLYNEANINASFATTVKANCPQSGGDNNLSPLDITSPTSFDNAYYKNLQIQKGLLHSDQV  263

Query  385   LFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             LFNGGSTDSIVNTYSSN +TF+TDFANAMVKM NLSPLTGT GQIRKNCRKTN
Sbjct  264   LFNGGSTDSIVNTYSSNSATFSTDFANAMVKMGNLSPLTGTNGQIRKNCRKTN  316



>ref|XP_010041464.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   472 bits (1215),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 231/295 (78%), Positives = 263/295 (89%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FYST+CP+ALS I++ V++AV SEARMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  25    AQLSSTFYSTSCPSALSTIKSGVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDTA  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NS+RG NVID IK+QLE +C G+VSCAD++ VAARDSVVALGGPSW +
Sbjct  85    NFTGEKNAGPNANSLRGFNVIDTIKSQLESACPGIVSCADLLTVAARDSVVALGGPSWTV  144

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTASQSAANS      LSLS LI+ FSNKGF+A+EMVALSGSHTIGQA+C+ F
Sbjct  145   PLGRRDSTTASQSAANSNIPAFTLSLSGLITAFSNKGFTAKEMVALSGSHTIGQARCTTF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNENNINA+FAT LKANCP SGGDNNL+PLDTT+PTSFDNAYFKNLQ QKGLLHSD
Sbjct  205   RTRLYNENNINATFATSLKANCPSSGGDNNLSPLDTTSPTSFDNAYFKNLQIQKGLLHSD  264

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTD+ VN YSSN +TF TDFANAMVKM NLSPLTG+ GQIRK+C K N
Sbjct  265   QQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKSCGKVN  319



>ref|XP_009594465.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=314

 Score =   467 bits (1201),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 228/295 (77%), Positives = 265/295 (90%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A+L++NFYS+TCPN LS+I+TAV +A++ E+RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  21    AELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDDTS  80

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN  S+RG +VID IKTQ+E +C GVVSCADI+AVAARDSVV LGGPSWN+
Sbjct  81    SFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSWNV  140

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS SAAN+    P L+LS LIS+FSNKGF+AREMVALSGSHTIGQA+C+ F
Sbjct  141   LLGRRDSTTASLSAANNDIPAPTLNLSSLISSFSNKGFNAREMVALSGSHTIGQARCTTF  200

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R+YNE NIN+SF T +KANCPQ+GGDNNL+PLD T+PT+FDNAY+KNLQSQKG+LHSD
Sbjct  201   RDRLYNETNINSSFGTSIKANCPQNGGDNNLSPLD-TSPTTFDNAYYKNLQSQKGILHSD  259

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDSIVNTYSSN +TF TDFA AMVKM NLSPLTGT GQIRKNCRK N
Sbjct  260   QQLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNCRKNN  314



>ref|XP_010041557.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   466 bits (1199),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 225/295 (76%), Positives = 257/295 (87%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FYST+CP+ALS I++AV++AV SEARMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  25    AQLSSTFYSTSCPSALSTIKSAVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDTA  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN NS+RG +VID IK+QLE +C GVVSCAD++ VAARDSVVALGGPSW +
Sbjct  85    NFTGEKNATPNANSLRGFDVIDTIKSQLESACPGVVSCADLLTVAARDSVVALGGPSWTV  144

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTASQSAANS           LI+ FSNKGF+ +EMVALSGSHTIGQA+C+ F
Sbjct  145   PLGRRDSTTASQSAANSNIPAPTLNLSGLITAFSNKGFTTKEMVALSGSHTIGQARCTSF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNENNIN +FAT LKANCP SGGDNNL+PLDTT+PTSFDNAYFKNLQ Q+GLLHSD
Sbjct  205   RARLYNENNINTTFATSLKANCPSSGGDNNLSPLDTTSPTSFDNAYFKNLQIQEGLLHSD  264

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTD+ VN YSSN +TF TDFANAMVKM NLSPLTG+ GQIRKNCR  N
Sbjct  265   QQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRNVN  319



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   466 bits (1198),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 227/295 (77%), Positives = 264/295 (89%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A+L++NFYS+TCPN LS+I+TAV +A++ E+RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  21    AELTSNFYSSTCPNVLSVIKTAVNSAISKESRMGASLLRLHFHDCFVNGCDASVLLDDTS  80

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN  S+RG +VID IKTQ+E +C GVVSCADI+AVAARDSVV LGGPSWN+
Sbjct  81    SFTGEKTANPNSGSLRGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSWNV  140

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS SAAN+    P L+LS LIS+FSNKGF++REMVALSGSHTIGQA+C+ F
Sbjct  141   LLGRRDSTTASLSAANNDIPAPTLNLSSLISSFSNKGFNSREMVALSGSHTIGQARCTTF  200

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R+YNE NIN+SF T +KANCPQ+GGDNNL+PLD T+PTSFDN Y+KNLQSQKG+LHSD
Sbjct  201   RDRLYNETNINSSFGTTIKANCPQNGGDNNLSPLD-TSPTSFDNVYYKNLQSQKGILHSD  259

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDSIVNTYSSN +TF TDFA AMVKM NLSPLTGT GQIRKNCRK N
Sbjct  260   QQLFNGGSTDSIVNTYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNCRKIN  314



>ref|XP_007033589.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY04515.1| Peroxidase superfamily protein [Theobroma cacao]
Length=322

 Score =   462 bits (1190),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 227/295 (77%), Positives = 254/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFY+TTCP AL+ I++AV +AV+ EARMGASLLRLHFHDCFVNGCDASILLDDTA
Sbjct  28    AQLSSNFYATTCPRALATIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASILLDDTA  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             N TGE++AGPN NS+RG  VID IK+QLE  C  VVSCADIVAVAARDSVVALGGPSW++
Sbjct  88    NITGEKTAGPNNNSVRGYEVIDTIKSQLESLCPAVVSCADIVAVAARDSVVALGGPSWSV  147

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS +AANS           LIS FSNKGF+A+EMVALSGSHTIGQA+C+ F
Sbjct  148   LLGRRDSTTASLNAANSNIPAPTLSLSGLISAFSNKGFTAKEMVALSGSHTIGQARCTTF  207

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE  I+ SFAT L+ANCP +GGDNNL+PLDTT+PTSFDNAY+KNLQSQKGLLHSD
Sbjct  208   RSRIYNETTIDPSFATSLRANCPSTGGDNNLSPLDTTSPTSFDNAYYKNLQSQKGLLHSD  267

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS VN YSSN  +F TDFANAM+KM NLSPLTGT GQIR NCRK N
Sbjct  268   QQLFSGGSTDSQVNAYSSNLGSFRTDFANAMIKMGNLSPLTGTSGQIRTNCRKVN  322



>ref|XP_010653358.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=325

 Score =   462 bits (1189),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 228/295 (77%), Positives = 258/295 (87%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFY+ TCPNALSII++AV +AV SEARMGASLLRLHFHDCFVNGCDASILLDDT+
Sbjct  31    AQLTTNFYAKTCPNALSIIKSAVNSAVKSEARMGASLLRLHFHDCFVNGCDASILLDDTS  90

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NS+RG  V+D IK+QLE SC GVVSCADI+AVAARDSVVAL GPSW +
Sbjct  91    NFTGEKTAGPNANSVRGYEVVDTIKSQLEASCPGVVSCADILAVAARDSVVALRGPSWMV  150

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAANS      L+LS LIS F+NKGF+AREMVALSGSHTIGQA+C+ F
Sbjct  151   RLGRRDSTTASLSAANSNIPAPTLNLSGLISAFTNKGFNAREMVALSGSHTIGQARCTTF  210

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE NI+ASF T L+ANCP SGGDN L+PLDT TPT+FDNAY+ NL ++KGLLHSD
Sbjct  211   RTRIYNEANIDASFKTSLQANCPSSGGDNTLSPLDTQTPTTFDNAYYTNLVNKKGLLHSD  270

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTD++VNTYS+  +TF TDFANAMVKM NLSPLTGT GQIR NCRKTN
Sbjct  271   QQLFNGGSTDAVVNTYSTRSTTFFTDFANAMVKMGNLSPLTGTSGQIRTNCRKTN  325



>ref|XP_010066394.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   461 bits (1186),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 227/295 (77%), Positives = 259/295 (88%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FYS +CP+AL  I++ V++AV+SEARMGASLLRLHFHDCFVNGCDASILLDDT 
Sbjct  25    AQLSSTFYSKSCPSALRTIKSGVSSAVSSEARMGASLLRLHFHDCFVNGCDASILLDDTT  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AG N NSIRG  VID IK+ LE SC GVVSCADI+A+AARDSVVALGGPSW +
Sbjct  85    NFTGEKTAGANNNSIRGYEVIDTIKSHLESSCPGVVSCADILAIAARDSVVALGGPSWTV  144

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS + ANS      LSLS LI++FSNKGF+A+EMVALSGSHTIGQA+C+ F
Sbjct  145   LLGRRDSTTASLTDANSDIPAPTLSLSDLITSFSNKGFTAKEMVALSGSHTIGQARCTSF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNEN+INA+FAT L ANCP SGGDNNL+PLDTT+PT FDNAYFKNLQ+QKGLLHSD
Sbjct  205   RTRLYNENDINATFATSLNANCPSSGGDNNLSPLDTTSPTYFDNAYFKNLQTQKGLLHSD  264

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTD+ VNTYSSN +TF TDFANAMV M NLSPLTG+ GQIRKNCRK N
Sbjct  265   QQLFSGGSTDAQVNTYSSNSATFMTDFANAMVTMGNLSPLTGSSGQIRKNCRKVN  319



>ref|XP_010041648.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   459 bits (1181),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 227/295 (77%), Positives = 260/295 (88%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A+LS+ FY T+CP+AL  I++ V +AV+SEARMGASLLRLHFHDCFVNGCDASILLDDT 
Sbjct  25    ARLSSTFYFTSCPSALHTIKSGVNSAVSSEARMGASLLRLHFHDCFVNGCDASILLDDTT  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AG N NSIRG  VID IK+QLE SC GVVSCADI+AVAARDS+VALGGPSW +
Sbjct  85    NFTGEKTAGANDNSIRGYEVIDTIKSQLESSCPGVVSCADILAVAARDSIVALGGPSWRV  144

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS SAANS      LSLS LI+ FSNKGF+A+EMVALSGSHTIGQA+C+ F
Sbjct  145   LLGRRDSTTASLSAANSDIPAPTLSLSDLITAFSNKGFTAKEMVALSGSHTIGQARCTTF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             ++R+YNE++IN++FAT LK NCP SGGDNNL+PLDTT+PT FDNAYFKNLQ+QKGLLHSD
Sbjct  205   QTRLYNESDINSTFATSLKENCPSSGGDNNLSPLDTTSPTYFDNAYFKNLQTQKGLLHSD  264

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTD+ VNTYSSN +TF TDFANAMVKM NLSPLTG+ GQIRKNCRK N
Sbjct  265   QQLFSGGSTDAQVNTYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRKLN  319



>ref|XP_009803848.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   459 bits (1181),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/293 (78%), Positives = 258/293 (88%), Gaps = 2/293 (1%)
 Frame = -1

Query  1102  LSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANF  923
             LSANFYS++CPN LS+I+TAV +AV  EARMGASLLRLHFHDCFVNGCDAS+LLDDT+NF
Sbjct  23    LSANFYSSSCPNVLSVIKTAVDSAVTKEARMGASLLRLHFHDCFVNGCDASVLLDDTSNF  82

Query  922   TGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLL  743
             TGE++A PN  S+RG +VID IKT++E SC GVVSCADI+AVAARDSVV LGGPSW +LL
Sbjct  83    TGEKTANPNSGSLRGFDVIDTIKTKVEASCAGVVSCADILAVAARDSVVKLGGPSWTVLL  142

Query  742   GRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRS  566
             GRRDSTTAS SAAN+    P L+LS LIS+FS KG +AREMVALSG HTIGQA+C+ FR+
Sbjct  143   GRRDSTTASLSAANNNIPAPTLNLSGLISSFSTKGLTAREMVALSGGHTIGQARCTTFRN  202

Query  565   RIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQ  386
             R+YNE NINASFAT +KANCPQSGG+NNL+PLD T+PTSFDN YFKNLQ QKGLLHSDQQ
Sbjct  203   RLYNEANINASFATSVKANCPQSGGNNNLSPLD-TSPTSFDNVYFKNLQIQKGLLHSDQQ  261

Query  385   LFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             LF+GGST SIVNTYSSN +TF TDF NAMVKM NLSPLTGT GQIRKNCRKTN
Sbjct  262   LFSGGSTHSIVNTYSSNSATFFTDFKNAMVKMGNLSPLTGTSGQIRKNCRKTN  314



>ref|XP_006345521.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   455 bits (1171),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 222/295 (75%), Positives = 260/295 (88%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL++NFY+++CPN LSII+T V +A+ +E+RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  23    AQLTSNFYNSSCPNVLSIIKTVVNSAIATESRMGASLLRLHFHDCFVNGCDASVLLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN  SIRG +VID IKTQ+E SC G+VSCADI+AVAARDSVV LGG SW +
Sbjct  83    SFTGEKTANPNSGSIRGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGRSWTV  142

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS S ANS      L+LS LIS+FSNKGF++REMVALSGSHTIGQA+C+ F
Sbjct  143   LLGRRDSTTASLSTANSDIPAPTLNLSGLISSFSNKGFNSREMVALSGSHTIGQARCTTF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R+YNE +INA+FAT LK+NCPQSG DNN++PLDTT+PT+FDN Y+KNL+ QKGLLHSD
Sbjct  203   RDRLYNETDINATFATSLKSNCPQSGSDNNISPLDTTSPTTFDNIYYKNLRIQKGLLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL +GGSTDSIVNTYSSN +TF TDFANAMVKM NLSPLTGT GQIRKNCRKTN
Sbjct  263   QQLSSGGSTDSIVNTYSSNSATFFTDFANAMVKMGNLSPLTGTNGQIRKNCRKTN  317



>ref|XP_004240055.1| PREDICTED: cationic peroxidase 1-like [Solanum lycopersicum]
Length=317

 Score =   451 bits (1161),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 220/295 (75%), Positives = 257/295 (87%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL++NFY+++CPN LSII+TAV +A+  E+RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  23    AQLTSNFYNSSCPNVLSIIKTAVNSAIAKESRMGASLLRLHFHDCFVNGCDASVLLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN  S+RG +VID IKTQ+E SC GVVSCADI+AVAARDSVV LGGPSW +
Sbjct  83    SFTGEKTANPNSGSLRGFDVIDTIKTQIESSCAGVVSCADILAVAARDSVVKLGGPSWTV  142

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS S ANS      L+LS LIS+FSNKGF+ REMVALSGSHTIGQA+C+ F
Sbjct  143   LLGRRDSTTASLSNANSDIPAPTLNLSSLISSFSNKGFNTREMVALSGSHTIGQARCTTF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R++NE +INASFAT +K+ CPQSG DNN++PLDTT+PT+FDN Y+KNL+ QKGLLHSD
Sbjct  203   RDRLHNETDINASFATSIKSKCPQSGSDNNVSPLDTTSPTTFDNIYYKNLRIQKGLLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL +GGSTDSIVNTYSSN +TF  DFA AMVKM NLSPLTGT GQIRKNCRKTN
Sbjct  263   QQLSSGGSTDSIVNTYSSNSATFLADFAKAMVKMGNLSPLTGTNGQIRKNCRKTN  317



>gb|ACJ11762.1| class III peroxidase [Gossypium hirsutum]
Length=323

 Score =   449 bits (1155),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 226/295 (77%), Positives = 254/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FYSTTCP ALS I++AV +AV++EARMGASL RLHFHDCFVNGCD SILLDDTA
Sbjct  29    AQLSSTFYSTTCPRALSTIKSAVNSAVSNEARMGASLPRLHFHDCFVNGCDGSILLDDTA  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             N TGE++A PN NS RG  VID IK+Q+E  C GVVSCADIVAVAARDSVVALGGPSW +
Sbjct  89    NMTGEKTAVPNSNSARGFEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPSWIV  148

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS SAANS      L+LS LI+ FSNKGF+A+EMVALSGSHTIGQA+C+ F
Sbjct  149   LLGRRDSTTASLSAANSNIPAPTLNLSGLITAFSNKGFTAKEMVALSGSHTIGQARCTTF  208

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE NI+++FAT L+ANCP +GGDN+L+PLDTT+ TSFDNAYFKNLQ QKGLLHSD
Sbjct  209   RTRIYNETNIDSTFATSLRANCPSNGGDNSLSPLDTTSSTSFDNAYFKNLQGQKGLLHSD  268

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS VN YSSN  +F TDFANAMVKM NLSPLTGT GQIR NCRK N
Sbjct  269   QQLFSGGSTDSQVNAYSSNLGSFTTDFANAMVKMGNLSPLTGTSGQIRTNCRKAN  323



>ref|XP_010653359.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=326

 Score =   449 bits (1154),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 221/295 (75%), Positives = 251/295 (85%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ N+YS++CPNALSII++AV  AVN+EARMGASLLRLHFHDCFVNGCDASILLDDT+
Sbjct  32    AQLTTNYYSSSCPNALSIIKSAVNTAVNNEARMGASLLRLHFHDCFVNGCDASILLDDTS  91

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN NS+RG +VID IK+Q+E SC GVVSCADI+AV ARDSVVALGGPSW +
Sbjct  92    NFTGEKTAVPNANSVRGFDVIDTIKSQVESSCPGVVSCADILAVVARDSVVALGGPSWTV  151

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S ANS           LIS+FSNKGFSA EMVALSGSHTIGQA+C+ F
Sbjct  152   RLGRRDSTTASLSTANSDIPAPTLNLSGLISSFSNKGFSANEMVALSGSHTIGQARCTNF  211

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R+YNE NI+ASF + L+ANCP SGGDNNL+PLDT +PT+FDNAYF NL + KGLLHSD
Sbjct  212   RDRLYNETNIDASFQSSLQANCPSSGGDNNLSPLDTKSPTTFDNAYFTNLVNNKGLLHSD  271

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDS V TYS+  +TF TDFANA+VKM NLSPLTGT GQIR NCRKTN
Sbjct  272   QQLFNGGSTDSQVTTYSTKSTTFFTDFANAIVKMGNLSPLTGTSGQIRTNCRKTN  326



>gb|ACZ51443.1| peroxidase protein [Mikania micrantha]
Length=321

 Score =   448 bits (1153),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 221/295 (75%), Positives = 255/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLSANFY+T+CPN  SII +AV +AV++EARMGASLLRLHFHDCFVNGCDAS+LLDDT 
Sbjct  27    GQLSANFYATSCPNFSSIISSAVNSAVSNEARMGASLLRLHFHDCFVNGCDASVLLDDTT  86

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NS+RG +VID IK+QLE SC GVVSCAD++A AARDSVVALGGPSWNL
Sbjct  87    NFTGEKTAGPNNNSLRGFDVIDTIKSQLESSCPGVVSCADLLATAARDSVVALGGPSWNL  146

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
               GRRDS TAS SAANS      L+LS LI++FSN GF+A EMVALSGSHTIGQA+C+ F
Sbjct  147   AFGRRDSITASLSAANSNIPAPTLNLSGLITSFSNLGFTANEMVALSGSHTIGQARCTVF  206

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNENNIN+SFAT L+ANCP SGGDNNL+PLD  +PTSFDN YF NL +Q GLLHSD
Sbjct  207   RARIYNENNINSSFATSLRANCPSSGGDNNLSPLDVVSPTSFDNTYFTNLLNQNGLLHSD  266

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGSTD+ V TYSSN +TF+TDFAN MVKMSNL+PLTG+ GQ+R NCR+TN
Sbjct  267   QELFNGGSTDAQVRTYSSNAATFSTDFANGMVKMSNLNPLTGSSGQVRTNCRRTN  321



>ref|XP_006345522.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   445 bits (1145),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 218/295 (74%), Positives = 255/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL++NFY+++CPN LSII+TAV +A+  E+RMGAS+LRLHFHDCFVNGCDAS+LLDDT+
Sbjct  23    AQLTSNFYNSSCPNILSIIKTAVNSAIAKESRMGASMLRLHFHDCFVNGCDASVLLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN  S+RG +VID IKTQ+E SC GVVSCADI+AVAARDSVV LGGPSW +
Sbjct  83    SFTGEKTANPNSGSLRGFDVIDTIKTQVESSCAGVVSCADILAVAARDSVVKLGGPSWTV  142

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS S ANS      L+LS LIS+FSNKGF+AREMVALSGSHTIGQA+C+ F
Sbjct  143   LLGRRDSTTASLSTANSDIPAPTLNLSGLISSFSNKGFNAREMVALSGSHTIGQARCTTF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R+YNE +IN SFAT +K+ CPQSG DNN++PLDTT+  +FDN Y+KNL+ QKGLLHSD
Sbjct  203   RDRLYNETDINDSFATSVKSKCPQSGSDNNISPLDTTSANTFDNIYYKNLRIQKGLLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL +GGSTDSIVNTYSSN +TF  DFA AMVKM NLSPLTGT GQIRKNCRKTN
Sbjct  263   QQLSSGGSTDSIVNTYSSNSATFFADFAKAMVKMGNLSPLTGTNGQIRKNCRKTN  317



>ref|XP_003534655.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=342

 Score =   446 bits (1146),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 217/295 (74%), Positives = 257/295 (87%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FY+ TCPNALS I++ V +AVN+E RMGASLLRLHFHDCFV GCDAS+LLDDT+
Sbjct  48    AQLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTS  107

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN  SIRG +VID IK+++E  C GVVSCADI+AVAARDSVVALGG +W +
Sbjct  108   SFTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTV  167

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S+ANS       SLS LIS+FSNKGFS++E+VALSGSHTIGQA+CS F
Sbjct  168   QLGRRDSTTASLSSANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSF  227

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI++SFA  L+ NCP +GGD+NLAPLDTT+P +FDNAYFKNLQS+KGLLHSD
Sbjct  228   RTRIYNDTNIDSSFAKSLQGNCPSTGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSD  287

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGSTDS VN+YSSNP++F TDFANAM+KM NLSPLTG+ GQIR NCRKTN
Sbjct  288   QELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  342



>ref|XP_003552297.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=316

 Score =   444 bits (1142),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 216/295 (73%), Positives = 254/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FY  TCPNALS I++ V +AVN+E RMGASLLRLHFHDCFV GCDAS+LLDDT+
Sbjct  22    AQLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTS  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +F GE++AGPN  SIRG NVID IK+++E  C GVVSCADI+AVAARDSVVALGGP+W +
Sbjct  82    SFKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGPTWTV  141

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S+ANS       SLS LIS+FSNKGFS++E+VALSGSHTIGQA+CS F
Sbjct  142   QLGRRDSTTASLSSANSDLPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI++SFA  L+ NCP +GG + LAPLDTT+P +FDNAYFKNLQS+KGLLHSD
Sbjct  202   RTRIYNDTNIDSSFAKSLQGNCPSTGGGSTLAPLDTTSPNTFDNAYFKNLQSKKGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGSTDS VN+YSSNP++F TDFANAM+KM NLSPLTG+ GQIR NCRKTN
Sbjct  262   QELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  316



>ref|XP_009373126.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=324

 Score =   444 bits (1141),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 220/295 (75%), Positives = 254/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FY T+CPNALS I++AV +AV+ EARMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  30    AQLSSTFYGTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTA  89

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AG N+NS+RG +VID IK+QLE  C  VVSCADI+ VAARDS+VALGG ++ +
Sbjct  90    NFTGEKTAGANVNSLRGFDVIDTIKSQLESLCPKVVSCADILTVAARDSIVALGGLTYTV  149

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAANS      L+LS LI+ FSNKGF+A+E+VALSGSHTIGQA+C+ F
Sbjct  150   PLGRRDSTTASLSAANSNIPAPTLNLSALITAFSNKGFTAKELVALSGSHTIGQARCTTF  209

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE NINASFAT LK++CP SGG NNL+PLD T+PTSFDNAYF NL SQKGLLHSD
Sbjct  210   RTRLYNEANINASFATSLKSSCPTSGGANNLSPLDVTSPTSFDNAYFTNLVSQKGLLHSD  269

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS VN Y SNP+TF TDFANAM+KM NLSPLTGT GQIR NCRK N
Sbjct  270   QQLFSGGSTDSQVNAYVSNPATFRTDFANAMIKMGNLSPLTGTNGQIRTNCRKVN  324



>ref|XP_010093550.1| Cationic peroxidase 1 [Morus notabilis]
 gb|EXB54257.1| Cationic peroxidase 1 [Morus notabilis]
Length=322

 Score =   443 bits (1140),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 217/295 (74%), Positives = 251/295 (85%), Gaps = 3/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFYS++CPNALSI+++AV  AV++EARMGASLLRLHFHDCF  GCDASILLDDT+
Sbjct  30    AQLSSNFYSSSCPNALSIVKSAVKTAVSNEARMGASLLRLHFHDCF--GCDASILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++AGPN NS+RG +V+D IKTQLE +C GVVSCADI+AVAARDSVV LGGPSW +
Sbjct  88    TFTGEKNAGPNANSVRGFDVVDTIKTQLESACAGVVSCADILAVAARDSVVLLGGPSWTV  147

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+TTASQSAA S       +LS LI+ FSNKGF+ +E+VALSG HTIGQAKCS F
Sbjct  148   QLGRRDATTASQSAAGSNIPAPTTNLSGLITAFSNKGFTTKELVALSGGHTIGQAKCSSF  207

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNENNI ASFAT  K+ CP SG DNNL+PLD T+PT+FDNAYFKN+ S KGLLHSD
Sbjct  208   RARLYNENNIEASFATSTKSKCPNSGSDNNLSPLDVTSPTTFDNAYFKNVVSLKGLLHSD  267

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFN GSTDS V  YS+NP++F TDFANAM+KM NLSPLTGT GQIR NCRK N
Sbjct  268   QQLFNNGSTDSQVRAYSTNPTSFRTDFANAMIKMGNLSPLTGTSGQIRTNCRKVN  322



>ref|XP_010066359.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   443 bits (1139),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 217/295 (74%), Positives = 247/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FYST+CP+ALS I+++V++AV +EARMGASLLRLHFHDCFVNGCDASILLDDT 
Sbjct  25    AQLSSTFYSTSCPSALSTIKSSVSSAVKNEARMGASLLRLHFHDCFVNGCDASILLDDTT  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NS+RG  VID IK++LE  C  +VSCADI+AV ARDS+VALGGPSW +
Sbjct  85    NFTGEKNAGPNANSMRGFEVIDTIKSELESKCPSIVSCADILAVVARDSIVALGGPSWTV  144

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTASQSAAN    P       LISTFSNKGF+A+EMVAL GSHTIGQA+C  F
Sbjct  145   NLGRRDSTTASQSAANISIPPPTLNLSGLISTFSNKGFTAKEMVALLGSHTIGQARCLTF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R  +YNENNI+A+FAT LKANCP SGGD+ L P DTT+PTSFDNA+FKNLQ+ K  LHSD
Sbjct  205   REHLYNENNIDATFATSLKANCPSSGGDSKLFPFDTTSPTSFDNAFFKNLQTHKVFLHSD  264

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTD  VN YSSN STF TDFANAMVKM NLSPL G+ GQIRKNCRK N
Sbjct  265   QQLFSGGSTDVHVNAYSSNLSTFRTDFANAMVKMGNLSPLIGSSGQIRKNCRKVN  319



>ref|XP_008370240.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=324

 Score =   442 bits (1138),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/295 (74%), Positives = 253/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FY T+CPNALS I++AV +AV+ EARMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  30    AQLSSTFYGTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTA  89

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AG N NS+RG +VID IK+QLE  C  VVSCADI+ VAARDS+VALGG ++ +
Sbjct  90    NFTGEKTAGANANSLRGFDVIDTIKSQLESLCPKVVSCADILTVAARDSIVALGGLTYTV  149

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAANS      L+LS LI+ FSNKGF+A+E+VALSGSHTIGQA+C+ F
Sbjct  150   PLGRRDSTTASLSAANSNIPAPTLNLSALITAFSNKGFTAKELVALSGSHTIGQARCTTF  209

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE NINASFAT LK++CP SGG+NNL+PLD T+PTSFDNAYF NL SQ GLLHSD
Sbjct  210   RTRLYNEANINASFATSLKSSCPTSGGBNNLSPLDVTSPTSFDNAYFSNLVSQXGLLHSD  269

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS VN Y SNP+TF TDFANAM+KM NLSPLTGT GQIR NCRK N
Sbjct  270   QQLFSGGSTDSQVNAYVSNPATFRTDFANAMIKMGNLSPLTGTNGQIRTNCRKVN  324



>ref|XP_004302590.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=317

 Score =   442 bits (1137),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 216/295 (73%), Positives = 255/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FYS++CP AL+ I++AV +AV+SEARMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  23    AQLSSTFYSSSCPKALATIKSAVDSAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDTA  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AG N NS+RG +V+D IK+QLE  C GV SC+DI+AVAARDSVVALGGPSW +
Sbjct  83    NFTGEKTAGANANSLRGFDVVDTIKSQLESLCPGVFSCSDILAVAARDSVVALGGPSWTV  142

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAAN+      L+LS L+++FSNKGF+A+E+VALSGSHTIGQA+C+ F
Sbjct  143   QLGRRDSTTASLSAANTNIPAPTLNLSALLTSFSNKGFNAKELVALSGSHTIGQARCTTF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE NI++SFAT LKANCP SGGD NL+PLD TTP  FDNAYFKNL SQKGLLHSD
Sbjct  203   RARLYNEANIDSSFATSLKANCPSSGGDANLSPLDVTTPNKFDNAYFKNLVSQKGLLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGST++ VN Y SNP TF+TDFA AMVKM NLSPLTGT GQIR +C+K N
Sbjct  263   QQLFSGGSTNAQVNAYVSNPGTFSTDFAKAMVKMGNLSPLTGTNGQIRTDCKKVN  317



>ref|XP_007205557.1| hypothetical protein PRUPE_ppa008642mg [Prunus persica]
 gb|EMJ06756.1| hypothetical protein PRUPE_ppa008642mg [Prunus persica]
Length=324

 Score =   442 bits (1137),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 218/295 (74%), Positives = 253/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYST+CPNALS I++AVA+AV+SEARMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  30    AQLSPTFYSTSCPNALSTIKSAVASAVSSEARMGASLLRLHFHDCFVNGCDASVLLDDTA  89

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             + TGE++AGPN NS+RG +VID IKTQLE  C  VVSCADI+ VAARDS+VALGGP++ +
Sbjct  90    SLTGEKTAGPNANSLRGFDVIDTIKTQLESLCPKVVSCADILTVAARDSIVALGGPTYTV  149

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+TTAS SAANS      L+L+ LIS FSNKGF+AREMVALSGSHTIGQA+C+ F
Sbjct  150   PLGRRDATTASLSAANSNIPGPQLNLAALISAFSNKGFTAREMVALSGSHTIGQARCTTF  209

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE NINASFAT +K+ CP SGGDN L+PLD T+PTSFDNAY++NL SQKGLLHSD
Sbjct  210   RNRLYNEANINASFATSVKSQCPSSGGDNTLSPLDVTSPTSFDNAYYRNLVSQKGLLHSD  269

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL++GGST++IV+ Y SN  TF  DFANAM KM NLSPLTGT GQIR NCRK N
Sbjct  270   QQLYSGGSTNTIVDAYISNTGTFRADFANAMKKMGNLSPLTGTNGQIRTNCRKIN  324



>gb|KHN29529.1| Cationic peroxidase 1 [Glycine soja]
Length=314

 Score =   439 bits (1130),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 216/295 (73%), Positives = 256/295 (87%), Gaps = 3/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FY+ TCPNALS I++ V +AVN+E RMGASLLRLHFHDCF  GCDAS+LLDDT+
Sbjct  22    AQLSSTFYAKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCF--GCDASVLLDDTS  79

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN  SIRG +VID IK+++E  C GVVSCADI+AVAARDSVVALGG +W +
Sbjct  80    SFTGEKTAGPNAGSIRGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTV  139

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S+ANS       SLS LIS+FSNKGFS++E+VALSGSHTIGQA+CS F
Sbjct  140   QLGRRDSTTASLSSANSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSF  199

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI++SFA  L+ NCP +GGD+NLAPLDTT+P +FDNAYFKNLQS+KGLLHSD
Sbjct  200   RTRIYNDTNIDSSFAKSLQGNCPSTGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSD  259

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGSTDS VN+YSSNP++F TDFANAM+KM NLSPLTG+ GQIR NCRKTN
Sbjct  260   QELFNGGSTDSQVNSYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  314



>ref|XP_008245160.1| PREDICTED: cationic peroxidase 1-like [Prunus mume]
Length=324

 Score =   438 bits (1127),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 217/295 (74%), Positives = 249/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYST+CPNALS I++AV +AV+ EARMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  30    AQLSPTFYSTSCPNALSTIKSAVDSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTA  89

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             + TGE++AGPN NS+RG  VID IKTQLE  C  VVSCADI+ VAARDS+VALGGP++ +
Sbjct  90    SLTGEKTAGPNANSLRGFEVIDTIKTQLESLCPKVVSCADILTVAARDSIVALGGPTYTV  149

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+TTAS SAANS      L+L+ LIS FSNKGF+AREMVALSGSHTIGQA+C+ F
Sbjct  150   PLGRRDATTASLSAANSNIPGPQLNLAALISAFSNKGFTAREMVALSGSHTIGQARCTTF  209

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE NINASFAT +K  CP SGGDN L+PLD T+PTSFDNAYF+NL SQKGLLHSD
Sbjct  210   RNRLYNEANINASFATSVKTQCPSSGGDNTLSPLDVTSPTSFDNAYFRNLVSQKGLLHSD  269

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL++GGST++IV+ Y SN  TF  DFANAM KM NLSPLTGT GQIR NCRK N
Sbjct  270   QQLYSGGSTNTIVDAYISNTGTFRADFANAMKKMGNLSPLTGTNGQIRTNCRKVN  324



>ref|XP_011095107.1| PREDICTED: cationic peroxidase 1-like [Sesamum indicum]
Length=321

 Score =   437 bits (1124),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 213/295 (72%), Positives = 250/295 (85%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFYS+TCPN LSII+TAV +AV  +ARMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  27    AQLSSNFYSSTCPNLLSIIKTAVDSAVRGDARMGASLLRLHFHDCFVNGCDASVLLDDTA  86

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN+NS+RG +VID IKTQ+E SC G+VSCADI++VAARD VVAL GPSW +
Sbjct  87    NFTGEKTAAPNVNSLRGFDVIDTIKTQVESSCPGIVSCADILSVAARDGVVALNGPSWAV  146

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAANS           LI++FSNKGF+AREMVALSGSHTIGQA+C+ F
Sbjct  147   ALGRRDSTTASLSAANSQIPGPNLNLNALITSFSNKGFTAREMVALSGSHTIGQARCTTF  206

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE NINASFA  ++ANCPQSGG+NNL+PLD  +P  F+N YF+NL S +GLLHSD
Sbjct  207   RNRIYNEANINASFAASVRANCPQSGGNNNLSPLDVVSPNVFNNDYFRNLLSLRGLLHSD  266

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+ GSTD+ V  YS+N + F  DFA+AMVKMSNLSPLTGT GQIR+NCR+TN
Sbjct  267   QQLFSNGSTDAQVRAYSTNSAAFFNDFASAMVKMSNLSPLTGTNGQIRRNCRRTN  321



>ref|XP_009371984.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=323

 Score =   436 bits (1121),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 214/295 (73%), Positives = 252/295 (85%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FY  +CPNALS I++AV +AV+ EARMGASLLRLHFHDCFVNGCDAS+LLDDT 
Sbjct  29    AQLSSTFYGKSCPNALSTIKSAVNSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTP  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NS+RG +VI+ IK+QLE  C  VVSCADI+ VAARDS+VALGGP++ +
Sbjct  89    NFTGEKTAGPNANSLRGFDVINTIKSQLESLCPKVVSCADILTVAARDSIVALGGPTYTV  148

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAANS      L+L+ LI+ FSNKGF+A+E+VALSGSHTIGQAKC+ F
Sbjct  149   PLGRRDSTTASLSAANSNLPAPTLNLAGLITAFSNKGFTAKELVALSGSHTIGQAKCTSF  208

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE NIN SFAT LK++CP  GGDNNL+PLD T+PTSFDNAYF+NL SQKGLLHSD
Sbjct  209   RARLYNETNINNSFATSLKSSCPTRGGDNNLSPLDVTSPTSFDNAYFRNLVSQKGLLHSD  268

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS VN Y SNP+TF  DFANA+ KM NLSPLTG++GQIR +CRK N
Sbjct  269   QQLFSGGSTDSQVNAYVSNPATFRADFANAIKKMGNLSPLTGSRGQIRTDCRKVN  323



>ref|XP_006842420.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
 gb|ERN04095.1| hypothetical protein AMTR_s00077p00014810 [Amborella trichopoda]
Length=315

 Score =   435 bits (1118),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 213/295 (72%), Positives = 251/295 (85%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FY+++CPNALS IQTAV +AVN+E+RMGASLLRLHFHDCFVNGCD S+LLDD A
Sbjct  21    AQLSSTFYNSSCPNALSTIQTAVRSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDNA  80

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG  V+DNIK+QLE  C GVVSCADI+AVAARDSVV LGGP+W +
Sbjct  81    TFTGEKTARPNNNSVRGFEVVDNIKSQLESLCPGVVSCADILAVAARDSVVVLGGPTWTV  140

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS S ANS      LSLS LI++FSNKG S+ EMVALSGSHTIGQA+C+ F
Sbjct  141   LLGRRDSTTASLSTANSDIPAPSLSLSGLITSFSNKGLSSSEMVALSGSHTIGQARCTTF  200

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+ IYNE NI++++AT LK+NCP SGGDNNL+PLD T+PT FDNAY+KNL ++KGLLHSD
Sbjct  201   RTHIYNETNIDSTYATSLKSNCPFSGGDNNLSPLDVTSPTVFDNAYYKNLVNKKGLLHSD  260

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGSTDS V  Y+S+ STF TDFA AMVKM N+SPLTG+ GQ+R NCRK N
Sbjct  261   QELFNGGSTDSQVTGYTSSSSTFPTDFAKAMVKMGNISPLTGSSGQVRTNCRKVN  315



>ref|XP_008388322.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=323

 Score =   435 bits (1118),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 247/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FY  +CPNALS I++AV +AV+ EARMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  29    AQLSSTFYGKSCPNALSTIKSAVNSAVSKEARMGASLLRLHFHDCFVNGCDASVLLDDTA  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NS+RG +VI+ IK+QLE  C  VVSCADI+ VAARDS+VALGGP++ +
Sbjct  89    NFTGEKTAGPNANSLRGFDVINTIKSQLESLCPKVVSCADILTVAARDSIVALGGPTYTV  148

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAANS           LI+ FSNKGF+A+E+VALSGSHTIGQ +C+ F
Sbjct  149   PLGRRDSTTASLSAANSNIPAPTLNLSGLITAFSNKGFTAKELVALSGSHTIGQVRCTSF  208

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE NI+ SFAT LK++CP  GGDNNL+PLD T+PTSFDNAYF+NL SQKGLLHSD
Sbjct  209   RARLYNETNISDSFATSLKSSCPTRGGDNNLSPLDVTSPTSFDNAYFRNLVSQKGLLHSD  268

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V  Y SNP+TF  DFANA+ KM NLSPLTGTKGQIR +CRK N
Sbjct  269   QQLFSGGSTDSQVKAYVSNPATFRADFANAIKKMGNLSPLTGTKGQIRTDCRKVN  323



>ref|XP_007206416.1| hypothetical protein PRUPE_ppa018664mg [Prunus persica]
 gb|EMJ07615.1| hypothetical protein PRUPE_ppa018664mg [Prunus persica]
Length=303

 Score =   433 bits (1114),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 209/296 (71%), Positives = 244/296 (82%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+++Y+TTCP ALS+++++V NAV  E RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  8     AQLSSDYYATTCPRALSVVRSSVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  67

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN+ S+RG  VID IK+QLE  C GVVSCADI+AVAARDSV+  GGPSW +
Sbjct  68    NFTGEKTALPNVRSLRGFEVIDTIKSQLESLCPGVVSCADILAVAARDSVLLFGGPSWTV  127

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S AN+         + LIS+FS KGFSA+EMVALSGSHT+GQA+C  F
Sbjct  128   QLGRRDSTTASLSDANTELPSPSLDLKDLISSFSTKGFSAKEMVALSGSHTMGQARCQMF  187

Query  571   RSRIYNENNINASFATLLKANCPQSGG-DNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             R RIYNE NIN+ FAT LK+NC QS G D+NL+PLD T+P  FDNAYFKNL   KGLLHS
Sbjct  188   RDRIYNETNINSEFATFLKSNCTQSSGTDDNLSPLDITSPVFFDNAYFKNLVDSKGLLHS  247

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLF+GGSTDS+V TYS++  TF TDFANAM+KM NLSPLTGT GQIR NCRKTN
Sbjct  248   DQQLFSGGSTDSLVTTYSNSSGTFYTDFANAMLKMGNLSPLTGTSGQIRTNCRKTN  303



>ref|XP_010066439.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=322

 Score =   434 bits (1115),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 222/295 (75%), Positives = 254/295 (86%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A+LS+ FYST+CP+AL  I++ V++AV+SEA M  SLLRLHFHDCFVNGCDASILLDDT 
Sbjct  28    ARLSSTFYSTSCPSALHTIKSGVSSAVSSEASMDGSLLRLHFHDCFVNGCDASILLDDTM  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A  N NSI G  VID IK+QLE SC GVVSCADI+AVAARDSVVALGGPSW +
Sbjct  88    NFTGEKTADANDNSIHGYEVIDKIKSQLESSCPGVVSCADILAVAARDSVVALGGPSWTV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS SAANS      LSLS LI+ FSNKGF+A+EMVALSGSHTIGQA+C+ F
Sbjct  148   LLGRRDSTTASLSAANSDLPASTLSLSDLITAFSNKGFTAKEMVALSGSHTIGQARCTTF  207

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE++IN+ +AT LKANC  SGGDNNL+PLDT +PT FDNAYFKNLQ+QKGLLHSD
Sbjct  208   RTRLYNESDINSMYATSLKANCQSSGGDNNLSPLDTMSPTYFDNAYFKNLQTQKGLLHSD  267

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTD+ VN YSSN +TF TDFANAMVKM NLSPLTG+ GQIRKNCRK N
Sbjct  268   QQLFSGGSTDAQVNMYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKNCRKVN  322



>ref|XP_010066274.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=319

 Score =   433 bits (1113),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 245/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FYST+CP+ALS I+++V++AV +EARMGASLLRL FHDCFVNGCDASILLDDT 
Sbjct  25    AQLSSTFYSTSCPSALSTIKSSVSSAVKNEARMGASLLRLDFHDCFVNGCDASILLDDTT  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NS+RG  VID IK++LE  C G+VSCADI+AV ARDS+VA+ GPSW +
Sbjct  85    NFTGEKNAGPNANSMRGFEVIDTIKSELESKCPGIVSCADILAVVARDSIVAVSGPSWTV  144

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTASQ+AAN    P     + LIS FSNKGF+A+EMVAL GSHTIGQA+C  F
Sbjct  145   SLGRRDSTTASQTAANISIPPPTLNLRGLISAFSNKGFTAKEMVALLGSHTIGQARCLTF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R  +YNENNI+ +FAT LKANCP SGGD+ L P DTT+PTSFDNA+FKNLQ+ K  LHSD
Sbjct  205   REHLYNENNIDTTFATSLKANCPSSGGDSKLFPFDTTSPTSFDNAFFKNLQTHKVFLHSD  264

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTD  VN YSSN STF+TDFANAMVKM NLSPL G+  QIRKNCRK N
Sbjct  265   QQLFSGGSTDVHVNAYSSNLSTFSTDFANAMVKMGNLSPLIGSSDQIRKNCRKVN  319



>ref|XP_008229747.1| PREDICTED: cationic peroxidase 1-like [Prunus mume]
Length=319

 Score =   432 bits (1112),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 209/296 (71%), Positives = 244/296 (82%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+++Y+TTCP ALS++++AV NAV  E RMGASLLRLHFHDCFVNGCDASILLDDT+
Sbjct  24    AQLSSDYYATTCPRALSVVKSAVINAVVKEHRMGASLLRLHFHDCFVNGCDASILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN+ S+RG  VID IK+QLE  C GVVSCADI+A+AARDSV++ GGPSW +
Sbjct  84    NFTGEKTALPNVGSLRGFEVIDTIKSQLESICPGVVSCADILAIAARDSVLSFGGPSWTV  143

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S AN+         + LIS+FS KGFSA E+VALSGSHT+GQA+C  F
Sbjct  144   QLGRRDSTTASLSDANTELPSPSLDLKDLISSFSTKGFSAEELVALSGSHTMGQARCRMF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGG-DNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             R+RIYNE NIN+ FAT LK+NC QS G D+NL+PLD T+P  FDN YFKNL   KGLLHS
Sbjct  204   RNRIYNETNINSEFATFLKSNCTQSSGTDDNLSPLDITSPVFFDNTYFKNLVDSKGLLHS  263

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLF+GGSTDS+V TYS++  TF TDFANAMVKM NLSPLTGT GQIR NCRKTN
Sbjct  264   DQQLFSGGSTDSLVTTYSTSSGTFYTDFANAMVKMGNLSPLTGTSGQIRTNCRKTN  319



>gb|KHN40655.1| Cationic peroxidase 1 [Glycine soja]
Length=334

 Score =   432 bits (1111),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/313 (69%), Positives = 255/313 (81%), Gaps = 19/313 (6%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFV-------------  968
             AQLS+ FY  TCPNALS I++ V +AVN+E RMGASLLRLHFHDCFV             
Sbjct  22    AQLSSTFYGKTCPNALSTIKSEVVSAVNNERRMGASLLRLHFHDCFVQASQLSLCPFFHY  81

Query  967   -----NGCDASILLDDTANFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIV  803
                  +GCDAS+LLDDT++F GE++AGPN  SIRG NVID IK+++E  C GVVSCADI+
Sbjct  82    DLFSLSGCDASVLLDDTSSFKGEKTAGPNAGSIRGFNVIDTIKSKVESLCPGVVSCADIL  141

Query  802   AVAARDSVVALGGPSWNLLLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSARE  626
             AVAARDSVVALGGP+W + LGRRDSTTAS S+ANS       SLS LIS+FSNKGFS++E
Sbjct  142   AVAARDSVVALGGPTWTVQLGRRDSTTASLSSANSDLPAPTSSLSALISSFSNKGFSSKE  201

Query  625   MVALSGSHTIGQAKCSFFRSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSF  446
             +VALSGSHTIGQA+CS FR+RIYN+ NI++SFA  L+ NCP +GG + LAPLDTT+P +F
Sbjct  202   LVALSGSHTIGQAQCSSFRTRIYNDTNIDSSFAKSLQGNCPSTGGGSTLAPLDTTSPNTF  261

Query  445   DNAYFKNLQSQKGLLHSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTG  266
             DNAYFKNLQS+KGLLHSDQ+LFNGGSTDS VN+YSSNP++F TDFANAM+KM NLSPLTG
Sbjct  262   DNAYFKNLQSKKGLLHSDQELFNGGSTDSQVNSYSSNPASFKTDFANAMIKMGNLSPLTG  321

Query  265   TKGQIRKNCRKTN  227
             + GQIR NCRKTN
Sbjct  322   SSGQIRTNCRKTN  334



>sp|P22195.2|PER1_ARAHY RecName: Full=Cationic peroxidase 1; AltName: Full=PNPC1; Flags: 
Precursor [Arachis hypogaea]
 gb|AAB06183.1| cationic peroxidase [Arachis hypogaea]
Length=316

 Score =   430 bits (1106),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/295 (72%), Positives = 247/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFY+T CPNALS I++AV +AV  EARMGASLLRLHFHDCFV GCDAS+LLDDT+
Sbjct  22    AQLSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTS  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NSIRG  VID IK+Q+E  C GVVSCADI+AVAARDSVVALGG SWN+
Sbjct  82    NFTGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNV  141

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS S+ANS       +LS LIS FSNKGF+ +E+V LSG+HTIGQA+C+ F
Sbjct  142   LLGRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE+NI+ ++A  L+ANCP  GGD NL+P D TTP  FDNAY+ NL+++KGLLHSD
Sbjct  202   RTRIYNESNIDPTYAKSLQANCPSVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNG STDS V  YS+N +TF TDF NAM+KM NLSPLTGT GQIR NCRKTN
Sbjct  262   QQLFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN  316



>ref|XP_010261061.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=317

 Score =   430 bits (1106),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 246/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY+++CP ALSII++AV+ AV  E RMGASLLRLHFHDCFVNGCDASILLDD +
Sbjct  23    AQLSPNFYASSCPRALSIIRSAVSIAVARERRMGASLLRLHFHDCFVNGCDASILLDDNS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +V+D IK+QLE +C GVVSCADI+AVAARDSVVALGG SW +
Sbjct  83    TFTGEKTAAPNANSVRGFDVVDTIKSQLESACPGVVSCADILAVAARDSVVALGGSSWTV  142

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS +AAN+        LS L+S FSNKGF+A+E+VALSGSHTIGQA+C+ F
Sbjct  143   QLGRRDSTTASLNAANNNLPSPFSDLSALLSAFSNKGFTAKELVALSGSHTIGQARCTIF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE NIN+++AT LKANCP SGGDNNLA LD +T T FDNAYF NL + +GLLHSD
Sbjct  203   RSRIYNETNINSAYATSLKANCPSSGGDNNLAGLDASTSTVFDNAYFTNLLNNRGLLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTD+ V  YSSN +TF +DF NAM+KM NLSPLTGT GQIR NCRK N
Sbjct  263   QQLFSGGSTDAQVRAYSSNSATFLSDFGNAMIKMGNLSPLTGTSGQIRNNCRKVN  317



>ref|XP_007140134.1| hypothetical protein PHAVU_008G086800g [Phaseolus vulgaris]
 gb|ESW12128.1| hypothetical protein PHAVU_008G086800g [Phaseolus vulgaris]
Length=322

 Score =   428 bits (1101),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 217/295 (74%), Positives = 250/295 (85%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             +QLS +FYSTTC NALS I+TAV +AV++EARMGASLLRLHFHDCFV GCD S+LL+DT+
Sbjct  29    SQLSTDFYSTTCSNALSTIKTAVDSAVSNEARMGASLLRLHFHDCFVQGCDGSVLLNDTS  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN+NS+RG  VIDNIK+QLE  C GVVSCADI+AVAARDSVVALGG SW +
Sbjct  89    SFTGEQTAFPNVNSLRGFGVIDNIKSQLESLCPGVVSCADILAVAARDSVVALGGQSWTV  148

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS ++ANS   GP  SL QL+  FS K F+  EMVALSG HTIGQA CS F
Sbjct  149   QLGRRDSTTASFNSANSDLPGPTFSLQQLVDAFSKKDFTTEEMVALSGGHTIGQAACSSF  208

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI++SFAT L+ANCP  GGD NLAPLD T+PT+FDNAYF++LQSQKGLLHSD
Sbjct  209   RTRIYNDTNIDSSFATSLQANCPSVGGDRNLAPLD-TSPTTFDNAYFQDLQSQKGLLHSD  267

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGSTDS VN Y SNPS+F TDFANAMVKMSNL PLTG+ G+IR NC KTN
Sbjct  268   QELFNGGSTDSQVNGYVSNPSSFQTDFANAMVKMSNLGPLTGSSGEIRTNCWKTN  322



>pdb|1SCH|A Chain A, Peanut Peroxidase
 pdb|1SCH|B Chain B, Peanut Peroxidase
Length=294

 Score =   427 bits (1097),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 210/293 (72%), Positives = 245/293 (84%), Gaps = 1/293 (0%)
 Frame = -1

Query  1102  LSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANF  923
             LS+NFY+T CPNALS I++AV +AV  EARMGASLLRLHFHDCFV GCDAS+LLDDT+NF
Sbjct  2     LSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTSNF  61

Query  922   TGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLL  743
             TGE++AGPN NSIRG  VID IK+Q+E  C GVVSCADI+AVAARDSVVALGG SWN+LL
Sbjct  62    TGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVLL  121

Query  742   GRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRS  566
             GRRDSTTAS S+ANS       +LS LIS FSNKGF+ +E+V LSG+HTIGQA+C+ FR+
Sbjct  122   GRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAFRT  181

Query  565   RIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQ  386
             RIYNE+NI+ ++A  L+ANCP  GGD NL+P D TTP  FDNAY+ NL+++KGLLHSDQQ
Sbjct  182   RIYNESNIDPTYAKSLQANCPSVGGDTNLSPFDVTTPNKFDNAYYINLRNKKGLLHSDQQ  241

Query  385   LFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             LFNG STDS V  YS+N +TF TDF NAM+KM NLSPLTGT GQIR NCRKTN
Sbjct  242   LFNGVSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN  294



>ref|XP_004294750.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=318

 Score =   427 bits (1097),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 246/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+++Y+T CP ALS ++TAV NAV  E RMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  24    AQLSSDYYATRCPRALSTVRTAVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTA  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN+NS+RG +V+D IK+QLE  C GVVSCADI+A+AARDSVV+LGGPSW +
Sbjct  84    NFTGEKTALPNLNSLRGFDVVDTIKSQLESICPGVVSCADILAIAARDSVVSLGGPSWIV  143

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAANS      L ++ LIS FSNKGFSA+E+VALSGSHT+GQAKC  F
Sbjct  144   QLGRRDSTTASLSAANSELPSPSLDVNDLISAFSNKGFSAKELVALSGSHTMGQAKCVLF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE +IN++F+T LK+NCP SG D+NL+PLD T+P  FDNAY+KNL + KGLLHSD
Sbjct  204   RDRIYNETSINSAFSTSLKSNCPNSGSDDNLSPLDVTSPVFFDNAYYKNLVNSKGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V TYS+  S F  DFANAMVKM NL+ LTG+ GQIR NCRK N
Sbjct  264   QQLFSGGSTDSQVTTYSTTASAFFADFANAMVKMGNLNLLTGSNGQIRTNCRKIN  318



>ref|XP_010263838.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010263839.1| PREDICTED: cationic peroxidase 1-like isoform X2 [Nelumbo nucifera]
Length=318

 Score =   426 bits (1095),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 212/295 (72%), Positives = 248/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFY+T+CP+ALSII++AV +AV  E RMGASLLRLHFHDCFVNGCDASILLDDT+
Sbjct  24    AQLSSNFYATSCPSALSIIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDASILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +VID IK+QLE +C GVVSCADI+AVA+RDSVVALGG SW +
Sbjct  84    SFTGEKTAAPNANSARGFDVIDTIKSQLESACPGVVSCADILAVASRDSVVALGGTSWTV  143

Query  748   LLGRRDSTTAS-QSAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS   A N+LP P L LS LIS F+NKGF+A+E+V LSG H+IGQA+CS F
Sbjct  144   QLGRRDSTTASLDDANNNLPSPFLDLSDLISAFANKGFTAKELVVLSGGHSIGQARCSLF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE N+++SFA  +K+NCP +GGDN LA LDTTT T FDNAYF NL + KGLLHSD
Sbjct  204   RSRIYNETNVDSSFAKSIKSNCPSAGGDNTLANLDTTTSTVFDNAYFTNLLNNKGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTD+ V  YS+N +TF +DF NAM+KM NLSPLTGT GQIR NCRK N
Sbjct  264   QQLFNGGSTDAQVRAYSTNSATFFSDFGNAMIKMGNLSPLTGTSGQIRTNCRKVN  318



>ref|NP_001242089.1| uncharacterized protein LOC100815671 precursor [Glycine max]
 gb|ACU22965.1| unknown [Glycine max]
Length=322

 Score =   426 bits (1095),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/295 (72%), Positives = 247/295 (84%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             +QLS++FYSTTCPNALS I++AV +AV++EARMGASLLRLHFHDCFV GCDAS+LL+DT+
Sbjct  29    SQLSSDFYSTTCPNALSTIKSAVDSAVSNEARMGASLLRLHFHDCFVQGCDASVLLNDTS  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A  N+NSIRG  VIDNIK+Q+E  C GVVSCADI+ VAARDSVVALGGPSW +
Sbjct  89    SFTGEQTAAGNVNSIRGFGVIDNIKSQVESLCPGVVSCADILTVAARDSVVALGGPSWTV  148

Query  748   LLGRRDSTTASQSAANslpgpglslSQLIS-TFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S+ANS         Q +S  F NKG +  EMVALSG HTIGQAKCS F
Sbjct  149   QLGRRDSTTASLSSANSDLPRFDLSLQQLSDNFQNKGLTTAEMVALSGGHTIGQAKCSTF  208

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE NI++SFAT L+ANCP  GGD+NLAPLD+   T FDNAYFK+LQSQKGLLH+D
Sbjct  209   RTRIYNETNIDSSFATSLQANCPSVGGDSNLAPLDSNQNT-FDNAYFKDLQSQKGLLHTD  267

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LFNGGSTDS VN Y+S+PS+F TDFANAMVKM N+SPLTG+ G+IR NC KTN
Sbjct  268   QVLFNGGSTDSQVNGYASDPSSFNTDFANAMVKMGNISPLTGSSGEIRTNCWKTN  322



>ref|XP_004500339.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=318

 Score =   425 bits (1093),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 246/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS++FY TTCP ALSII +AV +AV+ E RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  24    AQLSSDFYGTTCPKALSIINSAVCSAVSKEQRMGASLLRLHFHDCFVNGCDASVLLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SAG N+NS+RG  VID+IKTQLE +C G+VSCADIVAVAARDSV ALGGPSW++
Sbjct  84    SFTGEKSAGANVNSLRGFEVIDDIKTQLETACPGIVSCADIVAVAARDSVKALGGPSWSV  143

Query  748   LLGRRDSTTASQSAA-NslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS+ AA N +P P + LS LIS FSNKGF+  EMV LSG+HT GQA+C  F
Sbjct  144   GLGRRDSTTASKDAATNDIPSPLMDLSDLISAFSNKGFTTNEMVVLSGAHTTGQARCQLF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE  I+++FAT +K+NCP +GGD+NL  LD TT   FDNAYFKNL ++KGLLHSD
Sbjct  204   RGRIYNETTIDSNFATSVKSNCPSTGGDSNLTSLDVTTNVLFDNAYFKNLVNKKGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V TYS++PSTF  DFA+AMVKM NLSPLTG  GQIR NC K N
Sbjct  264   QQLFSGGSTDSQVTTYSTSPSTFNADFASAMVKMGNLSPLTGNNGQIRTNCHKVN  318



>ref|XP_004492538.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=317

 Score =   425 bits (1092),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 242/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS++FY+TTCP+ LS I+T +  AVN E RMGASLLRLHFHDCFV GCD S+LLDDT+
Sbjct  23    AQLSSDFYATTCPDVLSTIKTQIDLAVNDEPRMGASLLRLHFHDCFVQGCDGSVLLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SAGPN NS+RG +VID IK+++E  C  VVSCADI++VAARDSVVALGGPSW +
Sbjct  83    SFTGEKSAGPNANSLRGFDVIDTIKSEVESLCPNVVSCADILSVAARDSVVALGGPSWTV  142

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS  +AN+        L+ LI+ F  KGF+ +EMVALSGSHTIGQA C FF
Sbjct  143   QLGRRDSTTASLDSANTNLPGPTSDLTNLITAFDKKGFTTQEMVALSGSHTIGQASCRFF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE+NI+ +FA  L+ANCP SGGDNNL+PLDTTTP +FDN+Y+ NLQSQ GL HSD
Sbjct  203   RSRIYNEDNIDPTFAASLQANCPTSGGDNNLSPLDTTTPDTFDNSYYTNLQSQMGLFHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFN GSTDSIV+ YSS+PS+F TDFANAM+KM NLSPLTG+ GQIR  C   N
Sbjct  263   QELFNQGSTDSIVDGYSSDPSSFETDFANAMLKMGNLSPLTGSSGQIRTTCGAIN  317



>dbj|BAM28608.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   424 bits (1089),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 240/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ +Y ++CP ALS I++ V +A+  EARMGASLLRLHFHDCFVNGCD S+LLDDTA
Sbjct  22    AQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN+NS+RG +VID IK  +E  C GVVSCADI+AV ARDSVV LGG SW +
Sbjct  82    NFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWTV  141

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS SAAN+           LIS+FSNKG +  EMVALSG+HTIG A+C+ F
Sbjct  142   LLGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCTTF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE NI++S+AT LK  CP SGG NN APLDTT+P +FDNAYFK+L + KGLLHSD
Sbjct  202   RSRIYNETNIDSSYATSLKKTCPTSGGGNNTAPLDTTSPYTFDNAYFKDLINLKGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+N GS DS V+ YSS+PSTF+TDFANA+VKM NLSPLTGT+GQIR NCRK N
Sbjct  262   QQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNLSPLTGTEGQIRTNCRKVN  316



>gb|AFK46186.1| unknown [Lotus japonicus]
Length=316

 Score =   423 bits (1088),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/295 (71%), Positives = 246/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FY+ TCP  L+ I+T V  AV  EARMGASLLRLHFHDCFV GCDASILLDDT+
Sbjct  22    AQLSSTFYAKTCPLVLATIKTQVNLAVAKEARMGASLLRLHFHDCFVQGCDASILLDDTS  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN NS+RG +VID IK+++E  C GVVSCADIVAVAARDSVVALGG SW +
Sbjct  82    SFTGEKTAGPNANSVRGYDVIDTIKSKVESLCPGVVSCADIVAVAARDSVVALGGFSWAV  141

Query  748   LLGRRDSTTASQSAANslpgpglslSQLIST-FSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S+ANS      S    ++T FSNKGF+ REMVALSGSHTIGQA+C FF
Sbjct  142   PLGRRDSTTASLSSANSELPGPSSNLDGLNTAFSNKGFTTREMVALSGSHTIGQARCLFF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE NI+++FA  L+ NCP +GGD+NL+PLDTT+PT+FD+ Y++NLQS+KGL HSD
Sbjct  202   RTRIYNETNIDSTFAKNLQGNCPFNGGDSNLSPLDTTSPTTFDDGYYRNLQSKKGLFHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q  FNGGSTDS VN+Y +NP++F TDFANAMVKM NLSPLTG+ GQIR NCRKTN
Sbjct  262   QVPFNGGSTDSQVNSYVTNPASFKTDFANAMVKMGNLSPLTGSSGQIRTNCRKTN  316



>ref|XP_003552299.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=322

 Score =   424 bits (1089),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 210/295 (71%), Positives = 247/295 (84%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             +QLS++FYSTTCPNALS I++ V +AV++EARMGASLLRLHFHDCFV GCDAS+LL+DT 
Sbjct  29    SQLSSDFYSTTCPNALSTIKSVVDSAVSNEARMGASLLRLHFHDCFVQGCDASVLLNDTT  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A  N+NSIRG  VIDNIK+Q+E  C GVVSCADI+AVAARDSVVALGGPSW +
Sbjct  89    SFTGEQTARGNVNSIRGFGVIDNIKSQVESLCPGVVSCADILAVAARDSVVALGGPSWTV  148

Query  748   LLGRRDSTTASQSAANslpgpglslSQLIS-TFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S+ANS         Q +S  F NKG +  EMVALSG HTIGQA+CS F
Sbjct  149   QLGRRDSTTASLSSANSDLPRFDLSLQQLSDNFQNKGLTTAEMVALSGGHTIGQAQCSTF  208

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE NI++SFAT L+ANCP  GGD+NLAPLD++  T FDNAYFK+LQSQKGLLH+D
Sbjct  209   RTRIYNETNIDSSFATSLQANCPSVGGDSNLAPLDSSQNT-FDNAYFKDLQSQKGLLHTD  267

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LFNGGSTDS VN Y+S+PS+F TDFANAM+KM N+SPLTG+ G+IR NC KTN
Sbjct  268   QVLFNGGSTDSQVNGYASDPSSFNTDFANAMIKMGNISPLTGSSGEIRTNCWKTN  322



>ref|XP_002285723.1| PREDICTED: cationic peroxidase 1 isoform X1 [Vitis vinifera]
Length=317

 Score =   423 bits (1088),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 212/295 (72%), Positives = 247/295 (84%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFY+++CP ALS I+ AV NAV  E RMGASLLRLHFHDCFV GCDASILLDDTA
Sbjct  22    AQLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN +S+RG  VID IK+Q+E  C GVVSCADIVAVAARDSVVALGGP+W L
Sbjct  82    SFTGEKTAGPNKDSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPTWTL  141

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S ANS   GP   LS LIS FSNKGF+ +EMVALSG+HTIG+A+C+ F
Sbjct  142   QLGRRDSTTASLSTANSDLPGPASDLSTLISRFSNKGFTTKEMVALSGTHTIGKARCTSF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE NI+A+FAT  +  CP +GGDNNL+ LD TT T FDN YF+NL+++KGLLHSD
Sbjct  202   RSRIYNETNIDAAFATSKQKICPSTGGDNNLSDLDETT-TVFDNVYFRNLKAKKGLLHSD  260

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+NGGSTDSIV TYS+N +TF TD ANAM+KM NLSPLTGT G+IR +C+K N
Sbjct  261   QQLYNGGSTDSIVETYSTNSATFFTDVANAMIKMGNLSPLTGTNGEIRTDCKKIN  315



>dbj|BAA77389.1| peroxidase 3 [Scutellaria baicalensis]
Length=318

 Score =   423 bits (1088),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 244/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLSANFY+TTCPN L+II+ AV +AV+S+ RMGASLLRLHFHDCFVNGCDAS+LLDD  
Sbjct  24    AQLSANFYNTTCPNLLTIIRNAVNSAVSSDTRMGASLLRLHFHDCFVNGCDASVLLDDRT  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++AGPN NS+RG +VIDNIKT +E SC  +VSC+DI++VAARD VVA+GGPSW +
Sbjct  84    GFTGEKTAGPNANSLRGFDVIDNIKTLVEGSCPNIVSCSDILSVAARDGVVAVGGPSWAV  143

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS +AAN+           LI++FSNKGF+AREMVALSGSHTIGQA+C+ F
Sbjct  144   ALGRRDSTTASLNAANTQIPGPGLNLNALITSFSNKGFTAREMVALSGSHTIGQARCTTF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYN+ NIN +FAT L+ANCP+SGGDNNLAPLD  +P  F+N Y++NL   +GLLHSD
Sbjct  204   RGRIYNDTNINGAFATGLRANCPRSGGDNNLAPLDNVSPARFNNDYYRNLIGLRGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFN G+ D+ V  YS+N + F  DFANAMVKMSNLSPLTGT GQIR+NCR+TN
Sbjct  264   QELFNNGTADAQVRAYSTNSAAFFNDFANAMVKMSNLSPLTGTNGQIRRNCRRTN  318



>ref|XP_010263840.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=318

 Score =   422 bits (1086),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 212/295 (72%), Positives = 246/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS+ FY T+CP ALSII++AV +AV+SE RMGASLLRLHFHDCFVNGCDASILLDDT+
Sbjct  24    GQLSSTFYDTSCPRALSIIKSAVDSAVSSERRMGASLLRLHFHDCFVNGCDASILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VID IK+QLE +C GVVSCADI+AVAARDSVVALGG SW +
Sbjct  84    TFTGEKTALPNANSVRGFDVIDTIKSQLESACPGVVSCADILAVAARDSVVALGGTSWTV  143

Query  748   LLGRRDSTTAS-QSAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS   A N LP P L LS LIS F+NKGF+A E+V LSG+HTIGQA+C+ F
Sbjct  144   QLGRRDSTTASLNDANNDLPAPFLDLSALISAFANKGFTANELVVLSGAHTIGQARCTTF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RI+NE NI++ FAT +K+NCP SGGDNNLA LDTTT T+FDN +F NL S KGLLHSD
Sbjct  204   RDRIHNETNIDSQFATSMKSNCPSSGGDNNLANLDTTTATTFDNVFFTNLLSNKGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDS V TYS+N +TF +DF NAM+KM NLSPLTGT GQ+R NCR+ N
Sbjct  264   QQLFNGGSTDSQVRTYSTNSATFFSDFGNAMIKMGNLSPLTGTSGQLRTNCRRVN  318



>dbj|BAM28609.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   422 bits (1085),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 243/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ +Y ++CP ALS I++ V +A+  EARMGASLLRLHFHDCFVNGCD S+LLDDTA
Sbjct  22    AQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN+NS+RG +VID IK  +E  C GVVSCADI+AV ARDSVV LGG SW +
Sbjct  82    NFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWTV  141

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS SAAN+      L+LS LIS+FSNKG +  EMVALSG+HTIG A+C+ F
Sbjct  142   LLGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCTTF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE NI++S+AT LK  CP SGG NN APLDTT+P +FDNAYFK+L + KGLLHSD
Sbjct  202   RSRIYNETNIDSSYATSLKKTCPTSGGGNNTAPLDTTSPYTFDNAYFKDLINLKGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+N GS DS V+ YSS+PSTF+TDFANA+VKM N SPLTGT+GQIR NCRK N
Sbjct  262   QQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNFSPLTGTEGQIRTNCRKVN  316



>ref|XP_011021015.1| PREDICTED: cationic peroxidase 1-like [Populus euphratica]
Length=316

 Score =   422 bits (1084),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 247/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY+TTCP ALS I+TAV  AV  E RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  22    AQLSTNFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN NS+RG +VID IK+QLE  C GVVSCADI+AVAARDSVVAL GPSW +
Sbjct  82    SFTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTV  141

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAANS    P + LS LI++FSNKGF+A+EMVALSGSHTIGQA+C  F
Sbjct  142   QLGRRDSTTASLSAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLMF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE +++++ AT LK+NCP +G D++L+ LD TTP +FDN+YFKNL + KGLLHSD
Sbjct  202   RNRVYNETSLDSTLATSLKSNCPDTGSDDSLSSLDATTPVTFDNSYFKNLVNNKGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GG+TDS V TYS N +TF  DFA+AMVKM ++SPLTG+ GQIR NC K N
Sbjct  262   QQLFSGGTTDSQVKTYSINYATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN  316



>ref|XP_010685963.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=365

 Score =   422 bits (1085),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 243/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLSAN+Y+ TCP ALS IQ AV  AV++E RMGASLLRLHFHDCFVNGCDASILL+DT+
Sbjct  71    AQLSANYYAKTCPKALSTIQNAVRKAVSAERRMGASLLRLHFHDCFVNGCDASILLNDTS  130

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGEQ+AG N  S+RG  V+D+IK+Q+E  C GVVSCADI+AVAARDSVV+LGGP+W +
Sbjct  131   TFTGEQTAGANAGSLRGYTVVDSIKSQVESVCPGVVSCADILAVAARDSVVSLGGPTWQV  190

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S ANS      + LS L+S+FS+KG +A+EMVAL+G+HTIGQA+C  F
Sbjct  191   QLGRRDSTTASLSTANSDIPSPTMDLSGLLSSFSDKGLTAKEMVALAGAHTIGQARCVVF  250

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE+NI+ASF T +K NCP SGGDNNL PLD+TTP +FDN YFK+L + KGL+HSD
Sbjct  251   RNRVYNESNIDASFVTSVKTNCPSSGGDNNLTPLDSTTPVAFDNGYFKDLVNNKGLMHSD  310

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFN GSTDS V +YS +  +F  DFA+AMVKM NLSPLTGT GQIR NC KTN
Sbjct  311   QQLFNNGSTDSQVTSYSKDSKSFQKDFASAMVKMGNLSPLTGTNGQIRTNCWKTN  365



>ref|XP_007142069.1| hypothetical protein PHAVU_008G249900g [Phaseolus vulgaris]
 gb|ESW14063.1| hypothetical protein PHAVU_008G249900g [Phaseolus vulgaris]
Length=318

 Score =   420 bits (1079),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 243/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             +QL++  Y +TCP ALSII+++V +AV  E RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  24    SQLTSICYQSTCPQALSIIRSSVISAVAKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SAG N+NS+RG  VID+IKT++E  C GVVSCADIVAVAARDSVVALGGPSWN+
Sbjct  84    SFTGEKSAGANVNSLRGFEVIDDIKTKVEAVCPGVVSCADIVAVAARDSVVALGGPSWNV  143

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS+ AA        + LS LIS F+NKGF+++EMVALSG+HT G A+C  F
Sbjct  144   GLGRRDSTTASKDAATKDIPSPLMDLSALISAFANKGFNSKEMVALSGAHTTGLARCQLF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R+YNE +I ++FAT LK+NCP +GGD NL+PLD TT   FDNAYFKNL +QKGLLHSD
Sbjct  204   RGRVYNETSIESNFATSLKSNCPSTGGDTNLSPLDVTTSVQFDNAYFKNLINQKGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V TYS++PS F  DFA+AMVKM NLSPLTG  GQIR +CRK N
Sbjct  264   QQLFSGGSTDSQVTTYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTDCRKVN  318



>ref|XP_003623567.1| Peroxidase [Medicago truncatula]
 gb|AES79785.1| class III peroxidase [Medicago truncatula]
Length=312

 Score =   419 bits (1078),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 246/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS +FYSTTC + LS I+  + +AV +EARMGAS+LRLHFHDCFV GCDAS+LLDDT+
Sbjct  18    AQLSTDFYSTTCSDVLSTIKREIDSAVGNEARMGASILRLHFHDCFVQGCDASVLLDDTS  77

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AG N NS+RG +VID IKT+LE  C   VSCADI++VAARDSVVALGGPSW +
Sbjct  78    SFTGEKTAGANANSLRGFDVIDTIKTELESLCPNTVSCADILSVAARDSVVALGGPSWTV  137

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TAS S ANS     G  LS LI++F NKGF+ +EMVALSGSHTIGQA C FF
Sbjct  138   QLGRRDSITASLSLANSDLPGPGSDLSGLITSFDNKGFTPKEMVALSGSHTIGQASCRFF  197

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN++NI++SFAT L+ANCP +GGD+NL+PLDTTTP +FDN+YF+NLQSQKGL  SD
Sbjct  198   RTRIYNDDNIDSSFATSLQANCPTTGGDDNLSPLDTTTPNTFDNSYFQNLQSQKGLFSSD  257

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LFNGGSTDS V+ YSS+ S+FATDFANAMVKM NL+P+TG+ GQIR NCR  N
Sbjct  258   QALFNGGSTDSDVDEYSSDSSSFATDFANAMVKMGNLNPITGSNGQIRTNCRVIN  312



>ref|XP_010683553.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=329

 Score =   420 bits (1080),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 257/297 (87%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFYS++CPNALS IQ+AV  AV +E+RMGASLLRLHFHDCFVNGCD SILLDDTA
Sbjct  33    AQLSSNFYSSSCPNALSTIQSAVQAAVKNESRMGASLLRLHFHDCFVNGCDGSILLDDTA  92

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN NS+RG +VID IK+Q+E  C GVVSCADI+AVAARDSVVALGG SW +
Sbjct  93    NFTGEKNAAPNANSVRGFDVIDTIKSQVENVCSGVVSCADILAVAARDSVVALGGQSWTV  152

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRD+TTASQSAA S    P L+L+QLI+ FSNKGF+ +E+VALSG+HTIGQA+C+ F
Sbjct  153   LLGRRDATTASQSAATSNIPAPTLNLTQLITFFSNKGFTTQELVALSGAHTIGQARCTSF  212

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE +IN++FAT L+ANCP +GGDNNL+PLD T+PT+FDNAYF NL S +GLLHSD
Sbjct  213   RSRIYNETSINSTFATSLQANCPSNGGDNNLSPLDKTSPTTFDNAYFTNLLSLEGLLHSD  272

Query  391   QQLFNG--GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL++G  G+TDS V++YSS+ STF TDFANAMVKM N+S LTGT G+IR NCR TN
Sbjct  273   QQLYSGNSGTTDSQVSSYSSSSSTFFTDFANAMVKMGNMSVLTGTNGEIRTNCRNTN  329



>ref|XP_010035984.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   419 bits (1077),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/296 (71%), Positives = 245/296 (83%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLS-ANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDT  932
             AQLS  N+Y+T CP AL  I++AV +AV  EARMGASLLRLHFHDCFVNGCDASILLDDT
Sbjct  25    AQLSNQNYYATRCPKALDTIKSAVKSAVAKEARMGASLLRLHFHDCFVNGCDASILLDDT  84

Query  931   ANFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWN  752
             ANFTGE++A PN+NS RG NVID IK+++EK C GVVSCADI+AV ARDSVV LGG SW 
Sbjct  85    ANFTGEKTAFPNVNSARGFNVIDTIKSKVEKLCPGVVSCADILAVVARDSVVELGGRSWQ  144

Query  751   LLLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
             + LGRRDSTTAS +AAN+      L+LS LI++FSNKGF+A+EMVALSGSHTIGQA+C  
Sbjct  145   VQLGRRDSTTASLNAANTNLPAPTLNLSALITSFSNKGFTAKEMVALSGSHTIGQARCVT  204

Query  574   FRSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             FR+R+YNEN+I++SFAT LKA CP SGGDN L+PLD T+PTSFD+AYF NL SQKGLLHS
Sbjct  205   FRNRLYNENDISSSFATSLKAQCPSSGGDNKLSPLDITSPTSFDSAYFSNLVSQKGLLHS  264

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLF+GGST++ V TYS N   F  DFA AMVKM  LSPLTG+ GQIR NC++ N
Sbjct  265   DQQLFSGGSTNAQVTTYSKNLDLFKNDFAKAMVKMGGLSPLTGSAGQIRTNCKRVN  320



>emb|CAH10840.1| peroxidase [Picea abies]
Length=320

 Score =   419 bits (1077),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 239/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS+ FY+ +CP   SI++T V  AV  E RMGASL+RLHFHDCFVNGCD SILLDD A
Sbjct  26    GQLSSTFYAKSCPRVQSIVKTVVKQAVAKEKRMGASLVRLHFHDCFVNGCDGSILLDDNA  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++AGPN NS RG +VID IKTQ+E +C GVVSCADI+ +AARDS+V L GP+W +
Sbjct  86    TFTGEKTAGPNANSARGFDVIDTIKTQVEAACSGVVSCADILTIAARDSIVELQGPTWTV  145

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             +LGRRDS TAS SAAN+       SLS LI++F N G S +++VALSG+HTIGQ++C+FF
Sbjct  146   MLGRRDSPTASLSAANNNIPSPASSLSTLITSFQNHGLSTKDLVALSGAHTIGQSRCAFF  205

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE+NINA+FAT +K NCP +GGDN L+PLD  TPT+FDN Y+ NL+ QKGLLHSD
Sbjct  206   RTRIYNESNINAAFATSVKPNCPSAGGDNTLSPLDVVTPTTFDNKYYSNLKVQKGLLHSD  265

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDS V TYS+N ++F TDFA AMVKM N+SPLTGT GQIRKNCRK N
Sbjct  266   QQLFNGGSTDSQVTTYSTNQNSFFTDFAAAMVKMGNISPLTGTSGQIRKNCRKAN  320



>ref|XP_010256954.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=323

 Score =   419 bits (1076),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 249/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ +YST+CP ALS I++AV +AV  E RMGASLLRLHFHDCFVNGCD SILLDDT 
Sbjct  29    AQLSSTYYSTSCPEALSTIKSAVTSAVAKERRMGASLLRLHFHDCFVNGCDGSILLDDTT  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS+RG +VID IK+Q+E  C GVVSCADI+AVAARDSVVALGGP+W +
Sbjct  89    SFTGEKTATPNANSLRGFDVIDTIKSQVESVCAGVVSCADILAVAARDSVVALGGPTWTV  148

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+TTAS SAANS      L LS LIS FSNKGF+A+EMVALSG+HTIGQA+C+ F
Sbjct  149   QLGRRDATTASLSAANSDIPAPTLDLSGLISAFSNKGFTAKEMVALSGAHTIGQARCTSF  208

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE NIN+SFAT LK+ CP +GGDNNL+PLD T+ T+FDNAYF NL + KGLLHSD
Sbjct  209   RDRIYNETNINSSFATSLKSKCPSAGGDNNLSPLDATSATTFDNAYFTNLVNNKGLLHSD  268

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+N GSTDS V++YSSN +TF +DFA+AMVKM NLSPLTG+ G++R NCRKTN
Sbjct  269   QQLYNSGSTDSQVSSYSSNSATFFSDFASAMVKMGNLSPLTGSSGEVRTNCRKTN  323



>ref|NP_196153.1| peroxidase 52 [Arabidopsis thaliana]
 sp|Q9FLC0.1|PER52_ARATH RecName: Full=Peroxidase 52; Short=Atperox P52; AltName: Full=ATP49; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09977.1| peroxidase [Arabidopsis thaliana]
 gb|AAL38746.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED90861.1| peroxidase 52 [Arabidopsis thaliana]
Length=324

 Score =   419 bits (1076),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/297 (70%), Positives = 248/297 (84%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +QTAV +AVNSEARMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIK+ +EK+C GVVSCADI+A+AARDSVVALGGP+WN+
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS    P  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NINA+FAT  +  CP++   GD NLAPLD TT  SFDN YFKNL +Q+GLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRASGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ LFNGGSTDSIV  YS+NPS+F +DF  AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFNSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>gb|AAB02554.1| cationic peroxidase [Stylosanthes humilis]
Length=320

 Score =   417 bits (1073),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 207/296 (70%), Positives = 249/296 (84%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS+NFY+T CPNALS I++AV +AV+ EAR+GASLLRLHFHDCFV GCDAS+LLDDT+
Sbjct  25    GQLSSNFYATKCPNALSTIKSAVNSAVSKEARLGASLLRLHFHDCFVQGCDASVLLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN+NS RG +VID IK+Q+E  C GVVSCADI+A+AARDSVVALGGPSWN+
Sbjct  85    TFTGEKTAFPNVNSARGFDVIDTIKSQVESLCPGVVSCADILALAARDSVVALGGPSWNV  144

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS ++ANS   GP  +LS LIS FS KGF+A+E+V LSG+HTIGQA+C+ F
Sbjct  145   QLGRRDSTTASLNSANSDLPGPSFNLSGLISAFSKKGFTAKELVTLSGAHTIGQARCTTF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE+NI+ S+A  L+ NCP  GGD+NL+P D TTP  FDNAY+ NL+++KGLLH+D
Sbjct  205   RTRIYNESNIDPSYAKSLQGNCPSVGGDSNLSPFDVTTPNKFDNAYYINLKNKKGLLHAD  264

Query  391   QQLFN-GGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFN GGSTDS V  YS+N +TF TDF NAM+KM NLSPLTGT GQIR NCRKTN
Sbjct  265   QQLFNGGGSTDSQVTAYSNNAATFNTDFGNAMIKMGNLSPLTGTSGQIRTNCRKTN  320



>ref|XP_006596457.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=301

 Score =   417 bits (1071),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 245/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             +QL++N Y +TCP ALSII+T V  AV  + RMGASLLRLHFHDCFVNGCDAS+LLD+T+
Sbjct  7     SQLTSNCYESTCPQALSIIRTVVIGAVAKDHRMGASLLRLHFHDCFVNGCDASVLLDNTS  66

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE+SAG N+NS+RG  VID+IKT++E +C GVVSCADI+A+AARDSVVALGGPSWN+
Sbjct  67    TFTGEKSAGANVNSLRGFEVIDDIKTKVEAACPGVVSCADILAIAARDSVVALGGPSWNV  126

Query  748   LLGRRDSTTASQ-SAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS+ SA   +P P + LS LIS+FS KGF+ +EMVALSG+HT GQA+C  F
Sbjct  127   GLGRRDSTTASKDSATTDIPSPLMDLSALISSFSKKGFNTKEMVALSGAHTTGQARCQLF  186

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R+YNE++I ++FAT LK+NCP +GGD+NL+PLD TT   FD AYFKNL ++KGLLHSD
Sbjct  187   RGRVYNESSIESNFATSLKSNCPSTGGDSNLSPLDVTTSVLFDTAYFKNLINKKGLLHSD  246

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V  YS++PS F  DFA+AMVKM NLSPLTG  GQIR NCRK N
Sbjct  247   QQLFSGGSTDSQVTAYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTNCRKVN  301



>ref|XP_002873207.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49466.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   417 bits (1072),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 207/297 (70%), Positives = 248/297 (84%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +Q+AV +AVNSEARMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYSTSCPNLLSTVQSAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIK+ +EK+C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS    P  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NINA+FAT  +  CP++   GD NLAPLD TT  SFDN YFKNL +Q+GLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ LFNGGSTDSIV  YS+NPS+F +DFA AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>gb|AHL39176.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score =   417 bits (1071),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 243/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY+TTCP ALS I+TAV  AV  E RMGASLLRLHFHDCFV GCDAS+LLDDT+
Sbjct  22    AQLSTTFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVQGCDASVLLDDTS  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN NS+RG +VID IK+QLE  C GVVSCADI+AVAARDSVVAL GPSW +
Sbjct  82    SFTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTV  141

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS  AANS      + LS LI++FSNKGF+A+EMVALSGSHTIGQA+C  F
Sbjct  142   QLGRRDSTTASLGAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLLF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE +++++ AT LK+NCP +G D++L+ LD TTP +FDN+YFKNL + KGLLHSD
Sbjct  202   RNRVYNETSLDSTLATSLKSNCPNTGSDDSLSSLDATTPVTFDNSYFKNLANNKGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GG+TDS V TYS N +TF  DFA+AMVKM ++SPLTG+ GQIR NC K N
Sbjct  262   QQLFSGGTTDSQVKTYSINSATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN  316



>ref|XP_006468149.1| PREDICTED: cationic peroxidase 1-like [Citrus sinensis]
Length=305

 Score =   416 bits (1070),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+N Y  TCP ALS I++ V NAV  E RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  11    AQLSSNHYDNTCPKALSTIKSIVHNAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  70

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SA  N NSIRG  VID++K+++E  C GVVSCADI+AVAARDSVVA GGPSW +
Sbjct  71    SFTGEKSASANANSIRGFEVIDSVKSKVESLCPGVVSCADILAVAARDSVVAFGGPSWTV  130

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SA N+      + L+ LIS F+ KG SA+EMVALSG+HTIGQA+C  F
Sbjct  131   QLGRRDSTTASSSAVNTNIPSPLMDLNDLISNFAKKGLSAKEMVALSGAHTIGQARCLLF  190

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE NI++ FAT LK+NCP SGGD+NL+ LD T+P  FDN YF++L + KG+ HSD
Sbjct  191   RQRIYNETNIDSEFATSLKSNCPSSGGDDNLSSLDATSPVLFDNGYFRDLVNNKGVFHSD  250

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDS V TYS+N  TF  DFANAMVKM NLSPLTGT GQIR NCRK N
Sbjct  251   QQLFNGGSTDSQVTTYSTNIGTFYADFANAMVKMGNLSPLTGTDGQIRTNCRKIN  305



>ref|XP_002284007.1| PREDICTED: cationic peroxidase 1 isoform X2 [Vitis vinifera]
Length=316

 Score =   416 bits (1070),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 241/295 (82%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+++YS++CP+ALS IQTAV NAV  E+RMGASLLRLHFHDCFV GCDASILLDDTA
Sbjct  22    AQLSSDYYSSSCPSALSTIQTAVNNAVADESRMGASLLRLHFHDCFVLGCDASILLDDTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NS+RG +VID IK+Q+E  C GVVSCADIVAVAARDSVVALGGP+W +
Sbjct  82    NFTGEKTAGPNNNSVRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALGGPTWTV  141

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S ANS      S    LIS FSNKGF+ +EMV LSG+HTIG+A+CS F
Sbjct  142   QLGRRDSTTASFSTANSDLPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTIGKAQCSKF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE NI+A+FAT  +A CP SGGD NL+ LD TT T FDN YF NL  +KGLLHSD
Sbjct  202   RDRIYNETNIDATFATSKQAICPSSGGDENLSDLDETT-TVFDNVYFTNLIEKKGLLHSD  260

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+NG STDS+V TYS++ +TF TD A+AMVKM NLSPLTGT G+IR NCR  N
Sbjct  261   QQLYNGNSTDSMVETYSNDSTTFFTDVASAMVKMGNLSPLTGTDGEIRTNCRAIN  315



>ref|XP_009371986.1| PREDICTED: cationic peroxidase 1-like isoform X2 [Pyrus x bretschneideri]
Length=312

 Score =   416 bits (1070),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 246/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS+ FY T+CPNALS I++AV +AV+ EARMGA LLR+ FHDCFVNGCDAS+LLDDT 
Sbjct  18    GQLSSTFYETSCPNALSTIKSAVNSAVSKEARMGAFLLRIQFHDCFVNGCDASVLLDDTP  77

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN  S+RG +VID IK+QLE+ C  VV+CADI+AVAARDS+VALGGP++ +
Sbjct  78    NFTGEKTADPNAKSLRGFDVIDTIKSQLERICPKVVTCADIIAVAARDSIVALGGPAYKV  137

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAANS      L+L+ LI+ FSNKGF+A+++VALSGSHTIG A+C+ F
Sbjct  138   PLGRRDSTTASLSAANSNIPAPTLNLTGLITAFSNKGFTAKDLVALSGSHTIGLARCTNF  197

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE NINASFAT LK +CP SGGDNNL PLD T+PT+F+NAYF+NL +Q+GLLHSD
Sbjct  198   RARLYNETNINASFATSLKPSCPTSGGDNNLYPLDVTSPTTFNNAYFRNLVNQRGLLHSD  257

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTD+ VN Y SN + F  DFANAM KM NLSPLTGT GQIR +CRK N
Sbjct  258   QQLFSGGSTDAQVNAYVSNTAAFRADFANAMKKMGNLSPLTGTNGQIRTDCRKVN  312



>ref|XP_009371985.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Pyrus x bretschneideri]
Length=325

 Score =   417 bits (1071),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 246/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS+ FY T+CPNALS I++AV +AV+ EARMGA LLR+ FHDCFVNGCDAS+LLDDT 
Sbjct  31    GQLSSTFYETSCPNALSTIKSAVNSAVSKEARMGAFLLRIQFHDCFVNGCDASVLLDDTP  90

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN  S+RG +VID IK+QLE+ C  VV+CADI+AVAARDS+VALGGP++ +
Sbjct  91    NFTGEKTADPNAKSLRGFDVIDTIKSQLERICPKVVTCADIIAVAARDSIVALGGPAYKV  150

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAANS      L+L+ LI+ FSNKGF+A+++VALSGSHTIG A+C+ F
Sbjct  151   PLGRRDSTTASLSAANSNIPAPTLNLTGLITAFSNKGFTAKDLVALSGSHTIGLARCTNF  210

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE NINASFAT LK +CP SGGDNNL PLD T+PT+F+NAYF+NL +Q+GLLHSD
Sbjct  211   RARLYNETNINASFATSLKPSCPTSGGDNNLYPLDVTSPTTFNNAYFRNLVNQRGLLHSD  270

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTD+ VN Y SN + F  DFANAM KM NLSPLTGT GQIR +CRK N
Sbjct  271   QQLFSGGSTDAQVNAYVSNTAAFRADFANAMKKMGNLSPLTGTNGQIRTDCRKVN  325



>ref|XP_003538325.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=320

 Score =   416 bits (1070),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 246/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A LS++FY++TCPNALS I++AV +AV  E RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  26    ADLSSDFYASTCPNALSTIKSAVKSAVAKERRMGASLLRLHFHDCFVNGCDASVLLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SA  N+NS+RG +VID+IK+QLE SC G+VSCADIVAVAARDSVVALGGPSW +
Sbjct  86    SFTGEKSAAANLNSLRGFDVIDDIKSQLESSCPGIVSCADIVAVAARDSVVALGGPSWTI  145

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDST AS+ AA S      + LS LIS FSNKGF+++EMV LSG+HT GQAKC FF
Sbjct  146   GLGRRDSTAASKEAATSDIPSPLMDLSDLISAFSNKGFTSKEMVVLSGAHTTGQAKCQFF  205

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE NI++ FAT  K+NCP + GD+NL+PLD TT   FDNAYFKNL ++KGLLHSD
Sbjct  206   RGRIYNETNIDSDFATSAKSNCPSTDGDSNLSPLDVTTNVLFDNAYFKNLVNKKGLLHSD  265

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V TYS++ STF  DFA+AMVKM NLSPLTG+ GQIR NCRK N
Sbjct  266   QQLFSGGSTDSQVTTYSTSSSTFYADFASAMVKMGNLSPLTGSSGQIRTNCRKVN  320



>emb|CCJ34831.1| horseradish peroxidase isoenzyme HRP_1350 [Armoracia rusticana]
Length=324

 Score =   416 bits (1070),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/297 (69%), Positives = 248/297 (84%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +Q+AV +AVNSEARMGAS++RL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTPNFYSTSCPNLLSTVQSAVKSAVNSEARMGASIVRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIK  +EK+C GVVSCADI+A+AARDSVV LGGP+W +
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKAAVEKACPGVVSCADILAIAARDSVVVLGGPNWTV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS    P  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NINA+FAT  +  CP++   GD NLAPLD TT  SFDN YFKNL +Q+GLLH
Sbjct  208   RTRIYNETNINAAFATTRQRTCPRTSGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDSIV  YS+NPS+F++DFA AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  268   SDQELFNGGSTDSIVRGYSNNPSSFSSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>ref|XP_010452439.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   416 bits (1069),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/297 (70%), Positives = 248/297 (84%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +QTAV +AV SEARMG S+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIK+ +EK+C GVVSCADI+A+AARDSVVALGGP+WN+
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS   GP  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  148   KVGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NINA+FAT  +  CP++   GD NLAPLD TT  SFDN YFKNL +QKGLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ LFNGGSTDSIV  YS+NPS+F++DF  AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>ref|XP_010685954.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=318

 Score =   416 bits (1068),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 240/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS N+YS TCP AL  I+TAV  AV +E RMGASLLRLHFHDCFVNGCDAS+LL+D++
Sbjct  24    AQLSTNYYSKTCPRALFTIKTAVHKAVAAEHRMGASLLRLHFHDCFVNGCDASVLLNDSS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGEQ+AG N  S+RG  VID+IK+Q+E  C GVVSCADI+AVAARDSV  LGGP+W +
Sbjct  84    TFTGEQTAGGNAGSLRGFTVIDDIKSQVESVCPGVVSCADILAVAARDSVALLGGPTWPV  143

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S ANS      + LS L+S+FSNKG +A+EMVAL+G+HTIGQA+C  F
Sbjct  144   QLGRRDSTTASLSIANSDIPSPTMDLSGLLSSFSNKGLTAKEMVALAGAHTIGQARCVVF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE+NI+AS+ + +K NCP +GGDNNL PLD+ TP  FDN YFK+L S KGL+HSD
Sbjct  204   RNRVYNESNIDASYVSSVKPNCPNNGGDNNLTPLDSNTPVIFDNGYFKDLVSNKGLMHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDS V +YS NP++F  DFA AMVKM NLSPLTGTKGQIR NC KTN
Sbjct  264   QQLFNGGSTDSQVTSYSKNPTSFHADFAQAMVKMGNLSPLTGTKGQIRTNCWKTN  318



>ref|XP_010685962.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=365

 Score =   417 bits (1071),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 241/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLSAN+Y+ TCP ALS I+ AV  AV++E+RMGASLLRLHFHDCFVNGCDAS+LL+DT+
Sbjct  71    AQLSANYYAKTCPKALSTIRNAVRKAVSAESRMGASLLRLHFHDCFVNGCDASVLLNDTS  130

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGEQ+AG N  S+RG  V+D+IK+Q+E  C GVVSCADI+AVAAR+SVV+L GP+W +
Sbjct  131   TFTGEQTAGANAGSLRGYTVVDSIKSQVESVCPGVVSCADILAVAARESVVSLRGPTWQV  190

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S ANS         + L+S+FS+KG +A+EMVAL+G+HTIGQA+C  F
Sbjct  191   QLGRRDSTTASLSTANSDIPSPSMDLRGLLSSFSDKGLTAKEMVALAGAHTIGQARCVVF  250

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE+NI+ASF T +K+NCP SGGDNNL+PLD+TTP  FDN YFK+L + KGL+HSD
Sbjct  251   RNRVYNESNIDASFVTSVKSNCPSSGGDNNLSPLDSTTPVVFDNGYFKDLVNNKGLMHSD  310

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFN GSTDS V +YS   S+F  DFA AMVKM NLSPLTGT GQIR NC KTN
Sbjct  311   QQLFNNGSTDSQVTSYSKGSSSFHKDFARAMVKMGNLSPLTGTNGQIRTNCWKTN  365



>gb|AFK43134.1| unknown [Medicago truncatula]
Length=312

 Score =   414 bits (1064),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 244/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS +FYSTTC + LS I+  + +AV +EARMGAS+LRLHFHDCFV GCDAS+LLDDT+
Sbjct  18    AQLSTDFYSTTCSDVLSTIKREIDSAVGNEARMGASILRLHFHDCFVQGCDASVLLDDTS  77

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AG N NS+RG +VID IKT+LE  C   VSCADI++VAARDSVVALGGPSW +
Sbjct  78    SFTGEKTAGANANSLRGFDVIDTIKTELESLCPNTVSCADILSVAARDSVVALGGPSWTV  137

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TAS S ANS     G  LS LI++F NKGF+ +EMVALSGSHTIGQA C FF
Sbjct  138   QLGRRDSITASLSLANSDLPGPGSDLSGLITSFDNKGFTPKEMVALSGSHTIGQASCRFF  197

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIY+++NI++SFAT L+ANCP +GGD+NL+PLDTTTP +FDN+YF+NLQSQKGL  SD
Sbjct  198   RTRIYDDDNIDSSFATSLQANCPTTGGDDNLSPLDTTTPNTFDNSYFQNLQSQKGLFSSD  257

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LFNGGSTD  V+ YSS+ S+FATDFANAMVKM NL+P+TG  GQIR NCR  N
Sbjct  258   QALFNGGSTDFDVDEYSSDSSSFATDFANAMVKMGNLNPITGFNGQIRTNCRVIN  312



>ref|XP_010921098.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=319

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 247/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FY T+CPNALS IQ+AV  AV  EARMGASLLRLHFHDCFV GCD S+LLDDT+
Sbjct  25    AQLSSTFYDTSCPNALSTIQSAVKAAVAKEARMGASLLRLHFHDCFVQGCDGSVLLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PNINSIRG +VID IK+Q+E  C   VSCADI+AVAARDSVVALGGPSW +
Sbjct  85    TFTGEKTAKPNINSIRGFDVIDTIKSQVEAVCNQTVSCADILAVAARDSVVALGGPSWTV  144

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS S ANS   P    LS LIS FS KG S  +MVALSGSHTIGQA+C+ F
Sbjct  145   LLGRRDSTTASLSLANSDIPPPTSDLSALISAFSKKGLSTSDMVALSGSHTIGQARCTSF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE NI++S+AT L++NCP SGGDNNL+PLD +TPT+FDN Y++NL ++KGLLHSD
Sbjct  205   RARIYNETNIDSSYATSLQSNCPVSGGDNNLSPLDVSTPTTFDNFYYRNLVNKKGLLHSD  264

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+NGGSTDS V++Y++N +TF +DFA AMVKM N+SPLTG+ G+IR NCRKTN
Sbjct  265   QQLYNGGSTDSQVSSYNTNSATFFSDFAAAMVKMGNISPLTGSSGEIRINCRKTN  319



>ref|XP_010423480.1| PREDICTED: peroxidase 52 [Camelina sativa]
Length=324

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/297 (69%), Positives = 246/297 (83%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+  FYST+CPN LS +QTAV +AV SEARMG S+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTTFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIK+ +EK+C GVVSCADI+A+AARDSVVALGGP+WN+
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS    P  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NINA+FAT  +  CP++   GD NLAPLD TT  SFDN YFKNL +QKGLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ LFNGGSTDSIV  YS+NPS+F++DF  AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  268   SDQVLFNGGSTDSIVRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>dbj|BAM28607.1| putative peroxidase [Nepenthes alata]
Length=317

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 235/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ +Y ++CP ALS I++ V +A+  EARMGASLLRLHFHDCFVNGCD S+LLDDTA
Sbjct  22    AQLSSTYYDSSCPKALSTIESGVTSAIQKEARMGASLLRLHFHDCFVNGCDGSVLLDDTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN+NS+RG +VID IK  +E  C GVVSCADI+AV ARDSVV LGG SW +
Sbjct  82    NFTGEKTAAPNLNSLRGFDVIDTIKASVESVCPGVVSCADILAVVARDSVVKLGGQSWTV  141

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS SAAN+           LIS+FSNKG +  EMVALSG+HTIG A+C  F
Sbjct  142   LLGRRDSTTASLSAANANIPAPTLNLSGLISSFSNKGLTEDEMVALSGAHTIGLARCVTF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE NI +S+A  LK NCP + G NN APLD TTP  FDNAYFK+L + +GLLHSD
Sbjct  202   RSRIYNETNIKSSYAASLKKNCPTNDGGNNTAPLDITTPFIFDNAYFKDLINLEGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+N GS DS V+ YSS+PSTF+TDFANA+VKM NLSPLTGT+GQIR NCRK N
Sbjct  262   QQLYNNGSADSQVSKYSSSPSTFSTDFANAIVKMGNLSPLTGTEGQIRTNCRKVN  316



>gb|AII99880.1| peroxidase [Cicer arietinum]
Length=306

 Score =   413 bits (1061),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/298 (68%), Positives = 241/298 (81%), Gaps = 6/298 (2%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS++FY+TTCP+ LS I+T +  AVN E RMGASLLRLHFHDCF  GCD S+LLDDT+
Sbjct  11    AQLSSDFYATTCPDVLSTIKTQIDLAVNDEPRMGASLLRLHFHDCF--GCDGSVLLDDTS  68

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SAGPN NS+RG +VID IK+++E  C  VVSCADI++VAARDSVVALGGPSW +
Sbjct  69    SFTGEKSAGPNANSLRGFDVIDTIKSEVESLCPNVVSCADILSVAARDSVVALGGPSWTV  128

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALS---GSHTIGQAKC  581
              LGRRDSTTAS  +AN+        L+ LI+ F  KGF+ +EMVALS   GSHTIGQA C
Sbjct  129   QLGRRDSTTASLDSANTNLPGPTSDLTNLITAFDKKGFTTQEMVALSDVLGSHTIGQASC  188

Query  580   SFFRSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
              FFRSRIYNE+NI+ +FA  L+ANCP SGGDNNL+PLDTTTP +FDN+Y+ NLQSQ GL 
Sbjct  189   RFFRSRIYNEDNIDPTFAASLQANCPTSGGDNNLSPLDTTTPDTFDNSYYTNLQSQMGLF  248

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ+LFN GSTDSIV+ YSS+PS+F TDFANAM+KM NLSPLTG+ GQIR  C   N
Sbjct  249   HSDQELFNQGSTDSIVDGYSSDPSSFETDFANAMLKMGNLSPLTGSSGQIRTTCGAIN  306



>ref|XP_003551179.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
 gb|KHN48392.1| Cationic peroxidase 1 [Glycine soja]
Length=320

 Score =   413 bits (1062),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 247/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A+LS++FY++TCPNALS I++AV +AV  E RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  26    AELSSDFYASTCPNALSTIKSAVKSAVAKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SA  N+NS+RG +VID+IK+QLE +C G+VSCADIVAVAARDSVVALGGPSW +
Sbjct  86    SFTGEKSAAANLNSLRGFDVIDDIKSQLESACPGIVSCADIVAVAARDSVVALGGPSWTI  145

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS+ AA S      + L+ LIS FSNKGF+++EMV LSG+HT GQAKC FF
Sbjct  146   GLGRRDSTTASKDAATSDIPSPLMDLNDLISAFSNKGFTSQEMVVLSGAHTTGQAKCQFF  205

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE NI++ FAT  K+NCP + GD+NL+PLD TT   FDNAYFKNL ++KGLLHSD
Sbjct  206   RGRIYNETNIDSDFATSAKSNCPSTDGDSNLSPLDVTTNVLFDNAYFKNLVNKKGLLHSD  265

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V TYS++ STF  DFA+AMVKM NLSPLTG+ GQIR NCR  N
Sbjct  266   QQLFSGGSTDSQVTTYSTSSSTFYADFASAMVKMGNLSPLTGSSGQIRTNCRNVN  320



>ref|XP_004492537.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=316

 Score =   413 bits (1061),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 239/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFY  TCP  L+ I++ V  AVN+E RMGASLLRLHFHDCFV GCDAS+LLDDT+
Sbjct  22    AQLSSNFYLKTCPLVLATIKSEVTLAVNNERRMGASLLRLHFHDCFVQGCDASVLLDDTS  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SAGPN NS+RG +VID IK+++EK C   VSCADI++VAARDSVVALGGPSW++
Sbjct  82    SFTGEKSAGPNANSLRGFDVIDTIKSKVEKLCPNTVSCADILSVAARDSVVALGGPSWSV  141

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S ANS        LS L + FSNKGF+  E+VALSGSHTIG+  C FF
Sbjct  142   QLGRRDSTTASLSIANSDLPGPSSDLSDLKTAFSNKGFTLEELVALSGSHTIGEGSCRFF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE NI+ +FATLL+ NCP +GGD+NL+PLDTTTP +FDNAY++NLQ  KGL HSD
Sbjct  202   RARIYNEKNIDPTFATLLQGNCPSTGGDSNLSPLDTTTPNTFDNAYYRNLQKLKGLFHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFN GSTD+ VN+Y +NP++F  DFANAMVKM  LSPLTG+ GQIR  C  TN
Sbjct  262   QQLFNNGSTDTQVNSYVNNPASFRADFANAMVKMGRLSPLTGSSGQIRTKCGSTN  316



>ref|XP_010264472.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=325

 Score =   413 bits (1062),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 247/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ +Y T+CP A S I++ V  AV  E RMGASLLRLHFHDCFVNGCD SILLDDT+
Sbjct  31    AQLSSTYYDTSCPKAFSTIKSGVTAAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTS  90

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A  N NS+RG +VID IK+++E  C GVVSCADI+AVAARDSVVALGGPSW +
Sbjct  91    SFTGEKTATANANSVRGFDVIDTIKSKVESVCPGVVSCADILAVAARDSVVALGGPSWTV  150

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+TTAS SAANS      L LS L S FS KG +A+EMVALSG+HTIGQA+C+ F
Sbjct  151   QLGRRDATTASLSAANSDIPAPTLDLSDLTSAFSKKGLTAKEMVALSGAHTIGQARCTSF  210

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE NIN+S AT LK+NCP +GGD+NL+PLD T+PT+FDNAYFKNL + KGLLHSD
Sbjct  211   RSRIYNETNINSSLATSLKSNCPSTGGDSNLSPLDATSPTAFDNAYFKNLVNNKGLLHSD  270

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+NGGSTDS V++YSSN +TF++DFA+AMVKM N+SPLTG+ G+IR NCRKTN
Sbjct  271   QQLYNGGSTDSQVSSYSSNSATFSSDFASAMVKMGNISPLTGSNGEIRTNCRKTN  325



>ref|XP_006398996.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
 gb|ESQ40449.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
Length=324

 Score =   413 bits (1061),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 203/297 (68%), Positives = 250/297 (84%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYS++CPN LS +QTAV +AV+S+ RMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYSSSCPNLLSTVQTAVKSAVSSQNRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIK+ +EK+C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVILGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AANS    P  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  148   KLGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+R+YNE NINA+FATL + +CP++   GD NLAPLD  +  SFDN+YFKNL +Q+GLLH
Sbjct  208   RARVYNETNINAAFATLRQRSCPRTAGSGDGNLAPLDVNSAASFDNSYFKNLMAQRGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDSIV  YS+ PS+F++DFA AM+KM ++SPLTGT G+IRK C +TN
Sbjct  268   SDQELFNGGSTDSIVRGYSNTPSSFSSDFAAAMIKMGDISPLTGTSGEIRKLCGRTN  324



>ref|XP_010664359.1| PREDICTED: cationic peroxidase 1 isoform X3 [Vitis vinifera]
Length=316

 Score =   412 bits (1060),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/295 (71%), Positives = 238/295 (81%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFY+++CP ALS I+ AV NAV  E RMGASLLRLHFHDCFV GCDASILLDDTA
Sbjct  22    AQLSSNFYASSCPKALSTIRAAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NS+RG +VID IK+Q+E  C GVVSCADIVAVAARDSVVALGGP+W +
Sbjct  82    NFTGEKTAGPNNNSVRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALGGPTWTV  141

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S ANS      S    LIS FSNKGF+ +EMV LSG+HTIG+A+CS F
Sbjct  142   QLGRRDSTTASFSTANSDLPAPTSDLDALISLFSNKGFTTQEMVVLSGTHTIGKAQCSKF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE NI+A+FAT  +A CP SGGD NL+ LD TT T FDN YF NL  +KGLLHSD
Sbjct  202   RDRIYNETNIDATFATSKQAICPSSGGDENLSDLDETT-TVFDNVYFTNLIEKKGLLHSD  260

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+NG STDS+V TYS++ +TF TD A+AMVKM NLSPLTGT G+IR NCR  N
Sbjct  261   QQLYNGNSTDSMVETYSNDSTTFFTDVASAMVKMGNLSPLTGTDGEIRTNCRAIN  315



>ref|XP_010683551.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=343

 Score =   413 bits (1062),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 204/297 (69%), Positives = 252/297 (85%), Gaps = 4/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS++CPNALS IQ+AV +AVN+E+RMGASLLRLHFHDCFVNGCD S+LLDDTA
Sbjct  26    AQLSPNFYSSSCPNALSTIQSAVQSAVNNESRMGASLLRLHFHDCFVNGCDGSLLLDDTA  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN+NS+RG  VID IK+Q+E  C GVVSCADI+AVAARDSVVALGGPSW +
Sbjct  86    NFTGEKTAIPNLNSVRGFEVIDTIKSQVENVCAGVVSCADILAVAARDSVVALGGPSWTV  145

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTA+ SAAN++   P L+++QLI+ FS  GF+ +++VALSG+HTIGQA+C+ F
Sbjct  146   LLGRRDSTTANISAANAILPAPTLNITQLITLFSGLGFTNQDLVALSGAHTIGQARCTTF  205

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE NIN++FAT L+ANCP SGGDNN +PLD  TPT+FDN YF +L + +G+LHSD
Sbjct  206   RSRIYNETNINSTFATSLQANCPSSGGDNNTSPLD-KTPTTFDNTYFNDLLTLQGVLHSD  264

Query  391   QQLFNG--GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LF G  G+TDS V++Y SN +TF  DFA+AM+KM N+S LTGT G+IR NCR+ N
Sbjct  265   QELFTGNNGTTDSQVSSYGSNSTTFFADFASAMLKMGNMSVLTGTSGEIRTNCRRPN  321



>ref|XP_009775239.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=320

 Score =   412 bits (1059),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 239/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A+LSA++Y  +CP A+  I+ AV NAV  E RMGASLLRLHFHDCFVNGCDASILLDDT+
Sbjct  26    ARLSADYYEKSCPKAIYTIKNAVTNAVAKERRMGASLLRLHFHDCFVNGCDASILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS+RG ++ID IK+Q+EK C G+VSCADI+A+AARDSV  LGG +WN+
Sbjct  86    DFTGEKTAKPNSNSLRGFDLIDTIKSQVEKLCPGIVSCADIIAIAARDSVEILGGSTWNV  145

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS S+ANS      + LS LI+ F NKGF+A+EMVAL+G+HTIGQA+C+ F
Sbjct  146   LLGRRDSTTASLSSANSDIPSPLMDLSDLITKFDNKGFTAKEMVALAGAHTIGQAQCTTF  205

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R+YNE  I++S AT LK+NCP +GGD++L+ LD  TP  FDN YFKNL   KG+LHSD
Sbjct  206   RERVYNETTIDSSLATSLKSNCPSTGGDDSLSALDAATPAIFDNHYFKNLVKNKGILHSD  265

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V TYS+ P TFA DFA A+VKM NLSPLTGT GQIR NCRK N
Sbjct  266   QQLFSGGSTDSQVTTYSTRPITFAADFAKAIVKMGNLSPLTGTNGQIRTNCRKIN  320



>ref|XP_009358287.1| PREDICTED: cationic peroxidase 1-like [Pyrus x bretschneideri]
Length=319

 Score =   412 bits (1059),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 206/296 (70%), Positives = 241/296 (81%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+N Y TTCP AL I++ AV NAV  E RMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  24    AQLSSNHYETTCPLALFIVRNAVINAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTA  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN NS+RG  VID IK++LE +C GVVSCADI+A+AARDSV+ LGGPSW +
Sbjct  84    NFTGEKTALPNTNSLRGFEVIDTIKSELESACPGVVSCADILAIAARDSVLLLGGPSWTV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAAN+    P L+L+ LIS FS KGF+ +E+VALSGSHT+GQA+C  F
Sbjct  144   QLGRRDSTTASLSAANTELPSPSLNLNDLISFFSTKGFTTKELVALSGSHTMGQARCLLF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGG-DNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             R RI+NE NI++SFA  LK NC  S G D+NL+ LD T+P  FDNAYFKNL + KGLLHS
Sbjct  204   RERIHNETNIDSSFAASLKLNCTASSGTDDNLSSLDVTSPVIFDNAYFKNLVNSKGLLHS  263

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLF+GGSTDS+V TYS+   TF TDFA+AMVKM +LSPLTGT GQ+R NCRK N
Sbjct  264   DQQLFSGGSTDSLVTTYSTTAGTFYTDFASAMVKMGSLSPLTGTTGQVRTNCRKIN  319



>ref|XP_008782619.1| PREDICTED: cationic peroxidase 1-like [Phoenix dactylifera]
Length=320

 Score =   412 bits (1058),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 203/296 (69%), Positives = 240/296 (81%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY T+CP ALS IQ+AV  AV  E RMGASLLRLHFHDCFV GCD S+LLDDT+
Sbjct  25    AQLSPTFYDTSCPKALSTIQSAVKAAVAKERRMGASLLRLHFHDCFVQGCDGSVLLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++AGPN NSIRG +VID IK+++E  C   VSCADI+AVAARDSVVALGGPSW +
Sbjct  85    TFTGEKTAGPNNNSIRGFDVIDTIKSRVEAVCKQTVSCADILAVAARDSVVALGGPSWTV  144

Query  748   LLGRRDSTTASQSAANslpgp--glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDSTTAS S ANS         LS LIS FS KG +  +MVALSG+HTIGQA+C+ 
Sbjct  145   QLGRRDSTTASLSLANSDIPSPITSDLSALISAFSKKGLATSDMVALSGAHTIGQARCTS  204

Query  574   FRSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             FR+RIYNE NI++SFAT L++NCP SGGD+NLAPLD +TPT FDN Y++NL ++KGLLHS
Sbjct  205   FRNRIYNETNIDSSFATSLQSNCPVSGGDSNLAPLDVSTPTIFDNFYYRNLLNKKGLLHS  264

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLFNGGSTDS V++YS+N + F +DFA+AMV M N+SPLTGT G+IR +CRKTN
Sbjct  265   DQQLFNGGSTDSQVSSYSTNSAKFFSDFASAMVNMGNISPLTGTSGEIRISCRKTN  320



>ref|XP_004242492.1| PREDICTED: cationic peroxidase 1 [Solanum lycopersicum]
Length=314

 Score =   411 bits (1056),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 239/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A LS+++Y  +CP A+  I+ AVANAV +E RMGASLLRLHFHDCFVNGCDAS+LLDDT 
Sbjct  20    ADLSSDYYEKSCPKAMYTIKNAVANAVTNERRMGASLLRLHFHDCFVNGCDASVLLDDTT  79

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SA PN NSIRG +VID IK+Q+EK C G+VSCADI+AVAARDSVV LGGPSW +
Sbjct  80    DFTGEKSAKPNSNSIRGFDVIDKIKSQIEKLCPGIVSCADIIAVAARDSVVLLGGPSWTV  139

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS   ANS      L L+ LI+ F+NKGF+A+EMVALSG HTIG+A+C+ F
Sbjct  140   ELGRRDSTTASLDTANSDIPSPSLDLNDLITNFANKGFTAKEMVALSGGHTIGKAQCTTF  199

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE NI++S AT LK+NCP +GGD+ L+ LD TTP  FDN ++KNL + KG+LHSD
Sbjct  200   RARVYNETNIDSSLATSLKSNCPSTGGDDTLSSLDATTPVLFDNHFYKNLVNNKGILHSD  259

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL++GGSTDS V +YS+NP  F  DFA AMVK+ NLSPLTGT GQIR NCRK N
Sbjct  260   QQLYSGGSTDSQVKSYSTNPIAFDADFAKAMVKLGNLSPLTGTNGQIRTNCRKIN  314



>emb|CAH10839.1| peroxidase [Picea abies]
Length=317

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 242/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QL++ FY+  CP ALSI++ AV  AVN+E RMGASLLRLHFHDCFVNGCD SILLDD +
Sbjct  23    GQLTSTFYNKLCPTALSIVKAAVNKAVNNEKRMGASLLRLHFHDCFVNGCDGSILLDDNS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VID IKTQ+E +C GVVSCADI+A+ ARDSVV LGGP+W +
Sbjct  83    TFTGEKTALPNANSVRGFDVIDTIKTQVEAACSGVVSCADILAIVARDSVVQLGGPTWTV  142

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS SAAN+       +LS LIS+F+  G S +++VALSG HTIGQA+C+ F
Sbjct  143   LLGRRDSTTASLSAANNNIPSPASNLSALISSFTAHGLSTKDLVALSGGHTIGQARCTTF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE+NI+ SFAT +K++CP +GGDN L+PLD  TPT+FDN Y+ +L ++KGLLHSD
Sbjct  203   RARIYNESNIDTSFATSVKSSCPSAGGDNTLSPLDLATPTTFDNKYYTDLGNRKGLLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGST+S V TYS+N +TF TDFA AMVKM N+SPLTGT GQIRKNCRK N
Sbjct  263   QQLFSGGSTNSQVTTYSANQNTFFTDFAAAMVKMGNISPLTGTSGQIRKNCRKAN  317



>ref|XP_002319407.1| peroxidase family protein [Populus trichocarpa]
 gb|EEE95330.1| peroxidase family protein [Populus trichocarpa]
Length=302

 Score =   410 bits (1055),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 242/295 (82%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY+TTCP ALS I+TAV  AV  E RMGASLLRLHFHDCF  GCDAS+LLDDT+
Sbjct  9     AQLSTTFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCF-QGCDASVLLDDTS  67

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN NS+RG +VID IK+QLE  C GVVSCADI+AVAARDSVVAL GPSW +
Sbjct  68    SFTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVALSGPSWTV  127

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS  AANS      + LS LI++FSNKGF+A+EMVALSGSHTIGQA+C  F
Sbjct  128   QLGRRDSTTASLGAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQARCLLF  187

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+R+YNE +++++ AT LK+NCP +G D++L+ LD TTP +FDN+YFKNL + KGLLHSD
Sbjct  188   RNRVYNETSLDSTLATSLKSNCPNTGSDDSLSSLDATTPVTFDNSYFKNLANNKGLLHSD  247

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GG+TDS V TYS N +TF  DFA+AMVKM ++SPLTG+ GQIR NC K N
Sbjct  248   QQLFSGGTTDSQVKTYSINSATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN  302



>ref|XP_010543687.1| PREDICTED: peroxidase 52 [Tarenaya hassleriana]
Length=324

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/297 (68%), Positives = 244/297 (82%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYS++CPN LS +++A+ +AVN EAR GAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYSSSCPNLLSTVRSAMQSAVNREARAGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN NS RG +VIDNIKT +E++C GVVSCADI+AVAARD VV LGGP+WN+
Sbjct  88    NFTGEKNANPNRNSARGFDVIDNIKTAVERACPGVVSCADILAVAARDGVVLLGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQS ANS    P  SLSQLIS+F N G S R+MVALSG HTIGQA+C+ F
Sbjct  148   KLGRRDARTASQSGANSNIPAPTSSLSQLISSFGNVGLSTRDMVALSGGHTIGQARCTSF  207

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NIN++FAT  +  CP++   GD NLAPLD  TP +F+N YFKNL +Q+GLLH
Sbjct  208   RTRIYNETNINSAFATTRQQTCPRTAGSGDGNLAPLDIQTPANFNNDYFKNLMAQRGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDSIV TYSSNP+TF +DF  AM+KM ++SPLTG  G+IR+NCR+ N
Sbjct  268   SDQELFNGGSTDSIVRTYSSNPATFNSDFVAAMIKMGDISPLTGNSGEIRRNCRRLN  324



>ref|XP_010035985.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/296 (69%), Positives = 241/296 (81%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLS-ANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDT  932
             AQLS  N+Y   CP AL  I +AV +AV +E+RMGASLLRLHFHDCFVNGCD SILLDDT
Sbjct  25    AQLSNQNYYEKGCPKALQTIGSAVKSAVANESRMGASLLRLHFHDCFVNGCDGSILLDDT  84

Query  931   ANFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWN  752
             ANFTGE++A PN+NS+RG +V+D IK+++EK C GVVSCADI+A+ ARDSVV LGG SW 
Sbjct  85    ANFTGEKTAFPNLNSLRGFDVVDTIKSEVEKLCPGVVSCADILAIVARDSVVELGGQSWQ  144

Query  751   LLLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
             + LGRRDSTTAS + AN+      L+LS LI++FSNKGF+A EMV LSGSHTIGQ++C  
Sbjct  145   VQLGRRDSTTASLNTANTDLPAPTLNLSALITSFSNKGFTAEEMVTLSGSHTIGQSRCVT  204

Query  574   FRSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             FR+R+YNE+NI++SFAT LKANCP SGGDNNL+PLD T+PTSFDNAYF NL  QKGLLHS
Sbjct  205   FRARLYNESNIDSSFATTLKANCPSSGGDNNLSPLDVTSPTSFDNAYFTNLVCQKGLLHS  264

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLF+GGST++ V  YS N  +F  DFA AMVKM  LSPLTG+ GQIR NCR+ N
Sbjct  265   DQQLFSGGSTNAQVTAYSKNFGSFQNDFAKAMVKMGGLSPLTGSTGQIRTNCRRVN  320



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score =   410 bits (1055),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 201/297 (68%), Positives = 245/297 (82%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS TCPN  + +++AV +A++ E+RMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  25    AQLSTNFYSKTCPNVFTTVKSAVRSAISKESRMGASLLRLFFHDCFVNGCDGSILLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +V+D+IK+++EK C GVVSCADI+A+AARDSVV LGG SWN+
Sbjct  85    SFTGEKNANPNRNSARGFDVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGTSWNV  144

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TASQSAAN+    P  +L+ LIS+F +KG S ++MVALSG HTIGQA+C+ F
Sbjct  145   KLGRRDSKTASQSAANNNIPPPTSNLNNLISSFQSKGLSTKDMVALSGGHTIGQARCTNF  204

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE+NI +SFA   +  CP S   GDNNLAPLD  TPT+FDN YFKNL +QKGLLH
Sbjct  205   RARIYNESNIESSFAKTRQGRCPSSSGSGDNNLAPLDLQTPTAFDNNYFKNLINQKGLLH  264

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDS V TYS+NPSTF +DFA AM+KM ++SPLTG+ G+IRKNCR+ N
Sbjct  265   SDQQLFNGGSTDSQVRTYSNNPSTFNSDFAAAMIKMGDISPLTGSNGEIRKNCRRVN  321



>gb|KFK24955.1| hypothetical protein AALP_AA8G047500 [Arabis alpina]
Length=324

 Score =   411 bits (1056),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/297 (69%), Positives = 244/297 (82%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +QTAV +AV SEARMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVKSEARMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIK  +EK+C GVVSCAD++A+AARDSVVALGGP+WN+
Sbjct  88    SFTGEQNAAPNRNSARGFNVIDNIKAAVEKACPGVVSCADVLAIAARDSVVALGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS    P  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  148   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  207

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NINA+FAT  +  CP++   GD NLAPLD  TP SFDN YFKNL +QKGLLH
Sbjct  208   RTRIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVATPASFDNNYFKNLLTQKGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDSIV  Y++N  +F +DF  AM+KM ++SPLTG+ G+IRK C  TN
Sbjct  268   SDQELFNGGSTDSIVRGYNNNARSFNSDFTAAMIKMGDISPLTGSSGEIRKVCGSTN  324



>ref|XP_009408894.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=318

 Score =   410 bits (1054),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS  FY +TCPN  SI+++A+  AVN E RMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  24    GQLSPTFYGSTCPNLQSIVRSAMRQAVNKEPRMGASILRLFFHDCFVNGCDGSILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SAGPN NS RG  VID IK+ +E +C   VSCADI+A+AARD VV LGGP+W +
Sbjct  84    SFTGEKSAGPNANSARGFEVIDTIKSNVEAACKATVSCADILALAARDGVVLLGGPTWTV  143

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+TTASQSAANS     G SLSQLIS+F+ KG SAR+M ALSG+HTIGQA+C+ F
Sbjct  144   QLGRRDATTASQSAANSNLPGPGSSLSQLISSFAAKGLSARDMTALSGAHTIGQARCTSF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RS IYN+ N+NASFA L K NCP SGGD NLAPLD  TPT+FDN Y++NL  +KGLLHSD
Sbjct  204   RSHIYNDANVNASFAALRKQNCPSSGGDGNLAPLDLQTPTTFDNKYYQNLVVRKGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGS DS+V  YS+NP+ F  DF  AMVKM N+SPLTGTKGQIR NCRK N
Sbjct  264   QELFNGGSQDSLVQQYSTNPAVFNGDFTAAMVKMGNISPLTGTKGQIRLNCRKAN  318



>ref|XP_010650833.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=307

 Score =   409 bits (1052),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 200/293 (68%), Positives = 237/293 (81%), Gaps = 1/293 (0%)
 Frame = -1

Query  1102  LSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANF  923
             LS+ FYS  CP ALS I+TAV  AV +E RMGASLLRLHFHDCFVNGCD SILLDDTANF
Sbjct  15    LSSTFYSAKCPKALSTIRTAVNTAVANENRMGASLLRLHFHDCFVNGCDGSILLDDTANF  74

Query  922   TGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLL  743
             TGE++AGPN +S+RG  VID+IK+++E  C GVV+CADI+AVAARDSVVALGGP+W + L
Sbjct  75    TGEKTAGPNADSVRGFEVIDDIKSRVESVCPGVVTCADILAVAARDSVVALGGPTWTVQL  134

Query  742   GRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRS  566
             GRRDSTTAS S A +      L L  LIS FS+KGFSA+EMVALSGSHTIGQ++C  FR 
Sbjct  135   GRRDSTTASISDAETDIPSPALDLDDLISAFSDKGFSAKEMVALSGSHTIGQSRCLVFRD  194

Query  565   RIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQ  386
             RIYN++NI++SFA  LK+NCP + GD+NL+ LD T+P  FDN YFKNL   KGLLHSDQ+
Sbjct  195   RIYNDDNIDSSFAESLKSNCPDTDGDDNLSALDDTSPVIFDNGYFKNLVDNKGLLHSDQE  254

Query  385   LFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             LFN GSTDS V++Y+S+ ++F  DF  AMVKM N+SPLTGTKGQIR NCRK N
Sbjct  255   LFNNGSTDSQVSSYASSATSFYKDFTAAMVKMGNISPLTGTKGQIRVNCRKIN  307



>gb|KHN46100.1| Cationic peroxidase 1 [Glycine soja]
Length=300

 Score =   409 bits (1051),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 202/296 (68%), Positives = 241/296 (81%), Gaps = 4/296 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             +QL++N Y +TCP ALSII+TAV  AV  E RMGASLLRLHFHDCF  GCDAS+LLDDT+
Sbjct  7     SQLTSNCYESTCPQALSIIKTAVIGAVAKEHRMGASLLRLHFHDCF--GCDASVLLDDTS  64

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE+SA  N+NS+RG  VID+IKT++E +C GVVSCADI+A+AARDSVV LGGPSWN+
Sbjct  65    TFTGEKSAAANVNSLRGFEVIDDIKTKVEAACPGVVSCADILAIAARDSVVTLGGPSWNV  124

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS+ AA +      + LS LIS+FSNKGF+ +EMVALSG+HT GQA+C  F
Sbjct  125   GLGRRDSTTASKDAATTDIPSPLMDLSALISSFSNKGFNTKEMVALSGAHTTGQARCQLF  184

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R+YNE++I ++FAT LK+NCP +GGD+NL+PLD TT   FDNAYFKNL ++KGLLHSD
Sbjct  185   RGRVYNESSIESNFATSLKSNCPSTGGDSNLSPLDVTTNVVFDNAYFKNLINKKGLLHSD  244

Query  391   QQLFN-GGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFN GGSTDS V  YS++PS F  DFA+AMVKM NLSPLTG  GQIR NC K N
Sbjct  245   QQLFNSGGSTDSQVTAYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTNCHKVN  300



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 246/297 (83%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS++CPN LS +++ V +AVN+EARMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  27    AQLSTNFYSSSCPNLLSTVKSVVQSAVNNEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  86

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN  S+RG +V+D IKT +EK+C GVVSCADI+A++ARDSVV LGGP+WN+
Sbjct  87    SFTGEKNAFPNAGSLRGFDVVDQIKTAVEKACPGVVSCADILAISARDSVVILGGPTWNV  146

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+TTASQSAAN+    P  SLS LI +FS++G S  +MVALSG+HTIGQA+C+ F
Sbjct  147   KLGRRDATTASQSAANTNIPAPTASLSALIKSFSDQGLSTTDMVALSGAHTIGQARCTTF  206

Query  571   RSRIYNENNINASFATLLKANCP--QSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE+NI+ASFA   +ANCP   + G NNLAPLD  TP +FDN Y+ NL +QKGLLH
Sbjct  207   RTRIYNESNIDASFAKTRQANCPSASTSGSNNLAPLDIQTPNTFDNKYYNNLVNQKGLLH  266

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLF+GGST+++V TYSSNPS F TDF  AM+ M ++ PLTG+ GQIRKNCRKTN
Sbjct  267   SDQQLFSGGSTNALVQTYSSNPSRFNTDFVAAMINMGDVKPLTGSNGQIRKNCRKTN  323



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 244/297 (82%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CPN  + +++AV +A++ E RMGASLLRL FHDCFVNGCD SIL+DDT+
Sbjct  24    AQLSTNFYSKSCPNVFTTVKSAVGSAISKERRMGASLLRLFFHDCFVNGCDGSILVDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN NS+RG NV+D+IK+++EK C GVVSCADI+A+AARDSVV LGGPSW +
Sbjct  84    NFTGEKNAAPNRNSVRGFNVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGPSWKV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  SLS LIS+F +KG S ++MVALSGSHTIGQA+C+ F
Sbjct  144   KLGRRDARTASQAAANTSIPPPTSSLSNLISSFQSKGLSTKDMVALSGSHTIGQARCTSF  203

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE+NI+ SFA   +  CP +   GDNNLAPLD  TPT+FDN YFKNL + KGLLH
Sbjct  204   RTRIYNESNIDGSFAKARQRKCPATSGSGDNNLAPLDLQTPTAFDNNYFKNLINNKGLLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDS+V +YSS PSTF +DF+ AM+KM +++PLTG+ G+IR NCR+ N
Sbjct  264   SDQQLFNGGSTDSLVRSYSSKPSTFISDFSAAMIKMGDITPLTGSNGEIRNNCRRVN  320



>ref|XP_009622973.1| PREDICTED: cationic peroxidase 1-like [Nicotiana tomentosiformis]
Length=320

 Score =   409 bits (1050),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 237/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+++Y  +CP A+  I+ AV NAV  E RMGASLLRLHFHDCFVNGCD S+LLDDT+
Sbjct  26    AQLSSDYYEKSCPKAIYTIKDAVTNAVAKEHRMGASLLRLHFHDCFVNGCDGSVLLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS+RG ++ID IK+Q+EK C G+VSCADI+A+AARDSV  LGGPSW +
Sbjct  86    DFTGEKTAKPNSNSLRGFDLIDTIKSQVEKLCPGIVSCADIIAIAARDSVAILGGPSWTV  145

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S+ANS      + L+ LI+ F+NKGF+A+EMVAL+G+HTIGQA+C+ F
Sbjct  146   QLGRRDSTTASLSSANSDIPSPLMDLTDLITNFANKGFTAKEMVALAGAHTIGQAQCTTF  205

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R R+YNE  I++S AT LK+NCP +GGD++L+ LD  TP  FDN YF NL+  KG+LHSD
Sbjct  206   RERVYNETTIDSSLATSLKSNCPSTGGDDSLSALDAATPAIFDNHYFNNLKKNKGILHSD  265

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V TY + P TFA DFA A+VKM NLSPLTGT GQIR NCRK N
Sbjct  266   QQLFSGGSTDSQVTTYGTRPITFAADFAKAIVKMGNLSPLTGTNGQIRTNCRKIN  320



>ref|XP_010552918.1| PREDICTED: peroxidase P7-like [Tarenaya hassleriana]
Length=319

 Score =   408 bits (1049),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 240/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QL+ NFY+++CP  +  +++ + +AV  EAR+GAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  23    GQLTTNFYASSCPKLIPTVRSVMQSAVKREARIGASILRLFFHDCFVNGCDGSILLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN NS+RG +VIDNIKT  EK+C G+VSCADI+A+AARD VV LGGPSW +
Sbjct  83    SFTGEKNAGPNRNSVRGFDVIDNIKTAAEKACPGIVSCADILAIAARDGVVLLGGPSWEV  142

Query  748   LLGRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TASQSAAN        +LS+L+S+FSN G SAR+MVALSG HTIGQA+C+ F
Sbjct  143   KLGRRDSRTASQSAANRDIPAPTFNLSRLVSSFSNVGLSARDMVALSGGHTIGQARCTTF  202

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NIN++FA   + NCP++   GD NLAPLD  TPT FDN YFKNL  QKGLLH
Sbjct  203   RARIYNEKNINSAFAATRQRNCPRTNGSGDGNLAPLDIQTPTKFDNNYFKNLMVQKGLLH  262

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDSIV TY + P+TF++DF  AM++M ++SPLTG KG+IR+NCR+ N
Sbjct  263   SDQELFNGGSTDSIVRTYGTKPATFSSDFTAAMIRMGDISPLTGKKGEIRRNCRRVN  319



>ref|XP_006664869.1| PREDICTED: cationic peroxidase 1-like [Oryza brachyantha]
Length=317

 Score =   407 bits (1047),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 237/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLSANFY  +CPNALS I+TAV +A+  E RMGASLLRLHFHDCFV GCD S+LLDDT 
Sbjct  23    AQLSANFYDKSCPNALSTIRTAVRSAITKENRMGASLLRLHFHDCFVKGCDGSVLLDDTP  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VIDNIK Q+E  C  VVSCADI+AVAARDSVVALGGP+W +
Sbjct  83    TFTGEKTAAPNNNSLRGFDVIDNIKAQIEGICPQVVSCADILAVAARDSVVALGGPTWVV  142

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS  AAN+      L L  L  +FSNKG SA +M+ALSG+HTIGQA+C  F
Sbjct  143   QLGRRDSTTASLDAANNDIPAPTLDLGDLNKSFSNKGLSATDMIALSGAHTIGQARCVNF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIY+E NI++S AT LK+NCP + GDNN++PLD +TP  FDN Y+KNL  +KG+LHSD
Sbjct  203   RNRIYSETNIDSSLATSLKSNCPNTTGDNNISPLDASTPYVFDNFYYKNLLKKKGVLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGS DS   TYSSN +TF TDF+ AMVKMSN++PLTG+ GQIRKNCRK N
Sbjct  263   QQLFNGGSADSQTTTYSSNMATFFTDFSAAMVKMSNITPLTGSSGQIRKNCRKVN  317



>ref|XP_002283995.1| PREDICTED: cationic peroxidase 1-like [Vitis vinifera]
Length=316

 Score =   407 bits (1046),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 236/295 (80%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY+++CP ALS I+TAV NAV  E RMGASLLRLHFHDCFV GCDASILLDDTA
Sbjct  22    AQLSPNFYASSCPRALSTIRTAVNNAVAKERRMGASLLRLHFHDCFVLGCDASILLDDTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++AGPN NS+RG +VID IK+Q+E  C GVVSCADIVAVAARDSVVALGGP+W +
Sbjct  82    NFTGEKTAGPNNNSLRGYDVIDTIKSQMESLCPGVVSCADIVAVAARDSVVALGGPTWTV  141

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRDSTTAS S AN+      S    L S FSNKGF+ +EMVALSG+HTIG+A+C  F
Sbjct  142   QMGRRDSTTASLSTANADLPAPTSDLDVLTSLFSNKGFTTQEMVALSGTHTIGKAQCIKF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE N++A+FA   +  CP +GGD NL+ LD TT T FD  YFK+L  +KGLLHSD
Sbjct  202   RYRIYNETNVDAAFAKSKQKICPWTGGDENLSDLDETT-TVFDTVYFKDLIEKKGLLHSD  260

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+NG STDS+V TYS++ +TF TD ANAMVKM NLSPLTGT G+IR NCRK N
Sbjct  261   QQLYNGNSTDSMVETYSTDSTTFFTDVANAMVKMGNLSPLTGTDGEIRTNCRKIN  315



>gb|ABK23423.1| unknown [Picea sitchensis]
Length=318

 Score =   407 bits (1046),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 239/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QL++ FYS +CP ALSI+Q AV  AV  E RMGASLLRLHFHDCFVNGCD SILLDD +
Sbjct  24    GQLTSTFYSESCPRALSIVQAAVEQAVAKERRMGASLLRLHFHDCFVNGCDGSILLDDNS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VID IKTQ+E +C GVVSCADIVA+AARDSVVALGGP+W +
Sbjct  84    TFTGEKTATPNNNSVRGYDVIDTIKTQVEAACSGVVSCADIVAIAARDSVVALGGPTWTV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS +AANS    P  +LS LIS+F +   S +++VALSG+HTIGQA+C+ F
Sbjct  144   LLGRRDSTTASFNAANSSIPSPASNLSTLISSFRSHNLSPKDLVALSGAHTIGQARCTSF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE+NI+ S AT +K  CP++GGDN L+PLD  TP +FD  Y+ NL+S+KGLLHSD
Sbjct  204   RARIYNESNIDTSLATAVKPKCPRTGGDNTLSPLDLATPITFDKHYYCNLRSKKGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDS V TYS+N + F TDFA AMV M N+ PLTGT GQIR+NCRK+N
Sbjct  264   QQLFNGGSTDSQVTTYSTNQNNFFTDFAAAMVNMGNIKPLTGTSGQIRRNCRKSN  318



>emb|CDY14118.1| BnaC02g02350D [Brassica napus]
Length=324

 Score =   407 bits (1047),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 201/297 (68%), Positives = 250/297 (84%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +++ V +AV+S+ RMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+AGPN NS RG  VIDNIK+ +EK+C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS    P +SLSQLIS+FS  G S R+MVALSG+HTIGQ++C  F
Sbjct  148   KVGRRDAKTASQAAANSNIPAPNMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNF  207

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+R+YNE NINA+FATL + +CP++   GD NLAPLD  + TSFDN+YFKNL +Q+GLLH
Sbjct  208   RARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ LFNGGSTDSIV  YS++PS+F +DFA+AM+KM ++SPLTG+ G+IRK C KTN
Sbjct  268   SDQVLFNGGSTDSIVRGYSNSPSSFNSDFASAMIKMGDISPLTGSSGEIRKVCGKTN  324



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score =   407 bits (1045),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 242/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS TCPN  S +Q  + +A++SE RMGAS+LRL FHDCFVNGCD S+LLDDT+
Sbjct  24    AQLSTNFYSKTCPNLFSTVQPVIQSAISSEKRMGASILRLFFHDCFVNGCDGSLLLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +VID IK  +EK+C GVVSCADI+A++ARDSVV LGGP+WN+
Sbjct  84    SFTGEKTANPNRNSARGFDVIDKIKAAVEKACPGVVSCADILAISARDSVVLLGGPNWNV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TAS S AN+    P  SLS LIS FS +G SA EMVALSG+HTIGQA+C+ F
Sbjct  144   KLGRRDARTASLSGANNNIPPPTSSLSNLISKFSAQGLSANEMVALSGAHTIGQARCTSF  203

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYN+ NI+ SFA   ++NCP +   GDNNLAPLD  TPTSFDN YFKNL +QKGLLH
Sbjct  204   RARIYNDTNIDGSFAKTRRSNCPSTSGNGDNNLAPLDLQTPTSFDNDYFKNLVNQKGLLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFN GSTDS+V+TYS+NPS F++DF  AM+KM ++SPLTG++G+IRKNCRK N
Sbjct  264   SDQQLFNKGSTDSLVSTYSTNPSKFSSDFVAAMIKMGDISPLTGSQGEIRKNCRKIN  320



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 243/297 (82%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS++CP   S +++ V +A+  EARMGASLLRLHFHDCFVNGCD S+LLDDT+
Sbjct  23    AQLSTNFYSSSCPRLFSTVKSTVQSAIQKEARMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +V+DNIK+ +E  C GVVSCADI+A+AARDSVV LGGPSWN+
Sbjct  83    SFTGEKNAAPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVVTLGGPSWNV  142

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L+QLISTFS  G S R++VALSGSHTIGQA+C+ F
Sbjct  143   KLGRRDARTASQAAANNNIPPPTRNLNQLISTFSAVGLSTRDLVALSGSHTIGQARCTSF  202

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R RIYNE N+++S A   ++NCP++   GDNNLAPLD  TPTSFDN YFKNL   KGLLH
Sbjct  203   RPRIYNETNLDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTSFDNNYFKNLIQNKGLLH  262

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  YS++ + F++DFA+AM+KM ++ PLTG+ G+IRKNCRKTN
Sbjct  263   SDQQLFNGGSTDSIVRAYSNSYNAFSSDFASAMIKMGDIKPLTGSSGEIRKNCRKTN  319



>emb|CBI18066.3| unnamed protein product [Vitis vinifera]
Length=263

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/263 (77%), Positives = 226/263 (86%), Gaps = 1/263 (0%)
 Frame = -1

Query  1012  MGASLLRLHFHDCFVNGCDASILLDDTANFTGEQSAGPNINSIRGLNVIDNIKTQLEKSC  833
             MGASLLRLHFHDCFVNGCDASILLDDT+NFTGE++A PN NS+RG +VID IK+Q+E SC
Sbjct  1     MGASLLRLHFHDCFVNGCDASILLDDTSNFTGEKTAVPNANSVRGFDVIDTIKSQVESSC  60

Query  832   VGVVSCADIVAVAARDSVVALGGPSWNLLLGRRDSTTASQSAANslpgp-glslSQLIST  656
              GVVSCADI+AV ARDSVVALGGPSW + LGRRDSTTAS S ANS      L+LS LIS+
Sbjct  61    PGVVSCADILAVVARDSVVALGGPSWTVRLGRRDSTTASLSTANSDIPAPTLNLSGLISS  120

Query  655   FSNKGFSAREMVALSGSHTIGQAKCSFFRSRIYNENNINASFATLLKANCPQSGGDNNLA  476
             FSNKGFSA EMVALSGSHTIGQA+C+ FR R+YNE NI+ASF + L+ANCP SGGDNNL+
Sbjct  121   FSNKGFSANEMVALSGSHTIGQARCTNFRDRLYNETNIDASFQSSLQANCPSSGGDNNLS  180

Query  475   PLDTTTPTSFDNAYFKNLQSQKGLLHSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMV  296
             PLDT +PT+FDNAYF NL + KGLLHSDQQLFNGGSTDS V TYS+  +TF TDFANA+V
Sbjct  181   PLDTKSPTTFDNAYFTNLVNNKGLLHSDQQLFNGGSTDSQVTTYSTKSTTFFTDFANAIV  240

Query  295   KMSNLSPLTGTKGQIRKNCRKTN  227
             KM NLSPLTGT GQIR NCRKTN
Sbjct  241   KMGNLSPLTGTSGQIRTNCRKTN  263



>ref|XP_007146853.1| hypothetical protein PHAVU_006G075600g [Phaseolus vulgaris]
 gb|ESW18847.1| hypothetical protein PHAVU_006G075600g [Phaseolus vulgaris]
Length=318

 Score =   406 bits (1043),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 242/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS++FY+T+C +ALS I++ V +AV+ E RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  24    AQLSSDFYATSCSSALSTIKSKVKSAVSKERRMGASLLRLHFHDCFVNGCDASVLLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SA  N++S+RG +VID+IK+QLE  C G+VSCADI+AVAARDSVV+LGG SW +
Sbjct  84    SFTGEKSAAANVDSLRGFDVIDDIKSQLETDCPGIVSCADILAVAARDSVVSLGGSSWTV  143

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS+ AA +      L LS LI+ FSNKGF+ +EMV LSG+HT GQAKC FF
Sbjct  144   GLGRRDSTTASKDAATTDIPSPQLDLSDLITAFSNKGFTTKEMVVLSGAHTTGQAKCQFF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE NI++ FAT  ++NCP + GD+NL+PLD TT   FDN+YFKNL ++KGLLHSD
Sbjct  204   RGRIYNETNIDSDFATSTQSNCPSTDGDSNLSPLDVTTNVLFDNSYFKNLVNKKGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V  YS++ S+F  DF++AMVKM NLSPLTG+ GQIR NCR  N
Sbjct  264   QQLFSGGSTDSQVTAYSTSSSSFYADFSSAMVKMGNLSPLTGSSGQIRTNCRAVN  318



>ref|XP_010931328.1| PREDICTED: cationic peroxidase 1-like [Elaeis guineensis]
Length=316

 Score =   405 bits (1041),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/294 (68%), Positives = 232/294 (79%), Gaps = 1/294 (0%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLS  FY T+CP AL  IQ AV  AV  E RMGASLLRLHFHDCFVNGCD SILLDDT  
Sbjct  23    QLSPTFYETSCPGALYTIQNAVRAAVFKERRMGASLLRLHFHDCFVNGCDGSILLDDTPT  82

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGE++AGPN NS+RG +VID IK+Q+E  C  VVSCADI+AVAARDSVVALGGPSW + 
Sbjct  83    FTGEKTAGPNNNSVRGFDVIDTIKSQVEAICTQVVSCADILAVAARDSVVALGGPSWAVQ  142

Query  745   LGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRD+TTAS S ANS        LS LIS FS KG S  +MVALSG+HTIGQA+C+ FR
Sbjct  143   LGRRDATTASFSGANSDIPSPTSDLSALISAFSKKGLSTTDMVALSGAHTIGQARCTVFR  202

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             +R+YNE NI+AS AT LK+NCP SGGD+NL+PLD  TPT  DN Y+K+L ++KGLLHSDQ
Sbjct  203   TRLYNETNIDASLATSLKSNCPSSGGDDNLSPLDAITPTIVDNFYYKDLVNKKGLLHSDQ  262

Query  388   QLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QL+NGGSTDS V TY++N + F +DFA AMV M N+SPLTGT G+IR NCRK N
Sbjct  263   QLYNGGSTDSQVTTYANNFAKFYSDFAAAMVNMGNISPLTGTSGEIRTNCRKIN  316



>ref|XP_009125598.1| PREDICTED: peroxidase P7 [Brassica rapa]
Length=324

 Score =   405 bits (1041),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 248/297 (84%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +++ V +AV+S+ RMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+AGPN NS RG  VID IK+ +EK+C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS    P +SLSQLIS+FS  G S R+MVALSG+HTIGQ++C  F
Sbjct  148   KVGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNF  207

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+R+YNE NINA+FATL + +CP++   GD NLAPLD  + TSFDN+YFKNL +Q+GLLH
Sbjct  208   RARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ LFNGGSTDSIV  YS++PS+F +DFA AM+KM ++SPLTG+ G+IRK C KTN
Sbjct  268   SDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  324



>ref|XP_010491069.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   405 bits (1040),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 208/297 (70%), Positives = 249/297 (84%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +QTAV +AV SEARMG S+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYSTSCPNLLSTVQTAVKSAVRSEARMGGSILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIK+ +EK+C GVVSCADI+A+AARDSVVALGGP+WN+
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS   GP  SLSQLIS+FS  G S R+MVALSG+HTIGQA+C+ F
Sbjct  148   KVGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQARCTSF  207

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NINA+FAT  +  CP++   GD NLAPLD TT  SFDN YFKNL +QKGLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDSIV  YS++PS+F++DF  AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  268   SDQELFNGGSTDSIVRGYSNSPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>emb|CAH10841.1| peroxidase [Picea abies]
Length=320

 Score =   405 bits (1040),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 237/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS+ FY  +CP A SI++  V  A+  E RMGASL+RLHFHDCFV+GCD SILLDD A
Sbjct  26    GQLSSTFYDKSCPRAQSIVKRVVKQALAKEKRMGASLVRLHFHDCFVSGCDGSILLDDNA  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++AGPN NS RG +VID IKTQ+E +C GVVSCADI+ +AARDSVV L GP+W +
Sbjct  86    TFTGEKTAGPNANSARGFDVIDTIKTQVEAACSGVVSCADILTIAARDSVVELQGPTWTV  145

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             +LGRRDSTTAS SAAN+       SLS LIS+F   G S +++VALSG+HTIGQ++C+FF
Sbjct  146   MLGRRDSTTASLSAANNNIPSPASSLSALISSFKGHGLSTKDLVALSGAHTIGQSRCAFF  205

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE+NINA+FAT +KANCP +GGDN L+PLD  TP  F+N Y+ NL+ QKGLLHSD
Sbjct  206   RTRIYNESNINAAFATSVKANCPSAGGDNTLSPLDVVTPIKFNNKYYGNLKIQKGLLHSD  265

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDS V  YS+N ++F TDFA AMVKMSN+SPLTGT GQIRKNCRK N
Sbjct  266   QQLFNGGSTDSQVTAYSTNQNSFFTDFAAAMVKMSNISPLTGTSGQIRKNCRKAN  320



>emb|CDY04948.1| BnaAnng01300D [Brassica napus]
Length=324

 Score =   405 bits (1040),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 248/297 (84%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +++ V +AV+S+ RMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+AGPN NS RG  VID IK+ +EK+C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  88    SFTGEQNAGPNRNSARGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS    P +SLSQLIS+FS  G S R+MVALSG+HTIGQ++C  F
Sbjct  148   KVGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNF  207

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+R+YNE NINA+FATL + +CP++   GD NLAPLD  + TSFDN+YFKNL +Q+GLLH
Sbjct  208   RARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ LFNGGSTDSIV  YS++PS+F +DFA AM+KM ++SPLTG+ G+IRK C KTN
Sbjct  268   SDQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  324



>gb|EYU46001.1| hypothetical protein MIMGU_mgv1a018175mg [Erythranthe guttata]
Length=309

 Score =   404 bits (1037),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/302 (68%), Positives = 241/302 (80%), Gaps = 8/302 (3%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLSAN YST+CP AL+ I+T V   +  + RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  8     AQLSANHYSTSCPKALTTIKTTVLKTLLKDRRMGASLLRLHFHDCFVNGCDASVLLDDTS  67

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +  GE++A PN NS+RG  VID+IK+QLE  C GVVSCADI+AV+ARDSVVA+GGPSW +
Sbjct  68    SMIGEKTAAPNNNSLRGFEVIDSIKSQLETICPGVVSCADILAVSARDSVVAVGGPSWGV  127

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS  +AN+    P L L +LIS FSNKGF+ +EMVALSG+HTIGQA+C  F
Sbjct  128   QLGRRDSTTASIDSANTDIPSPTLDLPELISAFSNKGFTPKEMVALSGAHTIGQARCVVF  187

Query  571   RSRIYN---ENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R RIYN    +NI ASFAT LK+NCP +GGD+NL+PLD T+  SFD AYFKNL S KGLL
Sbjct  188   RERIYNNETNDNIPASFATSLKSNCPLTGGDDNLSPLDATSSLSFDTAYFKNLVSNKGLL  247

Query  400   HSDQQLFNGG----STDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRK  233
             HSDQQLF GG    STDS+V+ Y++NP  F +DFA+AM+KM NLSPLTGT GQIR NCRK
Sbjct  248   HSDQQLFGGGGATTSTDSLVSGYANNPPAFFSDFASAMIKMGNLSPLTGTNGQIRSNCRK  307

Query  232   TN  227
              N
Sbjct  308   IN  309



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score =   404 bits (1037),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 237/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CPN  S ++  V +A+N E RMGASL+RL FHDCFVNGCD SILLDDT+
Sbjct  24    AQLSTNFYSKSCPNLFSTVKPVVQSAINQEKRMGASLVRLFFHDCFVNGCDGSILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS+RG  VID+IK+ +EK+C GVVSCADI+A+AARDS   LGGPSWN+
Sbjct  84    SFTGEQTAVPNRNSVRGFEVIDSIKSAVEKACPGVVSCADILAIAARDSTAILGGPSWNV  143

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TAS SAAN+       +L+QLIS FS  G S R++VALSG+HTIGQA+C+ F
Sbjct  144   KLGRRDARTASLSAANNGIPAPTSNLNQLISRFSALGLSTRDLVALSGAHTIGQARCTNF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI++SFA   ++NCP +GGDNNLAPLD  TPTSFDN YFKNL  QKGLLHSD
Sbjct  204   RTRIYNDTNIDSSFAQTRRSNCPSTGGDNNLAPLDLQTPTSFDNNYFKNLLVQKGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFN GSTDSIV TYS+  STF +DF   M+KM ++SPLTG++G+IRKNC K N
Sbjct  264   QELFNNGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKNCGKVN  318



>ref|NP_001065566.1| Os11g0112200 [Oryza sativa Japonica Group]
 tpe|CAH69373.1| TPA: class III peroxidase 131 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF27411.1| Os11g0112200 [Oryza sativa Japonica Group]
Length=317

 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 238/295 (81%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLSANFY  +CPNALS I+TAV +AV  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  23    AQLSANFYDKSCPNALSTIRTAVRSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTP  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VIDNIK Q+E  C  VVSCADI+AVAARDSV ALGGP+W +
Sbjct  83    TFTGEKTAAPNNNSLRGFDVIDNIKAQVEGICPQVVSCADILAVAARDSVFALGGPTWVV  142

Query  748   LLGRRDSTTAS-QSAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS  +A N +P P L L  L  +FSNKG SA +M+ALSG+HTIGQA+C  F
Sbjct  143   QLGRRDSTTASLDTANNDIPAPTLDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIY+E NI+ S AT LK+NCP + GDNN++PLD +TP +FDN Y+KNL ++KG+LHSD
Sbjct  203   RNRIYSETNIDTSLATSLKSNCPNTTGDNNISPLDASTPYTFDNFYYKNLLNKKGVLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGS DS   TYSSN +TF TDF+ A+VKM N+ PLTG+ GQIRKNCRK N
Sbjct  263   QQLFNGGSADSQTTTYSSNMATFFTDFSAAIVKMGNIDPLTGSSGQIRKNCRKVN  317



>emb|CAH10842.1| peroxidase [Picea abies]
Length=320

 Score =   403 bits (1035),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 234/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS+ FY  +CP A SI++  V  AV  E RMGASL+RLHFHDCFVNGCD SILLDD A
Sbjct  26    GQLSSTFYDKSCPRAQSIVKRVVKQAVAKEKRMGASLVRLHFHDCFVNGCDGSILLDDNA  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++AGPN NS RG +VID IKTQ+E +C GVVSCADI+ +AARDSVV L GP+W +
Sbjct  86    TFTGEKTAGPNANSARGFDVIDTIKTQVEAACSGVVSCADILTIAARDSVVELQGPTWTV  145

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             +LGRRDSTTAS S AN+       SLS LIS+F   G S +++VALSG+HTIGQ++C+FF
Sbjct  146   MLGRRDSTTASLSDANNNIPSPASSLSALISSFKGHGLSTKDLVALSGAHTIGQSRCAFF  205

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE+NINA+FAT +KANCP +GGDN L+PLD  T   FDN Y+ NL+ QKGLLHSD
Sbjct  206   RTRIYNESNINAAFATSVKANCPSAGGDNTLSPLDVVTSIKFDNKYYGNLKIQKGLLHSD  265

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGG TDS V  YS+N ++F TDFA AMVKMSN+SPLTGT GQIRKNCRK N
Sbjct  266   QQLFNGGPTDSQVTAYSTNQNSFFTDFAAAMVKMSNISPLTGTSGQIRKNCRKAN  320



>ref|XP_010035986.1| PREDICTED: cationic peroxidase 1-like [Eucalyptus grandis]
Length=320

 Score =   403 bits (1035),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/296 (67%), Positives = 237/296 (80%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLS-ANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDT  932
             AQLS  ++Y+  CP AL  IQ+AV +AV +E RMGASLLRLHFHDCFVNGCDASILLDDT
Sbjct  25    AQLSNQDYYTQRCPRALETIQSAVRSAVANETRMGASLLRLHFHDCFVNGCDASILLDDT  84

Query  931   ANFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWN  752
              NFTGE++A PN+NS+RG +VID IK ++EK C G+VSCADI+AVAARDSVV L GPSW 
Sbjct  85    VNFTGEKTAFPNVNSVRGFDVIDTIKLKVEKLCPGIVSCADILAVAARDSVVILDGPSWQ  144

Query  751   LLLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
             + LGRRDSTTAS + AN            L+++FSNKGF+A+EMV LSGSHTIGQA+C  
Sbjct  145   VQLGRRDSTTASLNDANIDLPAPTLNLSGLVASFSNKGFTAKEMVTLSGSHTIGQARCVT  204

Query  574   FRSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             FR+R+YNE+NI+ SFA  LK+NCP SGG+NNL+PL+ T+PT FDNAYF NL SQ+GLLHS
Sbjct  205   FRTRLYNESNISPSFAMSLKSNCPSSGGNNNLSPLNITSPTFFDNAYFGNLVSQEGLLHS  264

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLF+GGST++ V  YS N  +F  DFA+AMVKM  LSPLTG+ GQIR NCRK N
Sbjct  265   DQQLFSGGSTNAQVAAYSKNLGSFRNDFADAMVKMGGLSPLTGSSGQIRTNCRKVN  320



>gb|KDP22793.1| hypothetical protein JCGZ_00380 [Jatropha curcas]
Length=293

 Score =   402 bits (1032),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 213/295 (72%), Positives = 242/295 (82%), Gaps = 6/295 (2%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYSTTCP ALS I +AV +A++ EARMGASLLRLHFHDCFVNGCD S+LLD   
Sbjct  4     AQLSPTFYSTTCPAALSTINSAVTSAISKEARMGASLLRLHFHDCFVNGCDGSVLLDGA-  62

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
               +GE++A  N NSIRG  VID+IK+QLE SC GVVSCADI+AVAARDSVVALGGPSW +
Sbjct  63    --SGEKTAPANNNSIRGFEVIDSIKSQLESSCAGVVSCADILAVAARDSVVALGGPSWTV  120

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAA+S      S    LIS FS+KGF+ +EMVALSG+HTIGQA+C+ F
Sbjct  121   QLGRRDSTTASFSAASSSLPSPFSDLSVLISNFSSKGFTTKEMVALSGAHTIGQARCTVF  180

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
              +RIYNE NIN +FAT LKANCP +GG NNLAPLD+TT T FDNAYFK+L +QKGLLHSD
Sbjct  181   ATRIYNETNINTAFATSLKANCPSTGG-NNLAPLDSTTRT-FDNAYFKDLLAQKGLLHSD  238

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDS V  YSSNP++F +DFA+AMVKM NLSPLTGT GQIR NCRK N
Sbjct  239   QQLFNGGSTDSQVRAYSSNPTSFRSDFASAMVKMGNLSPLTGTSGQIRTNCRKAN  293



>sp|P00434.3|PERP7_BRARR RecName: Full=Peroxidase P7; AltName: Full=TP7 [Brassica rapa 
subsp. rapa]
Length=296

 Score =   402 bits (1032),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/296 (67%), Positives = 248/296 (84%), Gaps = 3/296 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QL+ NFYST+CPN LS +++ V +AV+S+ RMGAS+LRL FHDCFVNGCD SILLDDT++
Sbjct  1     QLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSS  60

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGEQ+AGPN NS RG  VI++IK+ +EK+C GVVSCADI+A+AARDSVV LGGP+WN+ 
Sbjct  61    FTGEQNAGPNRNSARGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVK  120

Query  745   LGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             +GRRD+ TASQ+AANS    P +SLSQLIS+FS  G S R+MVALSG+HTIGQ++C  FR
Sbjct  121   VGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFR  180

Query  568   SRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             +R+YNE NINA+FATL + +CP++   GD NLAPLD  + TSFDN+YFKNL +Q+GLLHS
Sbjct  181   ARVYNETNINAAFATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHS  240

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQ LFNGGSTDSIV  YS++PS+F +DFA AM+KM ++SPLTG+ G+IRK C KTN
Sbjct  241   DQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  296



>ref|XP_002319968.2| peroxidase family protein [Populus trichocarpa]
 gb|EEE95891.2| peroxidase family protein [Populus trichocarpa]
 gb|AHL39178.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score =   403 bits (1035),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 237/298 (80%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CP     +++ V +AV+ E RMGASL+RL FHDCFV GCD SILL+DT+
Sbjct  28    AQLSTNFYSKSCPKVFGAVKSVVQSAVSKERRMGASLVRLFFHDCFVRGCDGSILLEDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+AGPN NS+RG NV+  IK+Q+EK C G+VSCADIVA+AARDS V LGGP WN+
Sbjct  88    SFTGEQTAGPNNNSVRGFNVVAKIKSQVEKVCPGIVSCADIVAIAARDSTVILGGPFWNV  147

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TAS SAANS     P  +LS LI+ F++KG S ++MVALSGSHTIGQA+C+ 
Sbjct  148   KLGRRDSKTASLSAANSGVIPPPTSTLSNLINRFNSKGLSVKDMVALSGSHTIGQARCTS  207

Query  574   FRSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR+RIYNE NI++SFAT  + NCP  G  GDN LAPLD  TPTSFDN Y+KNL SQKGLL
Sbjct  208   FRARIYNETNIDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTSFDNKYYKNLISQKGLL  267

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ LFNGGSTDS+V TYSSNP TF++DF  AM+KM ++ PLTG++G+IRK C K N
Sbjct  268   HSDQVLFNGGSTDSLVRTYSSNPKTFSSDFVTAMIKMGDIDPLTGSQGEIRKICSKRN  325



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score =   402 bits (1034),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 196/298 (66%), Positives = 239/298 (80%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYS +CP     +++AV +A+N E RMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  24    AQLSTGFYSKSCPKLYQTVKSAVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+ A PN+NS RG  VIDNIK+ +EK C GVVSCADI+AV ARDSVV LGGP+WN+
Sbjct  84    SFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWNV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TASQSAANS       +L++LIS+FS  G S ++MVALSG+HTIGQA+C+ F
Sbjct  144   KLGRRDSRTASQSAANSGIPPATSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTSF  203

Query  571   RSRIYNE-NNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R+RIYNE NN++ASFA   ++NCP+S   GDNNLAPLD  TP  FDN YFKNL  +KGLL
Sbjct  204   RARIYNETNNLDASFARTRQSNCPRSSGSGDNNLAPLDLQTPNKFDNNYFKNLVDKKGLL  263

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQLFNGGS DSIV +YS+NPS+F++DF  AM+KM ++ PLTG+ G+IRKNCR+ N
Sbjct  264   HSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDIRPLTGSNGEIRKNCRRLN  321



>ref|XP_010031113.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=331

 Score =   403 bits (1035),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS TCPN  + +++ V  A+N EARMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  35    AQLSTNFYSKTCPNVFTTVKSQVQAAINKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  94

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS RG +V+DNIK+ +EK C GVVSCAD++A+ ARDS V LGGPSWN+
Sbjct  95    TFTGEKNAAPNKNSARGFDVVDNIKSAVEKVCPGVVSCADLLAITARDSTVILGGPSWNV  154

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AAN+    P  +L+ LIS F N G S R+MVALSGSHTIGQA+C+ F
Sbjct  155   KVGRRDARTASQAAANNSIPPPTSNLNNLISFFQNVGLSTRDMVALSGSHTIGQARCTNF  214

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE N+++S A   ++NCP++   GDNNLAPLD  TPT FDN Y+KNL   KGLLH
Sbjct  215   RTRIYNETNLDSSLAKTRQSNCPRTVGSGDNNLAPLDLQTPTKFDNNYYKNLLQNKGLLH  274

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDS+V TY SNPSTF +DF   M+KM ++ PLTG+ G+IRKNCRK N
Sbjct  275   SDQQLFNGGSTDSLVRTYGSNPSTFTSDFVAGMIKMGDIKPLTGSSGEIRKNCRKIN  331



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 240/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYS +CPN L+ + + V +A+N E+RMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  26    AQLTTNFYSKSCPNLLTTVNSVVQSAINKESRMGASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN  S+RG  VID IK+ +EK+C GVVSCADI+ + ARDSVV LGGP+WN+
Sbjct  86    SFTGEKTALPNSGSVRGFEVIDQIKSAVEKACPGVVSCADILTITARDSVVILGGPTWNV  145

Query  748   LLGRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TAS++AAN+       SLSQL+S+FSN+G S  +MVAL+G HTIGQA+C+ F
Sbjct  146   KLGRRDARTASRTAANNNIPQPNFSLSQLMSSFSNQGLSTTDMVALAGGHTIGQARCTSF  205

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE+NI+ASFA   +ANCP+S   G NNLAPLD  TP SFDN Y+KNL SQKGLLH
Sbjct  206   RTRIYNESNIDASFAKTRQANCPRSSNSGSNNLAPLDLQTPNSFDNKYYKNLVSQKGLLH  265

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLF+GGST+S+V TY SNPS F  DF  AM+KM ++ PLTG+ G++RKNCRKTN
Sbjct  266   SDQQLFSGGSTNSLVQTYGSNPSRFNADFIAAMIKMGDIKPLTGSNGEVRKNCRKTN  322



>emb|CDX70158.1| BnaA10g25070D [Brassica napus]
Length=325

 Score =   402 bits (1033),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 247/297 (83%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +++ V +AV+S+ R GAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIKT +E +C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AAN+    P  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  149   KVGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  208

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+R+YNE NINA+FATL + +CP++   GD NLAPLD  +  +FDN+YFKNL +Q+GLLH
Sbjct  209   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLH  268

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDSIV  YS+NPS+F++DF  AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  269   SDQELFNGGSTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>gb|ACT35473.1| peroxidase 52, partial [Brassica rapa]
Length=306

 Score =   401 bits (1031),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 247/297 (83%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +++ V +AV+S+ R GAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  10    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  69

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIKT +E +C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  70    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  129

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AAN+    P  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  130   KVGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  189

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+R+YNE NINA+FATL + +CP++   GD NLAPLD  +  +FDN+YFKNL +Q+GLLH
Sbjct  190   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLH  249

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDSIV  YS+NPS+F++DF  AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  250   SDQELFNGGSTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  306



>ref|XP_002269918.1| PREDICTED: peroxidase 4 [Vitis vinifera]
 sp|A7NY33.1|PER4_VITVI RecName: Full=Peroxidase 4; Flags: Precursor [Vitis vinifera]
 emb|CBI15844.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 237/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS TCP     +++ V +AV+ E RMGASLLRL FHDCFVNGCDAS+LLDDT+
Sbjct  25    AQLSTNFYSKTCPKVFDTVKSGVQSAVSKERRMGASLLRLFFHDCFVNGCDASVLLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NSIRGLNVIDNIK+Q+E  C GVVSCADI+A+AARDSVV LGGP W++
Sbjct  85    SFTGEQTAVPNKNSIRGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILGGPDWDV  144

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TAS S AN+    P  SLS LIS F  +G S R+MVALSG+HTIGQA+C+ F
Sbjct  145   KLGRRDSKTASLSGANNNIPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTIGQARCTSF  204

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NI++SFA   +A+CP +   GDNNLAPLD  TPT+FDN Y+KNL +QKGLLH
Sbjct  205   RARIYNETNIDSSFAKTRQASCPSASGSGDNNLAPLDLQTPTTFDNYYYKNLINQKGLLH  264

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ L+NGGSTDS V TY +NP TF +DF   M+KM +++PLTG++G+IRK+C K N
Sbjct  265   SDQVLYNGGSTDSTVKTYVNNPKTFTSDFVAGMIKMGDITPLTGSEGEIRKSCGKVN  321



>gb|KEH34417.1| cationic peroxidase [Medicago truncatula]
Length=323

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 212/295 (72%), Positives = 248/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS++FY TTCP ALSII +AV +AV+ E RMGASLLRLHFHDCFVNGCDAS+LLDDT+
Sbjct  29    AQLSSDFYGTTCPKALSIINSAVCSAVSKEHRMGASLLRLHFHDCFVNGCDASVLLDDTS  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SAG N+NS+RG  VIDNIKTQLE +C GVVSCADIVA AARD+VVALGGPSW++
Sbjct  89    SFTGEKSAGANVNSLRGFYVIDNIKTQLETACPGVVSCADIVAAAARDAVVALGGPSWSV  148

Query  748   LLGRRDSTTASQ-SAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS+ +A N +P P + LS LIS FSNKGF+ +EMV LSG+HT GQA+C  F
Sbjct  149   GLGRRDSTTASKDTATNDIPSPLMDLSDLISAFSNKGFTTKEMVVLSGAHTTGQARCQLF  208

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYNE  I+++FAT +K+NCP +GGD+NL  LD TT   FDNAYFKNL ++KGLLHSD
Sbjct  209   RGRIYNETIIDSNFATSVKSNCPSTGGDSNLTSLDVTTNVLFDNAYFKNLVNKKGLLHSD  268

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS V  YS++PSTF TDFA+AMVKM NLSPLTG  GQIR NCRK N
Sbjct  269   QQLFSGGSTDSQVTAYSTSPSTFYTDFASAMVKMGNLSPLTGNNGQIRTNCRKVN  323



>ref|NP_001057822.1| Os06g0547400 [Oryza sativa Japonica Group]
 dbj|BAD54122.1| putative bacterial-induced peroxidase precursor [Oryza sativa 
Japonica Group]
 tpe|CAH69328.1| TPA: class III peroxidase 86 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF19736.1| Os06g0547400 [Oryza sativa Japonica Group]
 gb|EEC80780.1| hypothetical protein OsI_23305 [Oryza sativa Indica Group]
 gb|EEE65851.1| hypothetical protein OsJ_21628 [Oryza sativa Japonica Group]
Length=324

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 234/294 (80%), Gaps = 1/294 (0%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLS NFYS TCPN  +I+++ +A+AV +E RMGAS+LRL FHDCFVNGCD SILLDDT+ 
Sbjct  31    QLSPNFYSRTCPNLATIVRSGMASAVRTEPRMGASILRLFFHDCFVNGCDGSILLDDTST  90

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGE+SAGPN NS RG  VID IKTQ+E SC   VSCADI+A+AARD V  LGGP+W++ 
Sbjct  91    FTGEKSAGPNANSARGFEVIDAIKTQVEASCKATVSCADILALAARDGVNLLGGPTWSVA  150

Query  745   LGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGR+DS TASQSAANS     G SL+ LIS F N+G SAR+M ALSG+HTIG+A+C FFR
Sbjct  151   LGRKDSRTASQSAANSNLPGPGSSLATLISMFGNQGLSARDMTALSGAHTIGRAQCQFFR  210

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             SRIY E NINASFA+L +  CP+SGGD NLAP D  TP +FDNAY++NL SQ+GLLHSDQ
Sbjct  211   SRIYTERNINASFASLRQQTCPRSGGDANLAPFDVQTPDAFDNAYYQNLVSQRGLLHSDQ  270

Query  388   QLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +LFNGGS D +V  YS+NPS F++DF +AMVKM NL P +GT  ++R NCRK N
Sbjct  271   ELFNGGSQDGLVRQYSTNPSQFSSDFVSAMVKMGNLLPSSGTATEVRLNCRKVN  324



>ref|XP_002450134.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
 gb|EES09122.1| hypothetical protein SORBIDRAFT_05g001030 [Sorghum bicolor]
Length=317

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 233/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             +QL+ANFY  +CPNAL  IQTAV +AV  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  23    SQLNANFYDKSCPNALYTIQTAVRSAVARENRMGASLLRLHFHDCFVNGCDGSVLLDDTP  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VID+IK QLE+ C  VVSCADIVAVAARDSVVALGGP+W +
Sbjct  83    TFTGEKTAVPNNNSLRGFDVIDSIKAQLERICPQVVSCADIVAVAARDSVVALGGPTWAV  142

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TAS  AAN+      L L+ L  +FSNKG SA +M+ALSG HTIGQA+C  F
Sbjct  143   NLGRRDSLTASLDAANNDIPAPTLDLTDLTKSFSNKGLSASDMIALSGGHTIGQARCVNF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIY+E NI+ S AT LK NCP   GDNN++PLD +TP  FDN Y+KNL ++KG+LHSD
Sbjct  203   RDRIYSEANIDTSLATSLKTNCPNKTGDNNISPLDASTPYVFDNFYYKNLLNKKGVLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGS DS   TYSSN + F TDF+ AM+KMSN+SPLTG+ GQIRKNCR+ N
Sbjct  263   QQLFNGGSADSQTTTYSSNMAKFFTDFSTAMLKMSNISPLTGSSGQIRKNCRRVN  317



>gb|ACM47317.1| peroxidase [Capsicum annuum]
Length=324

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/298 (66%), Positives = 240/298 (81%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CP     +++ V +A+N E RMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  27    AQLSTNFYSKSCPKLFQTVKSTVQSAINRETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  86

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+ A PN+NS+RG  VIDNIK+ +EK+C GVVSCADI+A+ ARDSVV LGGP+WN+
Sbjct  87    SFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPNWNV  146

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ AANS    P  +L+QLIS+FS  G S  +MVALSG+HTIGQA+C+ F
Sbjct  147   KLGRRDARTASQGAANSSIPPPTSNLNQLISSFSAVGLSTTDMVALSGAHTIGQARCTSF  206

Query  571   RSRIYNE-NNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R+RIYNE NNI++SFAT  + NCP++   GDNNLAPLD  TPT FDN YFKNL S++GLL
Sbjct  207   RARIYNETNNIDSSFATTRQRNCPRNSGSGDNNLAPLDLQTPTKFDNNYFKNLVSKRGLL  266

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQLFNGGS DSIV +YS+NPS+F++DF  AM+KM +  PLTG+ G+IRKNCR  N
Sbjct  267   HSDQQLFNGGSADSIVTSYSNNPSSFSSDFVTAMIKMGDNRPLTGSNGEIRKNCRTRN  324



>ref|XP_009122142.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Brassica rapa]
Length=325

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/297 (66%), Positives = 246/297 (83%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +++ V +AV+S+ R GAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIKT +E +C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AAN+    P  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  149   KVGRRDARTASQAAANNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  208

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+R+YNE NINA+FATL + +CP++   GD NLAPLD  +  +FDN+YFKNL +Q+GLLH
Sbjct  209   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLH  268

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGG TDSIV  YS+NPS+F++DF  AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  269   SDQELFNGGXTDSIVTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>ref|XP_008385017.1| PREDICTED: cationic peroxidase 1-like [Malus domestica]
Length=319

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 205/296 (69%), Positives = 242/296 (82%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+N+YSTTCP  LSI++ AV NAV  E RMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  24    AQLSSNYYSTTCPRTLSIVRNAVVNAVVKEHRMGASLLRLHFHDCFVNGCDASVLLDDTA  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN NS+RG   ID IK+QLE +C GVVSCADI+A+AARDSVV+LGGPSW +
Sbjct  84    NFTGEKTAPPNTNSLRGFEXIDTIKSQLEGACPGVVSCADILAIAARDSVVSLGGPSWTV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS SAA S    P L+L+ LI++FS KGF+ +E+VALSGSHT GQA+C  F
Sbjct  144   QLGRRDSTTASLSAATSELPSPSLNLNDLITSFSTKGFTTKELVALSGSHTTGQARCLVF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGG-DNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             R RI+NE NI++SFAT LK+NC  S G D+NL+ LD T+P  FDNAY KNL + KGL+HS
Sbjct  204   RERIHNETNIDSSFATSLKSNCTASSGTDDNLSSLDVTSPFIFDNAYXKNLVNSKGLMHS  263

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLF+GGSTDS+V TYS+   TF TDFANAM+KM +LSPLTG  GQ+R NCRK N
Sbjct  264   DQQLFSGGSTDSLVKTYSTTAETFYTDFANAMLKMGSLSPLTGKSGQVRTNCRKIN  319



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 193/297 (65%), Positives = 244/297 (82%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY T+CP  LS +++++ +A++ E R+GASLLRL FHDCFVNGCD SILLDDT+
Sbjct  24    AQLSTNFYYTSCPKLLSTVKSSMQSAISKETRIGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG  VID+IK+ +EK C GVVSCADI+A+AARDSV  LGGP+W++
Sbjct  84    SFTGEKNANPNRNSARGYEVIDSIKSAVEKVCPGVVSCADILAIAARDSVGILGGPTWDV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQSAANS    P  +L+QLIS FS  G S ++MVALSG HTIGQ++C+ F
Sbjct  144   KLGRRDARTASQSAANSAIPPPTSNLNQLISKFSAVGLSTKDMVALSGGHTIGQSRCTSF  203

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE+NI+ SFA   +++CP++   GDNNLAPLD  TPTSFDN YFKNL  +KGLLH
Sbjct  204   RARIYNESNIDTSFARTRQSSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  YS+NPS+F++DF  AM+KM +++PLTG+KG++RKNCR+ N
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPSSFSSDFVTAMIKMGDITPLTGSKGEVRKNCRRIN  320



>ref|XP_006468162.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
 gb|KDO41521.1| hypothetical protein CISIN_1g020615mg [Citrus sinensis]
Length=323

 Score =   400 bits (1028),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 196/298 (66%), Positives = 242/298 (81%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS TCP  L+ +++AV +AV+ E RMGASLLRLHFHDCFVNGCD SILLDDT+
Sbjct  26    AQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+++GPNINS RG  V+D+IK+++EK C GVVSCADI+A+AAR SV  LGGPSWN+
Sbjct  86    SFTGEKTSGPNINSARGFEVVDDIKSKVEKVCPGVVSCADILAIAARHSVAILGGPSWNV  145

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TAS +AANS     P  +LS LI+ F  KG SA++MVALSG+HTIGQA+C  
Sbjct  146   KLGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQARCVA  205

Query  574   FRSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR+RIYNE+NI +SFA   + NCP++   GDNNLAPLD  +P  FDN Y+K+L +QKGLL
Sbjct  206   FRNRIYNESNIESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYKHLLNQKGLL  265

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ LFNGGSTDS+V+TY+SN  TF +DFA AM+KM ++SPLTG+ G+IRKNCR+ N
Sbjct  266   HSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGEIRKNCRRPN  323



>ref|XP_004977590.1| PREDICTED: cationic peroxidase 1-like [Setaria italica]
Length=317

 Score =   400 bits (1027),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 232/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ANFY  +CPNAL  IQTAV +AV  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  23    AQLTANFYDKSCPNALYTIQTAVKSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTP  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NSIRG +VID+IK Q+E  C  VVSCADI+AVAARDSVV LGGP+W +
Sbjct  83    TFTGEKTAVPNNNSIRGFDVIDSIKAQIEGICPQVVSCADILAVAARDSVVTLGGPTWVV  142

Query  748   LLGRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS  AAN+        LS L  +FSNKG +A +M+ALSG HTIGQA+C  F
Sbjct  143   NLGRRDSTTASLDAANNDIPKPTFDLSDLTKSFSNKGLTATDMIALSGGHTIGQARCVNF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIY+E NI+ S AT LK+NCP   GDNN++PLD +TP  FDN Y+KNL ++KG+LHSD
Sbjct  203   RNRIYSEANIDTSLATSLKSNCPNKTGDNNISPLDASTPYVFDNFYYKNLLNKKGVLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGS DS   TYSSN + F TDF+ AMVKM N+SPLTG+ GQIRKNCRK N
Sbjct  263   QQLFNGGSADSQTTTYSSNMAKFFTDFSAAMVKMGNISPLTGSSGQIRKNCRKVN  317



>ref|XP_010045407.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   400 bits (1027),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 196/298 (66%), Positives = 239/298 (80%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CPN LS  ++ V +AV+ E RMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  26    AQLSTNFYSKSCPNVLSTAKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +F GE++AGPN NS+RG NVID IK+++E +C GVVSCADIVA+AARDSVV LGGPSW +
Sbjct  86    SFQGEKTAGPNQNSVRGYNVIDQIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEV  145

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRD+ TAS S ANS     P  +LS LIS F  +G S R+MVALSGSHTIGQA+C  
Sbjct  146   KLGRRDARTASLSRANSGVIPPPTSTLSNLISRFKAQGLSTRDMVALSGSHTIGQARCIS  205

Query  574   FRSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR RIYN++NI++SF+   +  CP++   GDNNL+PLD  +PT+FDNAYFKNL S KGLL
Sbjct  206   FRPRIYNDSNIDSSFSKTRQGKCPRTAGSGDNNLSPLDLQSPTAFDNAYFKNLLSNKGLL  265

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ+LFNGG+TDS+V TYS+NP TF +DFA+AM+KM ++ PLTG+KG+IRK C K N
Sbjct  266   HSDQELFNGGTTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICSKIN  323



>ref|XP_003634480.1| PREDICTED: cationic peroxidase 1 [Vitis vinifera]
Length=318

 Score =   400 bits (1027),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 202/293 (69%), Positives = 236/293 (81%), Gaps = 2/293 (1%)
 Frame = -1

Query  1102  LSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANF  923
             LS NFY+ +CP AL  I+TAV  AV  E RMGASLLRLHFHDCFV GCDASILLDDTA F
Sbjct  25    LSPNFYARSCPRALPTIRTAVNKAVAKEKRMGASLLRLHFHDCFVLGCDASILLDDTATF  84

Query  922   TGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLL  743
             TGE++AGPN NS+RG  VID IK+Q+E  C GVVSCADIVAVAARDSVVALGGP+W + L
Sbjct  85    TGEKTAGPNNNSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPTWTVRL  144

Query  742   GRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRS  566
             GRRDSTTAS SAA +   GP L+LSQLIS FS KG + +EMV LSG+HTIG+A+C+ FR+
Sbjct  145   GRRDSTTASFSAARTDLPGPNLNLSQLISAFSKKGLTTKEMVVLSGTHTIGKARCTSFRN  204

Query  565   RIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQ  386
              IYN+ +I+ +FA   +  CP+SGGD+NL+PLD TT T FDN YF+ L+ +KGLLHSDQ+
Sbjct  205   HIYNDTDIDPAFAASKQKICPRSGGDDNLSPLDGTT-TVFDNVYFRGLKEKKGLLHSDQE  263

Query  385   LFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             L+NGGSTDSIV TYS N +TF  D ANAMVKM N+SPLTGT GQIR NCRK N
Sbjct  264   LYNGGSTDSIVETYSINTATFFRDVANAMVKMGNISPLTGTNGQIRTNCRKVN  316



>emb|CDX98835.1| BnaC09g50000D [Brassica napus]
Length=325

 Score =   399 bits (1026),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 246/297 (83%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +++ V +AV+S+ R GAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  29    AQLTTNFYSTSCPNLLSTVRSTVKSAVDSQPRTGASILRLFFHDCFVNGCDGSILLDDTS  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIKT +E +C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  89    SFTGEQNANPNRNSARGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNV  148

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS    P  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  149   KVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNF  208

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+R+YNE NINA+FATL + +CP++   GD NLAPLD  +   FDN+YFKNL +Q+GLLH
Sbjct  209   RTRVYNETNINAAFATLRQRSCPRAAGSGDGNLAPLDVNSANFFDNSYFKNLVAQRGLLH  268

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDSIV  YS+NP++F++DF  AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  269   SDQELFNGGSTDSIVTGYSNNPASFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>ref|XP_003523269.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=320

 Score =   399 bits (1025),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 238/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY  +CPN  S +++ V +A++ E RMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  24    AQLSTNFYYHSCPNLFSSVKSTVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG  VIDNIK+ +EK C GVVSCADI+A+AARDSV  LGGP+WN+
Sbjct  84    SFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPTWNV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQSAAN+    P  +L+QLIS FS  G S +++VALSG HTIGQA+C+ F
Sbjct  144   KLGRRDARTASQSAANNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNF  203

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NI  +FA   + +CP++   GDNNLAPLD  TPTSFDN YFKNL  +KGLLH
Sbjct  204   RARIYNETNIETAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  YS+NP TF++DFA AM+KM ++SPLTG+ G+IRKNCR+ N
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPGTFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN  320



>gb|ABR18139.1| unknown [Picea sitchensis]
Length=327

 Score =   399 bits (1025),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 202/339 (60%), Positives = 246/339 (73%), Gaps = 17/339 (5%)
 Frame = -1

Query  1240  LIPFLFSSSIRSHLCTSFTAAMAASAVPstfrfsfllllfsltSAQLSANFYSTTCPNAL  1061
             ++ F  +  IR  +C S    + +++V                  QL  +FY  +CPN L
Sbjct  5     VMAFFSTMGIRIAVCISLLVIVCSTSV----------------YGQLCPDFYDKSCPNVL  48

Query  1060  SIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEQSAGPNINSIR  881
             SI+ + V  AV  E RMGASLLRLHFHDCFVNGCD SILLDDT+ FTGE++A PN NS+R
Sbjct  49    SIVNSVVMQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTSTFTGEKTANPNNNSVR  108

Query  880   GLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLLGRRDSTTASQSAAN  701
             G +VID IKTQ+E +C GVVSCADIVA+AARDSVV LGGP+W ++LGRRDST+AS+SAAN
Sbjct  109   GFDVIDTIKTQVEATCSGVVSCADIVAIAARDSVVQLGGPTWTVMLGRRDSTSASKSAAN  168

Query  700   slp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRSRIYNENNINASFAT  524
             +    P  +LS LIS F  +G +  +MVALSGSHTIGQA+C+ FR+RIYNE+NI   FA 
Sbjct  169   NNIPPPTSNLSALISFFQAQGLTTEDMVALSGSHTIGQARCTNFRNRIYNESNIALLFAG  228

Query  523   LLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQLFNGGSTDSIVNTY  344
             L KANCP +GGDNNLAPLD  TPT+FDN+Y+ NLQ Q GLLHSDQQLF GGSTD+ V+ Y
Sbjct  229   LRKANCPVTGGDNNLAPLDLFTPTAFDNSYYNNLQFQNGLLHSDQQLFKGGSTDNRVSFY  288

Query  343   SSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             + +P  F  DFA AMVKM N+ PLT   G+IRKNCRK N
Sbjct  289   AVHPDAFFNDFAAAMVKMGNIKPLTVNNGEIRKNCRKIN  327



>ref|XP_003623564.1| Peroxidase [Medicago truncatula]
 gb|AES79782.1| cationic peroxidase [Medicago truncatula]
Length=316

 Score =   398 bits (1023),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFY  TCP  LS I+  V +A+ +E RMGASLLRLHFHDCFV GCDAS+LLDDT+
Sbjct  22    AQLSSNFYFRTCPLVLSTIKKEVISALINERRMGASLLRLHFHDCFVQGCDASVLLDDTS  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +F GE++AGPN NS+RG +VID IK+++EK C   VSCADI+AVAARDSVVALGG SW +
Sbjct  82    SFRGEKTAGPNANSLRGFDVIDKIKSEVEKLCPNTVSCADILAVAARDSVVALGGLSWTV  141

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS   ANS      S    LI+ F+NKGF+ +EMVALSGSHTIG+A C FF
Sbjct  142   QLGRRDSTTASFGLANSDLPGPGSDLSGLINAFNNKGFTPKEMVALSGSHTIGEASCRFF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNENNI++SFA  L+++CP++GGD NL+PLDTT+P +FDNAYFKNLQ+QKGL HSD
Sbjct  202   RTRIYNENNIDSSFANSLQSSCPRTGGDLNLSPLDTTSPNTFDNAYFKNLQNQKGLFHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LF+  +T S VN+Y  NP +F  DFANAM KM+NL PLTG+ GQ+RKNCR  N
Sbjct  262   QVLFDEVTTKSQVNSYVRNPLSFKVDFANAMFKMANLGPLTGSSGQVRKNCRSVN  316



>gb|AAP76387.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   399 bits (1025),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 242/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CPN LS +++ V +A+N EARMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  34    AQLSTNFYSKSCPNLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  93

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +V+DNIK+ +E  C GVVSCADI+A+AARDSV  LGGP W +
Sbjct  94    SFTGEKNANPNRNSSRGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVEILGGPKWAV  153

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ +ASQSAAN+    P  +L++L S F+  G S R++VALSG+HTIGQA+C+ F
Sbjct  154   KLGRRDARSASQSAANNGIPPPTSNLNRLTSRFNALGLSTRDLVALSGAHTIGQARCTSF  213

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE+NI+ASFA   + NCP++   GDNNLAPLD  TPTSFDN YFKNL SQ+GLLH
Sbjct  214   RARIYNESNIDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLISQRGLLH  273

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  Y ++PS+F +DF  AM+KM ++SPLTG++G+IRKNCR+ N
Sbjct  274   SDQQLFNGGSTDSIVRGYGNSPSSFNSDFVAAMIKMGDISPLTGSRGEIRKNCRRVN  330



>ref|XP_010264471.1| PREDICTED: cationic peroxidase 1-like [Nelumbo nucifera]
Length=320

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/293 (70%), Positives = 238/293 (81%), Gaps = 1/293 (0%)
 Frame = -1

Query  1102  LSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANF  923
             LS  FY T+CP ALS I+TAV  AV +EARMGASLLRLHFHDCFVNGCDASILL D A F
Sbjct  28    LSPTFYDTSCPTALSTIKTAVDAAVAAEARMGASLLRLHFHDCFVNGCDASILLVDNATF  87

Query  922   TGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLL  743
             TGEQ+A PN NS+RG  VI++IK+QLE  C  VVSCADI+AVAARDSVV+LGG SW + L
Sbjct  88    TGEQTAPPNNNSVRGFEVINSIKSQLESICPSVVSCADILAVAARDSVVSLGGASWTVQL  147

Query  742   GRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRS  566
             GRRDSTTA+ + AN+      L+L+ LI+ F+NKGF+  EM ALSGSHTIGQA+CS FR 
Sbjct  148   GRRDSTTANLTGANTDLPSPSLNLTDLITAFANKGFTTGEMAALSGSHTIGQARCSVFRD  207

Query  565   RIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQ  386
             RIYNE NIN+++A  L+ANCP+S GD+NL+PLDTTTP  FDNAYF NL + KGLLHSDQQ
Sbjct  208   RIYNETNINSTYAASLQANCPRSDGDDNLSPLDTTTPNVFDNAYFTNLLNMKGLLHSDQQ  267

Query  385   LFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             LF+ GSTDS+V TYS+N +TF TDFANAMVKM NLSPLTGT G+IR NC + N
Sbjct  268   LFSNGSTDSLVTTYSTNAATFLTDFANAMVKMGNLSPLTGTSGEIRTNCSRVN  320



>ref|XP_006288218.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
 gb|EOA21116.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
Length=324

 Score =   399 bits (1024),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/297 (69%), Positives = 247/297 (83%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFY+T+CPN LS +Q AV +AVNSE RMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  28    AQLTTNFYATSCPNLLSTVQAAVKSAVNSERRMGASILRLFFHDCFVNGCDGSILLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS RG NVIDNIK+ +EK+C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  88    SFTGEQNANPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNV  147

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS   GP  SLSQLIS+FS  G S R+MVALSG+HTIGQ++C+ F
Sbjct  148   KVGRRDARTASQAAANSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSF  207

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NINA+FAT  +  CP++   GD NLAPLD TT  SFDN YFKNL +Q+GLLH
Sbjct  208   RARIYNETNINAAFATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQRGLLH  267

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ LFNGGSTDSIV  YSSNPS+F++DF  AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  268   SDQVLFNGGSTDSIVRGYSSNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>tpe|CAH69378.1| TPA: class III peroxidase 136 precursor [Oryza sativa Japonica 
Group]
Length=317

 Score =   398 bits (1022),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLSANFY  +CPNAL  I+ AV +A+  E RMGASLLRLHFHDCFVNGCD S+LLDDT 
Sbjct  23    AQLSANFYDKSCPNALPTIRIAVRSAIARENRMGASLLRLHFHDCFVNGCDGSVLLDDTP  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VIDNIK  +E  C  VVSCADI+AVAAR+SVVALGGP+W +
Sbjct  83    TFTGEKTAAPNNNSLRGFDVIDNIKAHIEGICPQVVSCADILAVAARESVVALGGPTWVV  142

Query  748   LLGRRDSTTAS-QSAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS  +A N +P P   L  L  +FSNKG SA +M+ALSG+HTIGQA+C  F
Sbjct  143   QLGRRDSTTASLDTANNDIPAPTFDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNF  202

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIY+E NI+ S AT LK+NCP + GDNN++PLD +TP +FDN Y+KNL ++KG+LHSD
Sbjct  203   RNRIYSETNIDTSLATSLKSNCPNTTGDNNISPLDASTPYAFDNFYYKNLLNKKGVLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGS DS   TYSSN +TF TDF+ AMVKM N++P+TG+ GQIRKNCRK N
Sbjct  263   QQLFNGGSADSQTTTYSSNMATFFTDFSAAMVKMGNINPITGSSGQIRKNCRKVN  317



>ref|XP_009410539.1| PREDICTED: cationic peroxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=316

 Score =   397 bits (1021),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 248/295 (84%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY+T+CP+ALS IQ+ VA AV +E+RMGASLLRLHFHDCFVNGCD S+LLDDTA
Sbjct  22    AQLSPTFYNTSCPDALSTIQSVVATAVANESRMGASLLRLHFHDCFVNGCDGSVLLDDTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN+NSIRG +V+D+IK+Q+E  C  VVSCADI+AVAARDSVVALGGPS+ +
Sbjct  82    NFTGEKNAFPNLNSIRGFDVVDSIKSQVEAICEQVVSCADILAVAARDSVVALGGPSYTV  141

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+TTAS+SAANS   P  LSLS L+S+FS+KG S+ +MVALSG+HTIG AKCS +
Sbjct  142   QLGRRDATTASRSAANSNLPPPTLSLSGLLSSFSSKGLSSTDMVALSGAHTIGSAKCSSY  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE NINASFA   +ANCP SGG NNL+PLD  TPT FDN+YF+NL S+KGLLHSD
Sbjct  202   RNRIYNEANINASFANSTQANCPSSGGYNNLSPLDAVTPTVFDNSYFQNLVSKKGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL+NGGSTDS+V TYS +   F +DFA AMV M N+SPLTGT G+IR NCRK N
Sbjct  262   QQLYNGGSTDSLVTTYSEDTDAFFSDFATAMVNMGNISPLTGTDGEIRLNCRKIN  316



>gb|AFR44628.1| class III secretory peroxidase [Ginkgo biloba]
 gb|AGN03453.1| class III peroxidase [Ginkgo biloba]
Length=316

 Score =   397 bits (1021),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 233/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS  FY+ +CPN LS +++AV  AV  EARMGASLLRLHFHDCFVNGCD SILLDD++
Sbjct  22    GQLSPTFYAKSCPNVLSTVKSAVKQAVAKEARMGASLLRLHFHDCFVNGCDGSILLDDSS  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
               TGE++A PN NS RG +VIDNIK+Q+E  C GVVSCADI+ +AARDSVV LGGPSW +
Sbjct  82    TLTGEKTAVPNANSARGFDVIDNIKSQVEAVCSGVVSCADILTIAARDSVVELGGPSWAV  141

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TAS S AN+   P   SL+ L+S F  +G S ++MVAL+G HTIGQA+C+ F
Sbjct  142   PLGRRDSRTASLSGANNNIPPPTSSLANLMSKFQAQGLSTKDMVALAGGHTIGQARCTSF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+ IYN+ NI+ ++A  LKA CP++G DNN++PLD  TPTSFDN YFKNL+++KGLLHSD
Sbjct  202   RAHIYNDTNIDTTYANSLKAKCPRTGSDNNISPLDVVTPTSFDNNYFKNLRAKKGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGSTDS V +Y ++P TF  DFA +MVKM N+ PLTGT G+IRKNCRK N
Sbjct  262   QELFNGGSTDSQVTSYVTSPITFRNDFATSMVKMGNIKPLTGTNGEIRKNCRKPN  316



>ref|XP_010683552.1| PREDICTED: cationic peroxidase 1-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   398 bits (1022),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 206/297 (69%), Positives = 251/297 (85%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FYS++CPN LS IQ+AV +A+++E+RMGASLLRLHFHDCFVNGCD SILLDD A
Sbjct  31    AQLSSTFYSSSCPNVLSTIQSAVQSAIDTESRMGASLLRLHFHDCFVNGCDGSILLDDNA  90

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN+NS+RG +VID IK+Q+E  C GVVSCADI+AVAARDSVVALGG SW +
Sbjct  91    TFTGEKTALPNVNSVRGYDVIDTIKSQVENVCPGVVSCADILAVAARDSVVALGGQSWTV  150

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S ANS    P L LSQL+ +F+N+GF+ +E+V LSG+HTIGQA+C+ F
Sbjct  151   QLGRRDSTTASLSTANSNIPAPTLDLSQLLDSFNNQGFTPQELVVLSGAHTIGQARCTTF  210

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RSRIYNE NIN++FAT L+ANCP +GGDNNL+PLD T+PT+FDNAYF +L S +GLLHSD
Sbjct  211   RSRIYNETNINSTFATSLQANCPSNGGDNNLSPLDQTSPTTFDNAYFTHLTSLQGLLHSD  270

Query  391   QQLF--NGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF  NGGSTDS V +YSS+ STF +DFA+AMVKM NL+ +TGT G++R NCR TN
Sbjct  271   QQLFSGNGGSTDSHVTSYSSSSSTFLSDFADAMVKMGNLNVVTGTNGEVRTNCRVTN  327



>gb|ACU17608.1| unknown [Glycine max]
Length=320

 Score =   397 bits (1021),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/297 (66%), Positives = 237/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY  +CPN  S +++AV +A++ E RMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  24    AQLSTNFYYHSCPNLFSSVKSAVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG  VIDNIK+ +EK C GVVSCADI+A+AARDSV  LGGP+WN+
Sbjct  84    SFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPTWNV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQSAAN+    P  +L+QLIS FS  G S +++VALSG HTIGQA+C+ F
Sbjct  144   KLGRRDARTASQSAANNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNF  203

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NI  +FA   + +CP++   GDNNLAPLD  TPTSFDN YFKNL  +KG LH
Sbjct  204   RARIYNETNIGTAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGFLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  YS+NP TF +DFA AM+KM ++SPLTG+ G++RKNCR+ N
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPGTFPSDFAAAMIKMGDISPLTGSNGEVRKNCRRIN  320



>gb|EYU41993.1| hypothetical protein MIMGU_mgv1a010225mg [Erythranthe guttata]
Length=318

 Score =   397 bits (1019),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYSTTCPN L+II+TAV  AVN++ RMGASLLRLHFHDCFV GCD S+LLDD  
Sbjct  24    AQLSPNFYSTTCPNLLTIIRTAVNTAVNNDPRMGASLLRLHFHDCFVQGCDGSVLLDDVT  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VID IKTQ+E +C G+VSCADI+ VAARD  VA  GPSW L
Sbjct  84    GFTGEKTAAPNANSLRGFDVIDTIKTQVEAACPGIVSCADILTVAARDGTVARSGPSWAL  143

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS + AN      G SL+ LI++FSNKGF+ REMVALSGSHTIG A+CS F
Sbjct  144   SLGRRDSTTASLTGANGQLPGPGSSLNNLITSFSNKGFTTREMVALSGSHTIGLARCSTF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN  NI+ +FAT  +ANCP +GG+NNLAPLDT +PT+F+N Y+ NL + +GLL+SD
Sbjct  204   RNRIYNAANIDPAFATTRRANCPPTGGNNNLAPLDTLSPTTFNNDYYTNLVNLRGLLNSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LFN G+TD+ V  YS+N ++F  DFA AMVKMSNL+PLTGT GQIR+NCR  N
Sbjct  264   QVLFNNGTTDAQVRAYSTNSASFFNDFAAAMVKMSNLTPLTGTNGQIRRNCRLRN  318



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score =   397 bits (1020),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 240/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS +FYS +CPN  S I+  V +A+N E RMGASL+RL FHDCFVNGCD S+LLDDT+
Sbjct  29    AQLSTSFYSKSCPNLFSTIKPVVQSAINKEKRMGASLVRLFFHDCFVNGCDGSVLLDDTS  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG  VID+IK+ +EK+C GVVSCADI+AVAARDS V LGGP+WN+
Sbjct  89    SFTGEKTALPNRNSARGFEVIDSIKSAVEKACPGVVSCADILAVAARDSTVILGGPTWNV  148

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TAS SAAN+    P  +L+QLIS F+  G S R++VAL+GSHTIGQA+C+ F
Sbjct  149   KLGRRDARTASLSAANNGIPPPTSNLNQLISRFNALGLSTRDLVALTGSHTIGQARCTSF  208

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NI+ SFA   ++NCP++   GDNNLAPLD  TPTSFDN YFKNL +QKGLLH
Sbjct  209   RARIYNETNIDNSFAQTRRSNCPRTNGTGDNNLAPLDLQTPTSFDNNYFKNLLNQKGLLH  268

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV TYS+  STF +DF   M+KM ++SPLTG++G+IRKNCR+ N
Sbjct  269   SDQQLFNGGSTDSIVRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKNCRRMN  325



>gb|KHG18057.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=322

 Score =   397 bits (1019),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 241/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CP  LS +++ V +A+N EARMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  26    AQLSTNFYSKSCPKLLSTVKSTVTSAINKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +V+DNIK+ +E  C GVVSCADI+A+ ARDSV  LGGP W +
Sbjct  86    SFTGEKNAIPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAITARDSVEILGGPKWAV  145

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ +ASQSAAN+    P  +L+QL S F+  G S R++VALSG+HTIGQA+C+ F
Sbjct  146   KLGRRDARSASQSAANNGIPAPTSNLNQLTSRFNALGLSTRDLVALSGAHTIGQARCTSF  205

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE+NI+ASFA   + NCP++   GDNNLAPLD  TPTSFDN YFKNL S++GLLH
Sbjct  206   RARIYNESNIDASFAQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLVSRRGLLH  265

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  Y ++PS+F +DF +AM+KM ++SPLTG++G+IRKNCR+ N
Sbjct  266   SDQQLFNGGSTDSIVRGYGNSPSSFNSDFVSAMIKMGDISPLTGSRGEIRKNCRRVN  322



>gb|ABK21858.1| unknown [Picea sitchensis]
Length=326

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QL   FY  +CP+A SI+ + V  AV  E RMGASLLRLHFHDCFVNGCD SILLDDT+
Sbjct  32    GQLCPRFYDISCPSAFSIVNSVVTQAVAKEKRMGASLLRLHFHDCFVNGCDGSILLDDTS  91

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              F GE++A PN NS+RG  VID IKTQ+E +C GVVSCADIVA+AARD+VV LGGP+W +
Sbjct  92    TFQGEKTAVPNKNSVRGFEVIDAIKTQVEAACPGVVSCADIVAIAARDAVVQLGGPTWLV  151

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS SAANS   P   +LS LIS+F + G S R++VALSGSHTIGQA+C+ F
Sbjct  152   LLGRRDSTTASLSAANSNLPPPASNLSALISSFQSHGLSIRDLVALSGSHTIGQARCTNF  211

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RI++E+NI+ SFA   +ANCP +GGD+NLAPLD  TPT+FDN Y+KNL+ ++GLLHSD
Sbjct  212   RNRIHSESNIDLSFARARQANCPSTGGDDNLAPLDLLTPTTFDNNYYKNLERRRGLLHSD  271

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTD++V+ Y++ P  F+ DFA AMVKM ++ PLTG  G+IRKNCRK N
Sbjct  272   QQLFNGGSTDNLVSFYTTYPIAFSIDFAVAMVKMGSIEPLTGNNGEIRKNCRKIN  326



>gb|AEX20390.1| putative class III peroxidase [Coffea arabica x Coffea canephora]
Length=256

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/256 (76%), Positives = 217/256 (85%), Gaps = 1/256 (0%)
 Frame = -1

Query  991  LHFHDCFVNGCDASILLDDTANFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCA  812
            + F D FVNGCDAS+LLDDTANFTGE++AGPN NS+RG  VID+IK+QLE SC GVVSCA
Sbjct  1    MQFQDWFVNGCDASVLLDDTANFTGEKTAGPNNNSLRGFEVIDSIKSQLETSCPGVVSCA  60

Query  811  DIVAVAARDSVVALGGPSWNLLLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFS  635
            DI+ VAARD V ALGGPSWN+LLGRRDSTTAS SAANS           LIS  +NKGF+
Sbjct  61   DILTVAARDGVAALGGPSWNILLGRRDSTTASLSAANSNIPGPGLNLNALISALANKGFT  120

Query  634  AREMVALSGSHTIGQAKCSFFRSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTP  455
            A EMVALSG HTIGQA+C  FR+RIYNE NINASFA  +KANCP+SGGDNNL+PLDTT+P
Sbjct  121  ATEMVALSGGHTIGQARCLLFRNRIYNEANINASFAAAVKANCPRSGGDNNLSPLDTTSP  180

Query  454  TSFDNAYFKNLQSQKGLLHSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSP  275
             SFDNAYF+NLQ+QKGLLHSDQQLF+GGST++ VNTYSSN +TF TDFANAMVKM NLSP
Sbjct  181  ISFDNAYFRNLQTQKGLLHSDQQLFSGGSTNAQVNTYSSNSATFFTDFANAMVKMDNLSP  240

Query  274  LTGTKGQIRKNCRKTN  227
            LTGT GQIR NCRKTN
Sbjct  241  LTGTNGQIRTNCRKTN  256



>ref|XP_006486214.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=319

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 239/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY+ TC N L  +++ V +AV+ EARMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  23    AQLSTNFYANTCKNLLPTVKSVVQSAVSKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG  VIDNIK+ +EK+C G VSCADI+A+ ARDSVV LGGPSW +
Sbjct  83    SFTGEKNAVPNRNSARGFEVIDNIKSAVEKACPGAVSCADILAITARDSVVLLGGPSWEV  142

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TASQSAANS    P  +L+QL S F+  G S +++VAL+G HTIGQA+C+ F
Sbjct  143   KLGRRDSRTASQSAANSGIPPPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQARCTSF  202

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+ IYNE NI+ASFA   + NCP++   GDNNLAPLD  TPTSFDN YFKNL ++KGLLH
Sbjct  203   RAHIYNETNIDASFARTRQGNCPRANGTGDNNLAPLDLQTPTSFDNNYFKNLVNRKGLLH  262

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDS V TYS+NPSTF++DF   M+KM ++SPLTG++G+IRKNCR+ N
Sbjct  263   SDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRKNCRRIN  319



>ref|XP_010045399.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/298 (66%), Positives = 237/298 (80%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CPN LS +++ V +AV+ E RMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  26    AQLSTNFYSKSCPNVLSTVKSVVRSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +F GE++AGPN  S+RG NVID IK+++E +C GVVSCADIVA+AARDSVV LGGPSW +
Sbjct  86    SFQGEKTAGPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEV  145

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRD+ TAS S ANS     P  +LS L S F  +G S R+MVALSGSHTIGQA+C  
Sbjct  146   KLGRRDARTASFSLANSGALPPPTSTLSNLTSLFQAQGLSTRDMVALSGSHTIGQARCIS  205

Query  574   FRSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FRSRIYN++NI++SF+   +  CP +   GD NLAPLD  +PT+FDNAYFKNL S KGLL
Sbjct  206   FRSRIYNDSNIDSSFSKTRQRKCPSTVGSGDQNLAPLDLQSPTAFDNAYFKNLLSNKGLL  265

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ+LFNGGSTDS+V TYS+NP TF +DFA+AM+KM ++ PLTG+KG+IRK C K N
Sbjct  266   HSDQELFNGGSTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICSKVN  323



>emb|CAA62597.1| korean-radish isoperoxidase [Raphanus sativus]
Length=315

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 244/296 (82%), Gaps = 3/296 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYST+CPN LS +++ V +AV+S+ RMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  21    AQLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTS  80

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGEQ+AGPN NS RG NVIDNIK+ +EK+C GVVSCADI+A+AARDSVV LGGP+WN+
Sbjct  81    -FTGEQNAGPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNV  139

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQ+AANS      +SLSQLIS+F   G S R+MVALSG+HTIGQ++C+ F
Sbjct  140   KVGRRDAKTASQAAANSNIPAPSMSLSQLISSFRAVGLSTRDMVALSGAHTIGQSRCTNF  199

Query  571   RSRIYNENNINASFATLLKANCPQSG-GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             R+RIYNE NINA+FATL + +CP++        PLD  +PTSFDN+YFKNL +Q+GLLHS
Sbjct  200   RTRIYNETNINAAFATLRQKSCPRAAFRRRKPQPLDINSPTSFDNSYFKNLMAQRGLLHS  259

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQ LFNGGSTDSIV  YS++PS+F +DFA AM+KM ++SPLTG+ G+IRK C +TN
Sbjct  260   DQVLFNGGSTDSIVRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  315



>ref|XP_011021038.1| PREDICTED: peroxidase 4-like [Populus euphratica]
Length=325

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 234/298 (79%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A+LS NFYS +CP    ++++ V +AV+ E RMGASL+RL FHDCFV GCD SILL+DT+
Sbjct  28    AKLSTNFYSKSCPKVFGVVKSVVQSAVSKERRMGASLVRLFFHDCFVKGCDGSILLEDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+A PN NS+RG NV+  IK+++EK C GVVSCADIVA+AARDS V LGGP WN+
Sbjct  88    SFTGEQTARPNNNSVRGFNVVAKIKSRVEKVCPGVVSCADIVAIAARDSTVILGGPFWNV  147

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TAS SAANS     P  +LS LI+ F +KG S ++MVALSGSHTIGQA+C+ 
Sbjct  148   KLGRRDSKTASLSAANSGVIPPPTSTLSNLINRFKSKGLSVKDMVALSGSHTIGQARCTS  207

Query  574   FRSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR+RIYNE NI++SFAT  + NCP  G  GDN LAPLD  TPT+FDN Y+KNL SQKGLL
Sbjct  208   FRARIYNETNIDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTAFDNKYYKNLISQKGLL  267

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ LFNGGSTDS+V TYS NP TF +DF  AM+KM ++ PLTG++G+IRK C K N
Sbjct  268   HSDQVLFNGGSTDSLVRTYSRNPKTFRSDFVTAMIKMGDIDPLTGSQGEIRKICSKRN  325



>ref|XP_009363847.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
 ref|XP_009363901.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 239/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYS++CP   S +++ V +A+  E RMGASLLRLHFHDCFVNGCD S+LLDDT+
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG NV+D IK  +E  C GVVSCADI+A+AARDSV  LGGPSW++
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKFAVENVCPGVVSCADILAIAARDSVTILGGPSWDV  142

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L+QLISTF+  G S R++VALSGSHTIGQA+C+ F
Sbjct  143   KLGRRDTRTASQAAANNSIPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQARCTTF  202

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R R+YNE N+++S A   ++NCP++   GDNNLAPLD  +PTSFDN+YFKNL  +KGLLH
Sbjct  203   RPRVYNETNLDSSLAKTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKNLIQKKGLLH  262

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFN GSTDSIV  YS++ +TF++DFA AM+KM ++ PLTG+KG+IRKNCRK N
Sbjct  263   SDQQLFNRGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSKGEIRKNCRKPN  319



>ref|XP_008233851.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=319

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 243/297 (82%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS++CP   S +++ V +A+ +EAR+GASLLRLHFHDCFVNGCD S+LLDDT+
Sbjct  23    AQLSTNFYSSSCPRVFSAVRSTVQSAIRNEARIGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +V+DNIK+ +E  C GVVSCADI+A+AARDSV  LGGPSWN+
Sbjct  83    SFTGEKNAVPNRNSARGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVAILGGPSWNV  142

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L+QLIS F+  G S R++VALSGSHTIGQ++C  F
Sbjct  143   KLGRRDARTASQAAANNNIPPPTSNLNQLISRFNALGLSTRDLVALSGSHTIGQSRCIQF  202

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R RIYNE N+++SFA   ++NCP++   GDNNLAPLD  TPT+FDN YFKNL  +KGLLH
Sbjct  203   RPRIYNETNLDSSFAQTRRSNCPRASGSGDNNLAPLDLQTPTAFDNNYFKNLIQKKGLLH  262

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV TYS++ +TF++DF +A++KM ++ PLTG+ G+IRKNCRK N
Sbjct  263   SDQQLFNGGSTDSIVRTYSNSYNTFSSDFVSAIIKMGDIKPLTGSNGEIRKNCRKPN  319



>ref|XP_006657042.1| PREDICTED: peroxidase P7-like, partial [Oryza brachyantha]
Length=307

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 193/294 (66%), Positives = 232/294 (79%), Gaps = 1/294 (0%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLS NFYS TCPN  SI+++ +A+AV +E RMGAS+LRL FHDCFVNGCD SILLDDT+ 
Sbjct  14    QLSPNFYSRTCPNLASIVRSGMASAVRNEPRMGASILRLFFHDCFVNGCDGSILLDDTST  73

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGE+ AGPN NS RG  VID IKTQ+E SC   VSCADI+A+AARD V  LGGP+W++ 
Sbjct  74    FTGEKGAGPNANSARGFEVIDAIKTQVEASCKATVSCADILALAARDGVNLLGGPTWSVP  133

Query  745   LGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGR+DS TASQSAANS     G SL+ LIS F N+G SAR+M ALSG+HTIG+++C FFR
Sbjct  134   LGRKDSRTASQSAANSNLPGPGSSLATLISMFGNQGLSARDMTALSGAHTIGRSQCQFFR  193

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             SRIY E+NINASFA L +  CP+SGGD NLAP D  T  +FDNAY++NL SQ+GLLHSDQ
Sbjct  194   SRIYTESNINASFAALRQQTCPRSGGDANLAPFDVQTADAFDNAYYQNLVSQRGLLHSDQ  253

Query  388   QLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +LFNGGS D++V  YS+NPS F+ DF +AMVKM NL P +GT  ++R NCRK N
Sbjct  254   ELFNGGSQDALVRQYSTNPSQFSADFVSAMVKMGNLLPSSGTATEVRLNCRKVN  307



>ref|XP_007208188.1| hypothetical protein PRUPE_ppa020902mg [Prunus persica]
 gb|EMJ09387.1| hypothetical protein PRUPE_ppa020902mg [Prunus persica]
Length=326

 Score =   395 bits (1016),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 240/296 (81%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A+LSA+FY   CPNALS I++AV +AV  EARMGASLLRLHFHDCFVNGCDAS+LLDDTA
Sbjct  31    AELSASFYDKNCPNALSTIKSAVDSAVYKEARMGASLLRLHFHDCFVNGCDASLLLDDTA  90

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              F GE+++  N NS+RG  VIDNIK +LE  C  +VSCADI+AVAARDS+VALGGP++ +
Sbjct  91    TFKGEKTSVANANSLRGFEVIDNIKAELESLCPNMVSCADILAVAARDSIVALGGPTYTV  150

Query  748   LLGRRDSTTASQSAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
              LGRRDST A+ +A   LP P +++++LI+ FS KGF+ +EMVALSG+HTIGQA+C+FFR
Sbjct  151   ALGRRDSTAANVTATEDLPSPFVNVTKLIAAFSKKGFTVKEMVALSGAHTIGQARCAFFR  210

Query  568   SRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
              R+YN+ +INASFA  ++A CP SG  GDNN++ LD TTPT+FD++YFKN+ SQKGLLHS
Sbjct  211   GRLYNDTDINASFAAAVRAKCPGSGGSGDNNMSELDVTTPTTFDSSYFKNVMSQKGLLHS  270

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQL++GG T + V+ Y++N ++F  DFA AM KM  LSPLTG+ GQIR NCRK N
Sbjct  271   DQQLYSGGFTKTAVDAYANNAASFMEDFAEAMNKMGRLSPLTGSIGQIRTNCRKVN  326



>gb|EYU41994.1| hypothetical protein MIMGU_mgv1a010221mg [Erythranthe guttata]
Length=318

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 235/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYSTTCPN L+II+TAV  AV ++ RMGASLLRLHFHDCFV GCD S+LLDD  
Sbjct  24    AQLSPNFYSTTCPNLLTIIRTAVNTAVTNDPRMGASLLRLHFHDCFVQGCDGSVLLDDVT  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VID IKTQ+E +C G+VSCADI+ VAARD  VA  GPSW L
Sbjct  84    GFTGEKTAAPNANSLRGFDVIDTIKTQVEAACPGIVSCADILTVAARDGTVARSGPSWAL  143

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS + AN      G SL+ LI++FSNKGF+ REMVALSGSHTIG A+CS F
Sbjct  144   SLGRRDSTTASLTGANGQLPGPGSSLNNLITSFSNKGFTTREMVALSGSHTIGLARCSTF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN  NI+ +FAT  +ANCP +GG+NNLAPLDT +PT+F+N Y+ NL + +GLL+SD
Sbjct  204   RNRIYNAANIDPAFATTRRANCPPTGGNNNLAPLDTVSPTTFNNDYYTNLVNLRGLLNSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LFN G+TD+ V  YS+N ++F  DFA AMVKMSNL+PLTGT GQIR+NCR  N
Sbjct  264   QVLFNNGTTDAQVRAYSTNSASFFNDFAAAMVKMSNLTPLTGTNGQIRRNCRLRN  318



>ref|XP_006376028.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|ERP53825.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|AHL39175.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   395 bits (1015),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 240/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS +FYS +CP+ LS ++  V +A+N EARMGAS+LRL FHDCFVNGCD S+LLDDT+
Sbjct  26    AQLSIDFYSKSCPHLLSTVKPVVQSAINKEARMGASILRLFFHDCFVNGCDGSLLLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG  VIDNIK+ +EK+C GVVSCADI+A+AARDS V LGGP W++
Sbjct  86    SFTGEKNAAPNKNSARGFEVIDNIKSAVEKACPGVVSCADILAIAARDSTVILGGPEWDV  145

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L+QLIS F+  G S R+MVALSGSHTIGQA+C+ F
Sbjct  146   KLGRRDARTASQAAANNSIPRPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQARCTNF  205

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE  I++S A   ++NCP++   GDNNLAPLD  TPT F+N Y+KNL +++GLLH
Sbjct  206   RARIYNETTIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNLINRRGLLH  265

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV+TYSSN +TF +DF   M+KM ++ PLTG++G+IR NCR+ N
Sbjct  266   SDQQLFNGGSTDSIVSTYSSNENTFRSDFVAGMIKMGDIRPLTGSRGEIRNNCRRIN  322



>ref|XP_009369255.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   395 bits (1014),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 238/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYS++CP   S +++ V +A+  E R GASLLRLHFHDCFVNGCD S+LLDDT+
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVRSAIQKETRTGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG NV+D IK+ +E  C GVVSCADI+A+AARDSV  LGGPSW++
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKSAVENVCPGVVSCADILAIAARDSVTILGGPSWDV  142

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L+QLISTF+  G S R++VALSGSHTIGQA+C+ F
Sbjct  143   KLGRRDTRTASQAAANNSIPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQARCTTF  202

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R RIYNE N+++S A   ++NCP++   GDNNLAPLD  +PTSFDN+YFKNL  +KGLLH
Sbjct  203   RPRIYNETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKNLIQKKGLLH  262

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  Y ++ STF++DFA AM+KM ++ PLTG+ G+IRKNCRK N
Sbjct  263   SDQQLFNGGSTDSIVRAYRNSYSTFSSDFAKAMIKMGDIKPLTGSNGEIRKNCRKPN  319



>ref|XP_004239964.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=322

 Score =   395 bits (1014),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 239/298 (80%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CP     I++ V +A+N E RMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  25    AQLSTNFYSKSCPKLYQTIKSTVQSAINKETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+ A PN+NS+RG  VIDNIK+ +EK+C G+VSCADI+AV ARDSVV LGGP+WN+
Sbjct  85    SFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGIVSCADILAVTARDSVVILGGPNWNV  144

Query  748   LLGRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ AANS       +L++LIS+FS  G S ++MVALSG+HTIGQA+C+ F
Sbjct  145   KLGRRDARTASQGAANSSIPAPTFNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTTF  204

Query  571   RSRIYNE-NNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R+RIYNE NNI+++FA   + +CP++   GDNNLAPLD  TP+ FDN YFKNL ++KGLL
Sbjct  205   RARIYNETNNIDSTFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNLVNKKGLL  264

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQLFNGGS DSIV +Y +NPS+F +DF  AM+KM ++ PLTG+ G+IRKNCR+ N
Sbjct  265   HSDQQLFNGGSADSIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRKNCRRRN  322



>gb|AAD43561.1|AF155124_1 bacterial-induced peroxidase precursor [Gossypium hirsutum]
Length=316

 Score =   394 bits (1013),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 234/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY+++CPN  +I++ A++ AVN E R+GAS+LRL FHDCFVNGCD SILLDDTA
Sbjct  22    AQLSPNFYASSCPNLQTIVRNAMSRAVNRETRIGASILRLFFHDCFVNGCDGSILLDDTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS RG  VID IKT +E +C   VSCADI+A+AARD V  LGGP+W +
Sbjct  82    TFTGEKNAVPNRNSARGFEVIDTIKTNVEAACSATVSCADILALAARDGVALLGGPTWQV  141

Query  748   LLGRRDSTTASQSAANslpgpg-lslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQSAAN+       +L+ L S+F+ KG S R++ ALSG HTIG A+C+ F
Sbjct  142   PLGRRDARTASQSAANNQIPSPFANLATLTSSFAAKGLSTRDLTALSGGHTIGLARCTTF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYN+ NI+A+FA   +ANCP SGGDNNLAPLD  TPT FDN YF+NL +++GLLHSD
Sbjct  202   RGRIYNDTNIDANFAATRRANCPASGGDNNLAPLDIQTPTRFDNDYFRNLVARRGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGS D++V TYS+NP+TF+ DFA AMVKM N+SPLTGT+G+IR+NCR  N
Sbjct  262   QELFNGGSQDALVRTYSNNPATFSADFAAAMVKMGNISPLTGTQGEIRRNCRVVN  316



>gb|EYU41992.1| hypothetical protein MIMGU_mgv1a010234mg [Erythranthe guttata]
Length=318

 Score =   394 bits (1012),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 237/295 (80%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYST CPN L+I++TAV  AV ++ RMGASLLRLHFHDCFV GCD S+LLDD A
Sbjct  24    AQLSPNFYSTRCPNLLTIVRTAVNTAVANDRRMGASLLRLHFHDCFVQGCDGSVLLDDVA  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VID IKT++E +C G+VSCADI+ +AARD  VA+ GPSW L
Sbjct  84    GFTGEKTAAPNANSLRGFDVIDTIKTRVEAACPGIVSCADILTIAARDGTVAVSGPSWAL  143

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS + ANS     G SL+ LI++F+NKGF+ REMVALSGSHTIG A+CS F
Sbjct  144   SLGRRDSTTASLNGANSQLPGPGSSLNNLITSFANKGFTTREMVALSGSHTIGLARCSTF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN  NI+ +FAT  +ANCP++GGDNNLAPLDT +  +F+N Y+ NL S++GLL SD
Sbjct  204   RNRIYNAANIDPAFATARRANCPRTGGDNNLAPLDTVSSNTFNNDYYTNLVSRRGLLTSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LFN G+TD+ V  YS+N ++F  DFA AMVKMSNLSPLTGT GQIR+NCR+ N
Sbjct  264   QVLFNNGTTDAQVRAYSTNSASFFNDFAAAMVKMSNLSPLTGTNGQIRRNCRRRN  318



>emb|CAL25300.1| properoxidase [Picea abies]
Length=310

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 238/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS+ FY+ +CP ALS+++ AV  AV +E RMGASLLRLHFHDCFVNGCD S+LLDD++
Sbjct  14    GQLSSTFYAQSCPTALSVVKAAVRQAVANEKRMGASLLRLHFHDCFVNGCDGSVLLDDSS  73

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
               TGE++A PN NS RG +VID IK+ +EK+C GVVSCADI+A++ARDSVV LGGPSW +
Sbjct  74    TITGEKTANPNANSARGFDVIDTIKSNVEKACSGVVSCADILAISARDSVVELGGPSWTV  133

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             +LGRRDSTTAS++ AN+    P  SLS LIS F  +G S +EMVALSG HTIGQA+C  F
Sbjct  134   MLGRRDSTTASKNGANNNIPPPTSSLSNLISLFQAQGLSTKEMVALSGGHTIGQARCVNF  193

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+ IYNE NI+++++T L++ CP +   GD+NL+PLD  TPT+FD  Y+ NL+S+KGLLH
Sbjct  194   RAHIYNETNIDSTYSTSLQSKCPSTAGSGDSNLSPLDYVTPTAFDKNYYSNLKSKKGLLH  253

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDS V TY+SN ++F +DFA AMVKM N+ PLTGT GQIRKNCRK N
Sbjct  254   SDQELFNGGSTDSQVTTYASNQNSFFSDFAAAMVKMGNIKPLTGTSGQIRKNCRKPN  310



>ref|XP_006833057.1| hypothetical protein AMTR_s00170p00037010 [Amborella trichopoda]
 gb|ERM98335.1| hypothetical protein AMTR_s00170p00037010 [Amborella trichopoda]
Length=315

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 237/295 (80%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+ FYS++CPN LSI++TA+  AVN EAR+GAS+LRL FHDCFVNGCDASILLDDTA
Sbjct  22    AQLSSTFYSSSCPNLLSIVRTAMTQAVNREARLGASILRLFFHDCFVNGCDASILLDDTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN NS RG  VID IKT++  +C  VVSCADI+A+A RD VV LGGP+W +
Sbjct  82    NFTGEKNAAPNRNSARGFEVIDTIKTRVNAACGNVVSCADILALATRDGVVLLGGPTWTV  141

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQSAANS    P  SL+ LIS F  KG +AREM ALSG HTIG A+CS F
Sbjct  142   PLGRRDARTASQSAANSQIPSPFSSLTTLISMFQAKGLTAREMTALSGGHTIGFARCSTF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE NI+A+FA   +A CP +GGD NLAPLD  T T FDN Y++NL +++GLLHSD
Sbjct  202   RTRIYNETNIDATFARTRRATCPATGGDTNLAPLD-QTQTQFDNNYYQNLVNRRGLLHSD  260

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGS D++V TYS+N +TF++DFA+AMV M N+SPLTGT G+IR NCR+ N
Sbjct  261   QELFNGGSQDALVRTYSTNGATFSSDFASAMVNMGNISPLTGTNGEIRNNCRRIN  315



>ref|XP_010921101.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 242/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS N+YS TCPN  S ++  + +A++SE RMGAS+LRL FHDCFVNGCD S+LLDDT+
Sbjct  24    AQLSTNYYSKTCPNLFSAVKPVIESAISSEKRMGASILRLFFHDCFVNGCDGSLLLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A  N NS+RG +VID IKT +E++C GVVSCADI+AVAARDSVV LGGP+W++
Sbjct  84    SFTGEKTANANRNSVRGFDVIDKIKTAVEEACPGVVSCADILAVAARDSVVILGGPNWDV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TAS SAAN+    P  SLS LIS FS +G S  EMVAL+G+HTIGQA+C+ F
Sbjct  144   KLGRRDARTASLSAANNNIPPPTSSLSNLISKFSAQGLSTDEMVALAGAHTIGQARCTSF  203

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+ IYN+ +IN+SFA   +ANCP +   GDNNLAPLD  TPT FDN Y+KNL SQ+GLLH
Sbjct  204   RAHIYNDTDINSSFAKTRQANCPSTSGNGDNNLAPLDLQTPTVFDNNYYKNLVSQEGLLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+L+N GSTDS+V+TYS+NPS F++DF  A++KM ++SPLTG++G+IRKNCRK N
Sbjct  264   SDQELYNKGSTDSLVSTYSTNPSKFSSDFVAAIIKMGDISPLTGSQGEIRKNCRKIN  320



>gb|KDP45728.1| hypothetical protein JCGZ_17335 [Jatropha curcas]
Length=328

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 235/298 (79%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYS +CP     ++  VA+A++ E RMGASL+RL FHDCFV GCD SILL+DTA
Sbjct  31    AQLSTGFYSKSCPKLFETVKPVVADAISKERRMGASLVRLFFHDCFVKGCDGSILLEDTA  90

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGEQ+AGPN NS+RG NVI+NIK ++EK C GVVSCADI+A+AARDS V LGGP+W +
Sbjct  91    SFTGEQTAGPNNNSVRGFNVINNIKAKVEKVCPGVVSCADILAIAARDSTVTLGGPNWAV  150

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TAS SAANS     P  +LS LI+ F  KG SAR+MVALSG+HTIGQA+C  
Sbjct  151   KLGRRDSKTASFSAANSGVIPPPTSTLSNLINRFKAKGLSARDMVALSGAHTIGQARCVI  210

Query  574   FRSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR+RIYNE NI++SFA+  + NCP++   GDNNLAPLD  TP +FDN YFKNL +QKGLL
Sbjct  211   FRNRIYNETNIDSSFASTRQRNCPRATGSGDNNLAPLDVQTPNAFDNNYFKNLLNQKGLL  270

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ LFNGGSTDS+V TYS+NP TF +DF +AM+KM ++ PLTG+ G+IRK C + N
Sbjct  271   HSDQVLFNGGSTDSLVRTYSNNPKTFNSDFVSAMIKMGDIDPLTGSSGEIRKKCNRVN  328



>ref|NP_001106040.1| peroxidase 70 precursor [Zea mays]
 sp|A5H452.1|PER70_MAIZE RecName: Full=Peroxidase 70; AltName: Full=Plasma membrane-bound 
peroxidase 2b; Short=pmPOX2b; Flags: Precursor [Zea mays]
 gb|ABN48843.1| plasma membrane-bound peroxidase 2b [Zea mays]
Length=321

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 230/291 (79%), Gaps = 3/291 (1%)
 Frame = -1

Query  1090  FYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEQ  911
             FYS +CP AL+ I+ AV  AV  EARMGASLLRLHFHDCFV GCD S+LL+DTA FTGEQ
Sbjct  31    FYSRSCPRALATIKAAVTAAVAQEARMGASLLRLHFHDCFVQGCDGSVLLNDTATFTGEQ  90

Query  910   SAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLLGRRD  731
             +A PN+ SIRG  V+DNIK Q+E  C GVVSCADI+AVAARDSVVALGGPSW +LLGRRD
Sbjct  91    TANPNVGSIRGFGVVDNIKAQVEAVCPGVVSCADILAVAARDSVVALGGPSWRVLLGRRD  150

Query  730   STTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRSRIYN  554
             STTAS + ANS    P L L+ L + F+ K  S  ++VALSG+HTIG A+C  FR+ IYN
Sbjct  151   STTASLALANSDLPAPSLDLANLTAAFAKKRLSRTDLVALSGAHTIGLAQCKNFRAHIYN  210

Query  553   ENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQLF  380
             + N+NA+FATL +ANCP +   GD NLAPLDT TPT+FDNAY+ NL +Q+GLLHSDQQLF
Sbjct  211   DTNVNAAFATLRRANCPAAAGNGDGNLAPLDTATPTAFDNAYYTNLLAQRGLLHSDQQLF  270

Query  379   NGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             NGG+TD +V TY+S P  F+ DFA AM++M N+SPLTGT+GQIR+ C + N
Sbjct  271   NGGATDGLVRTYASTPRRFSRDFAAAMIRMGNISPLTGTQGQIRRACSRVN  321



>ref|NP_001241914.1| uncharacterized protein LOC100790279 precursor [Glycine max]
 gb|ACU17865.1| unknown [Glycine max]
Length=320

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/297 (65%), Positives = 239/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY  +CPN  S +++ V +A++ E RMGASLLR  FHDCFVNGCD SILLDDT+
Sbjct  24    AQLSTNFYYHSCPNLFSTVKSTVQSAISKETRMGASLLRPFFHDCFVNGCDGSILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG  VIDNIK+ +EK+C GVVSCADI+A+AARDSV  LGGPSWN+
Sbjct  84    SFTGEKNANPNRNSARGYEVIDNIKSAVEKACPGVVSCADILAIAARDSVQILGGPSWNV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQSAAN+    P  +L+QLIS FS  G S +++VALSG HTIGQA+C+ F
Sbjct  144   KVGRRDARTASQSAANNGIPPPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNF  203

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE+NI+ +FA   + +CP++   GDNNLA LD  TPT FDN YFKNL  +KGLLH
Sbjct  204   RARIYNESNIDTAFARARQQSCPRTSGSGDNNLATLDLQTPTEFDNYYFKNLVQKKGLLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  YS+NPS+F++DFA AM+KM ++SPLTG+ G+IRKNCR+ N
Sbjct  264   SDQQLFNGGSTDSIVRGYSTNPSSFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN  320



>gb|ABK25962.1| unknown [Picea sitchensis]
Length=323

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 237/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS+ FY  +CP ALS+++ AV  AV  E RMGASLLRLHFHDCFVNGCD S+LLDD++
Sbjct  27    GQLSSTFYDKSCPAALSVVKAAVKQAVAKEQRMGASLLRLHFHDCFVNGCDGSVLLDDSS  86

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
               TGE++A PN NS RG +VID IK+Q+EKSC GVVSCADI+A+AARDSVV LGGPSW +
Sbjct  87    KITGEKTAVPNANSARGFDVIDTIKSQVEKSCSGVVSCADILAIAARDSVVELGGPSWTV  146

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
             LLGRRDSTTAS+S AN+    P  SLS++IS F  +G SA+EMVAL+G+HTIGQA+C  F
Sbjct  147   LLGRRDSTTASKSGANNNIPPPTSSLSKIISLFQAQGLSAKEMVALAGAHTIGQARCFNF  206

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+ IYN+ NI ++++T L++ CP +   GDNNL+PLD  +PT+FD  Y+ NL+ +KGLLH
Sbjct  207   RAHIYNDTNILSTYSTSLRSKCPPTNGSGDNNLSPLDYVSPTAFDKNYYCNLKIKKGLLH  266

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ+LFNGGSTDS V TY+SN + F +DFA AMVKM N+ PLTGT GQIRKNCRK N
Sbjct  267   SDQELFNGGSTDSQVTTYASNQNIFFSDFAAAMVKMGNIKPLTGTSGQIRKNCRKPN  323



>ref|XP_008369321.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 239/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYS++CP   S +++ V +A+  E RMGASLLRLHFHDCFVNGCD S+LLDDT+
Sbjct  23    AQLSTKFYSSSCPKLFSTVKSTVHSAIQKETRMGASLLRLHFHDCFVNGCDGSLLLDDTS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG NV+D IK+ +E +C GVVSCADI+A+AAR+SV  LGGPSW++
Sbjct  83    SFTGEKNAVPNKNSARGFNVVDKIKSAVENACPGVVSCADILAIAARESVTVLGGPSWDV  142

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L+QL+STF+  G S R++VALSGSHTIGQA+C+ F
Sbjct  143   KLGRRDTRTASQAAANNSIPPPTRNLNQLVSTFNALGLSTRDLVALSGSHTIGQARCTTF  202

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R RIYNE N+++S A   ++NCP++   GDNNLAPLD  +PT FDN+YFKNL   KGLLH
Sbjct  203   RPRIYNETNLDSSLAQTRQSNCPRTSGSGDNNLAPLDLKSPTFFDNSYFKNLIQNKGLLH  262

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  YS++ +TF++DFA AM+KM ++ PLTG+ G+IRKNCRK N
Sbjct  263   SDQQLFNGGSTDSIVRAYSNSYNTFSSDFAKAMIKMGDIKPLTGSNGEIRKNCRKPN  319



>ref|XP_008384729.1| PREDICTED: peroxidase 4-like isoform X1 [Malus domestica]
Length=327

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 235/298 (79%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CP     +++ V +AV+ E RMGASLLRLHFHDCFVNGCD S+LLDDT+
Sbjct  30    AQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDTS  89

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN NS+RG  V+D IK+Q+EK+C GVVSCADI+A+A+RDSV  LGGPSW +
Sbjct  90    SFTGEKTAGPNNNSVRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWEV  149

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TAS SAANS     P  +L++L++ F   G S R++VALSG+HTIGQA+C+ 
Sbjct  150   KLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCTT  209

Query  574   FRSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR+R+YNE NI+ASFA   +  CP++   GDNNLAPLD TTP +FD AYFKNL ++KGLL
Sbjct  210   FRARVYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNRKGLL  269

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ LFNGG+TDS+V +YS N  TF  DFA AM+KM +  PLTG+KG+IR NCRK N
Sbjct  270   HSDQILFNGGATDSLVKSYSGNAETFNADFAKAMIKMGDNKPLTGSKGEIRLNCRKPN  327



>ref|XP_008650762.1| PREDICTED: peroxidase 70 isoform X1 [Zea mays]
 tpg|DAA64105.1| TPA: peroxidase 70 Precursor [Zea mays]
Length=321

 Score =   393 bits (1009),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 230/291 (79%), Gaps = 3/291 (1%)
 Frame = -1

Query  1090  FYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEQ  911
             FYS +CP AL+ I+ AV  AV  EARMGASLLRLHFHDCFV GCD S+LL+DTA FTGEQ
Sbjct  31    FYSRSCPRALATIKAAVTAAVAQEARMGASLLRLHFHDCFVQGCDGSVLLNDTATFTGEQ  90

Query  910   SAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLLGRRD  731
             +A PN+ SIRG  V+DNIK Q+E  C GVVSCADI+AVAARDSVVALGGPSW +LLGRRD
Sbjct  91    TANPNVGSIRGFGVVDNIKAQVEAVCPGVVSCADILAVAARDSVVALGGPSWRVLLGRRD  150

Query  730   STTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRSRIYN  554
             STTAS + ANS    P L L+ L + F+ K  S  ++VALSG+HTIG A+C  FR+ IYN
Sbjct  151   STTASLTLANSDLPAPSLDLANLTAAFAKKRLSRTDLVALSGAHTIGLAQCKNFRAHIYN  210

Query  553   ENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQLF  380
             + N+NA+FATL +ANCP +   GD NLAPLDT TPT+FDNAY+ NL +Q+GLLHSDQQLF
Sbjct  211   DTNVNAAFATLRRANCPAAAGNGDGNLAPLDTATPTAFDNAYYTNLLAQRGLLHSDQQLF  270

Query  379   NGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             NGG+TD +V TY+S P  F+ DFA AM++M N+SPLTGT+GQIR+ C + N
Sbjct  271   NGGATDGLVRTYASTPRRFSGDFAAAMIRMGNISPLTGTQGQIRRACSRVN  321



>emb|CAD67479.1| peroxidase [Asparagus officinalis]
Length=320

 Score =   393 bits (1009),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 242/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ NFYS++CP     I++ V +A++SE RMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  24    AQLTPNFYSSSCPTLFPTIKSVVQSAISSEKRMGASLLRLFFHDCFVNGCDGSLLLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN  S+RG +VID IKT +E++C GVVSCADI+AV ARDSVV LGGP+WN+
Sbjct  84    SFTGEKNAIPNKGSVRGFDVIDKIKTAVEQACPGVVSCADILAVTARDSVVLLGGPTWNV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TASQS AN+    P  SLS LIS FS +G SA+EMVAL G+HTIGQA+C+ F
Sbjct  144   KLGRRDSRTASQSGANNNIPPPTSSLSNLISKFSAQGLSAKEMVALVGAHTIGQARCTNF  203

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+ +YN+ +I+A+FA   ++NCP +   GDNNLAPLD  TP +FDN YFKNL S+KGLLH
Sbjct  204   RAHVYNDTDIDATFAKTRQSNCPSTSGSGDNNLAPLDLQTPVAFDNNYFKNLVSKKGLLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQ+F+GGST+S V+TYS++PST+++DF  AM+KM ++SPLTG  G+IRKNCRKTN
Sbjct  264   SDQQVFSGGSTNSQVSTYSTSPSTWSSDFVAAMIKMGDISPLTGKSGEIRKNCRKTN  320



>ref|XP_007048724.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOX92881.1| Peroxidase superfamily protein [Theobroma cacao]
Length=320

 Score =   393 bits (1009),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 231/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY+ +CPN  +I++ A+  AVN E R+GAS+LRL FHDCFVNGCDASILLDDTA
Sbjct  26    AQLSPKFYANSCPNLQTIVRNAMTQAVNRETRIGASILRLFFHDCFVNGCDASILLDDTA  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS RG  VID IKT +E +C   VSCADI+A+AARD VV L GPSW +
Sbjct  86    TFTGEKNAAPNRNSARGFEVIDTIKTSVEAACSATVSCADILALAARDGVVLLKGPSWQV  145

Query  748   LLGRRDSTTASQSAANslpgpg-lslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQSAAN+       +LS L S+F+ KG SAR++ ALSG HTIG A+C+ F
Sbjct  146   PLGRRDARTASQSAANNQLPSPFSNLSALTSSFAAKGLSARDLTALSGGHTIGLARCTTF  205

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIYN+ NI+ +FA   +ANCP SGGDNNLAPLD  TPT FDN YF+NL +Q+GLLHSD
Sbjct  206   RGRIYNDTNIDPNFAANRRANCPASGGDNNLAPLDIQTPTRFDNYYFRNLVAQRGLLHSD  265

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGS D++V TYS+NP  F++DFA AMV+M N+SPLTGT+G+IR+NCR  N
Sbjct  266   QELFNGGSQDALVRTYSTNPEVFSSDFAAAMVRMGNISPLTGTRGEIRRNCRVVN  320



>ref|XP_008384730.1| PREDICTED: peroxidase 4-like isoform X2 [Malus domestica]
Length=323

 Score =   392 bits (1008),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 235/298 (79%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CP     +++ V +AV+ E RMGASLLRLHFHDCFVNGCD S+LLDDT+
Sbjct  26    AQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN NS+RG  V+D IK+Q+EK+C GVVSCADI+A+A+RDSV  LGGPSW +
Sbjct  86    SFTGEKTAGPNNNSVRGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWEV  145

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TAS SAANS     P  +L++L++ F   G S R++VALSG+HTIGQA+C+ 
Sbjct  146   KLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCTT  205

Query  574   FRSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR+R+YNE NI+ASFA   +  CP++   GDNNLAPLD TTP +FD AYFKNL ++KGLL
Sbjct  206   FRARVYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNRKGLL  265

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ LFNGG+TDS+V +YS N  TF  DFA AM+KM +  PLTG+KG+IR NCRK N
Sbjct  266   HSDQILFNGGATDSLVKSYSGNAETFNADFAKAMIKMGDNKPLTGSKGEIRLNCRKPN  323



>gb|KDP21683.1| hypothetical protein JCGZ_03354 [Jatropha curcas]
Length=316

 Score =   392 bits (1007),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 233/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              +LS ++YS TCP ALS+++  V  A+ +E R+GASLLRLHFHDCFVNGCD SILLDD A
Sbjct  22    GKLSPDYYSRTCPKALSVVEAGVKKAIKNETRIGASLLRLHFHDCFVNGCDGSILLDDNA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              F GE++A PN NS+RG NVID+IK++LEK+C GVVSCADIVA+AARDS V LGGPSW +
Sbjct  82    TFIGEKTAAPNNNSVRGFNVIDDIKSKLEKACPGVVSCADIVALAARDSAVYLGGPSWKV  141

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGR+DS TAS++ AN+   P   +LS LI++FS +G S R+MVALSGSHTIG A+C+ +
Sbjct  142   GLGRKDSLTASRALANTSIPPPTSNLSALITSFSAQGLSLRDMVALSGSHTIGLARCTSY  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R  IYN++NI+ SFA  L+  CP+SG DN LAPLD  TPT FDN Y+KNL ++KGLLHSD
Sbjct  202   RGHIYNDSNIDPSFAKSLQQICPRSGKDNVLAPLDRQTPTRFDNLYYKNLLNKKGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNG S DS+V  Y+S P TF  DFA AMVKMSN+ PLTG+ GQ+RKNCR+ N
Sbjct  262   QELFNGRSADSLVRKYASKPFTFFKDFAQAMVKMSNIKPLTGSHGQVRKNCRRVN  316



>ref|XP_011008654.1| PREDICTED: peroxidase P7 [Populus euphratica]
Length=322

 Score =   392 bits (1006),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 238/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS +FYS +CP+  S ++  V +A+N EAR+GAS+LRL FHDCFVNGCD S+LLDDT+
Sbjct  26    AQLSTDFYSKSCPHLFSTVKPVVQSAINKEARIGASILRLFFHDCFVNGCDGSLLLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG  VIDNIK+ +EK+C GVVSCAD++A+AARDS V LGGP WN+
Sbjct  86    SFTGEKNAAPNRNSARGFEVIDNIKSAVEKACPGVVSCADVLAIAARDSTVILGGPQWNV  145

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L+QLIS F+  G S R+MVALSGSHTIGQA+C+ F
Sbjct  146   KLGRRDARTASQAAANNSIPPPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQARCTNF  205

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE  I++S A   ++NCP++   GDNNLAPLD  TPT F+N Y+KNL +++GLLH
Sbjct  206   RARIYNETTIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNLVNRRGLLH  265

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV TYS N +TF +DF   M+KM ++ PLTG++G+IRKNCR+ N
Sbjct  266   SDQQLFNGGSTDSIVRTYSYNENTFRSDFVAGMIKMGDIRPLTGSRGEIRKNCRRIN  322



>ref|XP_004307713.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=323

 Score =   392 bits (1006),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 194/299 (65%), Positives = 241/299 (81%), Gaps = 5/299 (2%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS+NFYS +CP   SI+++ V  A+ +E RMGAS+LRLHFHDCFVNGCD S+LLDDTA
Sbjct  25    AQLSSNFYSKSCPRLFSIVKSTVQPAIRNEPRMGASILRLHFHDCFVNGCDGSVLLDDTA  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN NS+RG NVIDNIK+ +E  C GVVSCADI+A+ ARDSV  LGGPSWN+
Sbjct  85    NFTGEKNAVPNKNSLRGFNVIDNIKSAVENVCPGVVSCADILAITARDSVAILGGPSWNV  144

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L+QLIS F+  G S ++MVALSGSHTIGQA+C+ F
Sbjct  145   KLGRRDARTASQAAANNSIPPPTSNLNQLISRFNALGLSTKDMVALSGSHTIGQARCTSF  204

Query  571   RSRIYNE-NNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R+R+YNE NN+++S A   ++NCP++   GDNNLAPLD  +PT+FDN Y+ NL   +GLL
Sbjct  205   RARVYNETNNLDSSLAQTRQSNCPRTTGSGDNNLAPLDLQSPTAFDNNYYNNLIKNRGLL  264

Query  400   HSDQQLF-NGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQLF NGGSTDSIV  YSS+ STF +DFA AM+KM N++PLTG+ G+IRKNCRK N
Sbjct  265   HSDQQLFLNGGSTDSIVRGYSSSQSTFTSDFAAAMIKMGNINPLTGSNGEIRKNCRKPN  323



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 237/298 (80%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYS +CP     +++AV +A+  E RMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  24    AQLSTGFYSKSCPKLYQTVKSAVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+ A PN+NS RG  VIDNIK+ +EK C GVVSCADI+AV ARDSVV LGGP+WN+
Sbjct  84    SFTGEKRAAPNVNSARGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWNV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN     P  +L++LIS+FS  G S ++MVALSG+HTIGQA+C+ F
Sbjct  144   KLGRRDARTASQAAANRSIPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTTF  203

Query  571   RSRIYNE-NNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R+RIYNE NN++ASFA   ++NCP+S   GDN+LAPLD  TP  FDN YFKNL ++KGLL
Sbjct  204   RARIYNETNNLDASFARTRQSNCPRSSGSGDNSLAPLDLQTPNKFDNNYFKNLVNKKGLL  263

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQLFNGGS DSIV +YS+NP +F++DF  AM+KM ++ PLTG+ G+IRKNC + N
Sbjct  264   HSDQQLFNGGSADSIVTSYSNNPRSFSSDFVTAMIKMGDIRPLTGSNGEIRKNCGRIN  321



>ref|XP_006365326.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=322

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 238/298 (80%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS +FYS +CP     +++ V +A+  E RMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  25    AQLSTSFYSKSCPKLYQTVKSTVQSAIKKETRMGASLLRLFFHDCFVNGCDGSLLLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+ A PN+NS+RG  VIDNIK+ +EK+C GVVSCADI+AV ARDSVV LGGP+WN+
Sbjct  85    SFTGEKRAAPNVNSVRGFEVIDNIKSAVEKACPGVVSCADILAVTARDSVVILGGPNWNV  144

Query  748   LLGRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ AANS       +L++LIS+FS  G S ++MVALSGSHTIGQA+C+ F
Sbjct  145   KLGRRDARTASQGAANSSIPAPTFNLNRLISSFSAVGLSTKDMVALSGSHTIGQARCTTF  204

Query  571   RSRIYNE-NNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R+RIYNE N+I++SFA   + +CP++   GDNNLAPLD  TP+ FDN YFKNL ++KGLL
Sbjct  205   RARIYNETNSIDSSFARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNLVNKKGLL  264

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQLFNGGS DSIV +Y +NPS+F +DF  AM+KM ++ PLTG+ G+IRKNCR+ N
Sbjct  265   HSDQQLFNGGSADSIVRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRKNCRRRN  322



>ref|XP_009593782.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 233/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLSANFY T+C N  +I+ +A+  AVN E+R+GAS+LRL FHDCFVNGCDASILLDDTA
Sbjct  25    AQLSANFYGTSCRNLQTIVSSAMRQAVNRESRLGASILRLFFHDCFVNGCDASILLDDTA  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS RG  VID IKTQ+E +C   VSCADI+A+AAR+ VV LGGPSW +
Sbjct  85    TFTGEKNANPNRNSARGFEVIDTIKTQVEAACPNAVSCADILALAAREGVVLLGGPSWAV  144

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQSAAN+       SLS L+S FS KG +AR+M ALSG HTIGQA+C+ F
Sbjct  145   PLGRRDARTASQSAANTQIPAPTSSLSTLLSMFSAKGLNARDMTALSGGHTIGQARCTTF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI+A FAT  +A CP SGGD NLAPLD  TP  FDN Y++NL +++GLLHSD
Sbjct  205   RTRIYNDTNIDAQFATTRRATCPSSGGDANLAPLDIQTPNRFDNDYYQNLVARRGLLHSD  264

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGS D++V +YS+N + F +DFA AMV+M N+SPLTGT G+IR+NCR  N
Sbjct  265   QELFNGGSQDALVRSYSTNGAAFRSDFAAAMVRMGNISPLTGTNGEIRRNCRAIN  319



>ref|XP_003602462.1| Peroxidase [Medicago truncatula]
 gb|AES72713.1| class III peroxidase [Medicago truncatula]
Length=322

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS TCP   SI+Q  V +A++ EAR+GAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  26    AQLSTNFYSKTCPKLSSIVQRQVQSAISKEARIGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             NFTGE++A PN NS+RG +VIDNIKT +E  C GVVSCADI+A+AA DSV  LGGP+WN+
Sbjct  86    NFTGEKNALPNKNSVRGFDVIDNIKTAVENVCPGVVSCADILAIAATDSVAILGGPTWNV  145

Query  748   LLGRRDSTTASQSAANslpgpglslSQLI-STFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+TTASQS AN+      S   ++ S F N G S +++VALSG+HTIGQA+C+ F
Sbjct  146   KLGRRDATTASQSDANTAIPRPTSNLNILTSMFKNVGLSTKDLVALSGAHTIGQARCTTF  205

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R RIYNE NI+ SFA+  ++NCP++   GDNNLAPLD  TPTSFDN Y++NL   KGLLH
Sbjct  206   RVRIYNETNIDTSFASTRQSNCPKTSGSGDNNLAPLDLHTPTSFDNCYYRNLVQNKGLLH  265

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGST+SIV+ Y +N ++F +DFA AM+KM ++ PLTG+ G+IRKNCRK N
Sbjct  266   SDQQLFNGGSTNSIVSGYFNNQNSFFSDFATAMIKMGDIKPLTGSNGEIRKNCRKPN  322



>ref|XP_009388702.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=456

 Score =   395 bits (1016),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/292 (66%), Positives = 236/292 (81%), Gaps = 1/292 (0%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLS  FYS+TCPN  SI+++A+  AVN E RM AS+LRL FHDCFV+GCD SILLDDT+ 
Sbjct  26    QLSPTFYSSTCPNLQSIVRSAMTQAVNKERRMAASILRLFFHDCFVSGCDGSILLDDTST  85

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGE++AGPN NS+RG  VID IK+ +E +C   VSCADI+A+AARD VV LGGP+W + 
Sbjct  86    FTGEKNAGPNANSVRGFEVIDTIKSNVETACKATVSCADILALAARDGVVLLGGPTWTVQ  145

Query  745   LGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRD+TTASQS+ANS     G SLSQLIS+FS+KG SAR+M ALSG+HTIGQA+C+ FR
Sbjct  146   LGRRDATTASQSSANSNLPSPGSSLSQLISSFSSKGLSARDMTALSGAHTIGQARCTTFR  205

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             S IYN+ N++ASFA+  K  CP SGGD+NLAPLD  TPT+FDN Y++NL  ++GLLHSDQ
Sbjct  206   SHIYNDANVDASFASTHKHTCPASGGDSNLAPLDLKTPTTFDNRYYQNLVVRRGLLHSDQ  265

Query  388   QLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRK  233
             +LFN GS DS+V  YS+N + F+ DFA AMVKM N+SPLTGTKG+IR NCRK
Sbjct  266   ELFNKGSQDSLVRQYSTNAAAFSCDFAAAMVKMGNISPLTGTKGEIRLNCRK  317


 Score =   196 bits (499),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  646  KGFSAREMVALSGSHTIGQAKCSFFRSRIYNENNINASFATLLKANCPQSGGDNNLAPLD  467
            K  +AR++ ALSG+HTIGQA+C  FRS IYN+ NI+ASFA+  + NCP SGGDN LAPLD
Sbjct  317  KNLNARDLTALSGAHTIGQARCVNFRSHIYNDANIDASFASQTQQNCPSSGGDNTLAPLD  376

Query  466  TTTPTSFDNAYFKNLQSQKGLLHSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMS  287
              TPT+FDNAY++NL SQKGLLHSDQ+LFN G+ D++V  YS+N + F+ DFA AMVKM 
Sbjct  377  LQTPTAFDNAYYQNLVSQKGLLHSDQELFNNGTQDALVRQYSTNAAAFSRDFAAAMVKMG  436

Query  286  NLSPLTGTKGQIRKNCRKTN  227
            N+SPLTG++G+IR +C+K N
Sbjct  437  NISPLTGSQGEIRLDCKKVN  456



>ref|XP_002323054.1| hypothetical protein POPTR_0016s14030g [Populus trichocarpa]
 gb|EEF04815.1| hypothetical protein POPTR_0016s14030g [Populus trichocarpa]
 gb|AHL39187.1| class III peroxidase [Populus trichocarpa]
Length=317

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 200/296 (68%), Positives = 239/296 (81%), Gaps = 10/296 (3%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL++NFY T+CP+ LS+I++AV +AV++EARMGASLLRLHFHDCFVNGCDAS+LLD   
Sbjct  30    AQLASNFYGTSCPSVLSVIKSAVDSAVSNEARMGASLLRLHFHDCFVNGCDASVLLDG--  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
                GE++A  N NS+RG  VID+IKTQLE SC GVVSCADI++VAARDSVVALGGPSW +
Sbjct  88    ---GEKTAPANTNSLRGFEVIDSIKTQLESSCPGVVSCADILSVAARDSVVALGGPSWQV  144

Query  748   LLGRRDSTTASQ--SAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TA       N++P P LS+S LIS FSNKGF+A+EMVALSGSHTIGQA+C+ 
Sbjct  145   QLGRRDSATAGSVSDVNNNVPSPALSVSGLISAFSNKGFTAKEMVALSGSHTIGQARCTT  204

Query  574   FRSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             F +RI NE NI++SF T  +A C  +   NN  PLD T+PTSFD+AY++NL +QKGLLHS
Sbjct  205   FLTRINNETNIDSSFKTSTQAQCQNT---NNFVPLDVTSPTSFDSAYYRNLLNQKGLLHS  261

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLF+GGSTD+ V  YSSN + F TDFANAM+KM NLSPLTGT GQIR NCRK N
Sbjct  262   DQQLFSGGSTDAQVRAYSSNQAAFRTDFANAMIKMGNLSPLTGTNGQIRTNCRKAN  317



>ref|XP_004958680.1| PREDICTED: peroxidase 70-like [Setaria italica]
Length=317

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/296 (65%), Positives = 231/296 (78%), Gaps = 3/296 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             +LS  FYS +CP AL+ I+ AV  AV  E RMGASLLRLHFHDCFV GCDAS+LL+DTA 
Sbjct  22    RLSPTFYSRSCPRALATIKAAVTAAVAQEPRMGASLLRLHFHDCFVQGCDASVLLNDTAT  81

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGEQ+A PN+ SIRG  V+DNIK Q+E  C   VSCADI+AVAARDSVVALGGPSW +L
Sbjct  82    FTGEQTAFPNVGSIRGFTVVDNIKAQVEAVCPRTVSCADILAVAARDSVVALGGPSWRVL  141

Query  745   LGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRDSTTAS S ANS    P L L+ L + F+ KG S  ++VALSG+HTIG A+C+ FR
Sbjct  142   LGRRDSTTASLSLANSDLPAPSLDLANLTAAFARKGLSRTDLVALSGAHTIGLAQCTNFR  201

Query  568   SRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             +RIYNE NINA+FATL +A CP +   GD NLAPLDT T T+FDNAY+ NL++Q GLLHS
Sbjct  202   ARIYNETNINAAFATLRRAGCPAAAGNGDGNLAPLDTATATAFDNAYYTNLRAQSGLLHS  261

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLFNGG+TD +V TY+S P+ F  DFA +MV+M N+SPLTG++GQIR  C + N
Sbjct  262   DQQLFNGGATDGLVRTYASTPTRFNRDFAASMVRMGNISPLTGSQGQIRLACSRVN  317



>ref|XP_011076613.1| PREDICTED: peroxidase P7 [Sesamum indicum]
Length=321

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 239/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS +FYS +CPN  + +++ V +AV +EARMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  25    AQLSPDFYSKSCPNLFATVKSVVHSAVQNEARMGASLLRLFFHDCFVNGCDGSILLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+ A PN NS RG +V+D IK+ +EK+C GVVSCAD++A+AARDSVV LGGP WN+
Sbjct  85    SFTGEKGAVPNRNSARGFDVVDQIKSAVEKACPGVVSCADVLAIAARDSVVILGGPDWNV  144

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TAS++AAN+   P  S    LIS F+  G S +++VALSGSHTIGQA+C+ F
Sbjct  145   KLGRRDAKTASRAAANNGIPPPTSNLNALISRFNALGLSTKDLVALSGSHTIGQARCTSF  204

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE+N++ S A   K NCP++   GDNNLAPLD  TPT+FDN YFKNL S++GLLH
Sbjct  205   RARIYNESNLDTSLAQTRKGNCPRASGVGDNNLAPLDLQTPTNFDNNYFKNLVSRRGLLH  264

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLF GG+TDSIV TYS++P+TF +DFA AM+KM ++ PLTG+ G++RKNCR+ N
Sbjct  265   SDQQLFIGGATDSIVRTYSNDPNTFKSDFAAAMLKMGDIRPLTGSNGEVRKNCRRVN  321



>ref|XP_010925616.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/294 (65%), Positives = 230/294 (78%), Gaps = 1/294 (0%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLS  FYS  CPN  SI+++ +A AV  E RM AS+LRL FHDCFVNGCD SILLDDT  
Sbjct  24    QLSPTFYSRNCPNLQSIVRSVMAQAVQKEPRMAASILRLFFHDCFVNGCDGSILLDDTPT  83

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGE++AGPN NS RG  VID IKTQ+E +C   VSCADI+A+AARD V  +GGP+WN+L
Sbjct  84    FTGEKNAGPNANSARGFEVIDAIKTQVEAACKATVSCADILALAARDGVALVGGPNWNVL  143

Query  745   LGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRD+ TASQSAANS     G SLS LIS F+ +G +A+E+ ALSG+HTIG+A+C FFR
Sbjct  144   LGRRDARTASQSAANSNLPGPGSSLSTLISMFAAQGLNAQELTALSGAHTIGRARCLFFR  203

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             +RI+NE N+NASFA L K  CP SGGD+NLAP D  TP  FDNAY+++L +Q+GLLHSDQ
Sbjct  204   NRIFNEANVNASFAALRKQTCPASGGDSNLAPFDIRTPDRFDNAYYQDLVNQQGLLHSDQ  263

Query  388   QLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +LFNGGS D++V  YS+NP+ FA DFA AMVKM N+SPLTG  G+IR NCRK N
Sbjct  264   ELFNGGSQDALVRQYSTNPALFARDFAAAMVKMGNISPLTGNSGEIRLNCRKIN  317



>ref|XP_004234419.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=320

 Score =   390 bits (1001),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 231/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLSANFY T+CPN  +I++ A+  AVN EAR+GAS+LRL FHDCFVNGCDASILLDDT+
Sbjct  26    AQLSANFYGTSCPNLQTIVRNAMTQAVNREARLGASILRLFFHDCFVNGCDASILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              F GE++A PN NS RG  VID IKTQ+E +C  V+SCADI+A+AAR+  V LGGPSW +
Sbjct  86    TFIGEKNANPNRNSARGYEVIDTIKTQVEAACPNVISCADILALAAREGTVLLGGPSWAV  145

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQSAAN+       SL+ LIS FS KG SAR+M ALSGSHTIGQA+C+ F
Sbjct  146   PLGRRDARTASQSAANTQIPAPSSSLATLISMFSAKGLSARDMTALSGSHTIGQARCTTF  205

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI+  FA   +A CP SGGD NLAPLD  TP  FDN Y++NL  ++GLLHSD
Sbjct  206   RNRIYNDTNIDPQFAATRRATCPASGGDANLAPLDIQTPNRFDNDYYQNLVVRRGLLHSD  265

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGS D++V +YS+N ++F +DFA AMVKM N+SPLTGT G+IR NCR  N
Sbjct  266   QELFNGGSQDALVRSYSNNGASFRSDFAAAMVKMGNISPLTGTNGEIRTNCRAIN  320



>ref|XP_004965567.1| PREDICTED: peroxidase 4-like [Setaria italica]
Length=325

 Score =   390 bits (1001),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 226/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QL+ NFYS TCPN   I++  +A+AV  E RMGAS+LR+ FHDCFVNGCD SILLDDT+ 
Sbjct  32    QLAPNFYSRTCPNLARIVRRGMASAVQKERRMGASILRMFFHDCFVNGCDGSILLDDTST  91

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGE+ AGPN NS+RG  VID IK Q+E SC   VSCADI+A+AARD V  LGGP+W++ 
Sbjct  92    FTGEKGAGPNANSVRGFEVIDAIKAQVEASCTATVSCADILALAARDGVNLLGGPTWSVP  151

Query  745   LGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGR+DS TASQSAAN      G SLS LIS F N+G SAR+M ALSG+HTIG+++C FFR
Sbjct  152   LGRKDSRTASQSAANDNLPGPGSSLSTLISMFGNQGLSARDMTALSGAHTIGRSQCQFFR  211

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             SRIY E N+NASFA L +  CP+SGGD NLAP D  TP  FDNAY++NL  QKGLLHSDQ
Sbjct  212   SRIYTEPNVNASFAALRQRTCPRSGGDANLAPFDVQTPDGFDNAYYQNLLQQKGLLHSDQ  271

Query  388   QLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +LFNGGS D++V  YS+NP+ F++DF  AM+KM NL P  GT+ ++R NCRK N
Sbjct  272   ELFNGGSQDALVRQYSNNPALFSSDFVTAMIKMGNLLPSAGTRTEVRLNCRKVN  325



>ref|XP_007011229.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY20039.1| Peroxidase superfamily protein [Theobroma cacao]
Length=321

 Score =   390 bits (1001),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 238/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS N+YS TCP     +++ V +A+  EARMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  25    AQLSTNYYSKTCPKLFPTVKSTVHSAIMKEARMGASLLRLFFHDCFVNGCDGSLLLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +V+DNIK+ +E  C GVVSCADI+ +AARDSV  LGGP+W++
Sbjct  85    SFTGEKNAAPNRNSARGFDVVDNIKSAVEDVCPGVVSCADILTIAARDSVAILGGPNWDV  144

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L++LIS F+  G S R+MVALSGSHTIG A+C+ F
Sbjct  145   KLGRRDARTASQAAANNSIPPPTSNLNRLISRFNALGLSTRDMVALSGSHTIGLARCTSF  204

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R RIYNE+NI++SFA   + NCP++   GDNNLAPLD  TPT FDN YFKNL +++GLLH
Sbjct  205   RPRIYNESNIDSSFAQTRQRNCPRTTGSGDNNLAPLDIQTPTFFDNNYFKNLINRRGLLH  264

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  YS+NPS+F++DF   M+KM ++SPLTG++G+IRKNCR+ N
Sbjct  265   SDQQLFNGGSTDSIVRGYSNNPSSFSSDFVTGMIKMGDISPLTGSRGEIRKNCRRVN  321



>gb|EYU46002.1| hypothetical protein MIMGU_mgv1a009759mg [Erythranthe guttata]
Length=332

 Score =   390 bits (1002),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 233/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+ ++Y  TCP     +++AV +A+  E RMGASL+RLHFHDCFV GCDAS+LLDDT+
Sbjct  35    AQLTEDYYKKTCPKVFDTVESAVKSAIKKEKRMGASLIRLHFHDCFVQGCDASVLLDDTS  94

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NSIRG NV+D+IK+++E  C GVVSCADI+A+AARDSV  LGGP W++
Sbjct  95    SFTGEKTAAPNNNSIRGFNVVDDIKSKVESVCPGVVSCADILAIAARDSVSILGGPEWDV  154

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              +GRRDS TAS +AANS     P  +L+ L++ F  +G S ++MVALSG+HTIGQA+CS 
Sbjct  155   KVGRRDSKTASLAAANSGVIPPPTSTLNNLVNRFQARGLSTKDMVALSGAHTIGQARCSL  214

Query  574   FRSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR+RIYNE NI+ASFA   + NCP++   GDNNLA LD  +PT FDNAY+KNL  +KGLL
Sbjct  215   FRTRIYNETNIDASFARKRQDNCPRTTGSGDNNLASLDVKSPTFFDNAYYKNLIKKKGLL  274

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ L+NGGSTDS++ TYS  P TF  DF  AM+KM ++SPLTG+ G+IRKNCR+ N
Sbjct  275   HSDQILYNGGSTDSLIETYSKKPETFNDDFVTAMIKMGDISPLTGSNGEIRKNCRRAN  332



>ref|XP_011003587.1| PREDICTED: cationic peroxidase 1-like [Populus euphratica]
Length=317

 Score =   389 bits (1000),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 200/296 (68%), Positives = 238/296 (80%), Gaps = 10/296 (3%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL++NFY T+CP+ LS+I++AV +AV++EARMGASLLRLHFHDCFVNGCDAS+LLD   
Sbjct  30    AQLASNFYGTSCPSVLSVIKSAVNSAVSNEARMGASLLRLHFHDCFVNGCDASVLLDG--  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
                GE++A  N NS+RG +VIDNIKTQLE SC GVVSCADI+ VAARDSVVALGGPSW +
Sbjct  88    ---GEKTAPANANSLRGFDVIDNIKTQLESSCPGVVSCADILTVAARDSVVALGGPSWQV  144

Query  748   LLGRRDSTTASQ--SAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TA       N++P P LS S LIS FSNKGF+A+EMVALSGSHTIGQA+C+ 
Sbjct  145   RLGRRDSATAGSVSDVNNNIPSPALSASGLISAFSNKGFTAKEMVALSGSHTIGQARCTT  204

Query  574   FRSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             F +RI NE NI++SF T  +A C  +   N+  PLD T+PTSFD+AY++NL +QKGLLHS
Sbjct  205   FLTRINNETNIDSSFKTSTQAQCQNT---NSFVPLDVTSPTSFDSAYYRNLLNQKGLLHS  261

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQQLF+GGSTD+ V  YSSN + F TDFANAM+KM NLSPLTGT GQIR NCRK N
Sbjct  262   DQQLFSGGSTDAQVRAYSSNQAAFRTDFANAMIKMGNLSPLTGTNGQIRTNCRKAN  317



>ref|XP_006470885.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=317

 Score =   389 bits (1000),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 231/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY  TCP AL  I+T + NAV+ E RM ASLLRLHFHDCFV GCDASILLDD++
Sbjct  23    AQLSPTFYDATCPRALKTIRTGIRNAVSGERRMAASLLRLHFHDCFVQGCDASILLDDSS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +   E++A PN  S+RG  VID++K+QLE  C GVVSCADIVAVAARD+  A+GGPSW +
Sbjct  83    SIDSEKNALPNFKSVRGFEVIDSVKSQLESVCPGVVSCADIVAVAARDASFAVGGPSWTV  142

Query  748   LLGRRDSTTASQSAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
              LGRRDSTTAS+S A +LP     L +LISTF+ KGFSAR++VALSG+HTIGQA+C+FFR
Sbjct  143   KLGRRDSTTASRSLAENLPSFTDGLDRLISTFATKGFSARDLVALSGAHTIGQAQCAFFR  202

Query  568   SRIY-NENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
              RIY N+++I+A FA+  +  CP SGGD+NL+PLD  TP SFDN YFKNL  +KGLL SD
Sbjct  203   DRIYSNQSDIDAGFASTRRRECPASGGDSNLSPLDLVTPDSFDNNYFKNLVQKKGLLASD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LF+GGSTDSIV+ YS N S F +DFA AM+KM+++SPLTGT GQIR+ C   N
Sbjct  263   QVLFSGGSTDSIVDEYSKNRSKFKSDFAAAMIKMADISPLTGTAGQIRRVCNLVN  317



>ref|XP_006470332.1| PREDICTED: peroxidase 4-like [Citrus sinensis]
Length=320

 Score =   389 bits (1000),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 237/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY+ TC N L  +++ V +A++ EARMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  24    AQLSTNFYANTCKNLLPTVKSVVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A  N NS RG  VIDNIK+ +EK+C GVVSCADI+A+ ARDSVV LGGPSW +
Sbjct  84    SFTGEKNANANRNSARGFQVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPSWRV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TAS SAANS    P  +L+QL S F+  G S +++VAL+G HTIGQA+C+ F
Sbjct  144   KLGRRDARTASLSAANSGIPAPTSNLNQLTSRFNALGLSNKDLVALAGGHTIGQARCTSF  203

Query  571   RSRIYNENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+ IYNE NI+ASFA   + NCP++   GDNNLAPLD  TPT FDN YFKNL ++KGLLH
Sbjct  204   RAHIYNETNIDASFARTRQGNCPRANGTGDNNLAPLDLQTPTCFDNNYFKNLVNRKGLLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDS V TYS+NPSTF++DF   M+KM ++SPLTG++G+IRKNCR+ N
Sbjct  264   SDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIKMGDISPLTGSRGEIRKNCRRVN  320



>ref|XP_008369323.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=335

 Score =   390 bits (1001),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 233/294 (79%), Gaps = 2/294 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             +L+ NFY + CP ALSI+Q  V  A+ +E R+GASLLRLHFHDCFVNGCDAS+LLDDT+N
Sbjct  43    KLTKNFYKSKCPKALSIVQEEVIAAIKNETRVGASLLRLHFHDCFVNGCDASVLLDDTSN  102

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             F GE++A PN NSIRG  V+D IK +LEK+C GVVSCAD++A+AARDSVV  GGPSW + 
Sbjct  103   FVGEKTAVPNNNSIRGFEVVDGIKAKLEKACPGVVSCADLLALAARDSVV-YGGPSWKVR  161

Query  745   LGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRDSTTAS+SAAN+   P   ++S LIS+FS +G S R++VALSGSHTIG A+C+ FR
Sbjct  162   LGRRDSTTASRSAANTSIPPPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTSFR  221

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             SRIYNE+ INA+FA  L+ +CP+SG DNNLA LD  TPT FDN Y+KNL  +KGLLHSDQ
Sbjct  222   SRIYNESTINAAFAKSLQGSCPRSGSDNNLASLDLQTPTHFDNLYYKNLLKEKGLLHSDQ  281

Query  388   QLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +L+NG STD +V  Y++N   F   FA AMVKM N+ PLTG++G+IR NCRK N
Sbjct  282   ELYNGTSTDKLVKKYANNTFVFFKHFAKAMVKMGNIDPLTGSQGEIRTNCRKVN  335



>gb|KHG09190.1| Peroxidase 4 [Gossypium arboreum]
Length=322

 Score =   389 bits (1000),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 235/298 (79%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS +FYS +CP  LS +++ V +AV+ E RMGASL+RL FHDCFV GCD SILLDDT+
Sbjct  25    AQLSTSFYSKSCPKVLSTVESVVKSAVSKEKRMGASLVRLFFHDCFVKGCDGSILLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +F GE++A PN NS+RG NV+D+IK ++EK C GVVSCADI+A+AARDSVV LGGP W++
Sbjct  85    SFRGEKTAAPNNNSVRGFNVVDDIKAKVEKVCPGVVSCADILALAARDSVVILGGPGWDV  144

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TAS +AANS     P  +LSQLI+ F  +G SA++MVALSG+HTIG+A+C  
Sbjct  145   KLGRRDSKTASFAAANSGVIPPPTATLSQLINRFQARGLSAKDMVALSGAHTIGKARCVL  204

Query  574   FRSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR RIYNE NI+ASFA   +++CP++   GDNNLAPLD  TP SFD  YF NL ++KGLL
Sbjct  205   FRDRIYNETNIDASFAKARQSSCPRTSGSGDNNLAPLDVATPNSFDLKYFNNLLNKKGLL  264

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ LFNGGSTDS+V TYSSN   F +DF  AM+KM +++PLTG+ G+IRKNCRK N
Sbjct  265   HSDQILFNGGSTDSLVKTYSSNTKKFYSDFVTAMIKMGDITPLTGSNGEIRKNCRKPN  322



>emb|CAA59484.1| pox1 [Triticum aestivum]
Length=316

 Score =   389 bits (999),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 226/289 (78%), Gaps = 1/289 (0%)
 Frame = -1

Query  1090  FYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEQ  911
             FY T+CPNAL+ I+  V  AV +EARMGASL+RLHFHDCFV+GCD S+LL DT +F GEQ
Sbjct  27    FYDTSCPNALATIKAGVTTAVQNEARMGASLVRLHFHDCFVDGCDGSVLLADTGSFIGEQ  86

Query  910   SAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLLGRRD  731
              A PN NSIRG+NVIDNIKTQ+E  C   VSCADI+AVAARDSVVALGGP+W +LLGRRD
Sbjct  87    GAAPNNNSIRGMNVIDNIKTQVEAVCKQTVSCADILAVAARDSVVALGGPTWTVLLGRRD  146

Query  730   STTASQS-AANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRSRIYN  554
             STTAS++ A N LP P   L  L + F NK  S  +MVALSG+HTIGQ++C FFR RIYN
Sbjct  147   STTASKTNAENDLPPPTFDLQNLTTLFGNKQLSMTDMVALSGAHTIGQSQCRFFRDRIYN  206

Query  553   ENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQLFNG  374
             E NIN +FAT L+ANCPQSGGD++LAPLDT TP  FDNAY+ NL SQKGLLHSDQ LFNG
Sbjct  207   ETNINTTFATSLRANCPQSGGDSSLAPLDTQTPNGFDNAYYTNLMSQKGLLHSDQVLFNG  266

Query  373   GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             G  D+ V ++SS+ +TF + F  AMV M N++P TGT+GQIR  C K N
Sbjct  267   GGADNTVRSFSSSAATFNSAFTTAMVNMGNIAPKTGTQGQIRLVCSKVN  315



>gb|AFK41406.1| unknown [Lotus japonicus]
Length=322

 Score =   389 bits (999),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 200/298 (67%), Positives = 248/298 (83%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS++CP   S ++++V +A++ EARMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  25    AQLSTNFYSSSCPKLFSTVKSSVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +VIDNIK+ +E +C GVVSCADI+A++ARDSVV+LGGP+WN+
Sbjct  85    SFTGEKNANPNRNSARGFDVIDNIKSAVEAACPGVVSCADILAISARDSVVSLGGPTWNV  144

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQSAAN+    P  SLSQL S FS  G S++++VALSG+HTIGQA+C+ F
Sbjct  145   KVGRRDAKTASQSAANTGIPAPTSSLSQLTSRFSALGLSSKDLVALSGAHTIGQARCTSF  204

Query  571   RSRIYNE-NNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R+RIYNE + I +SFAT  K+NCP +   GDNNLAPLD  TPTSFDN YFKNL   KGLL
Sbjct  205   RARIYNETSTIESSFATSRKSNCPSTSGSGDNNLAPLDLQTPTSFDNNYFKNLVQNKGLL  264

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQLFNGGSTDS V  YS+NPS+F++DFA+AMVKM ++SPLTG+ G+IRKNCRKTN
Sbjct  265   HSDQQLFNGGSTDSTVRGYSTNPSSFSSDFASAMVKMGDISPLTGSNGEIRKNCRKTN  322



>ref|XP_009420366.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=317

 Score =   389 bits (999),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 232/295 (79%), Gaps = 2/295 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLS+ FYST+CP A+  I+ AV  AV  EARMGASLLRLHFHDCFVNGCD S+LLDDT+ 
Sbjct  23    QLSSTFYSTSCPLAIQTIRLAVRAAVAKEARMGASLLRLHFHDCFVNGCDGSVLLDDTSG  82

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGE++A PN NS+RG +VIDNIK+Q+E  C  VVSCADI+AVAAR+SV ALGGP W + 
Sbjct  83    FTGEKTAVPNNNSLRGFDVIDNIKSQVEAVCKQVVSCADILAVAARESVAALGGPLWTVQ  142

Query  745   LGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRD+TTAS  AAN+    P   L  LIS +S KG    +MVALSG+HTIGQA+C  FR
Sbjct  143   LGRRDATTASLDAANTEIPSPKSDLDDLISAYSKKGLGTTDMVALSGAHTIGQARCISFR  202

Query  568   SRIYNENNINASFATLLKANCPQSG-GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
              RIYNE +I++S AT  ++NCP SG GD+NL+PLD  T T FDN YF+NL  +KGLLHSD
Sbjct  203   DRIYNETSIDSSLATSRQSNCPSSGDGDDNLSPLDAVTCTLFDNFYFRNLVKKKGLLHSD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF+GGSTDS+V TYS+N + F +DFA AMVKM N+SPLTGT G++R NCRKTN
Sbjct  263   QQLFSGGSTDSLVTTYSTNTARFFSDFAAAMVKMGNISPLTGTDGEVRLNCRKTN  317



>ref|XP_009369543.1| PREDICTED: peroxidase 4-like [Pyrus x bretschneideri]
Length=327

 Score =   389 bits (999),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 234/298 (79%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CP     +++ V +AV+ E RMGASLLRLHFHDCFVNGCD S+LLDDT+
Sbjct  30    AQLSTNFYSKSCPKVFDTVKSVVKSAVSKEKRMGASLLRLHFHDCFVNGCDGSLLLDDTS  89

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN NS RG  V+D IK+Q+EK+C GVVSCADI+A+A+RDSV  LGGPSW +
Sbjct  90    SFTGEKTAGPNNNSARGFEVVDKIKSQVEKACPGVVSCADILAIASRDSVQILGGPSWEV  149

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TAS SAANS     P  +L++L++ F   G S R++VALSG+HTIGQA+C+ 
Sbjct  150   KLGRRDSKTASLSAANSGVIPPPTATLNELVTRFRAVGLSQRDLVALSGAHTIGQARCTT  209

Query  574   FRSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR+RIYNE NI+ASFA   +  CP++   GDNNLAPLD TTP +FD AYFKNL +QKGLL
Sbjct  210   FRARIYNETNIDASFARTRQNTCPRTVGSGDNNLAPLDVTTPNTFDTAYFKNLVNQKGLL  269

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ LFN G+T+S+V +YS N  TF +DFA AM+KM +  PLTG+KG+IR NCRK N
Sbjct  270   HSDQILFNSGATNSLVKSYSGNAETFNSDFAKAMIKMGDNKPLTGSKGEIRLNCRKPN  327



>ref|XP_010246464.1| PREDICTED: peroxidase P7-like [Nelumbo nucifera]
Length=319

 Score =   389 bits (998),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 232/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY+ TCPN  +I++  +  AVN E R+GAS+LRL FHDCFVNGCDASILLDDTA
Sbjct  25    AQLSTNFYANTCPNLPTIVRNGMRQAVNRERRLGASILRLFFHDCFVNGCDASILLDDTA  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS RG  VID+IK+Q+E SC   VSCADI+A+AARD VV LGGP+WN+
Sbjct  85    TFTGEKNAAPNRNSARGFEVIDSIKSQVEASCNATVSCADILALAARDGVVLLGGPTWNV  144

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQS ANS       +LS LIS F+ KG SAR+M  LSG+HTIGQA+C  F
Sbjct  145   PLGRRDARTASQSGANSQIPGPSENLSSLISKFAAKGLSARDMTVLSGAHTIGQAQCRTF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI+A+FA   +ANCP +GGD NLAPLD  TP  FDN Y+ NL +++GLLHSD
Sbjct  205   RNRIYNDTNIDANFAATRRANCPATGGDANLAPLDIQTPARFDNNYYGNLVARRGLLHSD  264

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGS DS+V +YS++ ++FA DF+ AMV+M N+SPLTGT G+IR NCR+ N
Sbjct  265   QELFNGGSQDSLVRSYSTDGTSFARDFSAAMVRMGNISPLTGTNGEIRLNCRRVN  319



>ref|XP_010228647.1| PREDICTED: peroxidase 2-like [Brachypodium distachyon]
Length=325

 Score =   389 bits (999),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 229/289 (79%), Gaps = 1/289 (0%)
 Frame = -1

Query  1090  FYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEQ  911
             FY  +CP+AL+ I++AV  AV+ E RMGASLLRLHFHDCFV GCDAS+LL DTANFTGEQ
Sbjct  37    FYDASCPSALATIKSAVTAAVSKEPRMGASLLRLHFHDCFVQGCDASVLLADTANFTGEQ  96

Query  910   SAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLLGRRD  731
             +A PN NSIRGL+VID +K Q+E  C  +VSCADI+AVAARDSVV LGGPS+ + LGRRD
Sbjct  97    TAFPNANSIRGLDVIDTVKAQVEAVCTQIVSCADILAVAARDSVVTLGGPSYTVPLGRRD  156

Query  730   STTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRSRIYN  554
             STTAS S AN+   P    L+ L+  FS KG S  +MVALSG+HTIGQA C+ F+SRIY 
Sbjct  157   STTASLSLANNDLPPPTSDLADLVGNFSRKGLSTTDMVALSGAHTIGQAACTNFQSRIYG  216

Query  553   ENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQLFNG  374
             E+NINA++A  L+ANCPQSGGD N APLD  TP +FDNAY+ NL SQ+GLLHSDQQL NG
Sbjct  217   ESNINAAYAASLQANCPQSGGDGNFAPLDVATPNAFDNAYYGNLVSQQGLLHSDQQLLNG  276

Query  373   GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             GSTD++V+TY+S+ + F+ DFA AMV M N+  LTG++GQIR NC K N
Sbjct  277   GSTDALVSTYASSATQFSADFAAAMVSMGNIGVLTGSQGQIRLNCAKVN  325



>ref|XP_009786874.1| PREDICTED: peroxidase P7 [Nicotiana sylvestris]
Length=319

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 233/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQL+  FYS +CP     +++ V +A+  E RMGASLLRL FHDCFVNGCD S+ LDDT+
Sbjct  22    AQLTTGFYSKSCPKLYETVKSVVHSAIQKETRMGASLLRLFFHDCFVNGCDGSLFLDDTS  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE+ A PN NS RG  VID+IK+ +EK C GVVSCADI+AV ARDSVV LGGP+W++
Sbjct  82    TFTGEKRAQPNFNSARGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWDV  141

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AANS    P  +L++LIS+FS  G S ++MVALSG+HTIGQA+C+ F
Sbjct  142   KLGRRDARTASQAAANSSIPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTSF  201

Query  571   RSRIYNE-NNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R+RIYNE NN+++S A   + NCP++   GDNNLAPLD  TPT FDN YF NL S+KGLL
Sbjct  202   RARIYNETNNLDSSLAKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFINLVSKKGLL  261

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQLFNGGS DSIV +YS NPS FATDF  AM+KM ++ PLTG+KG+IRKNCR+ N
Sbjct  262   HSDQQLFNGGSADSIVKSYSDNPSIFATDFVTAMIKMGDIRPLTGSKGEIRKNCRRIN  319



>gb|ACF08086.1| class III peroxidase [Triticum aestivum]
Length=316

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 227/289 (79%), Gaps = 1/289 (0%)
 Frame = -1

Query  1090  FYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEQ  911
             FY T+CPNAL+ I+  V  AV +EARMGASL+RLHFHDCFV+GCD S+LL DT +F GEQ
Sbjct  27    FYDTSCPNALATIKAGVTTAVQNEARMGASLVRLHFHDCFVDGCDGSVLLADTGSFIGEQ  86

Query  910   SAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLLGRRD  731
              A PN NSIRG+NVIDNIKTQ+E  C   VSCADI+AVAARDSVVALGGP+W +LLGRRD
Sbjct  87    GAAPNNNSIRGMNVIDNIKTQVEAVCKQTVSCADILAVAARDSVVALGGPTWTVLLGRRD  146

Query  730   STTASQS-AANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRSRIYN  554
             STTAS++ A N LP P   L  L + F NK  S  +MVALSG+HTIGQ++C FFR+RIYN
Sbjct  147   STTASKTNAENDLPPPTFDLQNLTTLFGNKQLSMTDMVALSGAHTIGQSQCRFFRNRIYN  206

Query  553   ENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQLFNG  374
             E NIN +FAT L+ANCPQSGGD++LAPLDT TP  FDNAY+ NL SQKGLLHSDQ LFNG
Sbjct  207   ETNINTTFATSLRANCPQSGGDSSLAPLDTQTPNGFDNAYYTNLMSQKGLLHSDQVLFNG  266

Query  373   GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             G  D+ V +++S+ +TF + F  AMV M N++P TGT+GQIR  C K N
Sbjct  267   GGADNTVRSFASSAATFNSAFTTAMVNMGNIAPKTGTQGQIRLVCSKVN  315



>ref|XP_009419858.1| PREDICTED: cationic peroxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=328

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/295 (65%), Positives = 242/295 (82%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS++FY+T+CPNAL IIQ+AV  AV  E RMGASLLRLHFHDCFV GCD S+LLDDT+
Sbjct  34    AQLSSSFYNTSCPNALPIIQSAVKAAVAKERRMGASLLRLHFHDCFVQGCDGSVLLDDTS  93

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++AGPN NS+RG +V+D IK++LE  C  VVSCADI+AVAARDSVVALGGPSW +
Sbjct  94    GFTGEKTAGPNNNSLRGFDVVDAIKSKLESDCKQVVSCADILAVAARDSVVALGGPSWTV  153

Query  748   LLGRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S+ANS       +L+ LIS FS+KG +  +MVALSG+HTIGQA+C+ F
Sbjct  154   QLGRRDSTTASFSSANSDIPRPDFNLTDLISAFSDKGLTTTDMVALSGAHTIGQARCTSF  213

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI++S A  L+++CP SG D++LAPLD +T T+FD+ Y++NL S KGLLHSD
Sbjct  214   RARIYNDTNIDSSLAASLQSSCPSSGDDDSLAPLDASTSTAFDSCYYRNLLSNKGLLHSD  273

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL  GGSTDS V++Y++N + F  DFA+AMVKM ++SPLTG+ G+IR +CRKTN
Sbjct  274   QQLHGGGSTDSQVSSYAANSAKFFRDFASAMVKMGSISPLTGSSGEIRTDCRKTN  328



>ref|XP_002278996.1| PREDICTED: peroxidase 4 [Vitis vinifera]
Length=321

 Score =   387 bits (995),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 237/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS ++YS +CP     +++AV +AV  EARMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  25    AQLSTDYYSQSCPKLFPTVKSAVKSAVAKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +F GE++A PN NS+RG +V+D+IK+++E +C GVVSCAD++A+AARDSVV LGGPSWN+
Sbjct  85    SFIGEKNAAPNANSVRGFDVVDDIKSKVETACPGVVSCADVLAIAARDSVVILGGPSWNV  144

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L+QLIS F   G S R++VAL+GSHTIGQA+C+ F
Sbjct  145   KLGRRDARTASQAAANNSIPPPTSNLNQLISRFQALGLSTRDLVALAGSHTIGQARCTSF  204

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NI+ SFA   ++NCP++   GDNNLAPLD  TPT+F+N Y+KNL  +KGLLH
Sbjct  205   RARIYNETNIDNSFAKTRQSNCPRASGSGDNNLAPLDLQTPTAFENNYYKNLIKKKGLLH  264

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGSTDSIV  YS++ S F   F   M+KM ++SPLTG+ G+IRKNCR+ N
Sbjct  265   SDQQLFNGGSTDSIVRKYSNSRSNFNAHFVAGMIKMGDISPLTGSNGEIRKNCRRVN  321



>ref|XP_011080738.1| PREDICTED: peroxidase 4-like [Sesamum indicum]
Length=329

 Score =   387 bits (995),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/299 (64%), Positives = 240/299 (80%), Gaps = 5/299 (2%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS +FY  +CPN  S++ + V +AV  E RMGASLLRLHFHDCFV GCD SILLDDT+
Sbjct  31    AQLSTDFYEKSCPNVFSVVNSVVKSAVQKEKRMGASLLRLHFHDCFVQGCDGSILLDDTS  90

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPNINS+RG  VID+IK+++E +C GV+SCADIVA+AARDSVV LGGP+W +
Sbjct  91    SFTGEKTAGPNINSVRGYEVIDSIKSKVEATCPGVISCADIVAIAARDSVVLLGGPTWEV  150

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              +GRRDS TAS SAAN+     P  +L+ LI+ F  KG S ++MV LSG+H+IGQA+C+ 
Sbjct  151   KVGRRDSKTASLSAANNGQLPPPTSTLTNLINRFQAKGLSTKDMVVLSGAHSIGQARCTV  210

Query  574   FRSRIYNE-NNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGL  404
             FR RIYNE +NI++SFA L + NCP++   GDNNLAPLD  TPT FDNAYFKNL ++KGL
Sbjct  211   FRDRIYNETSNIDSSFAKLRQGNCPRTNGSGDNNLAPLDLKTPTFFDNAYFKNLIAKKGL  270

Query  403   LHSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             LHSDQ L+NGGSTDS+V +YS NP +F  DF  AM++M +++PLTG+KG+IRKNCRK N
Sbjct  271   LHSDQVLYNGGSTDSLVESYSKNPQSFNGDFVAAMIRMGDITPLTGSKGEIRKNCRKPN  329



>emb|CBI19219.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   392 bits (1006),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 200/291 (69%), Positives = 234/291 (80%), Gaps = 4/291 (1%)
 Frame = -1

Query  1102  LSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANF  923
             LS NFY+ +CP AL  I+TAV  AV  E RMGASLLRLHFHDCF  GCDASILLDDTA F
Sbjct  25    LSPNFYARSCPRALPTIRTAVNKAVAKEKRMGASLLRLHFHDCF--GCDASILLDDTATF  82

Query  922   TGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLL  743
             TGE++AGPN NS+RG  VID IK+Q+E  C GVVSCADIVAVAARDSVVALGGP+W + L
Sbjct  83    TGEKTAGPNNNSVRGYEVIDTIKSQVESLCPGVVSCADIVAVAARDSVVALGGPTWTVRL  142

Query  742   GRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRS  566
             GRRDSTTAS SAA +   GP L+LSQLIS FS KG + +EMV LSG+HTIG+A+C+ FR+
Sbjct  143   GRRDSTTASFSAARTDLPGPNLNLSQLISAFSKKGLTTKEMVVLSGTHTIGKARCTSFRN  202

Query  565   RIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQ  386
              IYN+ +I+ +FA   +  CP+SGGD+NL+PLD TT T FDN YF+ L+ +KGLLHSDQ+
Sbjct  203   HIYNDTDIDPAFAASKQKICPRSGGDDNLSPLDGTT-TVFDNVYFRGLKEKKGLLHSDQE  261

Query  385   LFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRK  233
             L+NGGSTDSIV TYS N +TF  D ANAMVKM N+SPLTGT GQIR NCRK
Sbjct  262   LYNGGSTDSIVETYSINTATFFRDVANAMVKMGNISPLTGTNGQIRTNCRK  312



>ref|XP_008795235.1| PREDICTED: peroxidase P7-like [Phoenix dactylifera]
Length=317

 Score =   387 bits (994),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 227/294 (77%), Gaps = 1/294 (0%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLS  FY+ TCPN  SI+++ +A AV  E+RM AS+LRL FHDCFVNGCD SILLDDT  
Sbjct  24    QLSPTFYNRTCPNLQSIVRSVMAQAVQKESRMAASILRLVFHDCFVNGCDGSILLDDTPT  83

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGE++AGPN NS RG  VID IKTQ+E +C   VSCADI+A+A RD V  +GGP+WN+ 
Sbjct  84    FTGEKNAGPNANSARGFEVIDAIKTQVEAACRATVSCADILALAGRDGVALVGGPTWNVP  143

Query  745   LGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRD+ TASQSAANS       SLS LIS F+ KG +AR+M  LSG+HTIGQA+C+ FR
Sbjct  144   LGRRDARTASQSAANSNLPGPSSSLSTLISMFAAKGLNARDMTVLSGAHTIGQARCTLFR  203

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             SRI+NE N+NASFA L K  CP SGGD NLAPLD  +P  FDNAY+++L +++GLLHSDQ
Sbjct  204   SRIFNEANVNASFAALRKRTCPASGGDGNLAPLDVRSPDRFDNAYYQDLVARQGLLHSDQ  263

Query  388   QLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +LFNGGS D+ V  YS++ + FA DFA AMVKM N+SPLTGT G+IR NCRK N
Sbjct  264   ELFNGGSQDAQVRQYSTDSAQFARDFAAAMVKMGNISPLTGTSGEIRLNCRKIN  317



>ref|XP_008456761.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Cucumis melo]
Length=323

 Score =   387 bits (994),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 200/298 (67%), Positives = 238/298 (80%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYS++CPN LS ++++V +AV+SEARMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  26    AQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLXFHDCFVNGCDGSILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+SA PN NS RG +VIDNIKT +E +C GVVSCADI+A+AARDSVV LGGPSWN+
Sbjct  86    SFTGEKSANPNRNSARGFDVIDNIKTAVENACPGVVSCADILAIAARDSVVFLGGPSWNV  145

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTASQS AN+   GP  SLSQL S FS  G S  ++VALSG HTIGQA+C+ F
Sbjct  146   KLGRRDSTTASQSQANNDIPGPNSSLSQLSSRFSALGLSNTDLVALSGGHTIGQARCTTF  205

Query  571   RSRIY-NENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             RSRIY N +NI + FA   ++NCP +   GDNNLAPLD  TP SFDN YFKNL   KGLL
Sbjct  206   RSRIYSNSSNIESLFARTRQSNCPNTSGSGDNNLAPLDLQTPNSFDNNYFKNLVQNKGLL  265

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
              SDQ LFNGGSTDS+V  Y++ P+ F +DFA AMVKM +++PLTG+ GQIRKNCR+ N
Sbjct  266   QSDQVLFNGGSTDSVVRNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRRVN  323



>ref|XP_006470886.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=317

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 231/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY  TCP AL  I+T + NAV+ E RM ASLLRLHFHDCFV GCDASILLDD++
Sbjct  23    AQLSPAFYDATCPRALKTIRTGIRNAVSRERRMAASLLRLHFHDCFVQGCDASILLDDSS  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +   E++A PN  S+RG  VID++K+QLE  C GVVSCADIVAVAARD+  A+GGPSW +
Sbjct  83    SIDSEKNALPNFKSVRGFEVIDSVKSQLESVCPGVVSCADIVAVAARDASFAVGGPSWAV  142

Query  748   LLGRRDSTTASQSAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
              LGRRDSTTAS+S A +LP     L +LISTF+ KGF+AR++VALSG+HTIGQA+C+FFR
Sbjct  143   KLGRRDSTTASRSLAENLPSFTDGLDKLISTFATKGFTARDLVALSGAHTIGQAQCAFFR  202

Query  568   SRIY-NENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
              RIY N+++I+A FA+  +  CP SGGD+NL+PLD  TP SFDN YFKNL  +KGLL SD
Sbjct  203   DRIYSNQSDIDAGFASSRRRQCPASGGDSNLSPLDLVTPDSFDNNYFKNLVQKKGLLASD  262

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LF+GGSTDSIV+ YS N S F +DFA AM+KM+++SPLTGT GQIR+ C   N
Sbjct  263   QVLFSGGSTDSIVDEYSKNRSKFKSDFAAAMIKMADISPLTGTAGQIRRVCNLVN  317



>ref|XP_010261059.1| PREDICTED: cationic peroxidase 1-like isoform X1 [Nelumbo nucifera]
Length=318

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 230/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY+TTCP AL +I TAV  AV  E RMGASLLRLHFHDCFVNGCDASILLDDT 
Sbjct  24    AQLSPTFYATTCPLALPVISTAVNLAVAQERRMGASLLRLHFHDCFVNGCDASILLDDTP  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG  VID+IK QLE  C GV+SCADI+AVAARD+VVALGG +W +
Sbjct  84    TFTGEKTALPNANSVRGYEVIDSIKAQLELLCPGVISCADILAVAARDAVVALGGITWTV  143

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS   AN+      L+L  LI+ F+NKGF+  E+VALSGSHTIGQA+C  F
Sbjct  144   QLGRRDSTTASLDVANTDIPSPFLNLDDLITAFANKGFTVNELVALSGSHTIGQARCLLF  203

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R RIY E NI+  FA  L++NCP +GGDNNLA  DTTTPT FDNAYF NL + KGLLHSD
Sbjct  204   RDRIYKETNIDTQFAIALRSNCPTAGGDNNLANFDTTTPTVFDNAYFTNLLANKGLLHSD  263

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF GGSTD+ V TYS N + F TDF NAM+KM NLSPLTG+ GQIR NCR+ N
Sbjct  264   QQLFTGGSTDAQVRTYSINSAAFFTDFGNAMIKMGNLSPLTGSNGQIRANCRRVN  318



>ref|XP_007205551.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
 gb|EMJ06750.1| hypothetical protein PRUPE_ppa008607mg [Prunus persica]
Length=325

 Score =   387 bits (994),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 235/299 (79%), Gaps = 5/299 (2%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CP     +++ V +AVN E RMGASLLRLHFHDCFVNGCD SILLDDT+
Sbjct  27    AQLSTNFYSKSCPKVFDAVKSVVQSAVNKEKRMGASLLRLHFHDCFVNGCDGSILLDDTS  86

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS+RG  V+DNIK+Q+EK+C GVVSCADI+A+AARDSV  LGGPSWN+
Sbjct  87    SFTGEKTARPNNNSVRGFEVVDNIKSQVEKTCPGVVSCADILAIAARDSVKILGGPSWNV  146

Query  748   LLGRRDSTTASQSAANslpg--pglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRDS TAS +AANS     P  +LSQL + F   G + R++VALSG+HTIGQA+C+ 
Sbjct  147   KLGRRDSKTASLAAANSGVIPPPTSTLSQLKTRFQAVGLNERDLVALSGAHTIGQARCTS  206

Query  574   FRSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR+RIYNE NI+ASFA   ++ CP +   GDNNLAPLD  TP +FD AYFKNL +QKGLL
Sbjct  207   FRARIYNETNIDASFAKARQSKCPSTVGSGDNNLAPLDVQTPNTFDTAYFKNLINQKGLL  266

Query  400   HSDQQLF-NGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ L+ NGGSTDS+V TYS + +TF +DFA AM+KM +  PLTG+ G+IR NCR+ N
Sbjct  267   HSDQILYNNGGSTDSLVKTYSGSANTFNSDFAKAMIKMGDNKPLTGSNGEIRLNCRRPN  325



>ref|XP_003519407.1| PREDICTED: peroxidase 4-like [Glycine max]
 gb|KHN38568.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   387 bits (994),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 235/295 (80%), Gaps = 3/295 (1%)
 Frame = -1

Query  1102  LSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANF  923
             L  NFY ++CP     ++  V +A++ E RMGASLLRL FHDCFVNGCD SILLDDT++F
Sbjct  30    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  89

Query  922   TGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLL  743
             TGE++AGPN NS RG  VID IK+ +EK C GVVSCADI+A+AARDSV  LGGP+W++ L
Sbjct  90    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILGGPTWDVKL  149

Query  742   GRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRS  566
             GRRDS TASQSAAN+    P  +L+QLIS F+  G S +++VALSG HTIGQA+C+ FR+
Sbjct  150   GRRDSRTASQSAANNDIPRPTSNLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTFRA  209

Query  565   RIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RIYNE NI++SFA + ++ CP++   GDNNLAP+D  TP  FDN YFKNL  +KGL+HSD
Sbjct  210   RIYNETNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPRFFDNHYFKNLIQKKGLIHSD  269

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLFNGGSTDSIV TYS+NP++F  DF+ AM++M ++SPLTG++G+IR+NCR+ N
Sbjct  270   QQLFNGGSTDSIVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  324



>emb|CDP13933.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   387 bits (993),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 187/298 (63%), Positives = 235/298 (79%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFY  +CPN  S +++ V +A++ EARMGASLLRL FHDCFVNGCD S+LLDDT+
Sbjct  24    AQLSTNFYYHSCPNLFSTVKSTVQSAISKEARMGASLLRLFFHDCFVNGCDGSVLLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +F GE+ A PN NS RG  V+DNIK+ +E++C GVVSCAD++A+AARDSV  LGGP W++
Sbjct  84    SFRGEKRAAPNFNSARGFEVVDNIKSAVERACPGVVSCADVLAIAARDSVEILGGPRWDV  143

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+   P  +    LIS FS  G SAR++VALSGSHTIG A+C+ F
Sbjct  144   KLGRRDARTASQAAANNSIPPPTTNLNALISRFSAVGLSARDLVALSGSHTIGLARCTNF  203

Query  571   RSRIYNE-NNINASFATLLKANCP--QSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R+RIYNE NN+++S A   ++NCP     GDNNLAPLD  TPT+FDN YFKNL +++GLL
Sbjct  204   RARIYNETNNLDSSLARTRQSNCPSVSGSGDNNLAPLDLQTPTNFDNNYFKNLVNRRGLL  263

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQLFNGGSTDS V  YS+NP +FA+DFA AM+KM ++ PLTG+ G+IRKNCR+ N
Sbjct  264   HSDQQLFNGGSTDSAVRAYSNNPGSFASDFAAAMIKMGDIKPLTGSNGEIRKNCRRIN  321



>gb|ADN96693.1| peroxidase 6 [Rubia cordifolia]
Length=321

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/298 (63%), Positives = 231/298 (78%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS N+Y + CP   S +++ V +A+  E RMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  24    AQLSENYYYSACPKLYSTVKSTVQSAIAKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+ A PN+NS RG  V+D+IK  +EK C GVVSCADI+A+AA DSV  LGGPSWN+
Sbjct  84    SFTGEKKAAPNVNSARGFEVVDDIKAAVEKVCPGVVSCADILAIAAHDSVEILGGPSWNV  143

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN    P  +    LIS F++ G SA+++VALSGSHTIGQA+C+ F
Sbjct  144   KLGRRDARTASQAAANQTIPPPTTNLNGLISRFNSFGLSAKDLVALSGSHTIGQARCTNF  203

Query  571   RSRIYNE-NNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             R+RIYNE NN++ S A   + NCP++   GDNNLAPLD  TPT FDN YF NL S+KGLL
Sbjct  204   RARIYNETNNLDTSLARTRQGNCPRATGSGDNNLAPLDLETPTRFDNHYFVNLVSRKGLL  263

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQL+NGGSTD+IV  YSSNP +FA DFA AM+KM ++ PLTG+KG++R NCR+ N
Sbjct  264   HSDQQLYNGGSTDTIVRGYSSNPGSFAADFAAAMIKMGDIKPLTGSKGEVRSNCRRIN  321



>ref|XP_009790966.1| PREDICTED: peroxidase P7-like [Nicotiana sylvestris]
Length=319

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 230/295 (78%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLSANFY T+C N  +I+ +A+  AVN E R+GAS+LRL FHDCFVNGCDASILLDDTA
Sbjct  25    AQLSANFYGTSCRNLQTIVSSAMRQAVNREPRLGASILRLFFHDCFVNGCDASILLDDTA  84

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS RG  VID IKTQ+E +C   VSCADI+A+AAR+ VV LGGPSW +
Sbjct  85    TFTGEKNANPNRNSARGFEVIDTIKTQVEAACPNAVSCADILALAAREGVVLLGGPSWAV  144

Query  748   LLGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQSAAN+       SLS L+S FS KG +AR+M ALSG HTIGQA+C+ F
Sbjct  145   PLGRRDARTASQSAANTQIPAPTSSLSTLLSMFSAKGLNARDMTALSGGHTIGQARCTTF  204

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI+A FA   +A CP S GD NLAPLD  TP  FDN Y++NL +++GLLHSD
Sbjct  205   RTRIYNDTNIDAQFAATRRATCPSSSGDANLAPLDIQTPNRFDNDYYQNLVARRGLLHSD  264

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGS D++V +YS+N + F +DFA AMV+M N+SPLTGT G+IR+NCR  N
Sbjct  265   QELFNGGSQDALVRSYSTNDAAFRSDFAAAMVRMGNISPLTGTNGEIRRNCRAIN  319



>ref|XP_010045401.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=321

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 232/296 (78%), Gaps = 2/296 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CPN LS +++ V +AV+ E RMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  26    AQLSTNFYSKSCPNGLSTVKSVVQSAVSKERRMGASLLRLFFHDCFVNGCDGSILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +F GE++A PN  S+RG NVID IK+++E +C GVVSCADIVA+AARDSVV LGGPSW +
Sbjct  86    SFQGEKTARPNNKSLRGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEV  145

Query  748   LLGRRDSTTASQSAANslpgp--glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRD+ TAS S ANS   P    +LS LIS F  +G S R+MVALSGSHTIGQA+C+ 
Sbjct  146   KLGRRDARTASFSLANSGALPPPTSTLSNLISLFQAQGLSTRDMVALSGSHTIGQARCTS  205

Query  574   FRSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
             FR  IYN++NI+++F    +  CP   GDNN APLD  +PT+FDNAYFKNL S KGLL S
Sbjct  206   FRPHIYNDSNIDSAFRKTRQGQCPFGSGDNNPAPLDLRSPTAFDNAYFKNLLSNKGLLRS  265

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQ+LFNGGSTDS+V TYS+NP TF +DFA+AM+KM ++ PL G++G+IRK C K N
Sbjct  266   DQELFNGGSTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLKGSQGEIRKICSKVN  321



>ref|XP_010915493.1| PREDICTED: peroxidase P7-like [Elaeis guineensis]
Length=317

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 226/295 (77%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS  FY+ +CPN  SI+++ +A AV++E RMGAS+LRL FHDCFVNGCD SILL DTA
Sbjct  22    GQLSPTFYAKSCPNVQSIVRSGMAQAVSAEPRMGASILRLFFHDCFVNGCDGSILLADTA  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGEQ+AGPN NS+RG  VID IK ++E +C   VSCADI+A+AARD V  LGGP+W +
Sbjct  82    TFTGEQNAGPNKNSVRGFGVIDTIKARVEAACKATVSCADILALAARDGVNLLGGPTWTV  141

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+TTASQSAAN+      S    LIS F+ +G SA+EM ALSGSHTIGQA+C  F
Sbjct  142   QLGRRDATTASQSAANNNLPSPASSLSILISKFAAQGLSAQEMTALSGSHTIGQAQCKNF  201

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+ IYN+ +IN SFA L K NCP SGGD NLAPLD  TP  FDNAY++NL +QKGLLHSD
Sbjct  202   RAHIYNDTDINPSFAALRKRNCPASGGDTNLAPLDVQTPNGFDNAYYQNLVAQKGLLHSD  261

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LF+GGS D++V  YS+N + F+ DF  AMVKM ++SPLTGT G+IR NC K N
Sbjct  262   QELFDGGSQDALVRQYSTNAALFSRDFVQAMVKMGSISPLTGTSGEIRLNCGKVN  316



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/298 (67%), Positives = 240/298 (81%), Gaps = 5/298 (2%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
              QLS  FYS++CPN LS ++++V +AV+SEARMGAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  26    GQLSTGFYSSSCPNLLSTVKSSVRSAVSSEARMGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +VIDNIKT +EK+C GVVSCADI+A+AARDSVV LGGPSWN+
Sbjct  86    SFTGEKNANPNRNSARGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWNV  145

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTASQS AN+   GP  SLSQL S FS  G S+ ++VALSG HTIGQA+C+ F
Sbjct  146   KLGRRDSTTASQSQANNDIPGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARCTTF  205

Query  571   RSRIY-NENNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             RSRIY N +NI +SFA   ++NCP +   GDNNLAPLD  TPTSFDN Y+KNL   KGLL
Sbjct  206   RSRIYSNSSNIESSFARTRQSNCPNTSGTGDNNLAPLD-FTPTSFDNNYYKNLVQNKGLL  264

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
              SDQ LFNGGSTDS+V  Y++ P+ F +DFA AMVKM +++PLTG+ GQIRKNCR  N
Sbjct  265   QSDQVLFNGGSTDSVVQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRMVN  322



>emb|CAA59487.1| peroxidase [Triticum aestivum]
 gb|ACF08093.1| class III peroxidase [Triticum aestivum]
Length=319

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 226/297 (76%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY+ +CP A +II+  VA AV SE RMGASLLRLHFHDCFV GCDASILL DTA
Sbjct  23    AQLSPRFYARSCPRAQAIIRRGVAAAVRSERRMGASLLRLHFHDCFVQGCDASILLSDTA  82

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGEQ AGPN  SIRG+NVIDNIK Q+E  C   VSCADI+AVAARDSVVALGGPSW +
Sbjct  83    TFTGEQGAGPNAGSIRGMNVIDNIKAQVEAVCTQTVSCADILAVAARDSVVALGGPSWTV  142

Query  748   LLGRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S ANS   P    ++ L + F+ KG S  +MVALSG+HTIGQA+C  F
Sbjct  143   PLGRRDSTTASLSLANSDLPPPSFDVANLTANFAAKGLSVTDMVALSGAHTIGQAQCQNF  202

Query  571   RSRIYNENNINASFATLLKANCPQ--SGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R R+YNE NI+ +FAT L+ANCP+    GD++LAPLDTTTP +FDNAY++NL SQKGLLH
Sbjct  203   RDRLYNETNIDTAFATSLRANCPRPTGSGDSSLAPLDTTTPNAFDNAYYRNLMSQKGLLH  262

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQ L N G T  +V TYSS  + F  DF  AMV M N+SPLTGT+GQ+R +C + N
Sbjct  263   SDQVLINDGRTAGLVRTYSSASAQFNRDFRAAMVSMGNISPLTGTQGQVRLSCSRVN  319



>gb|ACD70388.1| class III peroxidase [Triticum aestivum]
Length=316

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/289 (66%), Positives = 226/289 (78%), Gaps = 1/289 (0%)
 Frame = -1

Query  1090  FYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEQ  911
             FY T+CPNAL+ I+  V  AV +EARMGASL+RLHFHDCFV+GCD S+LL DT +F GEQ
Sbjct  27    FYDTSCPNALATIKAGVTAAVQNEARMGASLVRLHFHDCFVDGCDGSVLLADTGSFIGEQ  86

Query  910   SAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLLGRRD  731
              A PN NSIRG+NVIDNIKTQ+E  C   VSCADI+AVAARDSVVALGGP+W +LLGRRD
Sbjct  87    GAAPNNNSIRGMNVIDNIKTQVEAVCKQTVSCADILAVAARDSVVALGGPTWTVLLGRRD  146

Query  730   STTASQS-AANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRSRIYN  554
             STTAS++ A N LP P   L  L + F NK  S  +MVALSG+HTIGQ++C FFR RIYN
Sbjct  147   STTASKTNAENDLPPPTFDLQNLTTLFGNKQLSMTDMVALSGAHTIGQSQCRFFRDRIYN  206

Query  553   ENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQLFNG  374
             E NI+ +FAT L+ANCP+SGGDN+LAPLDT TP  FDNAY+ NL SQKGLLHSDQ LFNG
Sbjct  207   ETNIDTAFATSLRANCPRSGGDNSLAPLDTGTPNGFDNAYYTNLMSQKGLLHSDQVLFNG  266

Query  373   GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             G  D+ V ++SS+ +TF + F  AM+ M N++P TGT+GQIR  C K N
Sbjct  267   GGADNTVRSFSSSAATFNSAFTTAMINMGNIAPKTGTQGQIRLVCSKVN  315



>ref|XP_010685964.1| PREDICTED: peroxidase 4-like [Beta vulgaris subsp. vulgaris]
Length=319

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/298 (63%), Positives = 237/298 (80%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CP     +++ V +AV  E+RMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  22    AQLSPNFYSKSCPKLFGTVKSVVRSAVAKESRMGASLLRLFFHDCFVNGCDGSILLDDTS  81

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +F GE+SA PN+NS RG NVID IK+++E+ C GVVSCADI+A+ ARDSV  LGGP+WN+
Sbjct  82    SFRGEKSAAPNLNSARGFNVIDAIKSKVEQVCPGVVSCADILAITARDSVAILGGPNWNV  141

Query  748   LLGRRDSTTASQSAANslpgpglslSQLIST-FSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TA+Q+AAN+   P  S    + + F   G SA++MVALSG+HTIGQA+C  F
Sbjct  142   KLGRRDSKTANQAAANNGIPPPSSSLSSLISRFQAHGLSAKDMVALSGAHTIGQARCITF  201

Query  571   RSRIYNE-NNINASFATLLKANCPQSG--GDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             RS +YNE + I+ASFA+  + NCP++   GDNNLAPLD+ TPT+FDN YFK+L S++GLL
Sbjct  202   RSHVYNETSTIDASFASTRQRNCPRTNGQGDNNLAPLDSQTPTTFDNKYFKDLVSKRGLL  261

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQQLFNGGSTDSIV ++S+NP  F +DFA AM+KM ++SPLTG++G+IRKNCR+ N
Sbjct  262   HSDQQLFNGGSTDSIVQSFSNNPGYFRSDFATAMIKMGDISPLTGSQGEIRKNCRRAN  319



>ref|XP_004502855.1| PREDICTED: peroxidase 52-like [Cicer arietinum]
Length=322

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 241/297 (81%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS++C    S +++ + +A++ EAR+GAS+LRL FHDCFVNGCD SILLDDT+
Sbjct  26    AQLSENFYSSSCSQLSSTVKSTMQSAISKEARIGASILRLFFHDCFVNGCDGSILLDDTS  85

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG  VIDNIKT +EK C G+VSCADI+A+AA+DSV  LGGP+WN+
Sbjct  86    SFTGEKNANPNRNSARGFEVIDNIKTAVEKVCPGIVSCADILAIAAKDSVEILGGPTWNV  145

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              +GRRD+ TASQSAAN+    P  SL+QL S FS  G S +++VALSG+HTIGQA+C+ F
Sbjct  146   KVGRRDAKTASQSAANTGIPAPSSSLTQLTSRFSALGLSTKDLVALSGAHTIGQARCTNF  205

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NI+ SFAT  K++CP +   GDNNLAPLD  TPTSFDN YFKNL  +KGLLH
Sbjct  206   RARIYNETNIDTSFATTRKSSCPSTSGSGDNNLAPLDLQTPTSFDNNYFKNLIQKKGLLH  265

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNGGS DSIV  YS+NP++F++ F+ AM+KM ++SPLTG+ G+IRKNCR+TN
Sbjct  266   SDQQLFNGGSADSIVTGYSTNPTSFSSAFSAAMIKMGDISPLTGSNGEIRKNCRRTN  322



>ref|XP_010256951.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=318

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 230/295 (78%), Gaps = 2/295 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             +LS+N YS+TCP ALSI+  AV  A+  E R+GASLLRLHFHDCFVNGCD SILLDDTA+
Sbjct  24    KLSSNHYSSTCPEALSIVNNAVIAAIKKETRIGASLLRLHFHDCFVNGCDGSILLDDTAS  83

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGE++A PN NS+RG +V+D+IK++LEK C GVVSCADI+A+AARDSVV LGGPSW + 
Sbjct  84    FTGEKTAVPNNNSVRGFDVVDDIKSRLEKKCPGVVSCADILALAARDSVVYLGGPSWTVE  143

Query  745   LGRRDSTTASQSAANslpgpglslSQLIST-FSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRDS TA+ +AANS      S   ++ T F+ KG S ++MVALSGSHTIG A+C+ FR
Sbjct  144   LGRRDSITANLTAANSDIPAPTSNLSVLETRFAAKGLSVKDMVALSGSHTIGLARCTTFR  203

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             SRIYN++NI+ + A  L+  CP+SG DN LA LD  TPT FDN Y+KNL   KGLLH+DQ
Sbjct  204   SRIYNDSNIDGTLAMSLQRKCPRSGNDNKLAGLDAQTPTYFDNYYYKNLLKGKGLLHTDQ  263

Query  388   QLFNG-GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +LFNG  STDS+V  Y  NPS F  DFA AMVKM N+SPLTG++G+IR NCR+ N
Sbjct  264   ELFNGSSSTDSLVKKYVGNPSKFFKDFAKAMVKMGNISPLTGSEGEIRFNCRELN  318



>ref|XP_002438534.1| hypothetical protein SORBIDRAFT_10g021650 [Sorghum bicolor]
 gb|EER89901.1| hypothetical protein SORBIDRAFT_10g021650 [Sorghum bicolor]
Length=325

 Score =   385 bits (988),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/294 (63%), Positives = 229/294 (78%), Gaps = 1/294 (0%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             +LS NFYS TCPN  +I++  +A+AV +E RMGAS+LR+ FHDCFVNGCD SILLDDT+ 
Sbjct  32    KLSPNFYSKTCPNVATIVRQQMASAVAAEKRMGASILRMFFHDCFVNGCDGSILLDDTST  91

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGE+ AGPN NS+RG  VID IKT++E SC   VSCADI+A+AARD V  LGGP+W++ 
Sbjct  92    FTGEKGAGPNANSVRGFEVIDAIKTKVEASCKATVSCADILALAARDGVNLLGGPTWSVP  151

Query  745   LGRRDSTTASQSAANslpgp-glslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGR+DS TASQS ANS     G SL+ LI  F N+G SAR+M ALSG+HTIG+++C FFR
Sbjct  152   LGRKDSRTASQSLANSNLPGPGSSLATLIRMFGNQGLSARDMTALSGAHTIGRSQCQFFR  211

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             SRIY E+NINASFA L +  CP+SGGD  LAP D  TP  FDNAY++NL +QKGLLHSDQ
Sbjct  212   SRIYTESNINASFAALRQKTCPRSGGDATLAPFDVQTPDGFDNAYYQNLVAQKGLLHSDQ  271

Query  388   QLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +LFNGGS D++V  YS+N + F+ DF +AM+KM NL P +GT  ++R NCRKTN
Sbjct  272   ELFNGGSQDALVRQYSTNANQFSADFVSAMIKMGNLMPSSGTPTEVRLNCRKTN  325



>ref|XP_008374511.1| PREDICTED: peroxidase P7-like isoform X1 [Malus domestica]
Length=318

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 235/295 (80%), Gaps = 2/295 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             +L+ NFY + CP ALSI+Q  V  A+ +E R+GASLLRLHFHDCFVNGCDAS+LLDDT++
Sbjct  24    ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             F GE++A PN NSIRG  V+D IK +LEK+C GVVSCAD++A+AARDS V LGGPSW + 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  745   LGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRDSTTAS+SAAN+    P  ++S LIS+FS +G S R++VALSGSHTIG A+C+ FR
Sbjct  144   LGRRDSTTASRSAANTFLPSPTSNISALISSFSAQGLSLRDLVALSGSHTIGLARCTTFR  203

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             SRIYN++ I+A+FA  L+  CP+SG D+NLA LD  TPT FDN Y+KNL  +KGLLHSDQ
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNEYYKNLLKEKGLLHSDQ  263

Query  388   QLFNG-GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +LFNG  STD++V  Y++N  TF   FA AMVKM N+SPLTG++G+IR NCRK N
Sbjct  264   ELFNGTTSTDNLVQIYTNNTLTFFKHFAVAMVKMGNISPLTGSQGEIRTNCRKVN  318



>gb|ACF08087.1| class III peroxidase [Triticum aestivum]
Length=316

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 187/289 (65%), Positives = 227/289 (79%), Gaps = 1/289 (0%)
 Frame = -1

Query  1090  FYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEQ  911
             FY T+CPNAL+ I+  V  A+N+E RMGASL+RLHFHDCFV+GCD S+LL DT +F GEQ
Sbjct  27    FYDTSCPNALATIKAGVTAALNTETRMGASLVRLHFHDCFVDGCDGSVLLADTGSFIGEQ  86

Query  910   SAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLLGRRD  731
              A PN NSIRG+NVIDNIKTQ+E  C   VSCADI+AVAARDSVVALGGP+W +LLGRRD
Sbjct  87    GAAPNNNSIRGMNVIDNIKTQVEAVCKQTVSCADILAVAARDSVVALGGPTWTVLLGRRD  146

Query  730   STTASQS-AANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRSRIYN  554
             STTAS++ A N LP P   L  L + F NK  S  +MVALSG+HTIGQ++C FFR RIYN
Sbjct  147   STTASKTNAENDLPPPTFDLQNLTTLFGNKQLSMTDMVALSGAHTIGQSQCRFFRDRIYN  206

Query  553   ENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQLFNG  374
             E NIN +FAT L+ANCPQSGGD++LAPLDT TP +FDN+Y+ NL SQKGLLHSDQ LFNG
Sbjct  207   ETNINTTFATSLRANCPQSGGDSSLAPLDTATPNAFDNSYYTNLMSQKGLLHSDQVLFNG  266

Query  373   GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             G  D+ V +++++ +TF + F  AM+ M N++P TGT+GQIR  C K N
Sbjct  267   GGADNTVMSFATSAATFNSAFTTAMINMGNIAPKTGTQGQIRLVCSKVN  315



>ref|XP_006595847.1| PREDICTED: peroxidase 4-like [Glycine max]
Length=326

 Score =   384 bits (987),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 236/295 (80%), Gaps = 3/295 (1%)
 Frame = -1

Query  1102  LSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANF  923
             L  NFY ++CP     ++  V +A++ E RMGASLLRL FHDCFVNGCD SILLDDT++F
Sbjct  32    LHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSF  91

Query  922   TGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLL  743
             TGE++AGPN NS RG  VID IK+ +EK C GVVSCADI+A+AARDSV  L GP+W++ L
Sbjct  92    TGEKNAGPNRNSARGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILRGPTWDVKL  151

Query  742   GRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRS  566
             GRRDS TASQSAAN+    P  +L+QLIS F+  G S +++VALSG HTIGQA+C+ FR+
Sbjct  152   GRRDSRTASQSAANNGIPRPTSNLNQLISRFNTLGLSTKDLVALSGGHTIGQARCTTFRA  211

Query  565   RIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             RIYNE+NI++SFA + ++ CP++   GDNNLAP+D  TPT FDN YFKNL  +KGL+HSD
Sbjct  212   RIYNESNIDSSFARMRQSRCPRTSGSGDNNLAPIDFATPTFFDNHYFKNLIQKKGLIHSD  271

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q+LFNGGSTDS+V TYS+NP++F  DF+ AM++M ++SPLTG++G+IR+NCR+ N
Sbjct  272   QELFNGGSTDSLVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  326



>gb|AAP42508.1| anionic peroxidase swpb3 [Ipomoea batatas]
Length=320

 Score =   384 bits (987),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 228/297 (77%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FYS +CP     + + V +A+  EARMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  24    AQLSPGFYSKSCPKLFQTVNSVVRSAIQKEARMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE+ A PN  S RG  VID IK+ +EK C GVVSCADI+A+A+RDS V LGGPSWN+
Sbjct  84    SFTGEKRAAPNFQSARGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRD+ TASQ+AAN+    P  +L++LIS+FS  G S  +MV LSGSHTIGQA+C+ F
Sbjct  144   KLGRRDARTASQAAANNSIPAPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNF  203

Query  571   RSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE+NI++SFA   K NCP++   GDNNLAPLD  TP  FDN Y+ NL ++KGLLH
Sbjct  204   RARIYNESNIDSSFAQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNG STDS V  YS+NPS F +DFA AM+KM ++ PLTG  G+IRKNCR+ N
Sbjct  264   SDQQLFNGVSTDSTVRGYSTNPSKFKSDFAAAMIKMGDIKPLTGNNGEIRKNCRRRN  320



>ref|XP_008374568.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   384 bits (986),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 233/295 (79%), Gaps = 2/295 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             +L+ NFY + CP ALSI+Q  V  A+ +E R+GASLLRLHFHDCFVNGCDAS+LLDDT++
Sbjct  24    KLTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             F GE++A PN NSIRG  V+D IK +LEK+C GVVSCAD++A+AARDS V LGGPSW + 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  745   LGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRDSTTAS+SAAN+    P  ++S LIS+FS +G S R++VALSGSHTIG A+C+ FR
Sbjct  144   LGRRDSTTASRSAANTSIPPPTSNISALISSFSAQGLSIRDLVALSGSHTIGLARCTSFR  203

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             SRIYN++ I+A+FA  L+  CP+SG DNNLA LD  TPT FDN Y+KNL  +KGLLHSDQ
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRSGNDNNLASLDLQTPTHFDNKYYKNLLKEKGLLHSDQ  263

Query  388   QLFNG-GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +LFNG  STD +V  Y++N  TF   FA AMVKM N+ PLTG++G+IR NCRK N
Sbjct  264   ELFNGTTSTDKLVQIYANNTLTFFKHFAVAMVKMGNIDPLTGSQGEIRTNCRKVN  318



>gb|EPS58869.1| peroxidase, partial [Genlisea aurea]
Length=310

 Score =   384 bits (985),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 235/295 (80%), Gaps = 2/295 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY++TCPN  SI+++AVA AV  EARMGASLLRLHFHDCFVNGCD S+LLDDTA
Sbjct  17    AQLSPAFYASTCPNLPSIVKSAVAAAVAQEARMGASLLRLHFHDCFVNGCDGSVLLDDTA  76

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG +VID IK+Q+E +C G+VSCADIVA+AARDSVVAL GPSW +
Sbjct  77    TFTGEKTAFPNANSLRGFDVIDTIKSQVEAACPGIVSCADIVAIAARDSVVALNGPSWTV  136

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TAS +AANS    P  SL+QLIS FS KG +  EMVALSGSHTIGQA+C  F
Sbjct  137   GLGRRDSLTASLAAANSDLPSPASSLAQLISAFSAKGLTTAEMVALSGSHTIGQARCVVF  196

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYNE  ++  +A  L+ANCP++GGDNNLAPLD  TPT+FD+ Y++++  QKGLLHSD
Sbjct  197   RTRIYNE-TMDPFYAARLQANCPKTGGDNNLAPLDAVTPTTFDSNYYRDIVLQKGLLHSD  255

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQL +  ST + V  YS +   F  DFAN MVKMSNLSPLTG++GQIR NCRK N
Sbjct  256   QQLLSSLSTAAQVTIYSVSDLLFFNDFANGMVKMSNLSPLTGSQGQIRTNCRKVN  310



>ref|XP_007141708.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
 gb|ESW13702.1| hypothetical protein PHAVU_008G218500g [Phaseolus vulgaris]
Length=320

 Score =   384 bits (986),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             A L  NFYS++CP  L  ++ AV +A++ E RMGASLLRL FHDCFVNGCD SILLDDT+
Sbjct  24    ATLYTNFYSSSCPKLLDTVKCAVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTS  83

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++A PN NS RG +VID IK+ +E+ C GVVSCADI+A+AARDSV  LGGPSWN+
Sbjct  84    SFTGEKNARPNKNSARGFDVIDKIKSAVEEVCPGVVSCADILAIAARDSVHILGGPSWNV  143

Query  748   LLGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDS TASQSAAN+    P  +++QLIS F++ G S +++VALSG+HTIGQA+C+ F
Sbjct  144   KLGRRDSRTASQSAANNGIPPPTSNVNQLISRFNSLGLSPKDLVALSGAHTIGQARCTTF  203

Query  571   RSRIYNENNINASFATLLKANCP--QSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLH  398
             R+RIYNE NI++SFA + ++ CP     GDNNLAPLD  TPT FDN YFKNL  +KGLLH
Sbjct  204   RARIYNETNIDSSFAHIRQSTCPPNSGSGDNNLAPLDLATPTFFDNHYFKNLIQKKGLLH  263

Query  397   SDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             SDQQLFNG STDS+V TY++NP +F  DF+ AM+KM ++SPLTG+ G+IR  CR+ N
Sbjct  264   SDQQLFNGASTDSLVRTYNTNPGSFFADFSAAMIKMGDISPLTGSLGEIRNKCRRVN  320



>ref|XP_009419701.1| PREDICTED: cationic peroxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=324

 Score =   384 bits (986),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 239/297 (80%), Gaps = 3/297 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY+T+CPNALSII+TAV  AV  + RMGASLLRLHFHDCFV GCDAS+LLDDT+
Sbjct  28    AQLSPTFYNTSCPNALSIIRTAVRAAVARDRRMGASLLRLHFHDCFVQGCDASLLLDDTS  87

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
              FTGE++A PN NS+RG  VID IK++LE +C  VVSCADIVAVAARDSVVALGGP+W +
Sbjct  88    TFTGEKTANPNNNSLRGFEVIDAIKSKLESACKQVVSCADIVAVAARDSVVALGGPTWTV  147

Query  748   LLGRRDSTTASQSAANslpgpglslSQ-LISTFSNKGFSAREMVALSGSHTIGQAKCSFF  572
              LGRRDSTTAS S+AN+      +  + LIS+FS KG SA +M ALSG+HTIGQA+C  F
Sbjct  148   ELGRRDSTTASLSSANTDIPGPTADLRTLISSFSGKGLSASDMAALSGAHTIGQARCFLF  207

Query  571   RSRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
             R+RIYN+ NI+ SFA+ L++NC  SGGDN L+PLD+TTPT FDN Y+ NL  ++GLLHSD
Sbjct  208   RARIYNDTNIDPSFASSLQSNCSSSGGDNELSPLDSTTPTVFDNDYYANLVRERGLLHSD  267

Query  391   QQLF--NGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             QQLF   GGS +S V +Y++N + F +DFA+AMVKM+++SPLTG+ G+IR NCRK N
Sbjct  268   QQLFMNGGGSVESQVGSYATNSAKFFSDFASAMVKMASISPLTGSSGEIRINCRKIN  324



>dbj|BAC83101.1| putative peroxidase precursor [Oryza sativa Japonica Group]
 gb|EEE67813.1| hypothetical protein OsJ_25567 [Oryza sativa Japonica Group]
Length=318

 Score =   384 bits (986),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 197/296 (67%), Positives = 231/296 (78%), Gaps = 3/296 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLSA FYS +CP AL+II+  V  AV  E RMGASLLRLHFHDCFV GCDAS+LL+DTAN
Sbjct  23    QLSATFYSRSCPRALAIIRAGVRAAVAQEPRMGASLLRLHFHDCFVQGCDASVLLNDTAN  82

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGEQ A PN+ SIRG NV+DNIK Q+E +C   VSCADI+AVAARDSVVALGGPSW +L
Sbjct  83    FTGEQGANPNVGSIRGFNVVDNIKAQVEAACKQTVSCADILAVAARDSVVALGGPSWRVL  142

Query  745   LGRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRDSTTAS + ANS   P    ++ L ++F+ KG S  +MVALSG+HT+GQA+C  FR
Sbjct  143   LGRRDSTTASLALANSDLPPPSFDVANLTASFAAKGLSQADMVALSGAHTVGQAQCQNFR  202

Query  568   SRIYNENNINASFATLLKANCPQ--SGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
              R+YNE NI+A+FA  LKA+CP+    GD NLAPLDTTTPT+FDNAY+ NL S KGLLHS
Sbjct  203   DRLYNETNIDAAFAAALKASCPRPTGSGDGNLAPLDTTTPTAFDNAYYTNLLSNKGLLHS  262

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQ LFNGG+ D  V +Y+S PS F  DFA AMVKM N++PLTGT+GQIR  C K N
Sbjct  263   DQVLFNGGAVDGQVRSYASGPSRFRRDFAAAMVKMGNIAPLTGTQGQIRLVCSKVN  318



>gb|ACF08094.1| class III peroxidase [Triticum aestivum]
Length=321

 Score =   384 bits (986),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 192/291 (66%), Positives = 223/291 (77%), Gaps = 3/291 (1%)
 Frame = -1

Query  1090  FYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTANFTGEQ  911
             FY+ +CP AL+ I++AV  AV SE RMGASLLRLHFHDCFV GCDAS+LL DTA FTGEQ
Sbjct  31    FYAKSCPRALATIKSAVTAAVRSEPRMGASLLRLHFHDCFVQGCDASVLLSDTATFTGEQ  90

Query  910   SAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLLLGRRD  731
              A PN  SIRG+NVIDNIK Q+E  C   VSCADI+AVAARDSVVALGGPSW + LGRRD
Sbjct  91    GAAPNARSIRGMNVIDNIKAQVEAVCRQTVSCADILAVAARDSVVALGGPSWTVPLGRRD  150

Query  730   STTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFRSRIYN  554
             STTAS S ANS        L+ L + F+ KG S  +MVALSG HTIGQ++C FFRSR+YN
Sbjct  151   STTASLSLANSDLPAPSFDLANLTANFAAKGLSVTDMVALSGGHTIGQSQCRFFRSRLYN  210

Query  553   ENNINASFATLLKANCPQ--SGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQQLF  380
             E NI+A+FAT LKANCP+  S G+++LAPLDTTTP  FDNAY+ NL SQKGLLHSDQ L 
Sbjct  211   ETNIDAAFATSLKANCPRTTSSGNSSLAPLDTTTPNGFDNAYYSNLMSQKGLLHSDQVLI  270

Query  379   NGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             N G T  +V TYSS  + F  DFA AMV+M N+SPLTG +GQIR +C + N
Sbjct  271   NDGRTAGLVRTYSSASAQFNRDFAAAMVRMGNISPLTGAQGQIRLSCSRVN  321



>gb|EEC82680.1| hypothetical protein OsI_27324 [Oryza sativa Indica Group]
Length=318

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/296 (67%), Positives = 230/296 (78%), Gaps = 3/296 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLSA FYS +CP AL+II+  V  AV  E RMGASLLRLHFHDCFV GCDAS+LL+DTAN
Sbjct  23    QLSATFYSRSCPRALAIIRAGVRAAVAQEPRMGASLLRLHFHDCFVQGCDASVLLNDTAN  82

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGEQ A PN+ SIRG NV+DNIK Q+E +C   VSCADI+AVAARDSVVALGGPSW +L
Sbjct  83    FTGEQGANPNVGSIRGFNVVDNIKAQVEAACKQTVSCADILAVAARDSVVALGGPSWRVL  142

Query  745   LGRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRDSTTAS + ANS   P    ++ L + F+ KG S  +MVALSG+HT+GQA+C  FR
Sbjct  143   LGRRDSTTASLALANSDLPPPSFDVANLTAAFAAKGLSQADMVALSGAHTVGQAQCQNFR  202

Query  568   SRIYNENNINASFATLLKANCPQ--SGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
              R+YNE NI+A+FA  LKA+CP+    GD NLAPLDTTTPT+FDNAY+ NL S KGLLHS
Sbjct  203   DRLYNETNIDAAFAAALKASCPRPTGSGDGNLAPLDTTTPTAFDNAYYTNLLSNKGLLHS  262

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQ LFNGG+ D  V +Y+S PS F  DFA AMVKM N++PLTGT+GQIR  C K N
Sbjct  263   DQVLFNGGAVDGQVRSYASGPSRFRRDFAAAMVKMGNIAPLTGTQGQIRLVCSKVN  318



>ref|XP_008364165.1| PREDICTED: peroxidase 4-like [Malus domestica]
Length=318

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 234/295 (79%), Gaps = 2/295 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             +L+ NFY + CP ALSI+Q  V  A+ +E R+GASLLRLHFHDCFVNGCDAS+LLDDT++
Sbjct  24    ELTQNFYKSKCPKALSIVQEGVIAAIKNETRIGASLLRLHFHDCFVNGCDASVLLDDTSS  83

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             F GE++A PN NSIRG  V+D IK +LEK+C GVVSCAD++A+AARDS V LGGPSW + 
Sbjct  84    FVGEKTAAPNNNSIRGFEVVDQIKAKLEKACPGVVSCADLLALAARDSTVYLGGPSWKVG  143

Query  745   LGRRDSTTASQSAANslp-gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRDSTTAS+SAAN+    P  ++S LIS+FS +G S R++VALSGSHTIG A+C+ FR
Sbjct  144   LGRRDSTTASRSAANTXJPXPTSNISALISSFSAQGLSJRDLVALSGSHTIGLARCTXFR  203

Query  568   SRIYNENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSDQ  389
             SRIYN++ I+A+FA  L+  CP+SG D+NLA LD  TPT FDN Y+KNL  +KGLLHSDQ
Sbjct  204   SRIYNDSAIDATFAQSLQGICPRSGNDDNLASLDLQTPTHFDNEYYKNLLKEKGLLHSDQ  263

Query  388   QLFNG-GSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             +LFNG  STD++V  Y++N  TF   FA AMVKM N+ PLTG++G+IR NCRK N
Sbjct  264   ELFNGTTSTDNLVQIYTNNTLTFFKHFAVAMVKMGNIXPLTGSQGEIRTNCRKVN  318



>ref|XP_004294746.1| PREDICTED: peroxidase 4-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/298 (62%), Positives = 235/298 (79%), Gaps = 4/298 (1%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS NFYS +CP   + +++ V +A+++E R+GASLLRLHFHDCFVNGCD S+LLDDT+
Sbjct  30    AQLSTNFYSGSCPKLFTTVKSVVQSAISNENRIGASLLRLHFHDCFVNGCDGSVLLDDTS  89

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +FTGE++AGPN NS+RG +V+D IKT++EK+C GVVSCADIV +AARDSVV LGGPSW++
Sbjct  90    SFTGEKTAGPNNNSLRGFDVVDKIKTKVEKACPGVVSCADIVTIAARDSVVILGGPSWSV  149

Query  748   LLGRRDSTTASQSAANslp--gpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSF  575
              LGRRD+ T + +AANS     P   LS LI+ F  +G S  +MVALSG+HTIG+A+C+ 
Sbjct  150   KLGRRDAKTTTLAAANSGVIPAPTNDLSDLITKFQAQGLSTTDMVALSGAHTIGKARCTV  209

Query  574   FRSRIYNENNINASFATLLKANCPQS--GGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLL  401
             FR RIYNE NI+ASFA   + NCP +   GDNNLAPLDT T  +FD  YF+NL ++KGLL
Sbjct  210   FRDRIYNETNIDASFAKTRQNNCPSTSGSGDNNLAPLDTQTTNAFDPKYFQNLINKKGLL  269

Query  400   HSDQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             HSDQ+LFNGGSTDS+V  YS++   F  DFA AM+KM ++ PLTG++G+IRKNCRK N
Sbjct  270   HSDQELFNGGSTDSLVKKYSASAKNFNADFAKAMIKMGDIKPLTGSQGEIRKNCRKRN  327



>ref|XP_006470944.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=323

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 232/295 (79%), Gaps = 1/295 (0%)
 Frame = -1

Query  1108  AQLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTA  929
             AQLS  FY  TCP+AL+ I+T + NA + E RM ASL+RLHFHDCFV GCDASILLDD++
Sbjct  29    AQLSPTFYDATCPSALNTIRTGIRNAASRERRMAASLIRLHFHDCFVQGCDASILLDDSS  88

Query  928   NFTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNL  749
             +   E++A PN  S RG  VID++K+QLE+ C GVVSCADIVAVAARD+  A+GGPSW +
Sbjct  89    SIDSEKNALPNFKSARGFEVIDSVKSQLERVCPGVVSCADIVAVAARDASFAVGGPSWTV  148

Query  748   LLGRRDSTTASQSAANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
              LGRRDSTTAS+S A +LP     L +LISTF+ KG +AR++VALSG+HTIGQA+C+FFR
Sbjct  149   KLGRRDSTTASRSLAENLPSFTDGLDKLISTFATKGLNARDLVALSGAHTIGQAQCAFFR  208

Query  568   SRIY-NENNINASFATLLKANCPQSGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHSD  392
              RIY N++NI+A FA+  +  CP +GGD+NL+PLD  TP SFDN YFKNL  +KGLL SD
Sbjct  209   DRIYNNQSNIDAGFASTRRRQCPANGGDSNLSPLDLVTPNSFDNNYFKNLIQKKGLLASD  268

Query  391   QQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             Q LF+GGSTDSIV+ YS NPS F +DFA AM+KM+++SPLTGT GQIR+ C   N
Sbjct  269   QVLFSGGSTDSIVDEYSKNPSKFKSDFAAAMIKMADISPLTGTAGQIRRVCNIVN  323



>dbj|BAK07852.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 221/296 (75%), Gaps = 3/296 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLS  FY  +CP AL+II+  V  AV SE RMGASLLRLHFHDCFV GCDAS+LL DTA 
Sbjct  31    QLSPRFYGRSCPRALAIIRRGVTAAVRSERRMGASLLRLHFHDCFVQGCDASVLLSDTAT  90

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             FTGEQ AGPN  SIRG+NVIDNIK Q+E  C   VSCADI+AVAARDSVVALGGPSW + 
Sbjct  91    FTGEQGAGPNAGSIRGMNVIDNIKAQVEAVCAQTVSCADILAVAARDSVVALGGPSWTVP  150

Query  745   LGRRDSTTASQSAANslpgpgl-slSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRDSTTAS S ANS   P    ++ L + F+ KG S  +MVALSG+HTIGQA+C  FR
Sbjct  151   LGRRDSTTASMSLANSDLPPPSFDIANLTANFAAKGLSVTDMVALSGAHTIGQAQCQNFR  210

Query  568   SRIYNENNINASFATLLKANCPQ--SGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
              R+YNE NI  +FAT LKANCP+    GD+ LAPLDTTTP +FDN Y++NL SQKGLLHS
Sbjct  211   DRLYNETNIETAFATSLKANCPRPTGSGDSTLAPLDTTTPNAFDNVYYRNLMSQKGLLHS  270

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQ L N G T  +V TYSS  +    DFA AMVKM N+SPLTG +GQ+R +C + N
Sbjct  271   DQVLINDGRTAGLVRTYSSASTQLNRDFAAAMVKMGNISPLTGAQGQVRLSCSRVN  326



>ref|XP_003562452.1| PREDICTED: peroxidase 2-like [Brachypodium distachyon]
Length=320

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/296 (65%), Positives = 228/296 (77%), Gaps = 3/296 (1%)
 Frame = -1

Query  1105  QLSANFYSTTCPNALSIIQTAVANAVNSEARMGASLLRLHFHDCFVNGCDASILLDDTAN  926
             QLS+ FY T+CP AL  I+TAV  AV+SEARMGASLLRLHFHDCFV+GCDAS+LL DT +
Sbjct  24    QLSSTFYDTSCPKALDTIKTAVTAAVSSEARMGASLLRLHFHDCFVDGCDASVLLADTGS  83

Query  925   FTGEQSAGPNINSIRGLNVIDNIKTQLEKSCVGVVSCADIVAVAARDSVVALGGPSWNLL  746
             F GEQ+A PN  SIRGLNVIDNIKTQ+E  C   VSCADI+AVAARDSVV LGGPSW +L
Sbjct  84    FVGEQTAAPNAGSIRGLNVIDNIKTQVEAVCKQTVSCADILAVAARDSVVTLGGPSWTVL  143

Query  745   LGRRDSTTASQS-AANslpgpglslSQLISTFSNKGFSAREMVALSGSHTIGQAKCSFFR  569
             LGRRDSTTAS++ A N LP P   L  L   F+NK  S  +MVALSG HTIGQ++C  FR
Sbjct  144   LGRRDSTTASKTNAENDLPPPTFDLKNLTDNFANKQLSVTDMVALSGGHTIGQSQCLNFR  203

Query  568   SRIYNENNINASFATLLKANCPQ--SGGDNNLAPLDTTTPTSFDNAYFKNLQSQKGLLHS  395
              RIYNE NI+A+FA  LK+NCP+  S G+ +LAPLD  TPT+FDN YF NLQ+ KGLLHS
Sbjct  204   DRIYNETNIDAAFAASLKSNCPRSTSSGNTSLAPLDVATPTAFDNKYFVNLQANKGLLHS  263

Query  394   DQQLFNGGSTDSIVNTYSSNPSTFATDFANAMVKMSNLSPLTGTKGQIRKNCRKTN  227
             DQ LFNGG TD+ V  ++SNP+ F+  F  AMV M N++P TG++GQIR +C K N
Sbjct  264   DQVLFNGGGTDNTVRNFASNPAAFSAAFVTAMVNMGNIAPKTGSQGQIRLSCSKVN  319



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3201701632912