BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82154_g1_i1 len=914 path=[892:0-913]

Length=914
                                                                      Score     E

ref|XP_010649116.1|  PREDICTED: salicylate carboxymethyltransfera...    127   3e-30   
ref|XP_002262676.1|  PREDICTED: salicylate carboxymethyltransfera...    127   3e-30   Vitis vinifera
ref|XP_010649117.1|  PREDICTED: salicylate carboxymethyltransfera...    125   2e-29   
ref|XP_002262759.2|  PREDICTED: salicylate carboxymethyltransferase     125   2e-29   Vitis vinifera
ref|XP_010649118.1|  PREDICTED: salicylate carboxymethyltransfera...    125   2e-29   
ref|XP_002263123.2|  PREDICTED: salicylate carboxymethyltransfera...    125   2e-29   Vitis vinifera
gb|KHG11269.1|  Salicylate O-methyltransferase                          125   2e-29   
ref|XP_002263018.1|  PREDICTED: salicylate carboxymethyltransfera...    125   2e-29   Vitis vinifera
emb|CBI17471.3|  unnamed protein product                                122   3e-29   
ref|XP_010113410.1|  Salicylate O-methyltransferase                     123   1e-28   
gb|KHG15891.1|  Salicylate O-methyltransferase                          122   3e-28   
gb|ABK95036.1|  unknown                                                 120   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_007046855.1|  Salicylate O-methyltransferase                     120   1e-27   
ref|XP_002264863.1|  PREDICTED: salicylate carboxymethyltransferase     120   1e-27   Vitis vinifera
gb|AFP53830.1|  SAMT                                                    119   2e-27   
gb|AFP53831.1|  SAMT                                                    119   3e-27   
gb|ACZ55216.1|  S-adenosyl-L-methionine:salicylic acid carboxyl m...    119   3e-27   Nicotiana suaveolens
gb|AFS35577.1|  salicylic acid methyl transferase                       119   4e-27   
gb|ABO71014.1|  benzoic acid/salicylic acid methyltransferase           118   4e-27   Schwenckia americana
gb|KDP44576.1|  hypothetical protein JCGZ_22158                         118   7e-27   
gb|AAW66835.1|  SAMT                                                    117   7e-27   Schizanthus pinnatus
gb|ABO71012.1|  benzoic acid/salicylic acid methyltransferase           116   2e-26   Protoschwenkia mandonii
ref|XP_009594558.1|  PREDICTED: salicylate carboxymethyltransfera...    116   3e-26   
ref|XP_011025843.1|  PREDICTED: salicylate carboxymethyltransferase     116   3e-26   
gb|AAO45013.1|  S-adenosyl-L-methionine:benzoic acid/salicylic ac...    115   6e-26   Petunia x hybrida [garden petunia]
emb|CAC33768.1|  S-adenosyl-L-methionine:salicylic acid carboxyl ...    115   6e-26   Stephanotis floribunda [Madagascar jasmine]
gb|ACZ55219.1|  S-adenosyl-L-methionine:salicylic acid carboxyl m...    115   7e-26   Nicotiana alata [flowering tobacco]
gb|ABF50941.1|  S-adenosyl-L-methionine:benzoic acid/salicylic ac...    114   1e-25   Petunia x hybrida [garden petunia]
gb|KCW60614.1|  hypothetical protein EUGRSUZ_H03343                     114   2e-25   
ref|XP_010024170.1|  PREDICTED: salicylate carboxymethyltransfera...    114   2e-25   
gb|KCW60616.1|  hypothetical protein EUGRSUZ_H03343                     114   2e-25   
gb|KCW60619.1|  hypothetical protein EUGRSUZ_H03344                     113   3e-25   
ref|XP_007046857.1|  Salicylate O-methyltransferase                     113   3e-25   
ref|XP_004509288.1|  PREDICTED: salicylate O-methyltransferase-like     113   3e-25   
gb|AAO45012.1|  S-adenosyl-L-methionine:benzoic acid/salicylic ac...    112   4e-25   Petunia x hybrida [garden petunia]
gb|KHN22770.1|  Salicylate O-methyltransferase                          112   8e-25   
ref|XP_004509289.1|  PREDICTED: salicylate O-methyltransferase-like     112   9e-25   
gb|KDO70999.1|  hypothetical protein CISIN_1g017514mg                   111   1e-24   
sp|Q9SPV4.1|SAMT_CLABR  RecName: Full=Salicylate carboxymethyltra...    111   1e-24   Clarkia breweri [fairy fans]
gb|KDO70998.1|  hypothetical protein CISIN_1g017514mg                   111   1e-24   
ref|XP_003547964.1|  PREDICTED: salicylate carboxymethyltransfera...    111   1e-24   
gb|KHN22766.1|  Salicylate O-methyltransferase                          111   1e-24   
ref|XP_006466836.1|  PREDICTED: salicylate carboxymethyltransfera...    111   2e-24   
ref|XP_010278141.1|  PREDICTED: salicylate carboxymethyltransfera...    110   2e-24   
gb|KHN22764.1|  Salicylate O-methyltransferase                          110   4e-24   
gb|ACP20216.1|  salicylic acid carboxyl methyltransferase               110   4e-24   Mikania micrantha [bittervine]
ref|XP_003548875.1|  PREDICTED: salicylate carboxymethyltransfera...    110   5e-24   
emb|CAI05934.1|  S-adenosyl-L-methionine:salicylic acid carboxyl ...    109   5e-24   Hoya carnosa [honeyplant]
ref|XP_007156070.1|  hypothetical protein PHAVU_003G255800g             105   6e-24   
gb|KHN36081.1|  Salicylate O-methyltransferase                          109   6e-24   
ref|XP_003604791.1|  Jasmonate O-methyltransferase                      109   7e-24   
ref|XP_003547966.1|  PREDICTED: salicylate carboxymethyltransfera...    109   7e-24   
gb|AAW66834.1|  SAMT                                                    108   1e-23   Petunia nyctaginiflora
ref|XP_003612068.1|  Jasmonate O-methyltransferase                      108   1e-23   
gb|AAW66847.1|  SAMT                                                    108   2e-23   Solandra maxima
gb|AAW66842.1|  SAMT                                                    107   2e-23   Streptosolen jamesonii [firebush]
ref|XP_004247832.1|  PREDICTED: salicylate carboxymethyltransfera...    108   2e-23   
ref|XP_002265519.1|  PREDICTED: salicylate carboxymethyltransferase     107   2e-23   Vitis vinifera
ref|NP_001289539.1|  uncharacterized protein LOC104229603               107   2e-23   
gb|AGC11863.1|  salicylic acid carboxyl methyltransferase               107   2e-23   
ref|XP_004509302.1|  PREDICTED: salicylate O-methyltransferase-like     107   2e-23   
ref|XP_010026916.1|  PREDICTED: salicylate carboxymethyltransfera...    107   3e-23   
gb|ABO71015.1|  salicylic acid/benzoic acid carboxyl methyltransf...    107   3e-23   Datura wrightii
ref|XP_010024167.1|  PREDICTED: salicylate carboxymethyltransfera...    107   3e-23   
ref|NP_001237122.1|  salicylic acid methyl transferase-like protein     107   3e-23   
gb|KCW60608.1|  hypothetical protein EUGRSUZ_H03336                     106   3e-23   
ref|XP_007156072.1|  hypothetical protein PHAVU_003G256000g             107   4e-23   
gb|KHN00522.1|  Salicylate O-methyltransferase                          107   4e-23   
ref|XP_010026915.1|  PREDICTED: salicylate carboxymethyltransfera...    107   5e-23   
ref|XP_010024169.1|  PREDICTED: salicylate carboxymethyltransfera...    106   1e-22   
gb|AAW66837.1|  SAMT                                                    105   1e-22   Brunfelsia americana
gb|KCW60612.1|  hypothetical protein EUGRSUZ_H03342                     105   1e-22   
gb|KEH34490.1|  salicylic acid carboxyl methyltransferase               105   2e-22   
ref|XP_007156071.1|  hypothetical protein PHAVU_003G255900g             105   2e-22   
ref|XP_002529231.1|  Benzoate carboxyl methyltransferase, putative      105   2e-22   Ricinus communis
gb|KCW60613.1|  hypothetical protein EUGRSUZ_H03342                     104   3e-22   
ref|XP_011071562.1|  PREDICTED: salicylate carboxymethyltransfera...    104   3e-22   
gb|KHN22769.1|  Salicylate O-methyltransferase                          104   4e-22   
ref|XP_004149992.1|  PREDICTED: salicylate O-methyltransferase-like     104   4e-22   
gb|AAW66831.1|  SAMT                                                    103   4e-22   Brugmansia sp. Robadey 027
gb|KHN22768.1|  Salicylate O-methyltransferase                          103   5e-22   
ref|XP_002529243.1|  S-adenosyl-L-methionine:salicylic acid carbo...    102   5e-22   Ricinus communis
gb|AAW66832.1|  SAMT                                                    103   5e-22   Hyoscyamus albus [white henbane]
dbj|BAB39396.1|  S-adenosyl-L-methionine:salicylic acid carboxyl ...    103   1e-21   Atropa belladonna [deadly nightshade]
gb|AIN76709.1|  salicylic acid carboxy methyl transferase               102   1e-21   
ref|XP_002521542.1|  Benzoate carboxyl methyltransferase, putative      102   2e-21   Ricinus communis
ref|XP_011100960.1|  PREDICTED: salicylate carboxymethyltransfera...    102   2e-21   
gb|AAW66843.1|  SAMT                                                    102   2e-21   Juanulloa mexicana
gb|AAN40745.1|  S-adenosyl-L-methionine:salicylic acid methyltran...    102   2e-21   Antirrhinum majus [garden snapdragon]
gb|AAW66827.1|  SAMT                                                    101   2e-21   Datura stramonium [common thornapple]
ref|XP_003629413.1|  Jasmonate O-methyltransferase                      102   3e-21   
ref|XP_010263596.1|  PREDICTED: jasmonate O-methyltransferase           102   3e-21   
gb|AAW66846.1|  SAMT                                                    101   3e-21   Physalis virginiana
ref|XP_002529233.1|  S-adenosylmethionine-dependent methyltransfe...    101   3e-21   Ricinus communis
gb|ABO71017.1|  salicylic acid/benzoic acid carboxyl methyltransf...    100   6e-21   Protoschwenkia mandonii
ref|XP_008440755.1|  PREDICTED: salicylate carboxymethyltransfera...    100   6e-21   
ref|XP_006360373.1|  PREDICTED: salicylate carboxymethyltransfera...    100   7e-21   
ref|XP_010278173.1|  PREDICTED: salicylate carboxymethyltransfera...    100   1e-20   
ref|NP_001234809.1|  S-adenosyl-L-methionine: salicylic acid carb...  99.8    1e-20   
ref|XP_003520296.1|  PREDICTED: salicylate carboxymethyltransfera...  99.8    1e-20   
gb|KCW60599.1|  hypothetical protein EUGRSUZ_H033241                  96.3    2e-20   
ref|XP_003629397.1|  Jasmonate O-methyltransferase                    99.4    2e-20   
ref|XP_010670972.1|  PREDICTED: salicylate carboxymethyltransfera...  99.0    3e-20   
ref|XP_010670971.1|  PREDICTED: salicylate carboxymethyltransfera...  99.0    3e-20   
gb|KGN48858.1|  hypothetical protein Csa_6G504400                     97.8    4e-20   
ref|XP_004149993.1|  PREDICTED: salicylate O-methyltransferase-like   97.4    7e-20   
ref|XP_008388031.1|  PREDICTED: jasmonate O-methyltransferase-lik...  97.8    7e-20   
ref|XP_004167926.1|  PREDICTED: salicylate O-methyltransferase-like   97.4    7e-20   
ref|XP_008388030.1|  PREDICTED: jasmonate O-methyltransferase-lik...  97.8    7e-20   
ref|XP_004247831.1|  PREDICTED: salicylate carboxymethyltransfera...  97.4    8e-20   
ref|XP_008377209.1|  PREDICTED: jasmonate O-methyltransferase-like    97.4    9e-20   
ref|XP_010254766.1|  PREDICTED: jasmonate O-methyltransferase-like    97.4    9e-20   
gb|AAO27257.1|  putative S-adenosyl-L-methionine:salicylic acid c...  97.4    9e-20   Pisum sativum [garden pea]
ref|XP_008440753.1|  PREDICTED: salicylate carboxymethyltransfera...  97.4    9e-20   
ref|XP_009383765.1|  PREDICTED: jasmonate O-methyltransferase-like    97.1    1e-19   
ref|XP_002438141.1|  hypothetical protein SORBIDRAFT_10g008710        94.0    2e-19   Sorghum bicolor [broomcorn]
ref|XP_004499184.1|  PREDICTED: jasmonate O-methyltransferase-lik...  95.1    2e-19   
ref|XP_008440748.1|  PREDICTED: salicylate carboxymethyltransfera...  96.3    2e-19   
gb|AAW66840.1|  SAMT                                                  95.9    2e-19   Capsicum annuum
gb|KCW60597.1|  hypothetical protein EUGRSUZ_H03323                   96.3    2e-19   
gb|KCW60603.1|  hypothetical protein EUGRSUZ_H03330                   95.9    2e-19   
ref|XP_002510424.1|  Jasmonate O-methyltransferase, putative          96.3    2e-19   Ricinus communis
ref|XP_010024166.1|  PREDICTED: salicylate carboxymethyltransfera...  96.3    2e-19   
ref|XP_010026914.1|  PREDICTED: salicylate carboxymethyltransfera...  95.9    3e-19   
ref|XP_011048790.1|  PREDICTED: jasmonate O-methyltransferase         95.9    3e-19   
gb|AAW66830.1|  SAMT                                                  95.5    3e-19   Cestrum nocturnum [night jessamine]
ref|XP_002521540.1|  Benzoate carboxyl methyltransferase, putative    95.9    3e-19   Ricinus communis
gb|AIY26015.1|  SAMT                                                  95.5    4e-19   
gb|KGN48855.1|  hypothetical protein Csa_6G504130                     93.2    4e-19   
ref|XP_010670970.1|  PREDICTED: salicylate carboxymethyltransfera...  95.5    4e-19   
ref|XP_008440756.1|  PREDICTED: salicylate carboxymethyltransfera...  95.5    5e-19   
ref|XP_010678722.1|  PREDICTED: salicylate carboxymethyltransfera...  95.1    5e-19   
ref|XP_010678721.1|  PREDICTED: salicylate carboxymethyltransfera...  95.1    5e-19   
ref|XP_010026910.1|  PREDICTED: salicylate carboxymethyltransfera...  94.7    6e-19   
gb|ACH88356.1|  S-adenosyl-L-methionine:salicylic acid carboxyl m...  94.7    6e-19   Nicotiana tabacum [American tobacco]
gb|KDP38542.1|  hypothetical protein JCGZ_04467                       92.4    6e-19   
ref|XP_007017597.1|  Jasmonic acid carboxyl methyltransferase         94.7    9e-19   
ref|XP_004499183.1|  PREDICTED: jasmonate O-methyltransferase-lik...  94.4    1e-18   
gb|KCW60601.1|  hypothetical protein EUGRSUZ_H03327                   94.0    1e-18   
gb|KCW60600.1|  hypothetical protein EUGRSUZ_H03325                   93.6    1e-18   
ref|XP_009601458.1|  PREDICTED: salicylate carboxymethyltransfera...  94.0    1e-18   
ref|XP_010026911.1|  PREDICTED: salicylate carboxymethyltransfera...  93.6    2e-18   
ref|XP_007015210.1|  S-adenosyl-L-methionine-dependent methyltran...  94.0    2e-18   
ref|XP_004150007.1|  PREDICTED: salicylate O-methyltransferase-like   93.2    2e-18   
ref|XP_010664714.1|  PREDICTED: jasmonate O-methyltransferase iso...  93.6    2e-18   
gb|KEH40176.1|  salicylic acid carboxyl methyltransferase             93.6    2e-18   
gb|ABU88887.2|  S-adenosyl-L-methionine:salicylic acid carboxyl m...  93.6    2e-18   Chimonanthus praecox [wintersweet]
ref|XP_002281588.1|  PREDICTED: jasmonate O-methyltransferase iso...  93.2    2e-18   Vitis vinifera
ref|XP_008220839.1|  PREDICTED: jasmonate O-methyltransferase-like    93.6    2e-18   
gb|AIN76708.1|  jasmonic acid carboxyl methyltransferase              93.2    3e-18   
ref|XP_002281579.1|  PREDICTED: jasmonate O-methyltransferase         93.2    3e-18   Vitis vinifera
ref|XP_008440750.1|  PREDICTED: salicylate carboxymethyltransfera...  92.8    4e-18   
ref|XP_003638267.1|  Jasmonate O-methyltransferase                    93.2    4e-18   
ref|XP_008440751.1|  PREDICTED: salicylate carboxymethyltransfera...  92.4    4e-18   
ref|XP_006656836.1|  PREDICTED: anthranilate O-methyltransferase ...  92.4    5e-18   
ref|XP_002529241.1|  Benzoate carboxyl methyltransferase, putative    92.0    5e-18   Ricinus communis
gb|ACZ55217.1|  S-adenosyl-L-methionine:benzoic acid/salicylic ac...  92.0    7e-18   Nicotiana suaveolens
ref|XP_010255185.1|  PREDICTED: salicylate carboxymethyltransfera...  91.7    7e-18   
gb|KHN33247.1|  7-methylxanthosine synthase 1                         91.3    8e-18   
gb|AFV60450.1|  xanthosine methyltransferase 2                        91.7    9e-18   
gb|AFV60443.1|  xanthosine methyltransferase 2                        91.7    9e-18   
ref|XP_008440749.1|  PREDICTED: salicylate carboxymethyltransfera...  91.7    1e-17   
gb|AFD28989.1|  S-adenosyl-L-methionine:benzoic acid/salicylic ac...  91.7    1e-17   
ref|XP_002512934.1|  Benzoate carboxyl methyltransferase, putative    90.9    1e-17   Ricinus communis
gb|AHA06001.1|  jasmonate O-methyltransferase                         91.3    1e-17   
ref|XP_002307671.1|  JASMONIC ACID CARBOXYL METHYLTRANSFERASE fam...  90.9    2e-17   Populus trichocarpa [western balsam poplar]
gb|KEH40177.1|  salicylic acid carboxyl methyltransferase             90.9    2e-17   
ref|XP_002265637.1|  PREDICTED: benzoate carboxyl methyltransferase   90.5    2e-17   Vitis vinifera
ref|XP_003522180.1|  PREDICTED: theobromine synthase 2-like           89.4    2e-17   
emb|CBI28449.3|  unnamed protein product                              88.6    2e-17   
ref|XP_009365519.1|  PREDICTED: jasmonate O-methyltransferase-like    90.5    2e-17   
ref|XP_007160730.1|  hypothetical protein PHAVU_001G012300g           90.5    2e-17   
ref|XP_009765515.1|  PREDICTED: 3,7-dimethylxanthine N-methyltran...  89.7    3e-17   
ref|XP_003522019.1|  PREDICTED: 7-methylxanthosine synthase 1-like    90.1    3e-17   
gb|KEH34510.1|  salicylic acid carboxyl methyltransferase             90.1    3e-17   
dbj|BAG88225.1|  unnamed protein product                              89.4    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004143587.1|  PREDICTED: salicylate O-methyltransferase-like   90.1    3e-17   
sp|A4GE69.1|XMT1_COFCA  RecName: Full=7-methylxanthosine synthase...  90.1    3e-17   Coffea canephora [robusta coffee]
gb|KHN15663.1|  Theobromine synthase 2                                89.7    3e-17   
gb|AAM18505.1|AF494415_1  N-methyltransferase                         90.1    3e-17   Coffea canephora [robusta coffee]
gb|AAM18506.1|AF494416_1  N-methyltransferase                         89.7    4e-17   Coffea canephora [robusta coffee]
gb|KHN12690.1|  Jasmonate O-methyltransferase                         89.7    4e-17   
gb|AFV60437.1|  xanthosine methyltransferase 1                        89.7    4e-17   
sp|Q9AVK0.1|XMT1_COFAR  RecName: Full=7-methylxanthosine synthase...  89.7    4e-17   Coffea arabica [arabica coffee]
gb|AFV60442.1|  xanthosine methyltransferase 1                        89.7    4e-17   
ref|NP_001057273.1|  Os06g0244000                                     89.7    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003549442.2|  PREDICTED: jasmonate O-methyltransferase-like    90.1    4e-17   
gb|AAM18507.1|AF494417_1  N-methyltransferase                         90.1    4e-17   Coffea liberica
gb|EEC80308.1|  hypothetical protein OsI_22346                        89.7    4e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_007017600.1|  Jasmonic acid carboxyl methyltransferase         89.7    4e-17   
gb|AAW66828.1|  SAMT                                                  89.0    6e-17   Cestrum elegans
ref|XP_010673293.1|  PREDICTED: salicylate carboxymethyltransfera...  89.4    6e-17   
gb|KDO36613.1|  hypothetical protein CISIN_1g036335mg                 85.1    7e-17   
gb|EEC80306.1|  hypothetical protein OsI_22344                        87.4    7e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010533439.1|  PREDICTED: jasmonate O-methyltransferase-like    89.4    7e-17   
ref|XP_007042140.1|  Benzoate carboxyl methyltransferase, putative    89.0    7e-17   
gb|ACZ55220.1|  S-adenosyl-L-methionine:benzoic acid/salicylic ac...  89.4    8e-17   Nicotiana alata [flowering tobacco]
ref|XP_009336009.1|  PREDICTED: jasmonate O-methyltransferase-lik...  89.0    8e-17   
ref|XP_009336006.1|  PREDICTED: jasmonate O-methyltransferase-lik...  89.0    8e-17   
ref|XP_010906350.1|  PREDICTED: jasmonate O-methyltransferase-like    89.0    8e-17   
ref|XP_010246471.1|  PREDICTED: salicylate carboxymethyltransfera...  88.6    1e-16   
ref|XP_003627282.1|  Jasmonate O-methyltransferase                    88.6    1e-16   
ref|XP_007223087.1|  hypothetical protein PRUPE_ppa007005mg           89.0    1e-16   
gb|ABD33161.2|  Beta-ketoacyl synthase; SAM dependent carboxyl me...  88.2    1e-16   Medicago truncatula
gb|EEE65429.1|  hypothetical protein OsJ_20786                        87.4    1e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KHN22767.1|  Salicylate O-methyltransferase                        88.2    1e-16   
ref|XP_009775541.1|  PREDICTED: salicylate carboxymethyltransfera...  87.4    1e-16   
gb|EMT20995.1|  Benzoate carboxyl methyltransferase                   89.4    1e-16   
ref|XP_003624535.1|  Jasmonate O-methyltransferase                    88.2    1e-16   
gb|AES80745.2|  SAM-dependent carboxyl methyltransferase              87.8    1e-16   
emb|CDP20034.1|  unnamed protein product                              88.2    2e-16   
ref|XP_010227797.1|  PREDICTED: anthranilate O-methyltransferase ...  88.2    2e-16   
ref|XP_010254767.1|  PREDICTED: jasmonate O-methyltransferase-like    88.2    2e-16   
ref|XP_004291852.1|  PREDICTED: jasmonate O-methyltransferase-like    88.2    2e-16   
ref|XP_003624527.1|  Jasmonate O-methyltransferase                    87.8    2e-16   
ref|XP_010657481.1|  PREDICTED: LOW QUALITY PROTEIN: 7-methylxant...  88.6    2e-16   
emb|CDP12636.1|  unnamed protein product                              84.7    2e-16   
dbj|BAD45795.1|  putative benzothiadiazole-induced S-adenosyl-L-m...  87.0    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003627283.1|  Jasmonate O-methyltransferase                    87.4    2e-16   
gb|AAQ94895.1|  putative N-methyltransferase                          87.8    2e-16   Coffea liberica var. dewevrei [excelsa coffee]
sp|Q84PP7.1|MXMT2_COFAR  RecName: Full=Monomethylxanthine methylt...  87.8    2e-16   Coffea arabica [arabica coffee]
ref|XP_006349443.1|  PREDICTED: salicylate carboxymethyltransfera...  87.4    2e-16   
sp|Q8H0G0.1|CTS2_COFAR  RecName: Full=Theobromine synthase 2          87.8    2e-16   Coffea arabica [arabica coffee]
ref|XP_007156076.1|  hypothetical protein PHAVU_003G256300g           87.4    2e-16   
gb|EMS44996.1|  Salicylate O-methyltransferase                        87.4    2e-16   
gb|AFV60440.1|  7-methylxanthine methyltransferase 2                  87.8    2e-16   
ref|XP_004493098.1|  PREDICTED: jasmonate O-methyltransferase-lik...  87.4    3e-16   
gb|AFV60451.1|  methyltransferase-like 2                              87.8    3e-16   
gb|EMT20993.1|  Benzoate carboxyl methyltransferase                   87.4    3e-16   
ref|XP_010255758.1|  PREDICTED: salicylate carboxymethyltransfera...  87.4    3e-16   
ref|XP_004493097.1|  PREDICTED: jasmonate O-methyltransferase-lik...  87.4    3e-16   
ref|XP_006355759.1|  PREDICTED: salicylate carboxymethyltransfera...  84.7    3e-16   
gb|ABC74575.1|  N-methyltransferase                                   87.0    4e-16   Coffea canephora [robusta coffee]
ref|XP_010266334.1|  PREDICTED: jasmonate O-methyltransferase-like    87.0    4e-16   
gb|AAY56107.1|  N-methyltransferase                                   87.0    4e-16   Coffea canephora [robusta coffee]
ref|XP_007156073.1|  hypothetical protein PHAVU_003G256100g           86.7    4e-16   
gb|AAW66849.1|  SAMT                                                  85.9    4e-16   Anthocercis littorea
gb|AAM18503.1|AF494413_1  N-methyltransferase                         87.0    4e-16   Coffea arabica [arabica coffee]
sp|Q9AVJ9.1|MXMT1_COFAR  RecName: Full=Monomethylxanthine methylt...  87.0    4e-16   Coffea arabica [arabica coffee]
ref|XP_006471194.1|  PREDICTED: benzoate carboxyl methyltransfera...  87.0    4e-16   
ref|XP_009776652.1|  PREDICTED: salicylate/benzoate carboxyl meth...  86.3    4e-16   
ref|XP_008388029.1|  PREDICTED: jasmonate O-methyltransferase-lik...  86.7    4e-16   
dbj|BAC43756.1|  theobromine synthase 1                               87.0    4e-16   Coffea arabica [arabica coffee]
gb|EAZ00319.1|  hypothetical protein OsI_22336                        87.0    5e-16   Oryza sativa Indica Group [Indian rice]
gb|AFQ98271.1|  salicylic acid carboxyl methltransferase              86.7    5e-16   
gb|AFV60441.1|  methyltransferase-like 3                              87.0    5e-16   
gb|AFV60436.1|  methyltransferase-like 2                              86.7    5e-16   
ref|XP_010690843.1|  PREDICTED: salicylate carboxymethyltransfera...  86.7    5e-16   
ref|XP_010536341.1|  PREDICTED: jasmonate O-methyltransferase-like    86.7    6e-16   
emb|CDP12639.1|  unnamed protein product                              86.7    6e-16   
ref|XP_010673295.1|  PREDICTED: salicylate carboxymethyltransfera...  86.3    6e-16   
gb|ACZ55223.1|  S-adenosyl-L-methionine:benzoic acid/salicylic ac...  86.7    7e-16   Nicotiana sylvestris
ref|XP_009800984.1|  PREDICTED: jasmonate O-methyltransferase         86.7    7e-16   
ref|XP_009390969.1|  PREDICTED: jasmonate O-methyltransferase-like    86.3    7e-16   
ref|XP_009596413.1|  PREDICTED: 3,7-dimethylxanthine N-methyltran...  85.5    7e-16   
gb|AFV60454.1|  methyltransferase-like 1                              86.3    7e-16   
gb|KCW68221.1|  hypothetical protein EUGRSUZ_F01875                   84.0    7e-16   
gb|AFV60457.1|  N-methyltransferase-like protein                      86.3    8e-16   
gb|KDO40395.1|  hypothetical protein CISIN_1g0476252mg                81.6    9e-16   
ref|XP_008377279.1|  PREDICTED: salicylate carboxymethyltransfera...  85.9    1e-15   
ref|XP_008780308.1|  PREDICTED: inactive anthranilate O-methyltra...  81.6    1e-15   
ref|XP_003624529.1|  Jasmonate O-methyltransferase                    85.5    1e-15   
dbj|BAC75665.1|  Xanthosine N-methyltransferase                       85.5    1e-15   Coffea arabica [arabica coffee]
ref|XP_011100460.1|  PREDICTED: salicylate carboxymethyltransfera...  85.1    1e-15   
ref|XP_006478460.1|  PREDICTED: jasmonate O-methyltransferase-like    82.8    2e-15   
ref|XP_009596411.1|  PREDICTED: 7-methylxanthosine synthase 1-lik...  85.5    2e-15   
ref|NP_001182137.1|  anthranilic acid methyltransferase 1             85.1    2e-15   
sp|D9J0Z7.1|AAMT1_MAIZE  RecName: Full=Anthranilate O-methyltrans...  85.1    2e-15   
gb|AFH89623.1|  jasmonic acid carboxyl methyltransferase              85.1    2e-15   
gb|AAX07284.1|  N-methyltransferase                                   85.1    2e-15   Coffea canephora [robusta coffee]
ref|XP_004493099.1|  PREDICTED: jasmonate O-methyltransferase-like    85.1    2e-15   
gb|EMT20798.1|  Benzoate carboxyl methyltransferase                   87.0    2e-15   
ref|XP_004495805.1|  PREDICTED: 7-methylxanthosine synthase 1-like    84.7    2e-15   
ref|XP_008466535.1|  PREDICTED: jasmonate O-methyltransferase         84.7    2e-15   
gb|EMT33542.1|  Benzoate carboxyl methyltransferase                   84.7    2e-15   
ref|XP_004229529.1|  PREDICTED: salicylate carboxymethyltransfera...  84.7    3e-15   
gb|EEC80305.1|  hypothetical protein OsI_22341                        85.1    3e-15   Oryza sativa Indica Group [Indian rice]
gb|AIN76710.1|  salicylic acid carboxyl methyltransferase             84.7    3e-15   
ref|XP_004154852.1|  PREDICTED: LOW QUALITY PROTEIN: jasmonate O-...  84.7    3e-15   
ref|XP_002281566.1|  PREDICTED: jasmonate O-methyltransferase         84.7    3e-15   
ref|XP_009801212.1|  PREDICTED: salicylate carboxymethyltransfera...  84.0    3e-15   
ref|XP_004147853.1|  PREDICTED: jasmonate O-methyltransferase-like    84.7    3e-15   
ref|XP_009336030.1|  PREDICTED: jasmonate O-methyltransferase-like    84.3    3e-15   
ref|XP_009336020.1|  PREDICTED: jasmonate O-methyltransferase-like    84.3    3e-15   
ref|XP_006473538.1|  PREDICTED: jasmonate O-methyltransferase-like    84.3    3e-15   
ref|XP_006341965.1|  PREDICTED: jasmonate O-methyltransferase-like    84.7    3e-15   
ref|XP_004292025.1|  PREDICTED: monomethylxanthine methyltransfer...  84.0    3e-15   
ref|XP_004292024.1|  PREDICTED: uncharacterized protein LOC101297114  86.3    3e-15   
gb|EEE65423.1|  hypothetical protein OsJ_20776                        83.6    3e-15   
emb|CAF31508.1|  S-adenosyl-L-methionine:benzoic acid/salicylic a...  84.3    3e-15   
ref|XP_004253351.1|  PREDICTED: salicylate carboxymethyltransfera...  80.9    4e-15   
gb|KDO41105.1|  hypothetical protein CISIN_1g042009mg                 82.8    4e-15   
ref|XP_003544375.1|  PREDICTED: jasmonate O-methyltransferase-like    84.3    4e-15   
emb|CDO99942.1|  unnamed protein product                              84.3    4e-15   
ref|NP_001149207.1|  benzoate carboxyl methyltransferase              84.3    4e-15   
emb|CAN64559.1|  hypothetical protein VITISV_040163                   84.7    4e-15   
gb|KHN20960.1|  Jasmonate O-methyltransferase                         84.3    4e-15   
ref|XP_011093975.1|  PREDICTED: benzoate carboxyl methyltransfera...  84.3    4e-15   
ref|XP_004291853.1|  PREDICTED: jasmonate O-methyltransferase-like    84.3    4e-15   
gb|ACN33745.1|  unknown                                               84.3    4e-15   
ref|XP_004295404.1|  PREDICTED: 3,7-dimethylxanthine N-methyltran...  84.0    5e-15   
gb|EMS66346.1|  Salicylate O-methyltransferase                        84.7    5e-15   
dbj|BAD37845.1|  putative benzothiadiazole-induced S-adenosyl-L-m...  84.0    5e-15   
ref|XP_003624528.1|  Jasmonate O-methyltransferase                    79.7    5e-15   
ref|XP_007201313.1|  hypothetical protein PRUPE_ppa007495mg           83.6    6e-15   
ref|XP_008236923.1|  PREDICTED: salicylate carboxymethyltransfera...  83.6    6e-15   
ref|XP_007200744.1|  hypothetical protein PRUPE_ppa025683mg           83.2    6e-15   
gb|KCW44754.1|  hypothetical protein EUGRSUZ_L01687                   84.0    6e-15   
gb|KEH26426.1|  salicylic acid carboxyl methyltransferase             83.6    6e-15   
ref|XP_010103911.1|  7-methylxanthosine synthase 1                    83.6    7e-15   
ref|XP_004252434.1|  PREDICTED: salicylate carboxymethyltransfera...  81.3    7e-15   
ref|XP_007133406.1|  hypothetical protein PHAVU_011G1761000g          82.0    8e-15   
ref|XP_006371103.1|  hypothetical protein POPTR_0019s03900g           83.2    8e-15   
ref|XP_003522017.1|  PREDICTED: LOW QUALITY PROTEIN: probable caf...  82.8    8e-15   
ref|XP_008236922.1|  PREDICTED: salicylate carboxymethyltransfera...  83.2    8e-15   
gb|EMT05111.1|  Benzoate carboxyl methyltransferase                   83.6    8e-15   
ref|XP_004173785.1|  PREDICTED: LOW QUALITY PROTEIN: salicylate O...  82.8    9e-15   
dbj|BAC43758.1|  tentative caffeine synthase 3                        83.2    9e-15   
ref|XP_002325355.2|  hypothetical protein POPTR_0019s03940g           83.2    9e-15   
ref|XP_002325354.2|  S-adenosyl-L-methionine:carboxyl methyltrans...  83.2    9e-15   
sp|Q9AVK1.1|CS3_COFAR  RecName: Full=Probable caffeine synthase 3...  83.2    9e-15   
ref|XP_008365009.1|  PREDICTED: LOW QUALITY PROTEIN: jasmonate O-...  81.3    1e-14   
gb|ACZ55224.1|  S-adenosyl-L-methionine:nicotinic acid carboxyl m...  82.8    1e-14   
ref|XP_003563909.1|  PREDICTED: anthranilate O-methyltransferase ...  83.2    1e-14   
ref|XP_007139771.1|  hypothetical protein PHAVU_008G057700g           82.8    1e-14   
ref|XP_002436784.1|  hypothetical protein SORBIDRAFT_10g008730        82.8    1e-14   
ref|XP_006371102.1|  hypothetical protein POPTR_0019s03890g           82.8    1e-14   
gb|AAF98406.1|AC024609_7  Hypothetical protein                        82.0    1e-14   
ref|XP_010042957.1|  PREDICTED: 7-methylxanthosine synthase 1-like    78.6    1e-14   
gb|ACN25976.1|  unknown                                               82.8    1e-14   
gb|EEE65426.1|  hypothetical protein OsJ_20782                        81.6    1e-14   
ref|NP_001147683.1|  anthranilate O-methyltransferase 2               82.8    1e-14   
ref|XP_008679517.1|  PREDICTED: anthranilate O-methyltransferase ...  82.8    1e-14   
ref|XP_010064625.1|  PREDICTED: LOW QUALITY PROTEIN: jasmonate O-...  83.2    1e-14   
ref|NP_001183238.1|  hypothetical protein                             82.8    1e-14   
gb|AHA82523.1|  N-methyltransferase-like protein 2                    82.8    1e-14   
gb|AFW85186.1|  benzoate carboxyl methyltransferase                   82.8    1e-14   
dbj|BAC43759.1|  tentative caffeine synthase 4                        82.8    2e-14   
ref|XP_006478462.1|  PREDICTED: jasmonate O-methyltransferase-like    82.4    2e-14   
gb|AFV60456.1|  methyltransferase-like protein                        82.8    2e-14   
emb|CDP12640.1|  unnamed protein product                              82.8    2e-14   
sp|Q9AVL9.1|CS4_COFAR  RecName: Full=Probable caffeine synthase 4...  82.8    2e-14   
gb|ABB02661.1|  jasmonic acid carboxyl methyltransferase              82.8    2e-14   
gb|AFV60453.1|  methyltransferase-like 1                              82.4    2e-14   
gb|EMT10135.1|  Benzoate carboxyl methyltransferase                   82.4    2e-14   
gb|AFV60455.1|  methyltransferase-like protein                        82.4    2e-14   
ref|NP_173394.1|  jasmonic acid carboxyl methyltransferase            82.4    2e-14   
ref|XP_002893057.1|  S-adenosyl-L-methionine:jasmonic acid carbox...  82.4    2e-14   
ref|XP_006469448.1|  PREDICTED: probable caffeine synthase 4-like     82.0    2e-14   
gb|EMT25234.1|  Jasmonate O-methyltransferase                         82.0    2e-14   
ref|NP_001047944.1|  Os02g0719600                                     82.0    2e-14   
ref|XP_010066136.1|  PREDICTED: 7-methylxanthosine synthase 1-like    79.0    3e-14   
ref|XP_009378645.1|  PREDICTED: salicylate carboxymethyltransfera...  81.6    3e-14   
gb|AAG23343.1|  S-adenosyl-L-methionine:jasmonic acid carboxyl me...  82.0    3e-14   
emb|CBI17477.3|  unnamed protein product                              81.6    3e-14   
gb|KDP29939.1|  hypothetical protein JCGZ_18508                       77.8    3e-14   
gb|AIB06953.1|  benzoic acid/salicylic acid carboxyl methyltransf...  81.6    3e-14   
gb|KHG10149.1|  Jasmonate O-methyltransferase                         79.7    3e-14   
ref|XP_007046643.1|  S-adenosyl-L-methionine-dependent methyltran...  82.4    4e-14   
ref|XP_002265700.3|  PREDICTED: benzoate carboxyl methyltransferase   81.6    4e-14   
ref|NP_001182138.1|  anthranilate O-methyltransferase 3               81.3    4e-14   
ref|XP_006655959.1|  PREDICTED: anthranilate O-methyltransferase ...  81.3    4e-14   
gb|EYU30773.1|  hypothetical protein MIMGU_mgv1a025571mg              77.0    4e-14   
ref|XP_002461513.1|  hypothetical protein SORBIDRAFT_02g003820        81.3    5e-14   
gb|EMS56388.1|  Salicylate O-methyltransferase                        81.3    5e-14   
dbj|BAJ88524.1|  predicted protein                                    80.9    5e-14   
gb|EYU24142.1|  hypothetical protein MIMGU_mgv1a017679mg              77.0    5e-14   
ref|XP_007227263.1|  hypothetical protein PRUPE_ppa017829mg           81.3    5e-14   
ref|XP_009410315.1|  PREDICTED: anthranilate O-methyltransferase ...  80.9    5e-14   
emb|CDP21368.1|  unnamed protein product                              80.5    6e-14   
emb|CDO99414.1|  unnamed protein product                              80.5    6e-14   
ref|XP_004965118.1|  PREDICTED: benzoate carboxyl methyltransfera...  80.9    6e-14   
ref|XP_004965119.1|  PREDICTED: benzoate carboxyl methyltransfera...  80.5    6e-14   
gb|EYU40286.1|  hypothetical protein MIMGU_mgv1a009362mg              80.5    7e-14   
ref|XP_004965116.1|  PREDICTED: salicylate O-methyltransferase-like   80.9    7e-14   
ref|XP_009621240.1|  PREDICTED: LOW QUALITY PROTEIN: jasmonate O-...  80.9    7e-14   
ref|XP_008467021.1|  PREDICTED: salicylate carboxymethyltransfera...  78.6    7e-14   
ref|XP_010910064.1|  PREDICTED: anthranilate O-methyltransferase ...  80.5    7e-14   
ref|NP_001182139.1|  benzoate O-methyltransferase                     80.5    8e-14   
ref|XP_006375575.1|  hypothetical protein POPTR_0014s16620g           80.1    8e-14   
ref|XP_010040437.1|  PREDICTED: 7-methylxanthosine synthase 1-like    78.6    8e-14   
dbj|BAG84614.1|  theobromine synthase                                 80.5    9e-14   
gb|EMS46273.1|  Salicylate O-methyltransferase                        81.3    9e-14   
ref|XP_002461571.1|  hypothetical protein SORBIDRAFT_02g004880        80.5    9e-14   
ref|XP_007199241.1|  hypothetical protein PRUPE_ppa022279mg           80.1    9e-14   
ref|XP_009378646.1|  PREDICTED: salicylate carboxymethyltransfera...  80.1    9e-14   
ref|XP_007201312.1|  hypothetical protein PRUPE_ppa007492mg           80.1    1e-13   
emb|CBI17469.3|  unnamed protein product                              79.7    1e-13   
gb|KFK44098.1|  hypothetical protein AALP_AA1G215600                  80.5    1e-13   
gb|AFZ93516.1|  caffeine synthase 4                                   80.1    1e-13   
gb|AAV52268.1|  methyl transferase                                    80.1    1e-13   
gb|AFK46769.1|  unknown                                               79.7    1e-13   
dbj|BAG84613.1|  theobromine synthase                                 79.7    1e-13   
ref|XP_009110264.1|  PREDICTED: jasmonate O-methyltransferase         80.1    1e-13   
ref|XP_010068554.1|  PREDICTED: 7-methylxanthosine synthase 1-like    79.7    1e-13   
ref|XP_004238275.1|  PREDICTED: jasmonate O-methyltransferase         80.1    1e-13   
sp|Q8H0D2.1|DXMT1_COFAR  RecName: Full=3,7-dimethylxanthine N-met...  80.1    1e-13   
gb|KCW63954.1|  hypothetical protein EUGRSUZ_G01635                   79.7    1e-13   
ref|XP_009103381.1|  PREDICTED: jasmonate O-methyltransferase-like    80.1    1e-13   
ref|XP_007133407.1|  hypothetical protein PHAVU_011G176200g           79.7    1e-13   
gb|KCW63952.1|  hypothetical protein EUGRSUZ_G01632                   79.7    2e-13   
gb|AIG92833.1|  SAM:benzoic acid/salicylic acid carboxyl methyltr...  79.7    2e-13   
dbj|BAC75663.1|  3,7-dimethylxanthine N-methyltransferase             79.7    2e-13   
gb|EYU40287.1|  hypothetical protein MIMGU_mgv1a008683mg              79.7    2e-13   
emb|CBI17337.3|  unnamed protein product                              76.3    2e-13   
gb|AFR23078.1|  salicylic acid methyltransferase                      79.7    2e-13   
ref|XP_010040952.1|  PREDICTED: 7-methylxanthosine synthase 1-like    79.0    2e-13   
dbj|BAG84616.1|  theobromine synthase                                 79.3    2e-13   
gb|AGT37606.1|  SABATH methyltransferase                              79.3    2e-13   
ref|XP_003534534.1|  PREDICTED: jasmonate O-methyltransferase-like    79.3    2e-13   
ref|XP_004965117.1|  PREDICTED: benzoate carboxyl methyltransfera...  79.0    2e-13   
ref|XP_010066140.1|  PREDICTED: 7-methylxanthosine synthase 1-like    77.4    2e-13   
ref|XP_010928139.1|  PREDICTED: anthranilate O-methyltransferase ...  79.3    2e-13   
emb|CAD70190.1|  carboxyl methyltransferase                           79.3    2e-13   
gb|EYU40288.1|  hypothetical protein MIMGU_mgv1a008483mg              79.0    3e-13   
emb|CDY39364.1|  BnaC05g15230D                                        79.3    3e-13   
sp|A4GE70.1|DXMT1_COFCA  RecName: Full=3,7-dimethylxanthine N-met...  79.0    3e-13   
ref|XP_004237389.1|  PREDICTED: salicylate carboxymethyltransfera...  79.0    3e-13   
gb|KCW63948.1|  hypothetical protein EUGRSUZ_G01625                   78.6    3e-13   
gb|EMT04236.1|  Jasmonate O-methyltransferase                         79.0    3e-13   
dbj|BAG84612.1|  theobromine synthase                                 78.6    3e-13   
ref|XP_006648994.1|  PREDICTED: anthranilate O-methyltransferase ...  78.6    3e-13   
ref|XP_009411163.1|  PREDICTED: anthranilate O-methyltransferase ...  78.6    4e-13   
emb|CDY08520.1|  BnaA05g27560D                                        78.6    4e-13   
gb|AAM18509.1|AF494419_1  N-methyltransferase                         78.6    4e-13   
ref|XP_009146720.1|  PREDICTED: salicylate/benzoate carboxyl meth...  78.6    4e-13   
ref|XP_002462861.1|  hypothetical protein SORBIDRAFT_02g033280        78.2    4e-13   
emb|CDP13096.1|  unnamed protein product                              77.0    4e-13   
ref|XP_009381663.1|  PREDICTED: anthranilate O-methyltransferase ...  78.6    4e-13   
ref|XP_010510249.1|  PREDICTED: jasmonate O-methyltransferase-lik...  77.8    5e-13   
ref|XP_010510248.1|  PREDICTED: jasmonate O-methyltransferase-lik...  78.2    5e-13   
ref|XP_002267308.1|  PREDICTED: probable caffeine synthase 4          78.6    5e-13   
gb|ADR30037.1|  putative caffeine synthase                            78.2    5e-13   
ref|XP_010469767.1|  PREDICTED: jasmonate O-methyltransferase-like    78.6    5e-13   
gb|KCW63951.1|  hypothetical protein EUGRSUZ_G01628                   77.0    5e-13   
gb|KHN33736.1|  Monomethylxanthine methyltransferase 2                77.8    5e-13   
gb|AFW85185.1|  hypothetical protein ZEAMMB73_654068                  78.2    5e-13   
ref|XP_006602826.1|  PREDICTED: 3,7-dimethylxanthine N-methyltran...  78.2    5e-13   
gb|KDP29937.1|  hypothetical protein JCGZ_18506                       78.2    5e-13   
gb|AEV57593.1|  N-methyltransferase                                   78.2    5e-13   
emb|CDY39365.1|  BnaC05g15220D                                        77.4    5e-13   
gb|KEH25098.1|  SAM-dependent carboxyl methyltransferase              74.3    5e-13   
ref|XP_008659067.1|  PREDICTED: anthranilate O-methyltransferase 3    78.2    5e-13   
gb|AFV60434.1|  3,7-dimethylxanthine methyltransferase                78.2    6e-13   
emb|CDX96654.1|  BnaA08g21970D                                        78.2    6e-13   
ref|XP_004297372.1|  PREDICTED: jasmonate O-methyltransferase-like    78.2    6e-13   
sp|Q8H0D3.1|CCS1_COFAR  RecName: Full=Caffeine synthase 1             78.2    6e-13   
ref|XP_003523515.2|  PREDICTED: probable caffeine synthase 4-like     77.8    6e-13   
ref|XP_011036357.1|  PREDICTED: benzoate carboxyl methyltransfera...  77.4    6e-13   
ref|XP_010548821.1|  PREDICTED: salicylate/benzoate carboxyl meth...  75.5    7e-13   
gb|KDO50937.1|  hypothetical protein CISIN_1g044727mg                 77.8    7e-13   
gb|AAM18508.1|AF494418_1  N-methyltransferase                         77.8    8e-13   
emb|CDP11846.1|  unnamed protein product                              75.5    8e-13   
gb|AAM18510.1|AF494420_1  N-methyltransferase                         77.8    8e-13   
emb|CBI28448.3|  unnamed protein product                              78.2    8e-13   
ref|XP_008220905.1|  PREDICTED: jasmonate O-methyltransferase         77.4    9e-13   
ref|XP_007200067.1|  hypothetical protein PRUPE_ppa022226mg           77.0    9e-13   
gb|EYU32908.1|  hypothetical protein MIMGU_mgv1a013852mg              75.1    9e-13   
ref|XP_010110043.1|  Jasmonate O-methyltransferase                    77.4    9e-13   
ref|XP_011083897.1|  PREDICTED: jasmonate O-methyltransferase         77.4    9e-13   
ref|XP_006305037.1|  hypothetical protein CARUB_v10009402mg           77.8    9e-13   
dbj|BAE79732.1|  theobromine synthase                                 77.4    9e-13   
gb|ABR17222.1|  unknown                                               77.4    9e-13   
ref|XP_006416484.1|  hypothetical protein EUTSA_v10007856mg           77.4    1e-12   
ref|XP_009149447.1|  PREDICTED: jasmonate O-methyltransferase         77.4    1e-12   
emb|CAQ58077.1|  salicylic acid methyl transferase                    74.3    1e-12   
ref|XP_002534362.1|  Benzoate carboxyl methyltransferase, putative    76.6    1e-12   
ref|XP_009368610.1|  PREDICTED: salicylate carboxymethyltransfera...  77.0    1e-12   
ref|XP_010040438.1|  PREDICTED: 7-methylxanthosine synthase 1-like    77.0    1e-12   
emb|CDM83697.1|  unnamed protein product                              77.4    1e-12   
ref|XP_004493336.1|  PREDICTED: jasmonate O-methyltransferase-like    77.0    1e-12   
gb|EMT05110.1|  Jasmonate O-methyltransferase                         73.9    1e-12   
ref|XP_009368624.1|  PREDICTED: salicylate carboxymethyltransfera...  77.0    1e-12   
dbj|BAE79729.1|  theobromine synthase                                 77.0    1e-12   
dbj|BAG84617.1|  theobromine synthase                                 77.0    1e-12   
ref|XP_004493335.1|  PREDICTED: jasmonate O-methyltransferase-like    77.0    1e-12   
dbj|BAJ87645.1|  predicted protein                                    77.0    1e-12   
dbj|BAJ90456.1|  predicted protein                                    77.0    1e-12   
ref|XP_008448532.1|  PREDICTED: salicylate carboxymethyltransfera...  76.6    2e-12   
ref|XP_007139770.1|  hypothetical protein PHAVU_008G057600g           76.6    2e-12   
gb|EMT02237.1|  Benzoate carboxyl methyltransferase                   74.7    2e-12   
dbj|BAG84615.1|  theobromine synthase                                 76.6    2e-12   
ref|XP_009387584.1|  PREDICTED: anthranilate O-methyltransferase ...  74.3    2e-12   
emb|CDX83745.1|  BnaC08g19000D                                        76.6    2e-12   
ref|XP_010547461.1|  PREDICTED: salicylate/benzoate carboxyl meth...  76.6    2e-12   
dbj|BAD37856.1|  putative benzothiadiazole-induced S-adenosyl-L-m...  76.6    2e-12   
ref|XP_002263459.1|  PREDICTED: jasmonate O-methyltransferase-like    76.3    2e-12   
emb|CBI17336.3|  unnamed protein product                              76.3    2e-12   
ref|XP_010068553.1|  PREDICTED: 7-methylxanthosine synthase 1-like    75.9    2e-12   
gb|EYU34870.1|  hypothetical protein MIMGU_mgv11b024186mg             72.0    2e-12   
ref|XP_011011128.1|  PREDICTED: probable caffeine synthase 3          76.3    2e-12   
gb|AEC11049.1|  caffeine synthase                                     72.4    3e-12   
ref|XP_004953709.1|  PREDICTED: salicylate O-methyltransferase-like   76.3    3e-12   
gb|KCW63953.1|  hypothetical protein EUGRSUZ_G01634                   76.3    3e-12   
gb|EMS61717.1|  Salicylate O-methyltransferase                        76.3    3e-12   
ref|XP_004500800.1|  PREDICTED: theobromine synthase 2-like           76.3    3e-12   
ref|XP_010477183.1|  PREDICTED: LOW QUALITY PROTEIN: jasmonate O-...  76.3    3e-12   
emb|CAN82906.1|  hypothetical protein VITISV_039704                   76.3    3e-12   
gb|KHN40444.1|  Caffeine synthase 1                                   75.5    3e-12   
gb|ACG30376.1|  jasmonate O-methyltransferase                         75.9    3e-12   



>ref|XP_010649116.1| PREDICTED: salicylate carboxymethyltransferase isoform X2 [Vitis 
vinifera]
Length=342

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P YTPS AEVK  VEK+GSFTI  LE  +++W     +    + + +
Sbjct  224  GLIEEEKMDSFNIPQYTPSPAEVKCEVEKEGSFTISKLEVSEVNWNAYHGEFCPSDAHKD  283

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVSHFG+GIIEEVF RY KI+AD MSREKTE+ N
Sbjct  284  GGYNVAKLMRAVAEPLLVSHFGDGIIEEVFSRYQKIVADRMSREKTEFVN  333



>ref|XP_002262676.1| PREDICTED: salicylate carboxymethyltransferase isoform X1 [Vitis 
vinifera]
Length=364

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P YTPS AEVK  VEK+GSFTI  LE  +++W     +    + + +
Sbjct  246  GLIEEEKMDSFNIPQYTPSPAEVKCEVEKEGSFTISKLEVSEVNWNAYHGEFCPSDAHKD  305

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVSHFG+GIIEEVF RY KI+AD MSREKTE+ N
Sbjct  306  GGYNVAKLMRAVAEPLLVSHFGDGIIEEVFSRYQKIVADRMSREKTEFVN  355



>ref|XP_010649117.1| PREDICTED: salicylate carboxymethyltransferase-like isoform X2 
[Vitis vinifera]
Length=341

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EEK++SFN P YTPS AEVK  VEK+GSFTI  LE  +++W     +    + + +
Sbjct  223  GLIDEEKMDSFNIPQYTPSPAEVKCEVEKEGSFTINRLEVSEVNWNAYHGEFCPSDAHKD  282

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVSHFG+GIIEEVF RY KI+AD MSREKTE+ N
Sbjct  283  GGYNVAKLMRAVAEPLLVSHFGDGIIEEVFCRYKKIVADRMSREKTEFVN  332



>ref|XP_002262759.2| PREDICTED: salicylate carboxymethyltransferase [Vitis vinifera]
Length=364

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEK++SFN P YTPS AEVK  VEK+GSFTI  LE  +++W     +    + + +
Sbjct  246  GLVEEEKMDSFNIPQYTPSPAEVKCEVEKEGSFTINRLEASEVNWNAYHGEFCPSDAHED  305

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVS+FG+GIIEEVF RY KI+AD MSREKTE+ N
Sbjct  306  GGYNVAKLMRAVAEPLLVSYFGDGIIEEVFSRYQKIVADRMSREKTEFVN  355



>ref|XP_010649118.1| PREDICTED: salicylate carboxymethyltransferase isoform X2 [Vitis 
vinifera]
Length=342

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EEK++SFN P YTPS AEVK  VEK+GSFTI  LE  +++W     +    + + +
Sbjct  224  GLIDEEKMDSFNIPQYTPSPAEVKCEVEKEGSFTINRLEVSEVNWNAYHGEFCPSDAHKD  283

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVSHFG+GIIEEVF RY KI+AD M+REKTE+ N
Sbjct  284  GGYNVAKLMRAVAEPLLVSHFGDGIIEEVFSRYKKIVADRMTREKTEFVN  333



>ref|XP_002263123.2| PREDICTED: salicylate carboxymethyltransferase-like isoform X1 
[Vitis vinifera]
Length=363

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EEK++SFN P YTPS AEVK  VEK+GSFTI  LE  +++W     +    + + +
Sbjct  245  GLIDEEKMDSFNIPQYTPSPAEVKCEVEKEGSFTINRLEVSEVNWNAYHGEFCPSDAHKD  304

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVSHFG+GIIEEVF RY KI+AD MSREKTE+ N
Sbjct  305  GGYNVAKLMRAVAEPLLVSHFGDGIIEEVFCRYKKIVADRMSREKTEFVN  354



>gb|KHG11269.1| Salicylate O-methyltransferase [Gossypium arboreum]
Length=363

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 89/132 (67%), Gaps = 4/132 (3%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L     +A +  ++ G +EEEKLNSFN P YTPS AEVK  VEK+GSF+I+ L
Sbjct  228  CCYIWELL----AMALNDMVLEGVIEEEKLNSFNIPQYTPSPAEVKYEVEKEGSFSIDRL  283

Query  210  ETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIA  389
            E  +++W   + +  + +   +  Y VA+ +RAV EP+L SHFGE II+EVF RY +I+A
Sbjct  284  EVTEVNWNAYQNETDLSDAFKDGGYNVAKCMRAVAEPLLFSHFGEAIIDEVFRRYREIVA  343

Query  390  DSMSREKTEYTN  425
            D MS+EKTE+ N
Sbjct  344  DRMSKEKTEFVN  355



>ref|XP_002263018.1| PREDICTED: salicylate carboxymethyltransferase isoform X1 [Vitis 
vinifera]
 emb|CBI17472.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EEK++SFN P YTPS AEVK  VEK+GSFTI  LE  +++W     +    + + +
Sbjct  245  GLIDEEKMDSFNIPQYTPSPAEVKCEVEKEGSFTINRLEVSEVNWNAYHGEFCPSDAHKD  304

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVSHFG+GIIEEVF RY KI+AD M+REKTE+ N
Sbjct  305  GGYNVAKLMRAVAEPLLVSHFGDGIIEEVFSRYKKIVADRMTREKTEFVN  354



>emb|CBI17471.3| unnamed protein product [Vitis vinifera]
Length=245

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EEK++SFN P YTPS AEVK  VEK+GS+TI  LE  +++W     +    + + +
Sbjct  127  GLIDEEKMDSFNIPQYTPSPAEVKCEVEKEGSYTINRLEVSEVNWNAYHGEFCPSDAHKD  186

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVSHFG+GIIEEVF RY KI+AD M+REKTE+ N
Sbjct  187  GGYNVAKLMRAVAEPLLVSHFGDGIIEEVFGRYKKIVADRMTREKTEFVN  236



>ref|XP_010113410.1| Salicylate O-methyltransferase [Morus notabilis]
 gb|EXC35437.1| Salicylate O-methyltransferase [Morus notabilis]
Length=364

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EE+KL++FN P YTP  +EVKS V K+GSFTI  LE  Q++W     D    +  ++
Sbjct  246  GLIEEDKLDTFNIPQYTPCPSEVKSEVLKEGSFTINRLEVSQVNWDAYHSDFSPSDALDD  305

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVSHFGEGIIEEVF RY +IIAD MS+EKTE+ N
Sbjct  306  GGYSVAKCMRAVAEPLLVSHFGEGIIEEVFRRYREIIADRMSKEKTEFIN  355



>gb|KHG15891.1| Salicylate O-methyltransferase [Gossypium arboreum]
Length=363

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 87/132 (66%), Gaps = 4/132 (3%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L     IA    L+ G +EEEKLNSFN P+YTPS AEVK  V K+GSF I+ L
Sbjct  228  CCYFWELL----AIALGDMLVEGLIEEEKLNSFNIPMYTPSPAEVKYEVVKEGSFNIDRL  283

Query  210  ETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIA  389
            E  +++W   + +  + +   +  Y VA+ +RAV EP+L SHFGEGI++EVF RY +II+
Sbjct  284  EVTEVNWNAYQDEPDLSDAFKDGGYNVAKCIRAVAEPLLASHFGEGILDEVFRRYREIIS  343

Query  390  DSMSREKTEYTN  425
            D +S+EK E+ N
Sbjct  344  DRVSKEKNEFVN  355



>gb|ABK95036.1| unknown [Populus trichocarpa]
 gb|AGR50490.1| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
[Populus trichocarpa]
Length=364

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 89/134 (66%), Gaps = 8/134 (6%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L     +A +  ++ G +EEEK +SFN P YTPS  EV+S V+K+GSFTI+ L
Sbjct  228  CCYIWELL----AVALNEMVLEGIIEEEKFDSFNIPQYTPSPFEVESQVKKEGSFTIDRL  283

Query  210  ETFQIHWTGDEYDNMI--GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKI  383
            E  Q++W  + YDN +       +  Y VA+ +RAV EP+LVSHFGE II+EVF RY +I
Sbjct  284  EVSQVNW--NAYDNEVYQSAAFEDGGYNVAKCMRAVAEPLLVSHFGEAIIDEVFSRYGEI  341

Query  384  IADSMSREKTEYTN  425
            +A  MS+EKTE+ N
Sbjct  342  VASRMSKEKTEFVN  355



>ref|XP_007046855.1| Salicylate O-methyltransferase [Theobroma cacao]
 gb|EOX91012.1| Salicylate O-methyltransferase [Theobroma cacao]
Length=363

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKLNSFN P YTPS AEVKS V K+GSF I+ LE  +++W   + +  + +   +
Sbjct  246  GLIEEEKLNSFNIPQYTPSPAEVKSEVLKEGSFMIDRLEVTEVNWNAYQNEFDLSDAFKD  305

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+L SHFGE II+EVF RY  I+A+ MS+EKTE+ N
Sbjct  306  GGYNVAKCMRAVAEPLLASHFGEAIIDEVFRRYRDIVANRMSKEKTEFVN  355



>ref|XP_002264863.1| PREDICTED: salicylate carboxymethyltransferase [Vitis vinifera]
 emb|CBI17467.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EEK++SFN P YTPS  EVK  V K+GSFTI  LE  Q++W     +    + + +
Sbjct  246  GLIDEEKMDSFNLPHYTPSPTEVKCEVGKEGSFTINRLEVSQVNWNAYHGEFCPSDAHKD  305

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVSHFG+GIIEEVF RY KI+AD MSRE TE+ N
Sbjct  306  GGYNVAKLVRAVAEPLLVSHFGDGIIEEVFSRYQKIVADRMSRETTEFVN  355



>gb|AFP53830.1| SAMT, partial [Populus tomentosa]
Length=364

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 88/134 (66%), Gaps = 8/134 (6%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L     +A +  ++ G +EEEK +SFN P YTPS  EV++ V+K+GSFTI+ L
Sbjct  228  CCYIWELL----AVALNEMVLEGIIEEEKFDSFNIPQYTPSPFEVETQVKKEGSFTIDRL  283

Query  210  ETFQIHWTGDEYDNMI--GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKI  383
            E  Q++W  + YDN +       +  Y VAR +RAV EP+L SHFGE II+EVF RY +I
Sbjct  284  EVSQVNW--NAYDNEVHQSAAFEDGGYNVARCMRAVAEPLLASHFGEAIIDEVFSRYGEI  341

Query  384  IADSMSREKTEYTN  425
            +A  MS+EKTE+ N
Sbjct  342  VASRMSKEKTEFVN  355



>gb|AFP53831.1| SAMT, partial [Populus x beijingensis]
Length=364

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 88/134 (66%), Gaps = 8/134 (6%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L     +A +  ++ G +EEEK +SFN P YTPS  EV++ V+K+GSFTI+ L
Sbjct  228  CCYIWELL----AVALNDMVLEGIIEEEKFDSFNIPQYTPSPFEVETQVKKEGSFTIDRL  283

Query  210  ETFQIHWTGDEYDNMI--GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKI  383
            E  Q++W  + YDN +       +  Y VAR +RAV EP+L SHFGE II+EVF RY +I
Sbjct  284  EVSQVNW--NAYDNEVHQSAAFEDGGYNVARCMRAVAEPLLASHFGEAIIDEVFSRYGEI  341

Query  384  IADSMSREKTEYTN  425
            +A  MS+EKTE+ N
Sbjct  342  VASRMSKEKTEFVN  355



>gb|ACZ55216.1| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
[Nicotiana suaveolens]
Length=358

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 77/112 (69%), Gaps = 10/112 (9%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGnnn  269
            G +EEEK++SFN P YTPS  EVK  VEK+GSFTI  LE  ++HW    D Y N      
Sbjct  246  GLIEEEKVDSFNIPQYTPSPGEVKYAVEKEGSFTINQLEATRVHWNACNDNYKN------  299

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              + Y V+R +RAV EP+LVS FGE +++ VFH+Y  II+D MS+EKTE+TN
Sbjct  300  --SGYSVSRCMRAVAEPLLVSQFGEELMDLVFHKYEDIISDRMSKEKTEFTN  349



>gb|AFS35577.1| salicylic acid methyl transferase [Nicotiana benthamiana]
Length=358

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 79/112 (71%), Gaps = 10/112 (9%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGnnn  269
            G +EEEK++SFN P YTPS  +VK  VEK+GSFTI  LE  ++HW    D+Y N      
Sbjct  246  GLIEEEKVDSFNIPQYTPSPGDVKYAVEKEGSFTINQLEATRVHWNACNDKYKN------  299

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              + Y V+R +RAV EP+LVS FGE +++ VFH+Y +II+D MS+EKTE+TN
Sbjct  300  --SGYSVSRCMRAVAEPLLVSQFGEELMDLVFHKYEEIISDRMSKEKTEFTN  349



>gb|ABO71014.1| benzoic acid/salicylic acid methyltransferase [Schwenckia americana]
Length=343

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 79/112 (71%), Gaps = 8/112 (7%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW--TGDEYDNMIGnnn  269
            G +EEEKL SFN P+YTPSL EVK +VE DGSFTI+ LET +IHW  + D+  N+ G   
Sbjct  234  GLIEEEKLXSFNIPMYTPSLREVKYIVENDGSFTIDRLETSEIHWNVSDDDKCNING---  290

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                Y +A+ +RAV EP+L+SHF E  +++VFH+Y   I D MS+EKT++ N
Sbjct  291  ---GYNMAKCMRAVAEPLLLSHFSEEFMDQVFHKYKXKIVDCMSKEKTKFIN  339



>gb|KDP44576.1| hypothetical protein JCGZ_22158 [Jatropha curcas]
Length=367

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 81/114 (71%), Gaps = 6/114 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDN--MIGnnn  269
            G ++EEK NSFN P YTPS  EVKS +EK+GSFTI+ LE  +++W  D YDN   + ++ 
Sbjct  247  GLIDEEKFNSFNIPQYTPSPFEVKSEIEKEGSFTIDRLEVSEVNW--DAYDNEFNLSDSF  304

Query  270  nnaaYKVARGLRAVVEPILVSHFG--EGIIEEVFHRYTKIIADSMSREKTEYTN  425
             +  Y VAR +RAV EP+L+ HFG  + II+EVF RY  IIAD M++EKTE+ N
Sbjct  305  KDGGYNVARCMRAVAEPLLIGHFGFDKAIIDEVFRRYQTIIADRMAKEKTEFVN  358



>gb|AAW66835.1| SAMT [Schizanthus pinnatus]
Length=321

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 90/138 (65%), Gaps = 9/138 (7%)
 Frame = +3

Query  3    FLETNCHDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEK  182
            FL     D C     ++  +  ++ +  +  G +EE+K++ FN P YTPS AEVK +VEK
Sbjct  192  FLGRKSEDPCSKECCYIWELLSMSLNELVAQGLIEEDKVDLFNIPQYTPSPAEVKCIVEK  251

Query  183  DGSFTIECLETFQIHWTG-DEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEE  359
            +GSFTI+CLE  ++HW+G DE  N         +Y V+R +RAV EP+LV+HFGE ++++
Sbjct  252  EGSFTIDCLEATKVHWSGSDETFN--------DSYNVSRCMRAVAEPMLVNHFGEDLMDK  303

Query  360  VFHRYTKIIADSMSREKT  413
            VFH+Y + I D MS+EKT
Sbjct  304  VFHKYEQNIDDCMSKEKT  321



>gb|ABO71012.1| benzoic acid/salicylic acid methyltransferase [Protoschwenkia 
mandonii]
Length=333

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 85/135 (63%), Gaps = 10/135 (7%)
 Frame = +3

Query  9    ETNCHDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDG  188
            E  C   C Y +  L     +   VA   G +EEEK+NSFN P YTPS AEV  +V K+G
Sbjct  209  EDPCSKECCYIYELL--ANALNDLVAE--GLIEEEKVNSFNIPNYTPSPAEVTYVVGKEG  264

Query  189  SFTIECLETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFH  368
            SFTI+CLET +IHW   +   + G      AY VA+ +RAVVEP+LVSHFG  ++++VFH
Sbjct  265  SFTIDCLETSEIHWDASDGKCING------AYNVAQCMRAVVEPLLVSHFGVELMDQVFH  318

Query  369  RYTKIIADSMSREKT  413
            +Y + I D MS+E T
Sbjct  319  KYKEFITDCMSKENT  333



>ref|XP_009594558.1| PREDICTED: salicylate carboxymethyltransferase-like [Nicotiana 
tomentosiformis]
 gb|AAW66850.1| SAMT [Nicotiana tabacum]
Length=358

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 80/112 (71%), Gaps = 10/112 (9%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGnnn  269
            G +EEEK++SFN P YTPS A+VK +VEK+GSFTI  LE  ++HW    D+Y N+     
Sbjct  246  GLIEEEKVDSFNIPQYTPSPADVKYVVEKEGSFTINQLEATRVHWNACNDKYKNV-----  300

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                Y V+R +RAV EP+LVS FGE +++ VFH+Y +II++ MS+ +TE+TN
Sbjct  301  ---GYSVSRCMRAVAEPLLVSQFGEELMDLVFHKYEQIISECMSKAQTEFTN  349



>ref|XP_011025843.1| PREDICTED: salicylate carboxymethyltransferase [Populus euphratica]
Length=377

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (70%), Gaps = 4/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMI--Gnnn  269
            G +EEEK +SFN P YTPS  EV+S V+K+GSFTI+ LE   I W  + YDN +      
Sbjct  259  GIIEEEKFDSFNIPQYTPSPFEVESQVKKEGSFTIDRLEVSHISW--NAYDNEVHQSEAF  316

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             +  Y VAR +RAV EP+LVSHFGE II+EVF +Y +I+A  MS+EKTE+ N
Sbjct  317  EDDGYNVARCMRAVAEPLLVSHFGEAIIDEVFSKYGEIVASRMSKEKTEFVN  368



>gb|AAO45013.1| S-adenosyl-L-methionine:benzoic acid/salicylic acid carboxyl 
methyltransferase [Petunia x hybrida]
Length=357

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 78/110 (71%), Gaps = 7/110 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EEK+++FN P YTPS AEVK +VEK+GSFTI  LET ++HW     +   G     
Sbjct  246  GLIKEEKVDAFNIPQYTPSPAEVKYIVEKEGSFTINRLETSRVHWNASNNEKNGG-----  300

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y V+R +RAV EP+LVSHF + +++ VFH+Y +II+D MS+EKTE+ N
Sbjct  301  --YNVSRCMRAVAEPLLVSHFDKELMDLVFHKYEEIISDCMSKEKTEFIN  348



>emb|CAC33768.1| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
[Stephanotis floribunda]
Length=366

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 81/112 (72%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEE+L+ FN P YTPS AEVK  VE++GSF+I  LE   IHWT  ++D++ G+++  
Sbjct  246  GQIEEEQLDCFNVPQYTPSPAEVKYFVEEEGSFSITRLEATTIHWTAYDHDHVTGHHHAF  305

Query  276  aa--YKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                Y ++  +RAVVEP+LV HFGE I++EVFHRY +I+ + M++EK E+ N
Sbjct  306  KDGGYSLSNCVRAVVEPLLVRHFGEAIMDEVFHRYREILTNCMTKEKIEFIN  357



>gb|ACZ55219.1| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
[Nicotiana alata]
Length=358

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P YTPS A+VK +VEK+GSFTI  LE  +IHW      N    N  N
Sbjct  246  GLIEEEKVDSFNIPQYTPSPADVKYIVEKEGSFTINQLEATRIHW------NACNENYKN  299

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y V+R +RAV EP+LVS FGE +++ VFH+Y +II+D MS+E+TE+ N
Sbjct  300  GGYDVSRCMRAVAEPLLVSQFGEELMDLVFHKYEEIISDCMSKEQTEFIN  349



>gb|ABF50941.1| S-adenosyl-L-methionine:benzoic acid/salicylic acid carboxyl 
methyltransferase [Petunia x hybrida]
Length=357

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 7/110 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EEK+++FN P YTPS AEVK LVEK+GSFTI  LET ++HW         G     
Sbjct  246  GLIKEEKVDAFNIPQYTPSPAEVKYLVEKEGSFTINRLETSRVHWNASNNVKNGG-----  300

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y V+R +RAV EP+LVSHF + +++ VFH+Y +II+D MS+EKTE+ N
Sbjct  301  --YNVSRCMRAVAEPLLVSHFDKELMDLVFHKYEEIISDCMSKEKTEFIN  348



>gb|KCW60614.1| hypothetical protein EUGRSUZ_H03343 [Eucalyptus grandis]
Length=371

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P+YTPS  EV+  V+K GSF+I+CLE  +++W+  + +        +
Sbjct  253  GLIEEEKVDSFNVPMYTPSPKEVRGEVQKQGSFSIDCLEVSEVNWSVLDTNFNTNVVLED  312

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y +A+ +RAV EP+LV HFGE II+EVF RY   I D+MS+EKT + N
Sbjct  313  EGYNMAKCMRAVFEPLLVEHFGEEIIDEVFKRYRAQIVDAMSKEKTAFVN  362



>ref|XP_010024170.1| PREDICTED: salicylate carboxymethyltransferase-like [Eucalyptus 
grandis]
 gb|KCW60615.1| hypothetical protein EUGRSUZ_H03343 [Eucalyptus grandis]
Length=373

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P+YTPS  EV+  V+K GSF+I+CLE  +++W+  + +        +
Sbjct  255  GLIEEEKVDSFNVPMYTPSPKEVRGEVQKQGSFSIDCLEVSEVNWSVLDTNFNTNVVLED  314

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y +A+ +RAV EP+LV HFGE II+EVF RY   I D+MS+EKT + N
Sbjct  315  EGYNMAKCMRAVFEPLLVEHFGEEIIDEVFKRYRAQIVDAMSKEKTAFVN  364



>gb|KCW60616.1| hypothetical protein EUGRSUZ_H03343 [Eucalyptus grandis]
Length=374

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P+YTPS  EV+  V+K GSF+I+CLE  +++W+  + +        +
Sbjct  256  GLIEEEKVDSFNVPMYTPSPKEVRGEVQKQGSFSIDCLEVSEVNWSVLDTNFNTNVVLED  315

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y +A+ +RAV EP+LV HFGE II+EVF RY   I D+MS+EKT + N
Sbjct  316  EGYNMAKCMRAVFEPLLVEHFGEEIIDEVFKRYRAQIVDAMSKEKTAFVN  365



>gb|KCW60619.1| hypothetical protein EUGRSUZ_H03344 [Eucalyptus grandis]
Length=363

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P+YTPS  EV+  V+K GSF+I+CLE  +++W+  + +      + +
Sbjct  245  GLIEEEKVDSFNVPMYTPSPKEVRGEVQKQGSFSIDCLEVSEVNWSVLDTNFNPNVVSED  304

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y +A+ +RAV EP+L+ HFGE II+EVF RY   + D+MS+EKT + N
Sbjct  305  GGYNMAKCMRAVAEPLLIEHFGEEIIDEVFKRYRAQLVDAMSKEKTAFVN  354



>ref|XP_007046857.1| Salicylate O-methyltransferase [Theobroma cacao]
 gb|EOX91014.1| Salicylate O-methyltransferase [Theobroma cacao]
Length=363

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 84/132 (64%), Gaps = 4/132 (3%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L     +A +  +  G ++EEKLNSFN P Y PS AE+KS V K+ SFT++ L
Sbjct  228  CCYIWELL----AMALNDMVFEGLIKEEKLNSFNIPNYLPSPAELKSEVLKERSFTVDRL  283

Query  210  ETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIA  389
            E  +++W   + +  + +   +  Y  A+ +RAV EP+L SHFGE II+EVF RY  I+A
Sbjct  284  EVTEVNWNAYQNEPDLSDAFKDGGYNFAKCIRAVTEPLLASHFGEAIIDEVFRRYRDIVA  343

Query  390  DSMSREKTEYTN  425
            D MS+EKTE+ N
Sbjct  344  DRMSKEKTEFVN  355



>ref|XP_004509288.1| PREDICTED: salicylate O-methyltransferase-like [Cicer arietinum]
Length=364

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EE+L+SFN P YTPS +EVK  V K+GSF I+ L   ++ W   E ++ +  ++ +
Sbjct  246  GIIKEEQLDSFNIPQYTPSPSEVKLEVMKEGSFAIDQLNVSEVSWNSLECESQMSESHVD  305

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             AY V + +RAV EP+LVSHFGE IIEE+F+RY KI+ D MS+EKT++ N
Sbjct  306  GAYNVTQLMRAVAEPLLVSHFGENIIEELFNRYKKILTDRMSKEKTKFVN  355



>gb|AAO45012.1| S-adenosyl-L-methionine:benzoic acid/salicylic acid carboxyl 
methyltransferase [Petunia x hybrida]
Length=357

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 77/110 (70%), Gaps = 7/110 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EEK+++FN P YTPS AEVK +VEK+GSFTI  LET ++HW     +   G     
Sbjct  246  GLIKEEKVDAFNIPQYTPSPAEVKYIVEKEGSFTINRLETSRVHWNASNNEKNGG-----  300

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y V+R +RAV EP+LVSHF + +++ VFH+Y +I++D MS+E TE+ N
Sbjct  301  --YNVSRCMRAVAEPLLVSHFDKELMDLVFHKYEEIVSDCMSKENTEFIN  348



>gb|KHN22770.1| Salicylate O-methyltransferase [Glycine soja]
Length=370

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 82/116 (71%), Gaps = 6/116 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG------DEYDNMI  257
            G ++EE+L++FN PLYTPS +EVK  V K+GSF I  LE  +++W         E+++  
Sbjct  246  GIIKEEQLDTFNIPLYTPSPSEVKLEVLKEGSFAINRLEVSEVNWNAFDDWNALEFESER  305

Query  258  GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             +  ++  Y VA+ +RAVVEP+LVSHF E IIEEVF RY +I+AD MS+EKT++TN
Sbjct  306  SDTLSDGGYNVAQCMRAVVEPMLVSHFDEAIIEEVFSRYQQILADRMSKEKTKFTN  361



>ref|XP_004509289.1| PREDICTED: salicylate O-methyltransferase-like [Cicer arietinum]
Length=364

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EE+L+SFN P YTPS +EVK  V K+GSF I  L   ++ W   E ++ +  ++ +
Sbjct  246  GIIKEEQLDSFNLPHYTPSPSEVKLEVMKEGSFAIHQLNVSEVSWNSLECESQMSESHVD  305

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             AY V + +RAV EP+LVSHFGE IIEE+F+RY KI+ D MS+EKT++ N
Sbjct  306  GAYNVTQLMRAVAEPLLVSHFGENIIEELFNRYKKILTDRMSKEKTKFVN  355



>gb|KDO70999.1| hypothetical protein CISIN_1g017514mg [Citrus sinensis]
Length=349

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 80/114 (70%), Gaps = 5/114 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT----GDEYDNMIGn  263
            G +EEEK+N FN P YTPS AE+KS V K+GSFTI+ LE  +++W     G +++  +  
Sbjct  228  GLIEEEKVNCFNIPQYTPSPAEIKSEVIKEGSFTIDHLEVSEVNWNAYQNGFKFNEAVDA  287

Query  264  nnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             N+   Y VA  +RAV EP+LVS FGE II+E+F RY +I+AD MS+EKT++ N
Sbjct  288  FNDGG-YNVANCMRAVAEPLLVSQFGEAIIDELFKRYREIVADRMSKEKTKFIN  340



>sp|Q9SPV4.1|SAMT_CLABR RecName: Full=Salicylate carboxymethyltransferase; AltName: Full=S-adenosyl-L-methionine:salicylate 
acid carboxylmethyltransferase; 
Short=CbSAMT; AltName: Full=Salicylate O-methyltransferase 
[Clarkia breweri]
 pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase 
(Samt)
 gb|AAF00108.1|AF133053_1 S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
[Clarkia breweri]
Length=359

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 75/110 (68%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++ FN P YTPS  EV++ + K+GSF I+ +E  +I+W+    D   G +   
Sbjct  240  GLIEEEKMDKFNIPQYTPSPTEVEAEILKEGSFLIDHIEASEIYWSSCTKDGDGGGSVEE  299

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VAR +RAV EP+L+ HFGE IIE+VFHRY  +I + MS+EKT++ N
Sbjct  300  EGYNVARCMRAVAEPLLLDHFGEAIIEDVFHRYKLLIIERMSKEKTKFIN  349



>gb|KDO70998.1| hypothetical protein CISIN_1g017514mg [Citrus sinensis]
Length=370

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 81/114 (71%), Gaps = 5/114 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT----GDEYDNMIGn  263
            G +EEEK+N FN P YTPS AE+KS V K+GSFTI+ LE  +++W     G +++  + +
Sbjct  249  GLIEEEKVNCFNIPQYTPSPAEIKSEVIKEGSFTIDHLEVSEVNWNAYQNGFKFNEAV-D  307

Query  264  nnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              N+  Y VA  +RAV EP+LVS FGE II+E+F RY +I+AD MS+EKT++ N
Sbjct  308  AFNDGGYNVANCMRAVAEPLLVSQFGEAIIDELFKRYREIVADRMSKEKTKFIN  361



>ref|XP_003547964.1| PREDICTED: salicylate carboxymethyltransferase-like [Glycine 
max]
Length=370

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 82/116 (71%), Gaps = 6/116 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW------TGDEYDNMI  257
            G ++EE+L++FN P YTPS +EVK  V K+GSF I  LE  +++W         E+++  
Sbjct  246  GIIKEEQLDTFNIPQYTPSPSEVKLEVLKEGSFAINRLEVSEVNWDAFDDWNALEFESER  305

Query  258  GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             ++ ++  Y VA+ +RAV EP+LVSHFGE IIEEVF RY +I+AD MS+EKT++TN
Sbjct  306  ADSLSDGGYNVAQCMRAVAEPMLVSHFGEAIIEEVFSRYQQILADRMSKEKTKFTN  361



>gb|KHN22766.1| Salicylate O-methyltransferase [Glycine soja]
Length=370

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 82/116 (71%), Gaps = 6/116 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW------TGDEYDNMI  257
            G ++EE+L++FN P YTPS +EVK  V K+GSF I  LE  +++W         E+++  
Sbjct  246  GIIKEEQLDTFNIPQYTPSPSEVKLEVLKEGSFAINRLEVSEVNWDAFDDWNALEFESER  305

Query  258  GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             ++ ++  Y VA+ +RAV EP+LVSHFGE IIEEVF RY +I+AD MS+EKT++TN
Sbjct  306  ADSLSDGGYNVAQCMRAVAEPMLVSHFGEAIIEEVFSRYQQILADRMSKEKTKFTN  361



>ref|XP_006466836.1| PREDICTED: salicylate carboxymethyltransferase-like [Citrus sinensis]
Length=370

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 81/114 (71%), Gaps = 5/114 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT----GDEYDNMIGn  263
            G +EEEK+N FN P YTPS AE+KS V K+GSFTI+ LE  +++W     G +++  + +
Sbjct  249  GLIEEEKVNCFNIPQYTPSPAEIKSEVIKEGSFTIDHLEVSEVNWNAYQNGFKFNEAV-D  307

Query  264  nnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              N+  Y VA  +RAV EP+LVS FGE II+E+F RY +I+AD MS+EKT++ N
Sbjct  308  AFNDGGYNVANCMRAVAEPLLVSQFGESIIDELFKRYREIVADRMSKEKTKFIN  361



>ref|XP_010278141.1| PREDICTED: salicylate carboxymethyltransferase-like [Nelumbo 
nucifera]
Length=366

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 82/116 (71%), Gaps = 12/116 (10%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT------GDEYDNMI  257
            G +EEEK+++FN PLYTPS +E+K+++ ++GSF I+ LETF++HW        +E D + 
Sbjct  248  GLIEEEKVDTFNLPLYTPSPSEIKTVIGREGSFNIDRLETFEVHWNPEDKPGNNEVDKLR  307

Query  258  GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            G N       VAR +RA  EP+LV HFGE ++E+VF R  +I+A+ MS+E+T++TN
Sbjct  308  GANI------VARYMRAAAEPLLVDHFGEALMEQVFWRIREILANRMSKEETKHTN  357



>gb|KHN22764.1| Salicylate O-methyltransferase [Glycine soja]
Length=363

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-DEYDNMIGnnnn  272
            G ++EE+L++FN P YTPS +EVK  V K+GSF I CLE   +HW+  DE+   + +  +
Sbjct  246  GIIKEEQLDTFNIPFYTPSPSEVKLEVLKEGSFAINCLEVSVVHWSAWDEWS--VLDFES  303

Query  273  naaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             + Y + + +RAV E +LVSHFGE II+E+F RY +I+AD MS+EKT++ N
Sbjct  304  ESGYNLTQSMRAVAESMLVSHFGEAIIDELFSRYQEILADRMSKEKTKFIN  354



>gb|ACP20216.1| salicylic acid carboxyl methyltransferase [Mikania micrantha]
Length=362

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEKL+SFN P YTPS  EV+  VEK+GSF+I C+E  +++W     D       ++
Sbjct  250  GLVEEEKLDSFNIPQYTPSPKEVRKEVEKEGSFSINCVEVTEVNWDACTSDG------DD  303

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y + + +RAV EP+L+SHFGE IIEEVF RYT  I  SM++EKT+  N
Sbjct  304  QGYNMGKCMRAVAEPLLLSHFGELIIEEVFERYTNHIKISMAKEKTKLVN  353



>ref|XP_003548875.1| PREDICTED: salicylate carboxymethyltransferase-like [Glycine 
max]
Length=396

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-DEYDNMIGnnnn  272
            G ++EE+L++FN P YTPS +EVK  V K+GSF I CLE   +HW+  DE+   + +  +
Sbjct  279  GIIKEEQLDTFNIPFYTPSPSEVKLEVLKEGSFAINCLEVSVVHWSAWDEWS--VLDFES  336

Query  273  naaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             + Y + + +RAV E +LVSHFGE II+E+F RY +I+AD MS+EKT++ N
Sbjct  337  ESGYNLTQSMRAVAESMLVSHFGEAIIDELFSRYQEILADRMSKEKTKFIN  387



>emb|CAI05934.1| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
[Hoya carnosa]
Length=368

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 80/114 (70%), Gaps = 4/114 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGnnn  269
            G +E E+L+ FN P YTPS AEVK  VE++GSF+I  LE   IHWT    ++D++ G+++
Sbjct  246  GQIEGEQLDCFNIPQYTPSPAEVKYFVEEEGSFSITRLEATTIHWTAYDHDHDHVTGHHH  305

Query  270  nnaa--YKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                  Y V+  +RAV EP+LVSHFGE I++EVF +Y +I+ D M++EKTE+ N
Sbjct  306  AFKDGGYSVSNCMRAVAEPLLVSHFGEAIMDEVFRKYREILTDCMTKEKTEFIN  359



>ref|XP_007156070.1| hypothetical protein PHAVU_003G255800g [Phaseolus vulgaris]
 gb|ESW28064.1| hypothetical protein PHAVU_003G255800g [Phaseolus vulgaris]
Length=160

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 81/120 (68%), Gaps = 14/120 (12%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-DEYDNM------  254
            G ++EE+++SFN P YTPS +EVK  V K+GSF+I  LE   ++W   D+++ +      
Sbjct  36   GMIKEEQVDSFNIPQYTPSPSEVKLEVLKEGSFSINRLEVSAVNWNALDDWNALEFESER  95

Query  255  ---IGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +G+      Y VA+ +RAV EP+LVSHFGE IIEEVF RY +I+AD M++EKT++ N
Sbjct  96   FESVGDGG----YNVAQCMRAVAEPMLVSHFGEDIIEEVFSRYQQILADRMAKEKTKFFN  151



>gb|KHN36081.1| Salicylate O-methyltransferase [Glycine soja]
Length=373

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 6/116 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT----GDEYDNMIGn  263
            G ++EE++++FN P YTPS +EVK  V+K+GSF+I  LE   + W     G+ +D+  G 
Sbjct  249  GIIKEEQMDTFNIPQYTPSPSEVKFEVQKEGSFSITSLEVTVVPWNAYDNGNAFDSECGF  308

Query  264  nnnnaa--YKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            + + +   Y V + +RAV EP+LVSHFGE IIEEVF RY +I+ + MS+EKTE+ N
Sbjct  309  SKSLSNGGYNVTKCMRAVAEPLLVSHFGEAIIEEVFSRYQQILTERMSKEKTEFVN  364



>ref|XP_003604791.1| Jasmonate O-methyltransferase [Medicago truncatula]
 gb|AES86988.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
Length=359

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-DEYDNMIGnnnn  272
            G +++EKLNSFN P Y PS +EV+  V  +GSF+I  LE  +++W   D +D+       
Sbjct  246  GIIDQEKLNSFNIPNYYPSPSEVELEVLTEGSFSISRLEVSEVNWNALDNWDHF------  299

Query  273  naaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            N  Y VA+ +RAV EP+L SHFGEG+I+E+F+RY KI+ D MS+EKT++TN
Sbjct  300  NDGYNVAQCIRAVAEPLLASHFGEGVIKEIFNRYKKILGDRMSKEKTKFTN  350



>ref|XP_003547966.1| PREDICTED: salicylate carboxymethyltransferase-like [Glycine 
max]
Length=370

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 80/116 (69%), Gaps = 6/116 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG------DEYDNMI  257
            G ++EEKL++FN PLYTPS +EVK  V K+GSF I  LE  +++W         E+++  
Sbjct  246  GIIKEEKLDTFNIPLYTPSPSEVKLEVLKEGSFAINRLEVSEVNWNAFDDWNALEFESER  305

Query  258  GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             +  ++  Y VA+ +RAV EP+LVSHFGE IIEEVF RY +I+ D MS+E+T++ N
Sbjct  306  SDTLSDGGYNVAQCMRAVAEPMLVSHFGEAIIEEVFSRYQQILTDRMSKEQTKFIN  361



>gb|AAW66834.1| SAMT [Petunia nyctaginiflora]
Length=332

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 7/106 (7%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL++FN P YTPS  EVK +VEK+GSFTI  LET ++HW         G     
Sbjct  234  GLIEEEKLDAFNIPQYTPSPEEVKYVVEKEGSFTINRLETSRVHWNASNNVKNGG-----  288

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKT  413
              Y V+R +RAV EP+LVSHF + +++ VFH+Y +I++D MS+EKT
Sbjct  289  --YNVSRCMRAVAEPLLVSHFDKELMDLVFHKYEEIVSDCMSKEKT  332



>ref|XP_003612068.1| Jasmonate O-methyltransferase [Medicago truncatula]
 gb|ACJ84582.1| unknown [Medicago truncatula]
 gb|AES95026.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
 gb|AFK36396.1| unknown [Medicago truncatula]
Length=381

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 89/138 (64%), Gaps = 10/138 (7%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L     +A +  ++ G + EE++++FN P YTPS +EVK  V ++GSFTI+ L
Sbjct  239  CCYIWELL----AVALNDMVLEGIIMEEQMDTFNIPQYTPSPSEVKLEVLREGSFTIDRL  294

Query  210  ETFQIHWTG----DEYD--NMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHR  371
            E  ++HW      +E D  + +  +  + AY V + +RAV EP+LVSHFGE IIEEVF R
Sbjct  295  EVTEVHWNAYNDWNEVDFRSSLSKSLIDGAYNVTKCMRAVAEPLLVSHFGETIIEEVFGR  354

Query  372  YTKIIADSMSREKTEYTN  425
            Y +I+ D MS+E+TE+ N
Sbjct  355  YLEILVDRMSKERTEFIN  372



>gb|AAW66847.1| SAMT [Solandra maxima]
Length=333

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 6/106 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P YTPS AEVK +VEK+GSFTI  LE  ++HW     +   G     
Sbjct  234  GLIEEEKVDSFNIPQYTPSPAEVKYIVEKEGSFTINRLEATRVHWNNASNNENNG-----  288

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKT  413
             +Y V+R +RAV EP+LVS FG  +++ VF +Y +II+D MS+EKT
Sbjct  289  -SYNVSRCMRAVAEPLLVSQFGPKLMDLVFQKYEEIISDCMSKEKT  333



>gb|AAW66842.1| SAMT [Streptosolen jamesonii]
Length=331

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 83/137 (61%), Gaps = 8/137 (6%)
 Frame = +3

Query  3    FLETNCHDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEK  182
            FL     D C     ++  +  +A +  +    +EEEK++SFN P YTPS AEV+ +VEK
Sbjct  203  FLGRESEDPCSKECCYIWELLAMALNELVAERLIEEEKMDSFNIPQYTPSPAEVRCIVEK  262

Query  183  DGSFTIECLETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEV  362
            +GSFT+  LE+ ++HW  D  +N  G       Y V+R +RAV EP+LVSHFGE  ++ V
Sbjct  263  EGSFTVNRLESSRVHW--DVSNNSNG------GYNVSRCMRAVAEPLLVSHFGEKHMDLV  314

Query  363  FHRYTKIIADSMSREKT  413
            F +Y  II D MS EKT
Sbjct  315  FQKYQDIITDRMSNEKT  331



>ref|XP_004247832.1| PREDICTED: salicylate carboxymethyltransferase-like [Solanum 
lycopersicum]
Length=360

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EE+K++SF+ P YTPS  EVK +VEK+GSFTI  LET +++W    Y++  G     
Sbjct  247  GLIEEDKVDSFDVPNYTPSPREVKYIVEKEGSFTINRLETTRVNWNNSSYESNNG-----  301

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              YK+ R +RAV EP+L++ FG  +++ VF +Y KII+D M++EK E+ N
Sbjct  302  -GYKMTRCMRAVAEPLLINQFGPKLMDLVFQKYEKIISDCMAKEKAEFVN  350



>ref|XP_002265519.1| PREDICTED: salicylate carboxymethyltransferase [Vitis vinifera]
 emb|CAN64102.1| hypothetical protein VITISV_033032 [Vitis vinifera]
 emb|CBI17474.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 77/132 (58%), Gaps = 13/132 (10%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C YS+  L     +A    +  G +EEEKL+SFN P YTPS  E+K  +EKDGSF I+ L
Sbjct  228  CCYSWELL----ALALRDMVSEGLIEEEKLDSFNIPQYTPSPTEMKLEIEKDGSFVIDQL  283

Query  210  ETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIA  389
            E F++ W   E D              A+ +RAV E +  +HFG GIIEEVF R+ +I+ 
Sbjct  284  EVFEVDWDCYESDGPC---------NAAKCMRAVAESMFAAHFGSGIIEEVFRRHREIVV  334

Query  390  DSMSREKTEYTN  425
            D MS+EK +Y N
Sbjct  335  DRMSKEKPQYVN  346



>ref|NP_001289539.1| uncharacterized protein LOC104229603 [Nicotiana sylvestris]
 gb|ACZ55222.1| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
[Nicotiana sylvestris]
Length=358

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P YTPS  +VK  VEK+GSFTI  LE  ++ W     ++  G     
Sbjct  246  GLIEEEKVDSFNIPQYTPSPEDVKYAVEKEGSFTINQLEATRVQWNACNENHKNGG----  301

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y V+R +RAV EP+LVS FGE +++  FH+Y +II++ MS+E+TE+TN
Sbjct  302  --YSVSRCMRAVAEPLLVSQFGEELMDLAFHKYEEIISECMSKEQTEFTN  349



>gb|AGC11863.1| salicylic acid carboxyl methyltransferase [Camellia japonica]
Length=367

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 76/113 (67%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYD---NMIGnn  266
            G +EEEK++SFN P YTPS AEVKS V+K+GSF+I+ LE  ++ W   + +   +     
Sbjct  247  GLIEEEKMDSFNIPQYTPSPAEVKSEVQKEGSFSIDRLEVSRVDWNACKTELCPSSTDQE  306

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                 Y VA+ +RAV E +LVSHFG  II+EVF RY KI+ D M++E+TE+ N
Sbjct  307  FKEDGYDVAKCMRAVAESLLVSHFGVEIIDEVFERYKKIVTDRMAKERTEFFN  359



>ref|XP_004509302.1| PREDICTED: salicylate O-methyltransferase-like [Cicer arietinum]
Length=367

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNM---IGnn  266
            G + E++LN+FN P YTPS +EVKS V  +GSF+I+ LE F+++W G   + +   +  +
Sbjct  246  GIINEDQLNTFNVPWYTPSPSEVKSQVLHEGSFSIDRLEVFEVYWNGFNLNAIEFEMCKS  305

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEY  419
              +  Y VA+ +RA++EP+LVSHFGE IIEEVF+RY +I+ D MS++ +++
Sbjct  306  VKDDGYIVAQSMRALLEPLLVSHFGEAIIEEVFNRYQEILIDRMSKDISKF  356



>ref|XP_010026916.1| PREDICTED: salicylate carboxymethyltransferase-like [Eucalyptus 
grandis]
 gb|KCW60609.1| hypothetical protein EUGRSUZ_H03338 [Eucalyptus grandis]
Length=373

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 73/110 (66%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL+SFN P YTPS  EV+  V+K GSF+I+CLE  +++W   + D      + +
Sbjct  255  GLIEEEKLDSFNIPQYTPSPKEVRLEVQKQGSFSIDCLEVSEVNWNVFDTDFDPNVVSKD  314

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y +AR +RAV EP+L+ HFGE I++E+F RY   +A  MS+EK  + N
Sbjct  315  GEYNLARCMRAVAEPLLIDHFGEEIMDELFKRYKAQLAACMSKEKPAFVN  364



>gb|ABO71015.1| salicylic acid/benzoic acid carboxyl methyltransferase [Datura 
wrightii]
Length=361

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 77/112 (69%), Gaps = 7/112 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGnnn  269
            G +EEE+++SFN P YTPS AEVK +VEK+GSFTI  LET ++HW    + ++N I    
Sbjct  246  GLIEEERVDSFNIPQYTPSPAEVKYIVEKEGSFTINQLETTRVHWNNASNYHENNIN---  302

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                Y V++ +RAV EP+LVS F    ++ VF +Y +II+D M++EKTE+ N
Sbjct  303  --GGYNVSKCMRAVAEPLLVSQFDPKFMDLVFQKYEEIISDCMAKEKTEFIN  352



>ref|XP_010024167.1| PREDICTED: salicylate carboxymethyltransferase-like [Eucalyptus 
grandis]
 gb|KCW60610.1| hypothetical protein EUGRSUZ_H03340 [Eucalyptus grandis]
Length=373

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 73/110 (66%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EE+KL+SFN P YTPS  EV+  V+K  SF+I+CLE  +++W+    +        +
Sbjct  255  GLIEEDKLDSFNIPQYTPSPKEVREEVQKQESFSIDCLEVSEVNWSVVNTNFDPNVVLED  314

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y +AR +RAV EP+LV HFGE II+EVF RY   +A+ MS+EKT + N
Sbjct  315  RGYDMARCMRAVAEPLLVDHFGEEIIDEVFKRYKAQLANGMSKEKTAFVN  364



>ref|NP_001237122.1| salicylic acid methyl transferase-like protein [Glycine max]
 gb|ACF33514.1| salicylic acid methyl transferase-like protein [Glycine max]
Length=370

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 84/124 (68%), Gaps = 6/124 (5%)
 Frame = +3

Query  72   AKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-DEYD  248
            A S  ++ G + EE+L++FN P YTPS +EVK  V K+GSF I  LE  +++W   DE++
Sbjct  238  ALSDMVLQGIIREEQLDTFNIPQYTPSPSEVKLEVLKEGSFAINRLEVSEVNWNALDEWN  297

Query  249  NM-----IGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKT  413
             +        + ++  Y VA+ +RAV EP+L+SHFGE IIEEVF RY +I+A+ MS+EKT
Sbjct  298  ALDFESERSESLSDGEYNVAQCMRAVAEPMLISHFGEAIIEEVFCRYQQILAERMSKEKT  357

Query  414  EYTN  425
            ++ N
Sbjct  358  KFIN  361



>gb|KCW60608.1| hypothetical protein EUGRSUZ_H03336 [Eucalyptus grandis]
Length=284

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL+SFN P YTPS  EV+  V+K GSF+I+CLE  +++W   + D      + +
Sbjct  166  GLIEEEKLDSFNIPQYTPSPKEVRLEVQKQGSFSIDCLEVSEVNWNVFDADFDRNVVSKD  225

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y +AR +RAV EP+L++H+GE +++EVF RY   +A  MS+EK  + N
Sbjct  226  GGYNLARCMRAVAEPLLINHYGEEMMDEVFKRYRAQLATCMSKEKPAFVN  275



>ref|XP_007156072.1| hypothetical protein PHAVU_003G256000g [Phaseolus vulgaris]
 gb|ESW28066.1| hypothetical protein PHAVU_003G256000g [Phaseolus vulgaris]
Length=363

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EE+L+SFN P YTPS +E+K  V K+GSF I+ LE F ++W   E    +  +   
Sbjct  249  GIIKEEELDSFNIPQYTPSPSELKLEVLKEGSFAIDRLEVFGVNWNPLERSESVSESG--  306

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y +A+ +R+V EP+LVSHFGE IIEEVF R+ KI+A  MS EKTE++N
Sbjct  307  --YNLAQCMRSVAEPMLVSHFGEDIIEEVFSRFHKILAHRMSEEKTEFSN  354



>gb|KHN00522.1| Salicylate O-methyltransferase [Glycine soja]
Length=370

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 84/124 (68%), Gaps = 6/124 (5%)
 Frame = +3

Query  72   AKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-DEYD  248
            A S  ++ G + EE+L++FN P YTPS +EVK  V K+GSF I  LE  +++W   DE++
Sbjct  238  ALSDMVLQGIIREEQLDTFNIPQYTPSPSEVKLEVLKEGSFAINRLEVSEVNWNALDEWN  297

Query  249  NM-----IGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKT  413
             +        + ++  Y VA+ +RAV EP+L+SHFGE IIEEVF RY +I+A+ MS+EKT
Sbjct  298  ALDFESERSESLSDGGYNVAQCMRAVAEPMLISHFGEAIIEEVFCRYQQILAERMSKEKT  357

Query  414  EYTN  425
            ++ N
Sbjct  358  KFIN  361



>ref|XP_010026915.1| PREDICTED: salicylate carboxymethyltransferase-like [Eucalyptus 
grandis]
Length=373

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL+SFN P YTPS  EV+  V+K GSF+I+CLE  +++W   + D      + +
Sbjct  255  GLIEEEKLDSFNIPQYTPSPKEVRLEVQKQGSFSIDCLEVSEVNWNVFDADFDRNVVSKD  314

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y +AR +RAV EP+L++H+GE +++EVF RY   +A  MS+EK  + N
Sbjct  315  GGYNLARCMRAVAEPLLINHYGEEMMDEVFKRYRAQLATCMSKEKPAFVN  364



>ref|XP_010024169.1| PREDICTED: salicylate carboxymethyltransferase-like [Eucalyptus 
grandis]
Length=373

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L     IA +  +  G +EE+K++SFN P+YTPS  EV+  V+K GSF+I+ L
Sbjct  237  CCYVWELL----AIALNEMVSEGLIEEDKVDSFNVPMYTPSPKEVRGEVQKQGSFSIDWL  292

Query  210  ETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIA  389
            E  +++W+  E +      + +  Y +A+ +RA VEP+LV HFGE II+EVF RY   + 
Sbjct  293  EVAEVNWSVLETNFDPNVVSEDGGYNMAKCMRAAVEPLLVEHFGEEIIDEVFKRYRARLI  352

Query  390  DSMSREKTEYTN  425
            D MS+EKT   N
Sbjct  353  DVMSKEKTAIVN  364



>gb|AAW66837.1| SAMT [Brunfelsia americana]
Length=344

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 78/110 (71%), Gaps = 5/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EE K++SFN P YTPS AEVK  VEK+GSFTI  LE+ ++HW+  + +N +     N
Sbjct  234  GLIEEXKVDSFNIPQYTPSPAEVKYXVEKEGSFTINHLESSRVHWSACB-ENCVN----N  288

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VAR +RAV EP+LVS F + +++ VF +Y +II++ MS+EKTE+ N
Sbjct  289  GGYNVARCMRAVAEPLLVSQFDKKLMDLVFQKYEEIISNCMSKEKTEFIN  338



>gb|KCW60612.1| hypothetical protein EUGRSUZ_H03342 [Eucalyptus grandis]
Length=370

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L     IA +  +  G +EE+K++SFN P+YTPS  EV+  V+K GSF+I+ L
Sbjct  234  CCYVWELL----AIALNEMVSEGLIEEDKVDSFNVPMYTPSPKEVRGEVQKQGSFSIDWL  289

Query  210  ETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIA  389
            E  +++W+  E +      + +  Y +A+ +RA VEP+LV HFGE II+EVF RY   + 
Sbjct  290  EVAEVNWSVLETNFDPNVVSEDGGYNMAKCMRAAVEPLLVEHFGEEIIDEVFKRYRARLI  349

Query  390  DSMSREKTEYTN  425
            D MS+EKT   N
Sbjct  350  DVMSKEKTAIVN  361



>gb|KEH34490.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
Length=369

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 77/116 (66%), Gaps = 6/116 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDE------YDNMI  257
            G + EEK+N+FN P Y PS +EVK  V  +GSF I  LE  +++W   +      +++ +
Sbjct  245  GIINEEKINTFNIPNYYPSPSEVKLEVLNEGSFVINKLEVSEVNWNALDDCNAFDFESEM  304

Query  258  GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              +  +  Y +A+ +RAV EP+LVSHFGEG+I E+F RY KI+ D MS+EKT++TN
Sbjct  305  SESLRDDGYNMAQCIRAVAEPLLVSHFGEGVITEIFDRYRKILTDRMSKEKTKFTN  360



>ref|XP_007156071.1| hypothetical protein PHAVU_003G255900g [Phaseolus vulgaris]
 gb|ESW28065.1| hypothetical protein PHAVU_003G255900g [Phaseolus vulgaris]
Length=368

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 82/120 (68%), Gaps = 14/120 (12%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-DEYDNM------  254
            G ++EE+++SFN P YTPS +EVK  V K+GSF+I  LE  +++W   D+++ +      
Sbjct  244  GMIKEEQVDSFNIPQYTPSPSEVKLEVLKEGSFSINRLEVSEVNWNALDDWNALEFESER  303

Query  255  ---IGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +G+      Y VA+ +RAV EP+LVSHFGE IIEEVF RY +I+AD M++EKT++ N
Sbjct  304  FESVGDGG----YNVAQCMRAVAEPMLVSHFGEDIIEEVFTRYQQILADRMAKEKTKFFN  359



>ref|XP_002529231.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis]
 gb|EEF33144.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis]
Length=363

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +3

Query  69   IAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYD  248
            +A S  ++ G V++EKL+SFN P +TPS++EV S +EKDGSF I+ LE  + HW     +
Sbjct  234  MALSQLVLEGVVDKEKLDSFNVPFFTPSMSEVISEIEKDGSFLIDELEISEQHWNPYHGE  293

Query  249  NMIGnnnnnaaYKVARGLRAVVEPILVSHFG--EGIIEEVFHRYTKIIADSMSREKTEY  419
              I     +  Y VA+  RAV+EP+++SHFG  + I++EVF RY  I+ D M++EK EY
Sbjct  294  PNISEAFKDPGYNVAKYARAVIEPLIISHFGFDKAIMDEVFDRYKAILNDYMTKEKAEY  352



>gb|KCW60613.1| hypothetical protein EUGRSUZ_H03342 [Eucalyptus grandis]
Length=371

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EE+K++SFN P+YTPS  EV+  V+K GSF+I+ LE  +++W+  E +      + +
Sbjct  253  GLIEEDKVDSFNVPMYTPSPKEVRGEVQKQGSFSIDWLEVAEVNWSVLETNFDPNVVSED  312

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y +A+ +RA VEP+LV HFGE II+EVF RY   + D MS+EKT   N
Sbjct  313  GGYNMAKCMRAAVEPLLVEHFGEEIIDEVFKRYRARLIDVMSKEKTAIVN  362



>ref|XP_011071562.1| PREDICTED: salicylate carboxymethyltransferase-like [Sesamum 
indicum]
Length=375

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 74/118 (63%), Gaps = 12/118 (10%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--------DEYDN  251
            G +EEEKL SFN P YTPSL+EVK+ VEK+GSFTI  LE  +I W           EY  
Sbjct  253  GLIEEEKLGSFNIPQYTPSLSEVKTEVEKEGSFTINQLEVSEIEWAACGSSGFCSQEYSK  312

Query  252  MIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                N  +  Y VA+ +R+V EP+LV  FGE +I+++F  Y  I++D MSRE T++ N
Sbjct  313  ----NGIDDGYNVAKCMRSVAEPLLVEQFGELVIDQLFENYRNILSDRMSREDTKFIN  366



>gb|KHN22769.1| Salicylate O-methyltransferase [Glycine soja]
Length=370

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 79/116 (68%), Gaps = 6/116 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG------DEYDNMI  257
            G ++EE+L++FN P YTPS +EV+  V K+GSF I  LE  +++W         E+++  
Sbjct  246  GIIKEEQLDTFNIPQYTPSPSEVELEVLKEGSFAINRLEVSEVNWNAFDDWNALEFESER  305

Query  258  GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             +  ++  Y VA+ +RAV EP+LVSHFGE IIEEVF RY +I+ D MS+E+T++ N
Sbjct  306  SDTLSDGGYNVAQCMRAVAEPMLVSHFGEAIIEEVFSRYQQILTDRMSKEQTKFIN  361



>ref|XP_004149992.1| PREDICTED: salicylate O-methyltransferase-like [Cucumis sativus]
 ref|XP_004167925.1| PREDICTED: salicylate O-methyltransferase-like [Cucumis sativus]
 gb|KGN48856.1| hypothetical protein Csa_6G504380 [Cucumis sativus]
Length=364

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL SFN P Y PS  E++  +EK+GSF +  ++  ++ W     DN  GN ++N
Sbjct  248  GIIEEEKLESFNIPKYMPSPTEMRIEIEKEGSFVVNRIQVSKMDWNIVYKDN--GNKDDN  305

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EPIL+SHFGE II+E+F RY +II D M++EK E+ N
Sbjct  306  GGYNVAKYMRAVAEPILISHFGEAIIDELFIRYGQIIVDRMAKEKLEFVN  355



>gb|AAW66831.1| SAMT [Brugmansia sp. Robadey 027]
Length=335

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 72/108 (67%), Gaps = 8/108 (7%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGnnn  269
            G +EEEK+NSFN P YTPS  EVK +VEK+GSF I  LET ++HW    ++++N+ G   
Sbjct  234  GLIEEEKVNSFNIPQYTPSPGEVKYIVEKEGSFIINQLETTRVHWNNASNDHENING---  290

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKT  413
                Y V++ +RAV EP+LVS FG   ++ VF +Y   I+D M +EKT
Sbjct  291  ---GYNVSKCMRAVAEPLLVSQFGPKFMDLVFQKYEDNISDCMGKEKT  335



>gb|KHN22768.1| Salicylate O-methyltransferase [Glycine soja]
Length=370

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG------DEYDNMI  257
            G ++EE+L++FN PLYTPS +EVK  V K+GSF    LE  +++W         E+++  
Sbjct  246  GIIKEEQLDTFNIPLYTPSPSEVKLEVLKEGSFASNRLEVSEVNWNAFDDWNALEFESER  305

Query  258  GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             +  ++  Y VA+ +RAV EP+LVSHFGE IIEEVF RY +I+ D MS+E+T+  N
Sbjct  306  SDTLSDGGYNVAQCMRAVAEPMLVSHFGEAIIEEVFSRYQQILTDRMSKEQTKCIN  361



>ref|XP_002529243.1| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase, 
putative [Ricinus communis]
 gb|EEF33156.1| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase, 
putative [Ricinus communis]
Length=263

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 75/111 (68%), Gaps = 2/111 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G V++EKL+SFN P +TPS++EV S +EKDGSF I+ LE  + HW     +  I     +
Sbjct  143  GVVDKEKLDSFNVPFFTPSMSEVISEIEKDGSFLIDELEISEQHWNPYHDEPNISEAFKD  202

Query  276  aaYKVARGLRAVVEPILVSHFG--EGIIEEVFHRYTKIIADSMSREKTEYT  422
              Y VA+ +R+V+EP+ +SHFG  + I++EVF RY  I+ D M++EKTE+ 
Sbjct  203  PGYNVAKYVRSVIEPLFISHFGFDKAIMDEVFDRYKAILNDYMTKEKTEFV  253



>gb|AAW66832.1| SAMT [Hyoscyamus albus]
Length=332

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 80/135 (59%), Gaps = 11/135 (8%)
 Frame = +3

Query  9    ETNCHDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDG  188
            E  C   C Y +  L     +A +  +  G +EEEK++SFN P YTPS AEVK++VEK+G
Sbjct  209  EDPCSKECCYIWELL----SMALNELVFEGLIEEEKVDSFNIPQYTPSPAEVKNIVEKEG  264

Query  189  SFTIECLETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFH  368
            SFTI  LE  ++HW         G       Y V+R +RAV EP+L++ F   +++ VF 
Sbjct  265  SFTINRLEATRVHWNASNEGINGG-------YDVSRCMRAVAEPLLLTQFDHKLMDLVFQ  317

Query  369  RYTKIIADSMSREKT  413
            +Y  II+D MS+EKT
Sbjct  318  KYQHIISDCMSKEKT  332



>dbj|BAB39396.1| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
[Atropa belladonna]
Length=357

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 73/110 (66%), Gaps = 7/110 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P YTPS  EVK +VEK+GSF I  LE  ++HW        + N   N
Sbjct  246  GLIEEEKVDSFNIPQYTPSPEEVKYIVEKEGSFIINRLEATRVHWN-------VSNEGIN  298

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EP+LVS F + ++  VF +Y +II+D +S+EKTE+ N
Sbjct  299  GGYNVAKCMRAVAEPLLVSQFDQKLMNLVFQKYEEIISDCISKEKTEFIN  348



>gb|AIN76709.1| salicylic acid carboxy methyl transferase [Artemisia annua]
Length=370

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 70/110 (64%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EE K++SFN P YTP   EV + VEK+GSF I+ LE  ++ W      N+    ++ 
Sbjct  252  GLIEEAKMDSFNIPQYTPCAKEVSNEVEKEGSFEIDYLEVSEVDWDACTNHNLNFTKDDA  311

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y + + +RAV EP+++SHFGE I+EEVF RYT II + MS EK +  N
Sbjct  312  KGYNMGKCMRAVAEPLILSHFGESIVEEVFMRYTNIIKNRMSIEKAKLVN  361



>ref|XP_002521542.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis]
 gb|EEF40813.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis]
Length=366

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +++EK +SFN P YTPS  EVKS +E +GSF I+CLE  ++ W   E +  I +   +
Sbjct  246  GLIDKEKFDSFNIPKYTPSPFEVKSQIEAEGSFAIDCLEVSEVSWNAYENEVNIPDACKD  305

Query  276  aaYKVARGLRAVVEPILVSHFG--EGIIEEVFHRYTKIIADSMSREKTEYTN  425
              + VA+ +RAV EP+L+ HFG    I ++VF+RY  II D M++EKT + N
Sbjct  306  GGHNVAKCIRAVAEPLLIGHFGFDRVITDQVFNRYRLIITDRMAKEKTNFVN  357



>ref|XP_011100960.1| PREDICTED: salicylate carboxymethyltransferase-like [Sesamum 
indicum]
Length=376

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIG---nn  266
            G +EEEKL+SFN P YTPSL+EVK+ VEK+GSF+I  LE  +I W             + 
Sbjct  255  GLIEEEKLSSFNIPQYTPSLSEVKTEVEKEGSFSINSLEASEIRWAACGTSGFYAPEYSK  314

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              +  Y VA+ +R+V EP+LV  FGE +I+++F  Y  I++D MS+E T++ N
Sbjct  315  KGDDGYNVAKCMRSVAEPLLVEQFGELVIDKLFENYRNILSDRMSKEDTKFIN  367



>gb|AAW66843.1| SAMT [Juanulloa mexicana]
Length=334

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 68/106 (64%), Gaps = 5/106 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EE K+++FN P YTPS  EVK +VEK+GSFTI  LE  ++HW     D  I      
Sbjct  234  GLIEEGKVDAFNIPQYTPSPTEVKYVVEKEGSFTINRLEATRVHWNNASNDENIN-----  288

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKT  413
              Y V+R +RAV EP+L S FG  +++ VF +Y +II D MS+EKT
Sbjct  289  GGYNVSRCMRAVAEPLLASQFGPKLMDLVFQKYKEIIFDCMSKEKT  334



>gb|AAN40745.1| S-adenosyl-L-methionine:salicylic acid methyltransferase [Antirrhinum 
majus]
Length=383

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT--GDEYDNMIGnnn  269
            G +E+EKL+SF+ P YTPS  EVK+ VEK+GSFT+  LE  +I W   G+++ ++     
Sbjct  264  GVIEKEKLHSFHIPQYTPSPTEVKAEVEKEGSFTVNRLEVSEITWASCGNDF-HLPELVA  322

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            +   Y VA+ +R+V EP+L+ HFGE +I+ +F +Y +II D MSRE+T++ N
Sbjct  323  SGNEYNVAKCMRSVAEPLLIEHFGESVIDRLFEKYREIIFDRMSREETKFFN  374



>gb|AAW66827.1| SAMT [Datura stramonium]
Length=336

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 74/108 (69%), Gaps = 7/108 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGnnn  269
            G +EEE+++SFN P YTPS AEVK +VEK+GSFTI  LET ++HW    + ++N I    
Sbjct  234  GLIEEERVDSFNIPQYTPSPAEVKYIVEKEGSFTINQLETTRVHWNNASNYHENNIN---  290

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKT  413
                Y V++ +RAV EP+L+S F    ++ VF +Y +II+D M++EKT
Sbjct  291  --GGYNVSKCMRAVAEPLLLSQFDPKFMDLVFQKYEEIISDCMAKEKT  336



>ref|XP_003629413.1| Jasmonate O-methyltransferase [Medicago truncatula]
 gb|AET03889.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
Length=370

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 86/128 (67%), Gaps = 6/128 (5%)
 Frame = +3

Query  60   VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-  236
            +  IA +  ++ G ++EE+L++FN P YTPS +EVK  V K+GSFTI+ L   +++W   
Sbjct  234  LMAIALNDMVLQGTIKEEELDTFNIPQYTPSPSEVKLEVLKEGSFTIDRLGVSEVNWNAL  293

Query  237  DEYDNM-----IGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMS  401
            D+++ +     +  +  + AY V + +RAV EP+LV HFGE II+E+F RY +I+ D MS
Sbjct  294  DQWNALACESQMSESLGDGAYNVMQCMRAVSEPLLVRHFGESIIDELFDRYQEILVDRMS  353

Query  402  REKTEYTN  425
            +EKT++ N
Sbjct  354  KEKTKFVN  361



>ref|XP_010263596.1| PREDICTED: jasmonate O-methyltransferase [Nelumbo nucifera]
Length=378

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 77/113 (68%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnn-  272
            G VEEEKL+ FN P Y+PS  EVKS V+++GSF I+ +E  ++ W G   ++++ N  + 
Sbjct  256  GHVEEEKLDRFNAPYYSPSPEEVKSAVQREGSFMIDRIEILEVEWDGGSNNHVVSNGTSD  315

Query  273  --naaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                A +V + +RAVVE +L SHFGE I++E+F RY  I++D MSR++ +Y N
Sbjct  316  NLTGAQRVVKTVRAVVESMLASHFGEEIMDELFSRYGNIVSDYMSRKRAKYDN  368



>gb|AAW66846.1| SAMT [Physalis virginiana]
Length=333

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 71/106 (67%), Gaps = 6/106 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +E+EKL+SFN P YTPS AEV  +VEK  SFTI  LET ++HW     ++  G     
Sbjct  234  GLIEKEKLDSFNIPQYTPSPAEVXYIVEKQDSFTINXLETTRVHWNNASNNDNNG-----  288

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKT  413
              Y V++ +RAV EP+LVS FG  +++ VF +Y +I++D M++EKT
Sbjct  289  -GYNVSKCMRAVAEPLLVSQFGPKLMDLVFQKYEEIVSDCMAKEKT  333



>ref|XP_002529233.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF33146.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=337

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 84/128 (66%), Gaps = 2/128 (2%)
 Frame = +3

Query  48   FLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIH  227
            +L  +  IA +  ++ G + +EKL+SFN P +TPS++EV S +EKDGSF I+ +E  + H
Sbjct  201  YLWELLAIALTRLVLEGVINKEKLDSFNVPYFTPSMSEVISEIEKDGSFLIDQIELSEQH  260

Query  228  WTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFG--EGIIEEVFHRYTKIIADSMS  401
            W     +  I     N  Y VA+ +RA +EP+++SHFG  + I++EVF RY +I+ + M+
Sbjct  261  WNPYHDEPNISEAFKNPGYNVAKYVRAGIEPLIISHFGFDKAIMDEVFDRYKEILNEYMA  320

Query  402  REKTEYTN  425
            +EK+E+ N
Sbjct  321  KEKSEFVN  328



>gb|ABO71017.1| salicylic acid/benzoic acid carboxyl methyltransferase [Protoschwenkia 
mandonii]
Length=319

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 72/122 (59%), Gaps = 11/122 (9%)
 Frame = +3

Query  9    ETNCHDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDG  188
            E  C   C Y +  L     +A +  +  G +EEEKL++FN P YTPS  EVK +VEK+G
Sbjct  209  EDPCSKECCYIWELL----SMALNELVAEGLIEEEKLDTFNIPQYTPSPGEVKYIVEKEG  264

Query  189  SFTIECLETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFH  368
            SFTI  LET ++HW      N  G       Y V+R +RAV EP+LVSHFGE  ++ VF 
Sbjct  265  SFTINQLETSRVHWNASNNINNGG-------YNVSRCMRAVAEPLLVSHFGENFMDLVFQ  317

Query  369  RY  374
            +Y
Sbjct  318  KY  319



>ref|XP_008440755.1| PREDICTED: salicylate carboxymethyltransferase-like [Cucumis 
melo]
Length=363

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 74/110 (67%), Gaps = 2/110 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL SFN P Y PS  E++  +EK+GSF +  ++  ++ W     DN   N ++N
Sbjct  247  GIIEEEKLESFNIPKYMPSPTEMRIEIEKEGSFVVNRIQVSKVDWNIVYNDNT--NKDDN  304

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +RAV EPIL+SHFGE II+E+F RY +II D M++EK ++ N
Sbjct  305  GGYYVAKYMRAVAEPILISHFGEAIIDELFFRYGQIIVDRMAKEKPQFVN  354



>ref|XP_006360373.1| PREDICTED: salicylate carboxymethyltransferase-like [Solanum 
tuberosum]
Length=363

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P YT S +EVK LV+K+GSFTI  LET ++HW      N   N  NN
Sbjct  246  GLIEEEKVDSFNIPNYTASPSEVKYLVDKEGSFTINKLETTRVHWNYASNTNNE-NIYNN  304

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y ++R +RAV EP+LVS F   +++ +F +Y +I++D MS+EKTE+ N
Sbjct  305  GGYNLSRAIRAVAEPLLVSQFDPKLMDLIFQKYEEIVSDCMSKEKTEFIN  354



>ref|XP_010278173.1| PREDICTED: salicylate carboxymethyltransferase-like [Nelumbo 
nucifera]
Length=367

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 10/112 (9%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT-----GDEYDNMIG  260
            G +EEEK+N+FN P+Y PS  E+KS++E++GSF I+ LE F+I+W      GD   N + 
Sbjct  248  GLIEEEKVNTFNMPIYAPSPREMKSVIEREGSFDIDRLEAFEINWKQEDNLGDNETNKL-  306

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTE  416
                  A  +AR LRAVVEP+L +HFGE +++++F R  +I+AD M +E  +
Sbjct  307  ----RDAQNIARYLRAVVEPLLANHFGEALMDKLFCRLREILADRMLKEDAK  354



>ref|NP_001234809.1| S-adenosyl-L-methionine: salicylic acid carboxyl methyltransferase 
[Solanum lycopersicum]
 gb|ADB54832.1| S-adenosyl-L-methionine: salicylic acid carboxyl methyltransferase 
[Solanum lycopersicum]
Length=361

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 76/112 (68%), Gaps = 7/112 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGnnn  269
            G +EEEK++SFN P YTPS  EVK +V+K+GSFTI  LET ++HW    +  +N+     
Sbjct  246  GLIEEEKVDSFNIPQYTPSQGEVKYVVDKEGSFTINKLETTRVHWNNASNNIENI-----  300

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            NN  Y V++ +RAV EP+L+S F   +I+ VF +Y +I++  M++E TE+ N
Sbjct  301  NNDGYNVSKCMRAVAEPLLLSQFDPKLIDLVFQKYEEIVSKCMAKEDTEFIN  352



>ref|XP_003520296.1| PREDICTED: salicylate carboxymethyltransferase-like [Glycine 
max]
 gb|KHN00519.1| Salicylate O-methyltransferase [Glycine soja]
Length=373

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 80/119 (67%), Gaps = 6/119 (5%)
 Frame = +3

Query  87   LM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT------GDEYD  248
            +M G ++EE+L++FN P YTPS +EV+  V K+GSF I  LE  +++W         +++
Sbjct  246  VMQGIIKEEQLDTFNIPQYTPSPSEVELEVLKEGSFAINRLELAEVNWNPLDDLNALDFE  305

Query  249  NMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            +    +  +  Y +A+ +R+V EP+LV+ FGE IIEEVF RY K++AD MS+E+T++ N
Sbjct  306  SERSESLRDNGYSLAQCMRSVAEPMLVNQFGEDIIEEVFSRYQKLLADRMSKEQTKFNN  364



>gb|KCW60599.1| hypothetical protein EUGRSUZ_H033241, partial [Eucalyptus grandis]
Length=157

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL+SFN P YTPS  EV+  VEK GSF+I+CLE F+++    E D         
Sbjct  39   GLIEEEKLHSFNVPYYTPSPKEVRQEVEKQGSFSIDCLEMFEVNHDVIETDFDPNVVLEE  98

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREK  410
            A  K+   LRA+ EP+L+ HFGE II EVF R+   + +  S+EK
Sbjct  99   AVDKIVGCLRAIAEPLLIHHFGEEIINEVFKRFRAKLGNRFSKEK  143



>ref|XP_003629397.1| Jasmonate O-methyltransferase [Medicago truncatula]
 gb|AET03873.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
Length=362

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 84/132 (64%), Gaps = 6/132 (5%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L     +A +  ++ G ++EEKLN+FN P+Y PS +EVK  V  +GSF +  L
Sbjct  228  CCYIWELL----AMALNDMVLEGIIKEEKLNTFNIPIYYPSPSEVKLEVITEGSFVMNQL  283

Query  210  ETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIA  389
            E  +++W  +  D+    +  +  Y VA+ +RA+ EP+LVSHFGEG+++E+F+RY K + 
Sbjct  284  EISEVNW--NARDDFESESFGDDGYNVAQCMRALAEPLLVSHFGEGVVKEIFNRYKKYLT  341

Query  390  DSMSREKTEYTN  425
            D  S+ +T++ N
Sbjct  342  DRNSKGRTKFIN  353



>ref|XP_010670972.1| PREDICTED: salicylate carboxymethyltransferase-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=368

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 73/110 (66%), Gaps = 4/110 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G++EEEKLN+FN P+YTPS +E++ LV  +GSF +  +  F+I W  +++ N     N+ 
Sbjct  252  GYIEEEKLNTFNLPIYTPSPSELEFLVHSEGSFALNQVHAFEISWDVNDHKN----GNSC  307

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y     LRAVVEP+++SHFGE II+E+F R+ +I+  SM+ EK    N
Sbjct  308  DQYDFVTCLRAVVEPLIISHFGEVIIDEIFKRFREIVYVSMANEKNMIAN  357



>ref|XP_010670971.1| PREDICTED: salicylate carboxymethyltransferase-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=369

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 73/110 (66%), Gaps = 4/110 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G++EEEKLN+FN P+YTPS +E++ LV  +GSF +  +  F+I W  +++ N     N+ 
Sbjct  253  GYIEEEKLNTFNLPIYTPSPSELEFLVHSEGSFALNQVHAFEISWDVNDHKN----GNSC  308

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y     LRAVVEP+++SHFGE II+E+F R+ +I+  SM+ EK    N
Sbjct  309  DQYDFVTCLRAVVEPLIISHFGEVIIDEIFKRFREIVYVSMANEKNMIAN  358



>gb|KGN48858.1| hypothetical protein Csa_6G504400 [Cucumis sativus]
Length=303

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 74/115 (64%), Gaps = 5/115 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNM-----IG  260
            G +EEEKL SF+ P Y PS  E++  V K+ SF I+ ++  Q+ W   + + M     + 
Sbjct  180  GIIEEEKLESFHIPKYMPSPIEIRIEVAKEASFVIDSIKVSQVDWNVSDNNEMNKAKSVD  239

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             +   + Y VA+ +RAV EPIL+SHFGE +++E+F RY +IIAD M++E T++ N
Sbjct  240  VSLKGSGYNVAKYMRAVAEPILISHFGEEVMDELFIRYREIIADRMAKETTQFFN  294



>ref|XP_004149993.1| PREDICTED: salicylate O-methyltransferase-like, partial [Cucumis 
sativus]
Length=347

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 74/115 (64%), Gaps = 5/115 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNM-----IG  260
            G +EEEKL SF+ P Y PS  E++  V K+ SF I+ ++  Q+ W   + + M     + 
Sbjct  224  GIIEEEKLESFHIPKYMPSPIEIRIEVAKEASFVIDSIKVSQVDWNVSDNNEMNKAKSVD  283

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             +   + Y VA+ +RAV EPIL+SHFGE +++E+F RY +IIAD M++E T++ N
Sbjct  284  VSLKGSGYNVAKYMRAVAEPILISHFGEEVMDELFIRYREIIADRMAKETTQFFN  338



>ref|XP_008388031.1| PREDICTED: jasmonate O-methyltransferase-like isoform X3 [Malus 
domestica]
Length=367

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 76/110 (69%), Gaps = 5/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P Y PS  ++K  +E +GSFT++ LE F+I W G    +++      
Sbjct  254  GLIEEEKVDSFNAPYYAPSEEQLKLELENEGSFTVDRLEAFEIDWDGGAEISVV-----T  308

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            +  +VA+ +RAVVE ++ SHFG+ I++++F RY +++AD +S+ +T+Y N
Sbjct  309  SGQRVAKTIRAVVESMIESHFGKDIMDDLFRRYAELVADHLSKSRTKYIN  358



>ref|XP_004167926.1| PREDICTED: salicylate O-methyltransferase-like [Cucumis sativus]
Length=355

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 74/115 (64%), Gaps = 5/115 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNM-----IG  260
            G +EEEKL SF+ P Y PS  E++  V K+ SF I+ ++  Q+ W   + + M     + 
Sbjct  232  GIIEEEKLESFHIPKYMPSPIEIRIEVAKEASFVIDSIKVSQVDWNVSDNNEMNKAKSVD  291

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             +   + Y VA+ +RAV EPIL+SHFGE +++E+F RY +IIAD M++E T++ N
Sbjct  292  VSLKGSGYNVAKYMRAVAEPILISHFGEEVMDELFIRYREIIADRMAKETTQFFN  346



>ref|XP_008388030.1| PREDICTED: jasmonate O-methyltransferase-like isoform X2 [Malus 
domestica]
Length=367

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 76/110 (69%), Gaps = 5/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P Y PS  ++K  +E +GSFT++ LE F+I W G    +++      
Sbjct  254  GLIEEEKVDSFNAPYYAPSEEQLKLELENEGSFTVDRLEAFEIDWDGGAEISVV-----T  308

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            +  +VA+ +RAVVE ++ SHFG+ I++++F RY +++AD +S+ +T+Y N
Sbjct  309  SGQRVAKTIRAVVESMIESHFGKDIMDDLFRRYAELVADHLSKSRTKYIN  358



>ref|XP_004247831.1| PREDICTED: salicylate carboxymethyltransferase-like [Solanum 
lycopersicum]
Length=365

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 74/111 (67%), Gaps = 1/111 (1%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++ FN P YT S AEVK LV+K+GSF I  LET ++HW     +N   NN   
Sbjct  246  GLIEEEKVDLFNIPNYTASPAEVKYLVDKEGSFIINKLETTRVHWNYASNNNNNENNIIY  305

Query  276  a-aYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               Y ++R +RAV EP+LVS F   +++ VF +Y +II+D MS+EKTE+ N
Sbjct  306  NGGYNLSRAIRAVAEPLLVSQFDPKLMDLVFQKYEEIISDWMSKEKTEFIN  356



>ref|XP_008377209.1| PREDICTED: jasmonate O-methyltransferase-like [Malus domestica]
Length=367

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 76/110 (69%), Gaps = 5/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEK++SFN P Y PS  E+K  + K+GSFTI+ LE F+I W G    + + +    
Sbjct  254  GLVEEEKVDSFNAPYYAPSEEELKFELGKEGSFTIDRLEAFEIDWDGGAEISAVASGQ--  311

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +VA+ +RAVVE ++ SHFG+ I++++F RY++++AD +S+ +T++ N
Sbjct  312  ---RVAKTVRAVVESMIESHFGKDIMDDLFRRYSELVADHLSKSRTKHIN  358



>ref|XP_010254766.1| PREDICTED: jasmonate O-methyltransferase-like [Nelumbo nucifera]
Length=376

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 76/115 (66%), Gaps = 5/115 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDN-----MIG  260
            G VEEEKL+ FN P Y PS  E+K+ +E++GSF ++ L+  ++ W G   +N     M+ 
Sbjct  252  GIVEEEKLDRFNAPYYAPSGEEIKAAIEREGSFMVDRLDILEVEWDGGSCNNQARNGMLI  311

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            ++N N A++V + +RAVVE +L +HFG  I++E+F RY+ I+ D MS  +T Y N
Sbjct  312  DHNLNGAHRVVKTIRAVVESMLANHFGREIMDELFRRYSHIVTDYMSTNRTTYDN  366



>gb|AAO27257.1| putative S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
[Pisum sativum]
Length=360

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 73/107 (68%), Gaps = 6/107 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EE+K+N+FN P Y PS +EVKS + ++GSF I  +E  ++        N  G + ++
Sbjct  247  GLIEEDKVNTFNIPNYYPSRSEVKSSILEEGSFAINHVEFSEVDL------NNSGESLHD  300

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTE  416
            + Y VA+ +RAV EP++VSHFGE II++VF RY +I+ D MSREK +
Sbjct  301  SGYNVAQTIRAVFEPLMVSHFGEAIIDDVFQRYHEIVVDQMSREKMQ  347



>ref|XP_008440753.1| PREDICTED: salicylate carboxymethyltransferase-like [Cucumis 
melo]
Length=369

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 85/134 (63%), Gaps = 6/134 (4%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y++ FL     +A    +  G VE+EK++SFN P+Y PSL+EV+  V ++GSF IE L
Sbjct  231  CCYAWLFL----NLALHDLVAQGMVEKEKIDSFNIPIYMPSLSEVEDEVLREGSFIIEHL  286

Query  210  ETFQIHW--TGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKI  383
            +  +I W  +    +N+   +  N+ Y  A+ +R+V EP+LV HFG+ II+++F++Y +I
Sbjct  287  QISRIDWNLSNTNLNNIPSKDILNSGYNFAKCIRSVAEPLLVRHFGQHIIDKLFNKYAEI  346

Query  384  IADSMSREKTEYTN  425
            + D MS+ K E  N
Sbjct  347  VVDHMSKYKIENIN  360



>ref|XP_009383765.1| PREDICTED: jasmonate O-methyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=387

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 71/115 (62%), Gaps = 5/115 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P ++PSL EVK  +E++GSF+I  L+ F+  W               
Sbjct  253  GIIEEEKVDSFNAPYFSPSLEEVKQEIEREGSFSIRTLDLFEASWDAAHGSRQTKQEAAA  312

Query  276  a-----aYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                  A ++A+G+RAV+E +L SHFGEGI+EE+F RYT ++    SR K + TN
Sbjct  313  LGEITHAKRMAKGVRAVLESMLESHFGEGIMEELFSRYTSLLEGYYSRNKPQVTN  367



>ref|XP_002438141.1| hypothetical protein SORBIDRAFT_10g008710 [Sorghum bicolor]
 gb|EER89508.1| hypothetical protein SORBIDRAFT_10g008710 [Sorghum bicolor]
Length=181

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 73/112 (65%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIG---nn  266
            G V++EKL SFN P+Y PS+ EV ++V + G F I  ++ F+ +W  D YD+  G    +
Sbjct  62   GIVDKEKLYSFNLPIYGPSIDEVATIVRQSGLFNIGHIQLFESNW--DPYDDSEGDHVVD  119

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            +  +   VAR LRAV+EP+  SHFGE I++E+F RY   +A  + +EKT+Y+
Sbjct  120  SIQSGVNVARSLRAVMEPLFASHFGEQILDELFKRYACNVAKHLEKEKTKYS  171



>ref|XP_004499184.1| PREDICTED: jasmonate O-methyltransferase-like isoform X2 [Cicer 
arietinum]
Length=231

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 82/135 (61%), Gaps = 9/135 (7%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*--GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIE  203
            C Y +  L      A+++  M   G VEEEK++SFN P Y P + E+K ++EK+GSF ++
Sbjct  94   CCYQWELL------AQALMTMVSEGLVEEEKVDSFNAPYYAPCVEELKIVIEKEGSFMVD  147

Query  204  CLETFQIHW-TGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTK  380
              E ++I W  G E  +       ++  +VA+ +RAVVE +L  HFG  II+E+F RY K
Sbjct  148  SHEAYEIDWDDGTELLSENVLETVSSGERVAKTVRAVVESMLKYHFGSHIIDELFQRYAK  207

Query  381  IIADSMSREKTEYTN  425
            ++ D +S+ +T+Y N
Sbjct  208  LVEDYLSKTRTKYIN  222



>ref|XP_008440748.1| PREDICTED: salicylate carboxymethyltransferase-like [Cucumis 
melo]
Length=365

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 86/142 (61%), Gaps = 16/142 (11%)
 Frame = +3

Query  21   HDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTI  200
             D C Y+F+ L     +A +  +  G VEEEK++ FN P + PS  E+K  V K+GSF I
Sbjct  225  QDYC-YAFTLL----NLALNGMVAEGIVEEEKVDRFNIPNFMPSPKEIKDEVLKEGSFII  279

Query  201  ECLETFQIHWT-------GDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEE  359
              L+   I W        G ++ + +GN+ N     +A+ +R+V EP+++ HFGE I+EE
Sbjct  280  NELKVSSIDWNFYNTELEGTKHTSFVGNSYN----NIAKCIRSVTEPLMIPHFGEAIVEE  335

Query  360  VFHRYTKIIADSMSREKTEYTN  425
            +F+RY KI+ D MS+++ E+TN
Sbjct  336  LFYRYNKIVKDEMSKKRIEFTN  357



>gb|AAW66840.1| SAMT [Capsicum annuum]
Length=323

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 7/97 (7%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL++FN P YTPS AEVK +VEK+ SFTI  LE  +IHW     D++ G     
Sbjct  234  GLIEEEKLDAFNIPQYTPSPAEVKYIVEKENSFTINRLEATRIHWNASN-DHING-----  287

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKII  386
              Y V+R +RAV EP+LVS FG  +++ VF +Y KI+
Sbjct  288  -GYNVSRCMRAVAEPLLVSQFGPKLMDLVFQKYEKIV  323



>gb|KCW60597.1| hypothetical protein EUGRSUZ_H03323, partial [Eucalyptus grandis]
Length=354

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL+SFN P YTPS  EV+  VEK GSF+I+C E F+++    E D      +  
Sbjct  236  GIIEEEKLDSFNVPYYTPSPKEVRREVEKQGSFSIDCFEVFEVNRDVFETDFDPNVVSKE  295

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREK  410
            AA K+   LRA+ EP+LV HFGE II EVF R+   + +  S+EK
Sbjct  296  AADKIVGSLRAIAEPLLVHHFGEEIINEVFERFRAKLGNRFSKEK  340



>gb|KCW60603.1| hypothetical protein EUGRSUZ_H03330, partial [Eucalyptus grandis]
Length=347

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +E+EKL+SFN P Y PS  EV+  VEK GSF+++CLE F+++    E D      +  
Sbjct  229  GLIEKEKLDSFNVPYYPPSPKEVRQEVEKQGSFSVDCLEVFEVNRDVFETDFDPNVVSEE  288

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            AA K+   LRA+ EP+LV+ FGE II EVF R+   + D +S+EK    N
Sbjct  289  AANKMVGCLRAIAEPLLVNRFGEEIINEVFKRFRAKLGDRLSKEKIALVN  338



>ref|XP_002510424.1| Jasmonate O-methyltransferase, putative [Ricinus communis]
 gb|EEF52611.1| Jasmonate O-methyltransferase, putative [Ricinus communis]
Length=372

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 71/110 (65%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++EEK++SFN P Y P   E+K  V+K+GSF I+ LE F+I W G   D  +      
Sbjct  253  GKIKEEKVDSFNAPYYAPCAEEMKLEVQKEGSFIIDRLEAFEIDWDGGSNDGHVTTAALT  312

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +V++ +RAVVE +L +HFG  I++E+F R+ +++ D +S+ +T+Y N
Sbjct  313  RGQRVSKTIRAVVESMLETHFGSHIMDELFKRFGELVDDYLSKNRTKYVN  362



>ref|XP_010024166.1| PREDICTED: salicylate carboxymethyltransferase-like [Eucalyptus 
grandis]
Length=374

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL+SFN P YTPS  EV+  VEK GSF+I+C E F+++    E D      +  
Sbjct  256  GIIEEEKLDSFNVPYYTPSPKEVRREVEKQGSFSIDCFEVFEVNRDVFETDFDPNVVSKE  315

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREK  410
            AA K+   LRA+ EP+LV HFGE II EVF R+   + +  S+EK
Sbjct  316  AADKIVGSLRAIAEPLLVHHFGEEIINEVFERFRAKLGNRFSKEK  360



>ref|XP_010026914.1| PREDICTED: salicylate carboxymethyltransferase-like [Eucalyptus 
grandis]
Length=365

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +E+EKL+SFN P Y PS  EV+  VEK GSF+++CLE F+++    E D      +  
Sbjct  247  GLIEKEKLDSFNVPYYPPSPKEVRQEVEKQGSFSVDCLEVFEVNRDVFETDFDPNVVSEE  306

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            AA K+   LRA+ EP+LV+ FGE II EVF R+   + D +S+EK    N
Sbjct  307  AANKMVGCLRAIAEPLLVNRFGEEIINEVFKRFRAKLGDRLSKEKIALVN  356



>ref|XP_011048790.1| PREDICTED: jasmonate O-methyltransferase [Populus euphratica]
Length=369

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEK++SFN P Y P + EV+S +EKDGSF++  LETF+I W G   D    +   +
Sbjct  252  GLVEEEKVDSFNAPYYGPCVEEVRSEIEKDGSFSVNRLETFEIDWDGGVDDVDTTSGPAS  311

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +VA+ +RAVVE +L SHFG+ I++E+F RY  ++   +S+  T+YTN
Sbjct  312  RGQRVAKTIRAVVESMLESHFGKDIMDELFQRYGDLVEGYLSKTGTKYTN  361



>gb|AAW66830.1| SAMT [Cestrum nocturnum]
Length=340

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +3

Query  3    FLETNCHDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEK  182
            FL     D C     ++  +   A +  +  G  EE KL+SFN P YTPS AEVK +V K
Sbjct  208  FLGRESEDACSKECCYIWELLAKALNELVQEGLXEEXKLDSFNIPQYTPSPAEVKYIVGK  267

Query  183  DGSFTIECLETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEV  362
             GSF +  LE+ ++HW          NN+ N  Y V+R +RAV EP+LVSHFGE +++ V
Sbjct  268  HGSFAVNRLESSRVHWN----VTNNNNNSINGGYNVSRCMRAVAEPLLVSHFGEDLMDLV  323

Query  363  FHRYTKIIADSMSREKT  413
            F +Y  II++ M++EKT
Sbjct  324  FQKYEGIISECMAKEKT  340



>ref|XP_002521540.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis]
 gb|EEF40811.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis]
Length=366

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +++EK  SFN P YTPS  EV++ + K+GSF+I+ LE  +++W     +  +     +
Sbjct  246  GVIDKEKFESFNIPQYTPSPFEVRTGIAKEGSFSIDRLEVSEVNWNAYHNEFNMSEAFKD  305

Query  276  aaYKVARGLRAVVEPILVSHFGEG--IIEEVFHRYTKIIADSMSREKTEYTN  425
              + V + +RAV EP+LV HFG G   I++VF RY  I+AD M++EKTE+ N
Sbjct  306  GGHNVTKCMRAVAEPLLVGHFGFGRATIDQVFCRYRSIVADRMAKEKTEFVN  357



>gb|AIY26015.1| SAMT [Jasminum sambac]
Length=364

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G + +EKL SFN P Y PS  EVK  VEK+GS+TI  L   +I+W     +N  G     
Sbjct  245  GLIAKEKLYSFNIPQYIPSPLEVKKEVEKEGSYTINRLGASEINWAACGENNNEGG----  300

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+ +R+VVEP+L+ HFGE +++ +F +Y +++ D MS+E+T++ N
Sbjct  301  --YSVAKCMRSVVEPLLIGHFGEAVMDILFRKYGEVLNDRMSKEETKFVN  348



>gb|KGN48855.1| hypothetical protein Csa_6G504130 [Cucumis sativus]
Length=201

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 85/137 (62%), Gaps = 8/137 (6%)
 Frame = +3

Query  21   HDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTI  200
             D C Y+F+ L     +A +  +  G VEEEK++ FN P + PS  E+K  V K+GSF I
Sbjct  63   QDYC-YAFTLL----NLALNNMVAEGIVEEEKVDRFNIPTFMPSPKEIKEEVLKEGSFII  117

Query  201  ECLETFQIHWT--GDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRY  374
              L+  +I W     E +    +   +++Y VA+ +R+V+E ++  HFGE I+EE+F+RY
Sbjct  118  NELKVSKIDWNFYSTELEG-TKHVFVDSSYNVAKCIRSVIESLMSPHFGEAIVEELFYRY  176

Query  375  TKIIADSMSREKTEYTN  425
            +KI+ D MS +++E+TN
Sbjct  177  SKIVKDEMSNKRSEFTN  193



>ref|XP_010670970.1| PREDICTED: salicylate carboxymethyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=375

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 71/106 (67%), Gaps = 4/106 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G++EEEKLN+FN P+YT S +E++ LV  +GSF ++ +   +I W  +++ N     ++ 
Sbjct  259  GYIEEEKLNTFNLPIYTSSPSELEFLVHSEGSFALDQVHASEISWDANDHKN----RSSC  314

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKT  413
              Y  A  LRAVVE ++VSHFGE II+E+F RY +II  SM+ EK 
Sbjct  315  DQYDFAICLRAVVESLIVSHFGEEIIDEIFKRYREIICASMAEEKN  360



>ref|XP_008440756.1| PREDICTED: salicylate carboxymethyltransferase-like [Cucumis 
melo]
Length=369

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 73/115 (63%), Gaps = 5/115 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNM-----IG  260
            G +EEEKL SF+ P Y PS  E++  V K+GSF I+ +   ++ W     + +     + 
Sbjct  246  GIIEEEKLESFHIPKYMPSPTEIRIEVAKEGSFVIDSIRVSEVDWKVSNNNEVNKAKSVD  305

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             +   + Y VA+ +RAV EPIL+SHFGE I++E+F RY +IIAD M++E T++ N
Sbjct  306  ESLKGSGYNVAKYMRAVAEPILISHFGEEIMDELFIRYREIIADRMAKETTQFFN  360



>ref|XP_010678722.1| PREDICTED: salicylate carboxymethyltransferase-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=368

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNM-IGnnnn  272
            G+++EEKLNSFN P YTPS  E+  +VEK+GSFT+      ++ W   E++   I +   
Sbjct  250  GYIDEEKLNSFNIPQYTPSAEEIGFIVEKEGSFTLNEAHISEVSWESKEHEYCKINSYKA  309

Query  273  naaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               Y   + +R+V EP+L+SHF E IIEE+F RY +I+  SM+ +   + N
Sbjct  310  FDPYDFVKCMRSVAEPLLISHFSEAIIEELFKRYREIVQASMANDTNVFIN  360



>ref|XP_010678721.1| PREDICTED: salicylate carboxymethyltransferase-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=372

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNM-IGnnnn  272
            G+++EEKLNSFN P YTPS  E+  +VEK+GSFT+      ++ W   E++   I +   
Sbjct  254  GYIDEEKLNSFNIPQYTPSAEEIGFIVEKEGSFTLNEAHISEVSWESKEHEYCKINSYKA  313

Query  273  naaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               Y   + +R+V EP+L+SHF E IIEE+F RY +I+  SM+ +   + N
Sbjct  314  FDPYDFVKCMRSVAEPLLISHFSEAIIEELFKRYREIVQASMANDTNVFIN  364



>ref|XP_010026910.1| PREDICTED: salicylate carboxymethyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL+SFN P Y PS  EV+  VEK GSF+I+CLE F+++    E D         
Sbjct  236  GLLEEEKLDSFNVPYYPPSPKEVRREVEKQGSFSIDCLEVFEVNRDVFETDCDPNVVLEE  295

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            AA K+   LRA+ EP+LV HF E II EVF R+   + D +S EK    N
Sbjct  296  AADKMVGCLRAIAEPLLVYHFSEEIINEVFKRFRAKLGDRLSMEKIALVN  345



>gb|ACH88356.1| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
1 [Nicotiana tabacum]
Length=358

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 15/112 (13%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +EEEK+ +FNTP+Y PS AEVK ++EK+GSFTI+ L T +IH  + DEY+        
Sbjct  251  GSIEEEKVVAFNTPIYCPSPAEVKFIIEKEGSFTIDVLNTSEIHMDSSDEYN--------  302

Query  273  naaYKVARGLRAVVEPILVSHFGEGI-IEEVFHRYTKIIADSMSREKTEYTN  425
                 V + +RA +EP+LVSHFG+ + +++VFH+  +I    +++EKT  TN
Sbjct  303  -----VTQCMRAFIEPLLVSHFGDELNMDQVFHKCREIFVSGIAKEKTTCTN  349



>gb|KDP38542.1| hypothetical protein JCGZ_04467 [Jatropha curcas]
Length=196

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEK++SFN P Y P   E+K+ VEK+G F I+ +E F+I W G   D    ++  +
Sbjct  80   GLVEEEKVDSFNAPYYAPCGEEIKNQVEKEGCFIIDRIEAFEIDWDGGSCDT---HSQCS  136

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +VA+ +RAVVE +L +HFG  I++ +F RY +++ D +S  K +Y N
Sbjct  137  RGQRVAKTIRAVVESMLEAHFGRDIMDYLFIRYAEMVDDYLSNNKRKYIN  186



>ref|XP_007017597.1| Jasmonic acid carboxyl methyltransferase [Theobroma cacao]
 gb|EOY14822.1| Jasmonic acid carboxyl methyltransferase [Theobroma cacao]
Length=373

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 72/113 (64%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNM-IGnnnn  272
            G +EEEK++SFNTP Y P   E+K  ++K+GSF I+ LE F+I W G    ++       
Sbjct  252  GLIEEEKVDSFNTPFYAPCAEEIKVEIQKEGSFIIDRLEGFEIDWDGGAVSDVHTAQGKL  311

Query  273  naaYKVARGLRAVVEPILVSHFGEG--IIEEVFHRYTKIIADSMSREKTEYTN  425
                + A+ LRAVVE +L SHFG G  I++++F RY +I+ + +S+ +T+Y N
Sbjct  312  LIGQRAAKALRAVVESMLESHFGIGQDIMDDLFSRYAEIVGNHLSKTRTKYFN  364



>ref|XP_004499183.1| PREDICTED: jasmonate O-methyltransferase-like isoform X1 [Cicer 
arietinum]
Length=371

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G VEEEK++SFN P Y P + E+K ++EK+GSF ++  E ++I W  G E  +       
Sbjct  252  GLVEEEKVDSFNAPYYAPCVEELKIVIEKEGSFMVDSHEAYEIDWDDGTELLSENVLETV  311

Query  273  naaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            ++  +VA+ +RAVVE +L  HFG  II+E+F RY K++ D +S+ +T+Y N
Sbjct  312  SSGERVAKTVRAVVESMLKYHFGSHIIDELFQRYAKLVEDYLSKTRTKYIN  362



>gb|KCW60601.1| hypothetical protein EUGRSUZ_H03327, partial [Eucalyptus grandis]
Length=348

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +E+EKL+SFN P Y PS  EV+  VEK GSF+I+CLE F+++    E D      +  
Sbjct  230  GLIEKEKLDSFNVPYYPPSPKEVRREVEKQGSFSIDCLEVFEVNRDVFETDFDPNVVSEE  289

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            AA K+   LRA+ EP+LV+ FGE II EVF R+   + + +S+EK    N
Sbjct  290  AADKMVGCLRAIAEPLLVNRFGEEIINEVFKRFRAKLGNRLSKEKIALVN  339



>gb|KCW60600.1| hypothetical protein EUGRSUZ_H03325, partial [Eucalyptus grandis]
Length=337

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEKL+SFN P Y PS  EV+  VEK GSF+I+CLE F+++    E D         
Sbjct  230  GLLEEEKLDSFNVPYYPPSPKEVRREVEKQGSFSIDCLEVFEVNRDVFETDCDPNVVLEE  289

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREK  410
            AA K+   LRA+ EP+LV HF E II EVF R+   + D +S EK
Sbjct  290  AADKMVGCLRAIAEPLLVYHFSEEIINEVFKRFRAKLGDRLSMEK  334



>ref|XP_009601458.1| PREDICTED: salicylate carboxymethyltransferase-like [Nicotiana 
tomentosiformis]
Length=388

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 79/131 (60%), Gaps = 21/131 (16%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +EEEK+NSFN P+Y PS AEVK +VEK+GSFTI+ LET ++H    DE  +  G  + 
Sbjct  249  GLIEEEKVNSFNFPMYHPSPAEVKYVVEKEGSFTIDVLETSELHVDVSDETCSNTGQFDA  308

Query  273  naa-------------------YKVARGLRAVVEPILVSHFGEGI-IEEVFHRYTKIIAD  392
             +                    Y VA  LRA+ EP+LVSHFG  + +++VF++  +I  +
Sbjct  309  QSDLHLWRVQEMVTPQDCSNGEYNVAHCLRALAEPLLVSHFGTKLNMDQVFNKCREIFVN  368

Query  393  SMSREKTEYTN  425
             M++EKT +TN
Sbjct  369  CMAKEKTTFTN  379



>ref|XP_010026911.1| PREDICTED: salicylate carboxymethyltransferase-like [Eucalyptus 
grandis]
Length=365

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +E+EKL+SFN P Y PS  EV+  VEK GSF+I+CLE F+++    E D      +  
Sbjct  247  GLIEKEKLDSFNVPYYPPSPKEVRREVEKQGSFSIDCLEVFEVNRDVFETDFDPNVVSEE  306

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            AA K+   LRA+ EP+LV+ FGE II EVF R+   + + +S+EK    N
Sbjct  307  AADKMVGCLRAIAEPLLVNRFGEEIINEVFKRFRAKLGNRLSKEKIALVN  356



>ref|XP_007015210.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein, putative [Theobroma cacao]
 gb|EOY32829.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein, putative [Theobroma cacao]
Length=378

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 70/114 (61%), Gaps = 6/114 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EE  ++SFN P Y P   EV  +VEK+GSF ++ LE F ++W  D  D++   N   
Sbjct  249  GLIEESDVDSFNMPCYNPCQEEVLEIVEKEGSFDLDKLEKFGVNW--DPEDDVCNKNFVF  306

Query  276  aaYK----VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              YK    VA  +RA+ EP+L SHFGE II  +F RY + +A+ +S EKT++ N
Sbjct  307  NKYKSGQNVANCIRAITEPLLASHFGETIIHNLFTRYAQHVAEHLSIEKTKFVN  360



>ref|XP_004150007.1| PREDICTED: salicylate O-methyltransferase-like [Cucumis sativus]
Length=342

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 85/137 (62%), Gaps = 8/137 (6%)
 Frame = +3

Query  21   HDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTI  200
             D C Y+F+ L     +A +  +  G VEEEK++ FN P + PS  E+K  V K+GSF I
Sbjct  204  QDYC-YAFTLL----NLALNNMVAEGIVEEEKVDRFNIPTFMPSPKEIKEEVLKEGSFII  258

Query  201  ECLETFQIHWT--GDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRY  374
              L+  +I W     E +    +   +++Y VA+ +R+V+E ++  HFGE I+EE+F+RY
Sbjct  259  NELKVSKIDWNFYSTELEGT-KHVFVDSSYNVAKCIRSVIESLMSPHFGEAIVEELFYRY  317

Query  375  TKIIADSMSREKTEYTN  425
            +KI+ D MS +++E+TN
Sbjct  318  SKIVKDEMSNKRSEFTN  334



>ref|XP_010664714.1| PREDICTED: jasmonate O-methyltransferase isoform X2 [Vitis vinifera]
Length=372

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW---TGDEYDNMIGnn  266
            G +EE+K++SF+ P Y PS  EVK  + K+GSF ++ LE F+I W    GD YD    ++
Sbjct  251  GLIEEKKVDSFDAPYYAPSPEEVKFGIYKEGSFILDRLEMFEIDWDGGDGDNYDATPTSS  310

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              +   +VA+ +RAVVE +L SHFG  +++ +F RY +++ D +++ + +Y N
Sbjct  311  TLSNGARVAKTIRAVVESMLASHFGGDVMDGLFQRYGEMVGDHLAKTRAKYIN  363



>gb|KEH40176.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
Length=379

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G VEEEK++SFN P YTP   E+K  +EK+GSF ++  E ++I W TG E  +  G +  
Sbjct  262  GLVEEEKVDSFNAPYYTPCFEELKMEIEKEGSFMVDSHEAYEIDWDTGIELQS--GGDTM  319

Query  273  naaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            ++  +VA+ LRAVVE +L  HFG  I++E+F RY K + D +S+ +T+  N
Sbjct  320  SSGERVAKTLRAVVESMLEYHFGSHIMDELFQRYAKHVEDHLSKTRTKCIN  370



>gb|ABU88887.2| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase 
[Chimonanthus praecox]
Length=380

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 71/114 (62%), Gaps = 6/114 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNM----IGn  263
            G +EEEK++SFN P YTPS  EVKSLV  +GSF I  LET+ + W  D  D +    +  
Sbjct  258  GLIEEEKVDSFNLPQYTPSPEEVKSLVVSEGSFLIHRLETYTVSW--DPQDKLHHQSLAF  315

Query  264  nnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            N   +  KVA  +RAV E +L SHFG  II+++F +Y   +++ + RE+  +TN
Sbjct  316  NALKSGAKVAMYMRAVAESLLTSHFGGAIIDDLFQKYKDTVSEKLEREEPTFTN  369



>ref|XP_002281588.1| PREDICTED: jasmonate O-methyltransferase isoform X1 [Vitis vinifera]
 emb|CBI19734.3| unnamed protein product [Vitis vinifera]
Length=375

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW---TGDEYDNMIGnn  266
            G +EE+K++SF+ P Y PS  EVK  + K+GSF ++ LE F+I W    GD YD    ++
Sbjct  254  GLIEEKKVDSFDAPYYAPSPEEVKFGIYKEGSFILDRLEMFEIDWDGGDGDNYDATPTSS  313

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              +   +VA+ +RAVVE +L SHFG  +++ +F RY +++ D +++ + +Y N
Sbjct  314  TLSNGARVAKTIRAVVESMLASHFGGDVMDGLFQRYGEMVGDHLAKTRAKYIN  366



>ref|XP_008220839.1| PREDICTED: jasmonate O-methyltransferase-like [Prunus mume]
Length=387

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 74/116 (64%), Gaps = 11/116 (9%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYD------NMI  257
            G + EEK++SFN P Y P   E+   ++K+GSF ++ LE F+I W GD Y       +M+
Sbjct  268  GLIAEEKVDSFNAPYYAPCEEELSLALKKEGSFLMDSLEAFEIDWDGDGYQELHHTFDMV  327

Query  258  GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            G+       KVA+ +RAVVE +L SHFG+ I++ +F  Y +++++ +S+ +T+Y N
Sbjct  328  GSGQ-----KVAKTVRAVVESMLESHFGKDIMDHLFQCYAELVSNHLSKSRTKYIN  378



>gb|AIN76708.1| jasmonic acid carboxyl methyltransferase [Artemisia annua]
Length=366

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G V++E ++SFN P Y PS  EVK LVEK+GSF ++ +E F+I W G +     G   ++
Sbjct  250  GLVKKEMIDSFNAPYYAPSPEEVKFLVEKEGSFLVDGVEAFEIEWDGGDS----GVLEDS  305

Query  276  aaYKVARGLRAVVEPILVSHF--GEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            +  +VA+ +RAVVEP+L  HF     +++E+F RY KII D  S  + +YTN
Sbjct  306  SGKRVAKTIRAVVEPMLAIHFDLNPVMMDELFRRYAKIIDDCFSETRFKYTN  357



>ref|XP_002281579.1| PREDICTED: jasmonate O-methyltransferase [Vitis vinifera]
 emb|CBI19736.3| unnamed protein product [Vitis vinifera]
Length=375

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW---TGDEYDNMIGnn  266
            G +EE+K++SF+ P Y PS  EVK  + K+GSF ++ LE F+I W    GD YD    ++
Sbjct  254  GLIEEKKVDSFDAPYYAPSPEEVKFGIYKEGSFILDRLEMFEIDWDGGDGDNYDATPTSS  313

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              +   +VA+ +R VVE +L SHFG  +++ +F RY +++ D +++ +T+Y N
Sbjct  314  TLSNGARVAKTIRVVVESMLASHFGGDVMDGLFQRYGEMVGDHLAKTRTKYIN  366



>ref|XP_008440750.1| PREDICTED: salicylate carboxymethyltransferase-like isoform X1 
[Cucumis melo]
 ref|XP_008440752.1| PREDICTED: salicylate carboxymethyltransferase-like isoform X3 
[Cucumis melo]
Length=366

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 82/130 (63%), Gaps = 4/130 (3%)
 Frame = +3

Query  42   FSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQ  221
            F + L +  +A +  +  G + EEK++ FN P + PS  EVK+ V K+GSF +  +E  +
Sbjct  231  FCYTLTLLNLAINNMVKEGMIREEKVDRFNVPNFMPSSEEVKTEVLKEGSFIVNRVEVAR  290

Query  222  IHWT--GDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADS  395
            I W    DE++    N   +++Y  A+ +R+V EP+++ HFGE I+EE+FH++ KI+ D 
Sbjct  291  IDWNSYNDEFNQ--SNVFVDSSYCYAKCIRSVFEPLMIPHFGEAIVEELFHKFGKIVKDE  348

Query  396  MSREKTEYTN  425
            MS+++ E TN
Sbjct  349  MSKKQCEETN  358



>ref|XP_003638267.1| Jasmonate O-methyltransferase [Medicago truncatula]
Length=408

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 80/133 (60%), Gaps = 7/133 (5%)
 Frame = +3

Query  30   CIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECL  209
            C Y +  L      A    ++ G VEEEK++SFN P YTP   E+K  +EK+GSF ++  
Sbjct  273  CCYQWELL----AQALMTLVLEGLVEEEKVDSFNAPYYTPCFEELKMEIEKEGSFMVDSH  328

Query  210  ETFQIHW-TGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKII  386
            E ++I W TG E  +  G +  ++  +VA+ LRAVVE +L  HFG  I++E+F RY K +
Sbjct  329  EAYEIDWDTGIELQS--GGDTMSSGERVAKTLRAVVESMLEYHFGSHIMDELFQRYAKHV  386

Query  387  ADSMSREKTEYTN  425
             D +S+ +T+  N
Sbjct  387  EDHLSKTRTKCIN  399



>ref|XP_008440751.1| PREDICTED: salicylate carboxymethyltransferase-like isoform X2 
[Cucumis melo]
Length=366

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 82/130 (63%), Gaps = 4/130 (3%)
 Frame = +3

Query  42   FSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQ  221
            F + L +  +A +  +  G + EEK++ FN P + PS  EVK+ V K+GSF +  +E  +
Sbjct  231  FCYTLTLLNLAINNMVKEGMIREEKVDRFNVPNFMPSSEEVKTEVLKEGSFIVNRVEVAR  290

Query  222  IHWT--GDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADS  395
            I W    DE++    N   +++Y  A+ +R+V EP+++ HFGE I+EE+FH++ KI+ D 
Sbjct  291  IDWNSYNDEFNQ--SNVFVDSSYCYAKCIRSVFEPLMIPHFGEAIVEELFHKFGKIVKDE  348

Query  396  MSREKTEYTN  425
            MS+++ E TN
Sbjct  349  MSKKQCEETN  358



>ref|XP_006656836.1| PREDICTED: anthranilate O-methyltransferase 3-like [Oryza brachyantha]
Length=381

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 7/114 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNM-----IG  260
            G VE+ KL SFN PLY PS+ EVK+ VE+   F IE +E F+  W  D YD++       
Sbjct  259  GLVEKGKLESFNLPLYGPSMDEVKAAVEQSELFGIEHMELFESSW--DPYDDLQEHDSTH  316

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            ++       VAR +RAV EP+L  HFGE +++E+F RY +++   ++REK +++
Sbjct  317  SSPARGGMNVARCIRAVYEPLLAGHFGEHMLDELFRRYAQLVGRHLAREKAKFS  370



>ref|XP_002529241.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis]
 gb|EEF33154.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis]
Length=364

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 74/112 (66%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +++EK +SFN P YTPS+ EV S +E++GSF I+ LE ++ HW     +  +  +  +
Sbjct  243  GAIDKEKFDSFNIPQYTPSIFEVISKIEEEGSFLIDQLEVYEQHWNAYHDEPNLSEDFKD  302

Query  276  aaYKVARGLRAVVEPILVSHF--GEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              Y VA+  RAV EP+++SHF   + I++++F RY  ++ D M++EKT++ N
Sbjct  303  PGYNVAKFARAVSEPLIISHFCLDKAIMDKIFDRYRTMLNDYMAKEKTKFVN  354



>gb|ACZ55217.1| S-adenosyl-L-methionine:benzoic acid/salicylic acid carboxyl 
methyltransferase [Nicotiana suaveolens]
Length=387

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 89/162 (55%), Gaps = 21/162 (13%)
 Frame = +3

Query  3    FLETNCHDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEK  182
             L  N  DL      ++L    +A    ++ G +EEEKLNSFN P+Y PS AEVK +VEK
Sbjct  217  MLGRNNEDLYSKGCHYVLEPLAMALKELVVMGLLEEEKLNSFNIPIYNPSPAEVKYIVEK  276

Query  183  DGSFTIECLET--FQIHWTGDEYDN------------------MIGnnnnnaaYKVARGL  302
            +GSFTI  LET   +I  + + Y N                  +   +  N  Y VA+ L
Sbjct  277  EGSFTINVLETSELRIDVSDETYGNTGKSDAQSDSYFSGVQEMITSQDYINDEYNVAQCL  336

Query  303  RAVVEPILVSHFG-EGIIEEVFHRYTKIIADSMSREKTEYTN  425
            RAV EP+LVSHFG E   ++VF++  +I  + M++EKT +TN
Sbjct  337  RAVTEPLLVSHFGTELNKDQVFNKCREIYVNCMAKEKTVFTN  378



>ref|XP_010255185.1| PREDICTED: salicylate carboxymethyltransferase-like [Nelumbo 
nucifera]
Length=359

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 78/119 (66%), Gaps = 9/119 (8%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW----TGDE-----YD  248
            G +EE KL+SFN P YTPS  E+K L++ +GSF ++ +E F++ W    T D+      D
Sbjct  233  GLIEEAKLDSFNLPYYTPSTHEIKDLIQMEGSFKLDRMEIFKLSWDPTLTEDDGINKNKD  292

Query  249  NMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             ++  +   +A  V + +RAV EP++++HFGE +++++F RY + +A+ + RE+++Y N
Sbjct  293  QLLVYDKFKSAQNVTKMIRAVAEPMILNHFGEEMLDDLFQRYMEKVAEYLGREESKYVN  351



>gb|KHN33247.1| 7-methylxanthosine synthase 1 [Glycine soja]
Length=327

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGD---EYDNMIGnn  266
            G VEEEKL+ F+ P+Y PS  EV  ++E++GSFT++ L+T +I W  +   E D+ I ++
Sbjct  207  GLVEEEKLDFFDLPIYGPSAEEVGQVIEREGSFTLQTLKTIKIGWDANLEEEVDDGILDS  266

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                 + +A+ +RAV+EPIL + F E I++E+F RY  ++A  +  E  EYTN
Sbjct  267  KIRGEF-IAKSIRAVLEPILSAEFSEDIMDELFSRYANLVAQLIEVETLEYTN  318



>gb|AFV60450.1| xanthosine methyltransferase 2 [Coffea arabica]
Length=385

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 70/119 (59%), Gaps = 9/119 (8%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +EEEKL+SFN P+Y PS  EVK +VE++GSF I  LETF++ +  G   D+     ++
Sbjct  253  GHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAGFSIDDNYPVRSH  312

Query  273  naaYK--------VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               Y         VA  +RAV EPIL SHFGE II ++FHR+ K  A  +   K  Y N
Sbjct  313  VQVYSDEHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKAYYNN  371



>gb|AFV60443.1| xanthosine methyltransferase 2 [Coffea arabica]
Length=385

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 70/119 (59%), Gaps = 9/119 (8%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +EEEKL+SFN P+Y PS  EVK +VE++GSF I  LETF++ +  G   D+     ++
Sbjct  253  GHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAGFSIDDNYPVRSH  312

Query  273  naaYK--------VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               Y         VA  +RAV EPIL SHFGE II ++FHR+ K  A  +   K  Y N
Sbjct  313  VQVYSDEHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKAYYNN  371



>ref|XP_008440749.1| PREDICTED: salicylate carboxymethyltransferase-like [Cucumis 
melo]
Length=372

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT---GDEYDNMIGnn  266
            G ++EEK++ FN P + PS  EVK  + K+GSF I C++  +I W      E+D ++ NN
Sbjct  248  GLIKEEKVDQFNIPKFRPSPEEVKVEILKEGSFMINCVQVSRIDWNFYNNGEFDGLLSNN  307

Query  267  nnn----aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            N      ++Y  A+ +R+V EP+L+ +F E I++E+F RY+KII D MS  K EY N
Sbjct  308  NVCGEVDSSYYFAKCIRSVYEPLLIFYFEEAIVDELFQRYSKIIKDEMSNNKYEYIN  364



>gb|AFD28989.1| S-adenosyl-L-methionine:benzoic acid/salicylic acid carboxyl 
methyltransferase, partial [Nicotiana attenuata]
Length=393

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 75/131 (57%), Gaps = 21/131 (16%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G  EEEK+NSFN P+Y PS AEVK +VEK+GSFTI+ LET ++     DE     G +  
Sbjct  254  GLTEEEKVNSFNIPIYNPSPAEVKYVVEKEGSFTIDVLETSELCIDVSDESCGNTGQSAE  313

Query  273  naa-------------------YKVARGLRAVVEPILVSHFGEGI-IEEVFHRYTKIIAD  392
                                  Y  A  LRAV EP+LVSHFG  + +++VF++  +II +
Sbjct  314  QNDSHLCRVQEMITPQDCSNGEYNAAHCLRAVTEPLLVSHFGTELNMDQVFNKCREIIVN  373

Query  393  SMSREKTEYTN  425
             M++EKT +TN
Sbjct  374  CMAKEKTTFTN  384



>ref|XP_002512934.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis]
 gb|EEF49437.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis]
Length=328

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 68/110 (62%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +++EK+ SFN P Y P+  E+K +++ +GSFT++ LE F++ W         G +   
Sbjct  210  GLIKKEKMESFNLPYYAPTTEEIKKVIDAEGSFTLQRLEVFKMDWDAYIKKAKPGADKKA  269

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
             A  +A  LRAV EPIL SHFG  I++++FHR+ +++ D M   K ++ N
Sbjct  270  RAAIIATDLRAVGEPILGSHFGSEIMDDLFHRFEEVVLDHMEINKCQFIN  319



>gb|AHA06001.1| jasmonate O-methyltransferase [Ipomoea nil]
Length=380

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 6/116 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGD---EYDNMIGnn  266
            G VEEEK++ FN P Y PS+ EVK  V+ +GSF I  LE F++ W GD   E +N    +
Sbjct  257  GVVEEEKVDCFNAPYYAPSVEEVKDAVDGEGSFIINRLEAFEVEWDGDLELESNNSSCCD  316

Query  267  nnnaaY---KVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                     +VA+ +RAVVE +L  HFG  +++E+F  YT ++ D  SR + +Y N
Sbjct  317  TLRLMSRGERVAKTIRAVVESMLTCHFGRNVMDELFTIYTGLVDDYFSRTRPKYIN  372



>ref|XP_002307671.1| JASMONIC ACID CARBOXYL METHYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|EEE94667.1| JASMONIC ACID CARBOXYL METHYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|AGR50489.1| S-adenosyl-L-methionine:jasmonic acid carboxyl methyltransferase 
[Populus trichocarpa]
Length=369

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 73/110 (66%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VE+EK++SFN P Y P + E++  +EKDGSF++  LETF+I W G   D    +    
Sbjct  252  GLVEKEKVDSFNAPYYGPCVEEMRLEIEKDGSFSVNRLETFEIDWDGGVDDVDTTSGAAL  311

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +VA+ +RAVVE +L SHFG+ I++E+F RY +++   +S+  T+YTN
Sbjct  312  RGQRVAKTIRAVVESMLESHFGKDIMDELFRRYGEMVEGYLSKTGTKYTN  361



>gb|KEH40177.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
Length=378

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEK++SFN P Y P   E+K  +EK+GSF +   E ++I W  D+   +  ++   
Sbjct  262  GLVEEEKVDSFNAPYYAPCFEELKMEIEKEGSFMVNSHEAYEIDW--DDGIELQSDDTMI  319

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            +  +VA+ +RAVVE +L  HFG  I++E+F R+ K + D +S+ +T+Y N
Sbjct  320  SGERVAKTIRAVVESMLEYHFGSHIMDELFQRFAKFVEDHLSKTRTKYIN  369



>ref|XP_002265637.1| PREDICTED: benzoate carboxyl methyltransferase [Vitis vinifera]
 emb|CAN80044.1| hypothetical protein VITISV_025095 [Vitis vinifera]
 emb|CBI17475.3| unnamed protein product [Vitis vinifera]
Length=359

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 7/119 (6%)
 Frame = +3

Query  69   IAKSV--ALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDE  242
            +AKS+   L  G VEE  ++SFN P+Y P   EVK+L+E++GSF ++ LETF+  W  D 
Sbjct  236  LAKSLLDMLADGLVEEADVDSFNLPMYNPFEGEVKALIEEEGSFNLDKLETFEASW--DP  293

Query  243  YDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEY  419
            YD+   ++   +   VA  +R+  EP+L +HFG+ II ++F RY   +A+ +S EK  +
Sbjct  294  YDD---SDKTRSGQNVANCIRSATEPMLATHFGDAIIPDLFARYANRVAEHLSMEKGHH  349



>ref|XP_003522180.1| PREDICTED: theobromine synthase 2-like, partial [Glycine max]
Length=273

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEE KL+SFN P+Y P++ EV+ ++E +GSFT++ L+TF++ W  +  D + G+  ++
Sbjct  154  GLVEETKLDSFNLPIYFPTMEEVREVIEAEGSFTLQTLKTFKLGWDANLQDEVNGSLLDS  213

Query  276  aaYK--VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                  +A+ +R V EPIL   FG  I++E+F R+   I+  +  E  EYTN
Sbjct  214  KIRGEFIAKSIRVVFEPILTVEFGNEIMDELFSRFATKISQLIEFEALEYTN  265



>emb|CBI28449.3| unnamed protein product [Vitis vinifera]
Length=226

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG---DEYDNMIGnn  266
            GFV+E KL+  N PLY P+  EV+ +V ++GSF +  LETF++ W     D   +++ + 
Sbjct  102  GFVQESKLDRCNIPLYMPTAEEVRDVVRREGSFNLLRLETFRLDWDAHIDDGNKDLVFDR  161

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               A Y V  G+RAV EP+ +SHFG+GI++++FHR+   +AD +   K    N
Sbjct  162  FERAKY-VVMGMRAVAEPLRISHFGDGIMDDLFHRFFMKVADDIEAGKDICIN  213



>ref|XP_009365519.1| PREDICTED: jasmonate O-methyltransferase-like [Pyrus x bretschneideri]
Length=368

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 75/112 (67%), Gaps = 7/112 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P Y PS  ++K  +EK+GSFT++ LE F+I W G    + + +    
Sbjct  253  GLIEEEKVDSFNAPYYAPSEEQLKFELEKEGSFTMDRLEAFEIDWDGGAEISAVASGQ--  310

Query  276  aaYKVARGLR--AVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +VA+ +R  AVVE ++ SHFG+ I++++F RY +++AD +S+ +T+  N
Sbjct  311  ---RVAKTVRAVAVVESMIESHFGKDIMDDLFRRYAELVADHLSKSRTKNIN  359



>ref|XP_007160730.1| hypothetical protein PHAVU_001G012300g [Phaseolus vulgaris]
 gb|ESW32724.1| hypothetical protein PHAVU_001G012300g [Phaseolus vulgaris]
Length=379

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 77/122 (63%), Gaps = 4/122 (3%)
 Frame = +3

Query  69   IAKSVALM*--GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGD-  239
            +A+S+  M   G +EEEK++SFN P Y P + EVK  +EK+GSF +E  E ++I W G  
Sbjct  249  LARSLMAMVSQGVLEEEKVDSFNAPYYAPCMEEVKREIEKEGSFMVEEHEAYEIEWDGGM  308

Query  240  EYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEY  419
            E  +  G + +    +V+R LRAV+E +L SHFG  I++E+F R+ + + D +S   T+Y
Sbjct  309  ELQSNCGVSVSKGE-RVSRTLRAVLESMLESHFGSHIMDELFRRFGEFVEDHLSNTDTKY  367

Query  420  TN  425
             N
Sbjct  368  IN  369



>ref|XP_009765515.1| PREDICTED: 3,7-dimethylxanthine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=312

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 68/110 (62%), Gaps = 6/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDN-----MIG  260
            G VEE KL+ FN PLY PS  E+K ++EK+GSF +  LETF++ W  +  DN      I 
Sbjct  176  GLVEEAKLDKFNLPLYAPSTKELKQIIEKEGSFKLLQLETFKLKWDSNMDDNSEKEATIF  235

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREK  410
            +  + A Y +A  +RAV EPILV HFGE I++++F RY K   + M   K
Sbjct  236  DEKSKAKY-IAGNMRAVQEPILVEHFGEEIMDDLFERYGKKAIEYMKNGK  284



>ref|XP_003522019.1| PREDICTED: 7-methylxanthosine synthase 1-like [Glycine max]
Length=369

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGD---EYDNMIGnn  266
            G VEEEKL+ F+ P+Y P+  EV  ++E++GSFT++ L+T +I W  +   E D+ I ++
Sbjct  249  GLVEEEKLDFFDLPIYGPTAEEVGQVIEREGSFTLQTLKTIKIGWDANLEEEVDDGILDS  308

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                 + +A+ +RAV+EPIL + F E I++E+F RY  ++A  +  E  EYTN
Sbjct  309  KIRGEF-IAKSIRAVLEPILSAEFSEDIMDELFSRYATLVAQLIEVETLEYTN  360



>gb|KEH34510.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
Length=389

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEKL+ FN P Y P++ EV+ ++E +GSFT++ ++TF++ W  + +++ I ++   
Sbjct  272  GLVEEEKLDLFNFPTYHPTVEEVRQVIEAEGSFTLQVMKTFKMGWDANLHNDGIVDSKMR  331

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                +A+  RAV EP+L+  FGE I++E+F R+ K++A  +  E  E+TN
Sbjct  332  GEL-IAKYHRAVFEPLLIDGFGENIMDELFSRFAKLLAQLIELETLEFTN  380



>dbj|BAG88225.1| unnamed protein product [Oryza sativa Japonica Group]
Length=330

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGn---n  266
            G VE EKL SFN PLY PS+ EVK+++  +  F I+ ++ F+ +W  D YD+M  +   +
Sbjct  211  GLVEREKLESFNLPLYGPSIDEVKAVIALNKLFGIDHIQLFESNW--DPYDDMENDGMCS  268

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            +      VA+ +RAV EP+L SHFGE I++E+F RY + +   ++ + T+Y+
Sbjct  269  SPQHGVNVAKSIRAVFEPLLASHFGECILDELFQRYARNVERHLAEDNTKYS  320



>ref|XP_004143587.1| PREDICTED: salicylate O-methyltransferase-like [Cucumis sativus]
 ref|XP_004166933.1| PREDICTED: salicylate O-methyltransferase-like [Cucumis sativus]
 gb|KGN48853.1| hypothetical protein Csa_6G503870 [Cucumis sativus]
Length=371

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 75/117 (64%), Gaps = 7/117 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT---GDEYDNMIGnn  266
            G ++EEK + FN P Y PS  EVK+ + K+GSF I  ++  +I W      E+D ++ NN
Sbjct  247  GLIKEEKADRFNIPKYRPSPKEVKTEILKEGSFMINRVQVSRIDWNFYNNGEFDELLSNN  306

Query  267  nn----naaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            N     +++Y  A+ +R+V EP+ +SHFGE I++E+F RY+K++   MS +K EY N
Sbjct  307  NVHDVVDSSYYFAKCIRSVYEPLFISHFGEAIVDELFQRYSKMVKYKMSNKKYEYVN  363



>sp|A4GE69.1|XMT1_COFCA RecName: Full=7-methylxanthosine synthase 1; AltName: Full=Xanthosine 
methyltransferase; Short=XMT [Coffea canephora]
 pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase
 pdb|2EG5|C Chain C, The Structure Of Xanthosine Methyltransferase
 pdb|2EG5|E Chain E, The Structure Of Xanthosine Methyltransferase
 pdb|2EG5|G Chain G, The Structure Of Xanthosine Methyltransferase
 gb|ABD90685.1| xanthosine methyltransferase [Coffea canephora]
Length=372

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 77/140 (55%), Gaps = 23/140 (16%)
 Frame = +3

Query  60   VTCIAKSVAL-----------------M*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDG  188
            +TCI K V L                 + G +EEEKL+SFN P+Y PS  EVK +VE++G
Sbjct  224  LTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEG  283

Query  189  SFTIECLETFQIHW-TGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVF  365
            SF I  LETF++ +  G   D+      +  A  VA  +RAV EPIL SHFGE II ++F
Sbjct  284  SFEILYLETFKVLYDAGFSIDD-----EHIKAEYVASSVRAVYEPILASHFGEAIIPDIF  338

Query  366  HRYTKIIADSMSREKTEYTN  425
            HR+ K  A  +   K  Y N
Sbjct  339  HRFAKHAAKVLPLGKGFYNN  358



>gb|KHN15663.1| Theobromine synthase 2, partial [Glycine soja]
Length=346

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEE KL+SFN P+Y P++ EV+ ++E +GSFT++ L+TF++ W  +  D + G+  ++
Sbjct  227  GLVEETKLDSFNLPIYFPTMEEVREVIEAEGSFTLQTLKTFKLGWDANLQDEVNGSLLDS  286

Query  276  aaYK--VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                  +A+ +R V EPIL   FG  I++E+F R+   I+  +  E  EYTN
Sbjct  287  KIRGEFIAKSIRVVFEPILTVEFGNEIMDELFSRFATKISQLIEFEALEYTN  338



>gb|AAM18505.1|AF494415_1 N-methyltransferase [Coffea canephora]
Length=371

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 77/140 (55%), Gaps = 23/140 (16%)
 Frame = +3

Query  60   VTCIAKSVAL-----------------M*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDG  188
            +TCI K V L                 + G +EEEKL+SFN P+Y PS  EVK +VE++G
Sbjct  223  LTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEG  282

Query  189  SFTIECLETFQIHW-TGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVF  365
            SF I  LETF++ +  G   D+      +  A  VA  +RAV EPIL SHFGE II ++F
Sbjct  283  SFEILYLETFKVLYDAGFSIDD-----EHIKAEYVASSVRAVYEPILASHFGEAIIPDIF  337

Query  366  HRYTKIIADSMSREKTEYTN  425
            HR+ K  A  +   K  Y N
Sbjct  338  HRFAKHAAKVLPLGKGFYNN  357



>gb|AAM18506.1|AF494416_1 N-methyltransferase [Coffea canephora]
 gb|AAQ16154.1| putative caffeine synthase [Coffea canephora]
 emb|CDP12638.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 77/140 (55%), Gaps = 23/140 (16%)
 Frame = +3

Query  60   VTCIAKSVAL-----------------M*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDG  188
            +TCI K V L                 + G +EEEKL+SFN P+Y PS  EVK +VE++G
Sbjct  224  LTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEG  283

Query  189  SFTIECLETFQIHW-TGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVF  365
            SF I  LETF++ +  G   D+      +  A  VA  +RAV EPIL SHFGE II ++F
Sbjct  284  SFEILYLETFKVLYDAGFSIDD-----EHIKAEYVASSVRAVYEPILASHFGEAIIPDIF  338

Query  366  HRYTKIIADSMSREKTEYTN  425
            HR+ K  A  +   K  Y N
Sbjct  339  HRFAKHAAKVLPLGKGFYNN  358



>gb|KHN12690.1| Jasmonate O-methyltransferase [Glycine soja]
Length=374

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGD---EYDNMIGnn  266
            G +EEEK++SF+ P Y P L E+K  ++K+GSF +   E ++I W      + D+     
Sbjct  253  GLLEEEKVDSFDAPYYAPCLEEMKMEIQKEGSFIVTEHEAYEIDWDAGMELQSDSPTTGT  312

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +  +VAR +RAVVE +L SHFG  I++E+F RY +++ D +S+ +T+Y N
Sbjct  313  PLTSGERVARSIRAVVESMLESHFGCHIMDELFRRYAQMVEDHLSKTRTKYIN  365



>gb|AFV60437.1| xanthosine methyltransferase 1 [Coffea canephora]
 gb|AFV60446.1| xanthosine methyltransferase 1 [Coffea canephora]
Length=372

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 77/140 (55%), Gaps = 23/140 (16%)
 Frame = +3

Query  60   VTCIAKSVAL-----------------M*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDG  188
            +TCI K V L                 + G +EEEKL+SFN P+Y PS  EVK +VE++G
Sbjct  224  LTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEG  283

Query  189  SFTIECLETFQIHW-TGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVF  365
            SF I  LETF++ +  G   D+      +  A  VA  +RAV EPIL SHFGE II ++F
Sbjct  284  SFEILYLETFKVLYDAGFSIDD-----EHIKAEYVASSVRAVYEPILASHFGEAIIPDIF  338

Query  366  HRYTKIIADSMSREKTEYTN  425
            HR+ K  A  +   K  Y N
Sbjct  339  HRFAKHAAKVLPLGKGFYNN  358



>sp|Q9AVK0.1|XMT1_COFAR RecName: Full=7-methylxanthosine synthase 1; Short=CmXRS1; AltName: 
Full=Methyltransferase-like 3; Short=CaMTL3; AltName: 
Full=Xanthosine methyltransferase; Short=CaXMT1 [Coffea arabica]
 gb|AAM18502.1|AF494412_1 N-methyltransferase [Coffea arabica]
 dbj|BAB39215.1| xanthosine methyltransferase [Coffea arabica]
 dbj|BAC43755.1| 7-methylxanthosine synthase 1 [Coffea arabica]
 gb|ADR30038.1| 7-methylxanthosine synthase 1 [Coffea canephora]
Length=372

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 77/140 (55%), Gaps = 23/140 (16%)
 Frame = +3

Query  60   VTCIAKSVAL-----------------M*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDG  188
            +TCI K V L                 + G +EEEKL+SFN P+Y PS  EVK +VE++G
Sbjct  224  LTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEG  283

Query  189  SFTIECLETFQIHW-TGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVF  365
            SF I  LETF++ +  G   D+      +  A  VA  +RAV EPIL SHFGE II ++F
Sbjct  284  SFEILYLETFKVLYDAGFSIDD-----EHIKAEYVASSVRAVYEPILASHFGEAIIPDIF  338

Query  366  HRYTKIIADSMSREKTEYTN  425
            HR+ K  A  +   K  Y N
Sbjct  339  HRFAKHAAKVLPLGKGFYNN  358



>gb|AFV60442.1| xanthosine methyltransferase 1 [Coffea arabica]
 gb|AFV60449.1| xanthosine methyltransferase 1 [Coffea arabica]
Length=372

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 77/140 (55%), Gaps = 23/140 (16%)
 Frame = +3

Query  60   VTCIAKSVAL-----------------M*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDG  188
            +TCI K V L                 + G +EEEKL+SFN P+Y PS  EVK +VE++G
Sbjct  224  LTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEG  283

Query  189  SFTIECLETFQIHW-TGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVF  365
            SF I  LETF++ +  G   D+      +  A  VA  +RAV EPIL SHFGE II ++F
Sbjct  284  SFEILYLETFKVLYDAGFSIDD-----EHIKAEYVASSVRAVYEPILASHFGEAIIPDIF  338

Query  366  HRYTKIIADSMSREKTEYTN  425
            HR+ K  A  +   K  Y N
Sbjct  339  HRFAKHAAKVLPLGKGFYNN  358



>ref|NP_001057273.1| Os06g0244000 [Oryza sativa Japonica Group]
 dbj|BAD45797.1| putative benzothiadiazole-induced S-adenosyl-L-methionine:salicylic 
acid carboxyl methyltransferase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF19187.1| Os06g0244000 [Oryza sativa Japonica Group]
 dbj|BAG93849.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65431.1| hypothetical protein OsJ_20789 [Oryza sativa Japonica Group]
Length=374

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGn---n  266
            G VE EKL SFN PLY PS+ EVK+++  +  F I+ ++ F+ +W  D YD+M  +   +
Sbjct  255  GLVEREKLESFNLPLYGPSIDEVKAVIALNKLFGIDHIQLFESNW--DPYDDMENDGMCS  312

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            +      VA+ +RAV EP+L SHFGE I++E+F RY + +   ++ + T+Y+
Sbjct  313  SPQHGVNVAKSIRAVFEPLLASHFGECILDELFQRYARNVERHLAEDNTKYS  364



>ref|XP_003549442.2| PREDICTED: jasmonate O-methyltransferase-like [Glycine max]
Length=383

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGD---EYDNMIGnn  266
            G +EEEK++SF+ P Y P L E+K  ++K+GSF +   E ++I W      + D+     
Sbjct  262  GLLEEEKVDSFDAPYYAPCLEEMKMEIQKEGSFIVTEHEAYEIDWDAGMELQSDSPTTGT  321

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +  +VAR +RAVVE +L SHFG  I++E+F RY +++ D +S+ +T+Y N
Sbjct  322  PLTSGERVARSIRAVVESMLESHFGCHIMDELFRRYAQMVEDHLSKTRTKYIN  374



>gb|AAM18507.1|AF494417_1 N-methyltransferase [Coffea liberica]
Length=386

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 70/119 (59%), Gaps = 9/119 (8%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +EEEKL+SFN P+Y PS  EVK +VE++GSF I  LETF++ +  G   D+     ++
Sbjct  252  GHLEEEKLDSFNLPVYIPSTEEVKCIVEEEGSFEILYLETFKVLYDAGFSIDDDYPLRSH  311

Query  273  naaYK--------VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               Y         VA  +RAV EPIL SHFGE II ++FHR+ K  A  +   K  Y N
Sbjct  312  VQVYSDEHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKGFYNN  370



>gb|EEC80308.1| hypothetical protein OsI_22346 [Oryza sativa Indica Group]
Length=374

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGn---n  266
            G VE EKL SFN PLY PS+ EVK+++  +  F I+ ++ F+ +W  D YD+M  +   +
Sbjct  255  GLVEREKLESFNLPLYGPSIDEVKAVIALNKLFGIDHIQLFESNW--DPYDDMENDGMCS  312

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            +      VA+ +RAV EP+L SHFGE I++E+F RY + +   ++ + T+Y+
Sbjct  313  SPQHGVNVAKSIRAVFEPLLASHFGECILDELFQRYARNVERHLAEDNTKYS  364



>ref|XP_007017600.1| Jasmonic acid carboxyl methyltransferase [Theobroma cacao]
 gb|EOY14825.1| Jasmonic acid carboxyl methyltransferase [Theobroma cacao]
Length=373

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 69/113 (61%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEY-DNMIGnnnn  272
            G +EE K++SFN P Y P   E+K  ++K GSF I+ LE F+I W G    D        
Sbjct  252  GLIEEAKVDSFNAPYYAPCAEEIKVEIQKVGSFVIDRLEGFEIDWDGGAVSDVQTAQGKL  311

Query  273  naaYKVARGLRAVVEPILVSHFGEG--IIEEVFHRYTKIIADSMSREKTEYTN  425
                +VA+ +RAVVE +L SHFG G  I++++F RY +I+ + +S+ +T+Y N
Sbjct  312  LIGQRVAKTIRAVVESMLESHFGIGQDIMDDLFSRYAEIVGNHLSKTRTKYIN  364



>gb|AAW66828.1| SAMT [Cestrum elegans]
Length=332

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 12/133 (9%)
 Frame = +3

Query  9    ETNCHDLCIYSFSFLL*VTCIAKSVA--LM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEK  182
            E  C   C Y +  L      AK++   +  G  EE KL+SFN P YTPS AEVK +V K
Sbjct  210  EDACSKECCYIWELL------AKALXELVQEGLXEEXKLDSFNIPQYTPSPAEVKYIVGK  263

Query  183  DGSFTIECLETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEV  362
             GSF +  LE+ ++HW          NN+ N  Y V+R +RAV EP+LVSHFGE +++ V
Sbjct  264  HGSFAVNRLESSRVHWN----VTNNNNNSINGGYNVSRCMRAVAEPLLVSHFGEDLMDLV  319

Query  363  FHRYTKIIADSMS  401
            F +Y  II++ M+
Sbjct  320  FQKYEGIISECMA  332



>ref|XP_010673293.1| PREDICTED: salicylate carboxymethyltransferase-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=367

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 67/110 (61%), Gaps = 0/110 (0%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            GF++E+KLN+FNTP Y PS  E+  LVEK+GSF +  ++  ++ W  +E      +   +
Sbjct  249  GFIDEDKLNTFNTPFYAPSKEELGFLVEKEGSFNLNQVQISEVSWKPNEQHKNNSHPFES  308

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                  + +R+V E ++ SHFGE I+EEV+HRY + +  SM +E   + N
Sbjct  309  DHDAFTKCIRSVTEYLITSHFGESIVEEVYHRYKEFVKVSMGKENNVFIN  358



>gb|KDO36613.1| hypothetical protein CISIN_1g036335mg [Citrus sinensis]
Length=122

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 68/114 (60%), Gaps = 3/114 (3%)
 Frame = +3

Query  90   M*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGn  263
            M G +EEEKL+SFN P Y P   E+K  ++K+GSF I+ L+ F+I W G  +E  + +  
Sbjct  1    MQGLIEEEKLDSFNAPYYGPCPEELKMEIQKEGSFIIDRLDHFEIDWDGGVEELTSTMSL  60

Query  264  nnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                   +VA+ +RAVVE +   HFG GI++ +F RY +I+   +S+    Y N
Sbjct  61   PLARGQ-RVAKTIRAVVESMFELHFGRGIMDLLFTRYAQIVDGYLSKNSANYIN  113



>gb|EEC80306.1| hypothetical protein OsI_22344 [Oryza sativa Indica Group]
Length=233

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VE+ KL SFN P+Y PS+ EVK+++ ++  F I+ +E F+ +W  D YD++  +  + 
Sbjct  114  GIVEKGKLESFNIPIYGPSIDEVKTVITRNKLFCIDHIELFESNW--DPYDDLEHDGMHI  171

Query  276  aaYK---VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            + ++   VA+ +RAV EP+L SHFGE I++++F R+ +I+   +++E  +Y+
Sbjct  172  SPHRGMNVAKCIRAVSEPLLASHFGEYILDKLFQRFAQIVERHLAKENAKYS  223



>ref|XP_010533439.1| PREDICTED: jasmonate O-methyltransferase-like [Tarenaya hassleriana]
Length=376

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 66/114 (58%), Gaps = 4/114 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG----DEYDNMIGn  263
            G +EEEK+++FN P Y P   EV   +E +GSF ++ LET +I W G      YD    +
Sbjct  254  GIIEEEKIDTFNAPYYAPCSGEVTVAIEAEGSFGVDRLETVEIDWEGCLGEKSYDVKSKS  313

Query  264  nnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +   +VA  +RAVVE +L SHFGE +++E+F RY +I+ D     +  Y N
Sbjct  314  EAISRGLRVANTIRAVVESMLESHFGENVMDELFRRYGEIVGDYFYERRPRYGN  367



>ref|XP_007042140.1| Benzoate carboxyl methyltransferase, putative [Theobroma cacao]
 gb|EOX97971.1| Benzoate carboxyl methyltransferase, putative [Theobroma cacao]
Length=369

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGnnn  269
            G +EEEKL SF+ P Y  +  EVK ++E +GSFT++ LE F + W     + D+ +    
Sbjct  250  GLIEEEKLESFDLPYYAATTEEVKEVIEAEGSFTLQRLEVFNMDWDAYIKQADSNLDKTA  309

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              A   +A+ +RAV EPIL SHFGE I++++FHR+ + + + M   K +Y N
Sbjct  310  RAAI--IAKDIRAVGEPILASHFGEDIMDDLFHRFKEDVLEYMEAHKCQYIN  359



>gb|ACZ55220.1| S-adenosyl-L-methionine:benzoic acid/salicylic acid carboxyl 
methyltransferase [Nicotiana alata]
Length=387

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 77/131 (59%), Gaps = 21/131 (16%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +EEEK+NSFN P+Y+PS AEVK +VEK+GSFTI+ LET ++     DE     G ++ 
Sbjct  248  GLIEEEKVNSFNIPIYSPSPAEVKYVVEKEGSFTIDVLETSELCIDVSDETCGNTGPSDA  307

Query  273  naa-------------------YKVARGLRAVVEPILVSHFGEGI-IEEVFHRYTKIIAD  392
                                  Y VA  LRAV E +LVSHFG  + +++VF++  +I  +
Sbjct  308  QNDLHLCRVQEMVTPQDCSNGEYNVAHCLRAVTESLLVSHFGTELNMDQVFNKCREIFVN  367

Query  393  SMSREKTEYTN  425
             M++EKT +TN
Sbjct  368  CMAKEKTTFTN  378



>ref|XP_009336009.1| PREDICTED: jasmonate O-methyltransferase-like isoform X2 [Pyrus 
x bretschneideri]
Length=367

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 73/110 (66%), Gaps = 5/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEE ++SFN P Y PS  E+K  +E +GSFT++ LE F+I W G    + + +    
Sbjct  254  GLIEEETVDSFNAPYYAPSEEELKLELENEGSFTVDRLEAFEIDWDGGAEISAVASGQ--  311

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +VA+ +RAVVE ++ SHFG+ I++++F RY +++ D +S+ +T+Y N
Sbjct  312  ---RVAKTIRAVVESMIESHFGKDIMDDLFRRYAELVVDHLSKSRTKYIN  358



>ref|XP_009336006.1| PREDICTED: jasmonate O-methyltransferase-like isoform X1 [Pyrus 
x bretschneideri]
Length=371

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 73/110 (66%), Gaps = 5/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEE ++SFN P Y PS  E+K  +E +GSFT++ LE F+I W G    + + +    
Sbjct  258  GLIEEETVDSFNAPYYAPSEEELKLELENEGSFTVDRLEAFEIDWDGGAEISAVASGQ--  315

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +VA+ +RAVVE ++ SHFG+ I++++F RY +++ D +S+ +T+Y N
Sbjct  316  ---RVAKTIRAVVESMIESHFGKDIMDDLFRRYAELVVDHLSKSRTKYIN  362



>ref|XP_010906350.1| PREDICTED: jasmonate O-methyltransferase-like [Elaeis guineensis]
Length=379

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%), Gaps = 12/120 (10%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW----------TGDEY  245
            G +E EK++SF+ P Y PS  E+K  +E +GSF ++ L+ F+  W            +E 
Sbjct  254  GLIEVEKVDSFDAPFYAPSSEELKREIESEGSFAVKSLKLFEASWGHNNRIGYSKATEEK  313

Query  246  DNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            D M+G  +     +VA+G+RAVVE +L SHFGE +IE+ F RY +++ D  +R  T+  N
Sbjct  314  DPMLGELSTAQ--RVAKGIRAVVESMLESHFGEAMIEDFFSRYCELLEDHCTRNDTKVFN  371



>ref|XP_010246471.1| PREDICTED: salicylate carboxymethyltransferase-like [Nelumbo 
nucifera]
Length=367

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 11/113 (10%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWT-----GDEYDNMIG  260
            G +EEEK+N+FN P+Y  S  E+KS++E++GSF I+ LET +I W      GD   N + 
Sbjct  248  GLIEEEKVNTFNMPIYIASPREMKSVIEREGSFDIDRLETSEIKWREEDNLGDNEANKL-  306

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKI-IADSMSREKTE  416
                  A  +AR LRAV EP+L  HFGE ++EE+F R  +I + D M +E+ +
Sbjct  307  ----RDANNLARYLRAVAEPLLADHFGEALMEELFCRLREILVVDGMDKEEAK  355



>ref|XP_003627282.1| Jasmonate O-methyltransferase [Medicago truncatula]
 gb|AET01758.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
Length=360

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 70/114 (61%), Gaps = 13/114 (11%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQI--HWTGDE--YDNMIGn  263
            G + E+++N+FN P Y PS  EV+  V  +GSF I  +E F+   + + DE  YDN    
Sbjct  247  GIIREDQVNTFNIPHYYPSPNEVELEVVNEGSFVINHIELFETESNTSNDESDYDN----  302

Query  264  nnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                  Y VA  +RAVVEP+LVSHFGE IIEEVF RY +++ D +S+E+    N
Sbjct  303  -----EYDVAGCIRAVVEPLLVSHFGEAIIEEVFSRYKELLIDQISKERMNSVN  351



>ref|XP_007223087.1| hypothetical protein PRUPE_ppa007005mg [Prunus persica]
 gb|EMJ24286.1| hypothetical protein PRUPE_ppa007005mg [Prunus persica]
Length=386

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 74/117 (63%), Gaps = 12/117 (10%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYD-------NM  254
            G + EEK++SF+ P Y P   E+   ++K+GSF ++ LE F+I W G + D       +M
Sbjct  266  GLIAEEKVDSFDAPYYAPCEEELSLALKKEGSFLMDSLEAFEIDWDGGDGDQELHHTFDM  325

Query  255  IGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            +G+       KVA+ +RAVVE +L SHFG+ I++ +F  Y +++++ +S+ +T+Y N
Sbjct  326  VGSGQ-----KVAKTIRAVVESMLESHFGKDIMDHLFQCYAELVSNHLSKSRTKYIN  377



>gb|ABD33161.2| Beta-ketoacyl synthase; SAM dependent carboxyl methyltransferase 
[Medicago truncatula]
Length=336

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGD-EYDNMIGnnnn  272
            G VEEEKL+ F+ P Y P++ EV  L+E +GSFT++ ++TF++ W  + E DN+    ++
Sbjct  216  GLVEEEKLDLFDFPAYHPTVKEVSQLIEAEGSFTLQTIKTFKMGWDANLEKDNVDYVVDS  275

Query  273  naaYK-VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                + +A+  RAV EP+L++ FGE I++E+F R+ K+IA  +  E  E+TN
Sbjct  276  KMRGEFIAKYHRAVYEPLLIAGFGENIMDELFSRFAKLIAQLIEIETLEFTN  327



>gb|EEE65429.1| hypothetical protein OsJ_20786 [Oryza sativa Japonica Group]
Length=282

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VE+ KL SFN P+Y PS+ EVK+++ ++  F I+ +E F+ +W  D YD++  +  + 
Sbjct  163  GIVEKGKLESFNLPIYGPSIDEVKTVITRNKLFCIDHIELFESNW--DPYDDLEHDGMHI  220

Query  276  aaYK---VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            + ++   VA+ +RAV EP+L SHFGE I++++F R+ +I+   +++E  +Y+
Sbjct  221  SPHRGMNVAKCIRAVSEPLLASHFGEYILDKLFQRFAQIVERHLAKENVKYS  272



>gb|KHN22767.1| Salicylate O-methyltransferase [Glycine soja]
Length=341

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 64/96 (67%), Gaps = 6/96 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMI------  257
            G ++EEKL++FN PLYTPS +EVK  V K+GSF I  LE  +++W   +  N +      
Sbjct  246  GIIKEEKLDTFNIPLYTPSPSEVKLEVLKEGSFAINRLEVSEVNWNAFDDRNALEFESER  305

Query  258  GnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVF  365
             +  ++  Y VA+ +RAV EP+LVSHFGE IIEEVF
Sbjct  306  SDTLSDGGYNVAQCMRAVAEPMLVSHFGEAIIEEVF  341



>ref|XP_009775541.1| PREDICTED: salicylate carboxymethyltransferase-like [Nicotiana 
sylvestris]
Length=296

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 73/112 (65%), Gaps = 8/112 (7%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +++EK+NSFN  +Y PS AEVK +VEK+GSFTI+ LET + H    DE  N   ++  
Sbjct  182  GLIQKEKVNSFNILIYHPSPAEVKYIVEKEGSFTIDVLETSEFHIDVSDETCNCTNSD--  239

Query  273  naaYKVARGLRAVVEPILVSHFGEGI-IEEVFHRYTKIIADSMSREKTEYTN  425
                 +A  LR + EP+LVSHFG  + +++VF++  +I    M++EKT +TN
Sbjct  240  ----NMANSLRPLAEPLLVSHFGTELNMDQVFNKCREIFVYCMAKEKTTFTN  287



>gb|EMT20995.1| Benzoate carboxyl methyltransferase [Aegilops tauschii]
Length=445

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGn---n  266
            G VE+EKL+SFN PLY PS+ EVK++VE+   F I  ++ F+ +W  D YD+  GN   +
Sbjct  327  GLVEKEKLDSFNLPLYGPSMDEVKAVVERSQQFDISRIKLFETNW--DPYDDSEGNDVHD  384

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            +  +   +A  LRAV+E +  SHFGE +++E+F+++   +A  + +EKT+Y+
Sbjct  385  SIQSGINIAMCLRAVMEALFTSHFGESVLDELFNKFAYNVALHLDKEKTKYS  436



>ref|XP_003624535.1| Jasmonate O-methyltransferase [Medicago truncatula]
 gb|AES80753.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
Length=365

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 75/112 (67%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGD-EYDNMIGnnnn  272
            G VEEEKL+ F+ P Y P++ EV  L+E +GSFT++ ++TF++ W  + E DN+    ++
Sbjct  245  GLVEEEKLDLFDFPAYHPTVKEVSQLIEAEGSFTLQTIKTFKMGWDANLEKDNVDYVVDS  304

Query  273  naaYK-VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                + +A+  RAV EP+L++ FGE I++E+F R+ K+IA  +  E  E+TN
Sbjct  305  KMRGEFIAKYHRAVYEPLLIAGFGENIMDELFSRFAKLIAQLIEIETLEFTN  356



>gb|AES80745.2| SAM-dependent carboxyl methyltransferase [Medicago truncatula]
Length=333

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEE KL+ FN P+Y P++ EVK ++E + SFT++ L TF+I    +  D+++    ++
Sbjct  213  GLVEEAKLDLFNLPVYHPTIEEVKQVIEAEASFTLQTLNTFKIGCDANLQDDIVDYVEDS  272

Query  276  aaYK--VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                  +A+  RAV EP+L++ FGE I++E+F R+ K+IA  +  E  E+TN
Sbjct  273  KMRGEFIAKYHRAVYEPLLIAGFGENIMDELFSRFAKLIAQLIEIETLEFTN  324



>emb|CDP20034.1| unnamed protein product [Coffea canephora]
Length=359

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = +3

Query  87   LM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnn  266
            +M G +EE  L++FN PLY PS+ E++S++E + SF I  LETF++HW  D++   +   
Sbjct  237  VMQGMLEEANLDAFNIPLYGPSMEELRSIIENENSFNIFSLETFKLHW--DDFYMEVFKK  294

Query  267  nnnaaY----KVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSM  398
                 Y     VA  LRA++EPIL SHFG+ I++E F R  K I++ +
Sbjct  295  KPEDNYIRGEYVAASLRAILEPILTSHFGDAIMDEFFRRLAKKISEHL  342



>ref|XP_010227797.1| PREDICTED: anthranilate O-methyltransferase 3-like [Brachypodium 
distachyon]
Length=377

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 80/144 (56%), Gaps = 6/144 (4%)
 Frame = +3

Query  3    FLETNCHDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEK  182
            FL     D+   + S L  +   +    +  G V+ EKL++FN P Y PS+ EV  +V+ 
Sbjct  227  FLGRKDEDVYTGAMSHLYGLLAQSMETLVQEGLVKREKLDAFNLPFYGPSVDEVNDIVKA  286

Query  183  DGSFTIECLETFQIHWTGDEYDNMIGnnnnnaaYK----VARGLRAVVEPILVSHFGEGI  350
             G F I  ++ F+ +W  D +D   G++  +   +    VA+ LRAV+EP+ VSHFGE I
Sbjct  287  SGQFDINHIKLFESNW--DPHDKSEGDDPLHDPLRSGKNVAKTLRAVMEPLFVSHFGESI  344

Query  351  IEEVFHRYTKIIADSMSREKTEYT  422
            I  +F ++   +A  + REKT+Y+
Sbjct  345  INRLFDKFAYNVAAHLEREKTKYS  368



>ref|XP_010254767.1| PREDICTED: jasmonate O-methyltransferase-like [Nelumbo nucifera]
Length=376

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 71/117 (61%), Gaps = 7/117 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEE+KL+SFN P Y+PS  E++S ++++GSF ++ L+  +I W G ++D         
Sbjct  249  GLVEEKKLDSFNAPYYSPSAEELRSAIQREGSFAVDRLDILEIDWDGGDHDTAEAAAAAE  308

Query  276  aaY-----KVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSM--SREKTEYTN  425
                    +V + +RAVVE +L SHFG  +++E+F RY  +++  M  S   T+YTN
Sbjct  309  TTEESGAERVMKTIRAVVESMLTSHFGGEMMDELFRRYRDLLSHYMSTSNNTTKYTN  365



>ref|XP_004291852.1| PREDICTED: jasmonate O-methyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=390

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 69/117 (59%), Gaps = 7/117 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEK++SFN P Y P   E+KS ++KDGSF ++ LE F+I W G   D  I  N  +
Sbjct  265  GLVEEEKVDSFNAPYYAPCAEELKSELQKDGSFIMDRLEAFEIDWDGGADDQAITMNGFD  324

Query  276  aaYKVARG-------LRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                VAR        +RAV E ++ +HFG  I++++F RY +++   +   +T+Y N
Sbjct  325  HDQMVARSGKRVANTIRAVAESMIEAHFGIEIMDDLFRRYAELVTKHLLETRTKYIN  381



>ref|XP_003624527.1| Jasmonate O-methyltransferase [Medicago truncatula]
Length=346

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEE KL+ FN P+Y P++ EVK ++E + SFT++ L TF+I    +  D+++    ++
Sbjct  226  GLVEEAKLDLFNLPVYHPTIEEVKQVIEAEASFTLQTLNTFKIGCDANLQDDIVDYVEDS  285

Query  276  aaYK--VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                  +A+  RAV EP+L++ FGE I++E+F R+ K+IA  +  E  E+TN
Sbjct  286  KMRGEFIAKYHRAVYEPLLIAGFGENIMDELFSRFAKLIAQLIEIETLEFTN  337



>ref|XP_010657481.1| PREDICTED: LOW QUALITY PROTEIN: 7-methylxanthosine synthase 1-like 
[Vitis vinifera]
Length=396

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG---DEYDNMIGnn  266
            GFV+E KL+  N PLY P+  EV+ +V ++GSF +  LETF++ W     D   +++ + 
Sbjct  277  GFVQESKLDRCNIPLYMPTAEEVRDVVRREGSFNLLRLETFRLDWDAHIDDGNKDLVFDR  336

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               A Y V  G+RAV EP+ +SHFG+GI++++FHR+   +AD +   K    N
Sbjct  337  FERAKY-VVMGMRAVAEPLRISHFGDGIMDDLFHRFFMKVADDIEAGKDICIN  388



>emb|CDP12636.1| unnamed protein product [Coffea canephora]
Length=158

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 70/119 (59%), Gaps = 9/119 (8%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQI-HWTGDEYDNMIGnnnn  272
            G +EEEKL+S N P YTPS+ E++ +VE++GSF I  LETF++ H  G   D+     ++
Sbjct  7    GHLEEEKLDSLNLPNYTPSVEEIRYIVEEEGSFEILYLETFKLRHDAGFSIDDDYQLRSH  66

Query  273  naaY--------KVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            +  Y         VA  +RAV EPIL SHFGE +I  +FHR+ K  A  +   K  + N
Sbjct  67   SQVYCDEHVRAAYVASFIRAVYEPILASHFGEAVIPHIFHRFAKNAAKLLRMGKGFFNN  125



>dbj|BAD45795.1| putative benzothiadiazole-induced S-adenosyl-L-methionine:salicylic 
acid carboxyl methyltransferase 1 [Oryza sativa Japonica 
Group]
Length=324

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VE+ KL SFN P+Y PS+ EVK+++ ++  F I+ +E F+ +W  D YD++  +  + 
Sbjct  205  GIVEKGKLESFNLPIYGPSIDEVKTVITRNKLFCIDHIELFESNW--DPYDDLEHDGMHI  262

Query  276  aaYK---VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            + ++   VA+ +RAV EP+L SHFGE I++++F R+ +I+   +++E  +Y+
Sbjct  263  SPHRGMNVAKCIRAVSEPLLASHFGEYILDKLFQRFAQIVERHLAKENVKYS  314



>ref|XP_003627283.1| Jasmonate O-methyltransferase [Medicago truncatula]
 gb|AET01759.1| salicylic acid carboxyl methyltransferase [Medicago truncatula]
Length=357

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 65/105 (62%), Gaps = 8/105 (8%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G ++E+++N+FN P Y PS  EV+  V  +GSF I  LE F+ +  G  +   +      
Sbjct  247  GIIKEDQVNTFNVPQYYPSPYEVELEVLNEGSFAINRLELFEAYVDGSNHHEYV------  300

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREK  410
              Y  AR +RA+ EP++VSHFGE IIEE+F R+ KII D + +EK
Sbjct  301  --YNAARLMRAMAEPLVVSHFGEDIIEEIFSRHQKIIIDKLPKEK  343



>gb|AAQ94895.1| putative N-methyltransferase [Coffea liberica var. dewevrei]
Length=384

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 70/120 (58%), Gaps = 11/120 (9%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-----DEYD----  248
            G +EEEKL SFN P YTPS  EVK +VE++GSF I  LETF+ H+       D+Y     
Sbjct  252  GHLEEEKLASFNLPFYTPSAEEVKCIVEEEGSFEILYLETFKAHYDAGFSIDDDYPVRSH  311

Query  249  -NMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                G+ +  A Y VA  +R+V EPIL SHFGE I+ ++FHR  K  A  +   K  Y N
Sbjct  312  FQGYGDEHIKAEY-VASLIRSVYEPILASHFGEAIMPDLFHRLAKHAAKVLRLGKGCYNN  370



>sp|Q84PP7.1|MXMT2_COFAR RecName: Full=Monomethylxanthine methyltransferase 2; Short=CaMXMT2; 
AltName: Full=7-methylxanthine N-methyltransferase 2; 
AltName: Full=Theobromine synthase 3 [Coffea arabica]
 dbj|BAC75664.1| 7-methylxanthine N-methyltransferase [Coffea arabica]
Length=384

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 71/120 (59%), Gaps = 11/120 (9%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-----DEYD----  248
            G +EEEKL SFN P +TPS  EVK +VE++GSF I  LETF+ H+       D+Y     
Sbjct  252  GHLEEEKLASFNLPFFTPSAEEVKCIVEEEGSFEILYLETFKAHYDAGFSIDDDYPVRSH  311

Query  249  -NMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              + G+ +  A Y VA  +R+V EPIL SHFGE I+ ++FHR  K  A  +   K  Y N
Sbjct  312  FQVYGDEHIKAEY-VASLIRSVYEPILASHFGEAIMPDLFHRLAKHAAKVLHLGKGCYNN  370



>ref|XP_006349443.1| PREDICTED: salicylate carboxymethyltransferase-like [Solanum 
tuberosum]
Length=354

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 73/112 (65%), Gaps = 15/112 (13%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK+ +FN P Y PSL EV  +V+K+GSFTI+ L+T ++H   D++D         
Sbjct  247  GSIEEEKVYTFNIPAYYPSLREVMYIVDKEGSFTIDILKTCELH--KDDFDE--------  296

Query  276  aaYKVARGLRAVVEPILVSHFGEG--IIEEVFHRYTKIIADSMSREKTEYTN  425
                +A+ +RA  EP+LVSHFG+   +I++VFH+  +I  + M+ EKT +TN
Sbjct  297  ---NMAQCVRAFTEPLLVSHFGDNEILIDQVFHKCREIYVNFMTIEKTTFTN  345



>sp|Q8H0G0.1|CTS2_COFAR RecName: Full=Theobromine synthase 2 [Coffea arabica]
 dbj|BAC43757.1| theobromine synthse 2 [Coffea arabica]
Length=384

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 71/120 (59%), Gaps = 11/120 (9%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-----DEYD----  248
            G +EEEKL SFN P +TPS  EVK +VE++GSF I  LETF+ H+       D+Y     
Sbjct  252  GHLEEEKLASFNLPFFTPSAEEVKCIVEEEGSFEILYLETFKAHYDAGFSIDDDYPVRSH  311

Query  249  -NMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              + G+ +  A Y VA  +R+V EPIL SHFGE I+ ++FHR  K  A  +   K  Y N
Sbjct  312  FQVYGDEHIKAEY-VASLIRSVYEPILASHFGEAIMPDLFHRLAKHAAKVLHLGKGCYNN  370



>ref|XP_007156076.1| hypothetical protein PHAVU_003G256300g [Phaseolus vulgaris]
 gb|ESW28070.1| hypothetical protein PHAVU_003G256300g [Phaseolus vulgaris]
Length=356

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 74/111 (67%), Gaps = 14/111 (13%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYD----NMIGn  263
            G ++EE+++SFN P YTPS +EV+  V K+GSF+I   E   ++W   +++      IG+
Sbjct  244  GMIKEEQVDSFNIPQYTPSPSEVELEVLKEGSFSINLSE---LNWDTLDFEPERFESIGD  300

Query  264  nnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTE  416
                    VA+ +RA+ EP+LVSHFGE IIEEVF RY +I+A  +S+EKT+
Sbjct  301  -------DVAQWMRALAEPMLVSHFGEDIIEEVFTRYKQILAHRLSKEKTQ  344



>gb|EMS44996.1| Salicylate O-methyltransferase [Triticum urartu]
Length=371

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnn--  269
            G +E  KLNSFN P Y PSL EVK ++++ G F I  +E F+ +W  D  DN   N    
Sbjct  253  GLLERGKLNSFNLPFYGPSLTEVKMVIKQSGLFDINHIELFESNW--DPRDNSESNEVHD  310

Query  270  -nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
               +   V++ LRAV+EP+  SHFGE +++ +F+++   +A+ ++REKT+Y+
Sbjct  311  PLRSGMNVSKSLRAVMEPLFTSHFGESVLDILFNKFAYNVAEHLAREKTKYS  362



>gb|AFV60440.1| 7-methylxanthine methyltransferase 2 [Coffea arabica]
 gb|AFV60448.1| 7-methylxanthine methyltransferase 2 [Coffea arabica]
Length=384

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 71/120 (59%), Gaps = 11/120 (9%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-----DEYD----  248
            G +EEEKL SFN P +TPS  EVK +VE++GSF I  LETF+ H+       D+Y     
Sbjct  252  GHLEEEKLASFNLPFFTPSAEEVKCIVEEEGSFEILYLETFKAHYDAGFSIDDDYPVRSH  311

Query  249  -NMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
              + G+ +  A Y VA  +R+V EPIL SHFGE I+ ++FHR  K  A  +   K  Y N
Sbjct  312  FQVYGDEHIKAEY-VASLIRSVYEPILASHFGEAIMPDLFHRLAKHAAKVLHLGKGCYNN  370



>ref|XP_004493098.1| PREDICTED: jasmonate O-methyltransferase-like isoform X2 [Cicer 
arietinum]
Length=368

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEKL+ F+ P Y PSL EV+ ++E +GSFT++  +TF++ W  +   +M+    ++
Sbjct  248  GLVEEEKLDLFDFPTYHPSLEEVRQIIEAEGSFTLQTTKTFKMGWDANLQKDMVDYVVDS  307

Query  276  aaYK--VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                  +A+  RAV EP+L+  FGE I++E+F R+ K+I   +  E   +TN
Sbjct  308  KMRGEFIAKYHRAVFEPLLIIAFGESIMDELFSRFAKLIGQHIELETLAFTN  359



>gb|AFV60451.1| methyltransferase-like 2 [Coffea pseudozanguebariae]
Length=385

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 9/103 (9%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +EEEKL+SFN PLYTPSL  VK +VE++GSF I  LETF++ +  G   D+     ++
Sbjct  253  GLLEEEKLDSFNLPLYTPSLEVVKCIVEEEGSFEILHLETFKVRYDAGFSIDDDYQVRSH  312

Query  273  naaYK--------VARGLRAVVEPILVSHFGEGIIEEVFHRYT  377
               Y         VA  +RAV EPIL SHFGE II ++FHR+ 
Sbjct  313  FQVYCDEHVKAAYVASFVRAVFEPILASHFGEAIIPDLFHRFA  355



>gb|EMT20993.1| Benzoate carboxyl methyltransferase [Aegilops tauschii]
Length=371

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGn---n  266
            G VE+EKL SFN P+Y PS+ EVK++V++   F +  ++ F+ +W  D YD+  GN   +
Sbjct  253  GLVEKEKLESFNLPVYGPSMDEVKAVVDQSQQFELTNIKLFETNW--DPYDDSEGNDVHD  310

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            +  +   VA  LRAV+EP+  SHFGE +++E+F ++   +A  + +EKT+Y+
Sbjct  311  SVQSGINVANCLRAVMEPLFTSHFGESVLDELFKKFAYNVALHLVKEKTKYS  362



>ref|XP_010255758.1| PREDICTED: salicylate carboxymethyltransferase-like [Nelumbo 
nucifera]
Length=376

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 71/115 (62%), Gaps = 6/115 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnn---  266
            G VEE KL+ FN P YTPS  E++  ++ +GSF I+ LETF+I W  D+ +   G +   
Sbjct  252  GLVEEAKLDCFNLPYYTPSAQEIRDTIQMEGSFRIDSLETFEISWDPDDMEEDDGEDKDF  311

Query  267  ---nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
                  +A  V + +RA+ EPIL+SHF E  ++E+F RYT  +A+ + REK ++ 
Sbjct  312  VIDTFRSAQNVTKWMRAIAEPILMSHFREVTMDELFQRYTNKVAEHLGREKGKFV  366



>ref|XP_004493097.1| PREDICTED: jasmonate O-methyltransferase-like isoform X1 [Cicer 
arietinum]
Length=378

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEKL+ F+ P Y PSL EV+ ++E +GSFT++  +TF++ W  +   +M+    ++
Sbjct  258  GLVEEEKLDLFDFPTYHPSLEEVRQIIEAEGSFTLQTTKTFKMGWDANLQKDMVDYVVDS  317

Query  276  aaYK--VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                  +A+  RAV EP+L+  FGE I++E+F R+ K+I   +  E   +TN
Sbjct  318  KMRGEFIAKYHRAVFEPLLIIAFGESIMDELFSRFAKLIGQHIELETLAFTN  369



>ref|XP_006355759.1| PREDICTED: salicylate carboxymethyltransferase-like, partial 
[Solanum tuberosum]
Length=197

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 72/115 (63%), Gaps = 17/115 (15%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG--DEYDNMIGnnn  269
            G ++E+K++SFN PLY PS  EV  +VEK+GSFTI+ L+T +IH     DE  NM+    
Sbjct  86   GSIDEKKVDSFNIPLYNPSPKEVMYIVEKEGSFTIDILKTSKIHRNSCDDEKYNMV----  141

Query  270  nnaaYKVARGLRAVVEPILVSHFG--EGIIEEVFHRYTKI-IADSMSREKTEYTN  425
                    +  R+V EP+LVSHFG  E  +++VFH+Y +I + D  ++EK  + N
Sbjct  142  --------QSFRSVAEPLLVSHFGHDELNMDQVFHKYNEIFVNDCRAKEKIMFVN  188



>gb|ABC74575.1| N-methyltransferase [Coffea canephora]
Length=378

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-----DEYDNMIG  260
            G +EEEKL+SFN P +TPS  EVK +VE++GS  I  LETF+ H+       D+Y   + 
Sbjct  252  GLLEEEKLDSFNIPFFTPSAEEVKCIVEEEGSCEILNLETFKAHYDAAFSIDDDYP--VR  309

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            ++    A  VA  +R+V EPIL SHFGE I+ ++FHR  K  A  +   K  Y N
Sbjct  310  SHEQIKAEYVASLIRSVYEPILASHFGEAIMPDLFHRLAKHAAKVLHMGKGCYNN  364



>ref|XP_010266334.1| PREDICTED: jasmonate O-methyltransferase-like [Nelumbo nucifera]
Length=379

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G VEEEKL+SFN P Y PS  E+KS +EK+GSF ++CLE+  + W+ D+  +        
Sbjct  264  GIVEEEKLDSFNAPFYAPSAEEIKSEIEKNGSFELDCLESMALDWSQDQEKDECD--KLT  321

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKII  386
             A  +AR +RAV E +L +HFGE +++ ++ R+  ++
Sbjct  322  KALGLARAIRAVSESMLQNHFGEEVMDRLYQRFGHLL  358



>gb|AAY56107.1| N-methyltransferase [Coffea canephora]
 gb|AFV60435.1| 7-methylxanthine methyltransferase 1 [Coffea canephora]
 gb|AFV60445.1| 7-methylxanthine methyltransferase 1 [Coffea canephora]
 emb|CDP21124.1| unnamed protein product [Coffea canephora]
Length=378

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-----DEYDNMIG  260
            G +EEEKL+SFN P +TPS  EVK +VE++GS  I  LETF+ H+       D+Y   + 
Sbjct  252  GLLEEEKLDSFNIPFFTPSAEEVKCIVEEEGSCEILYLETFKAHYDAAFSIDDDYP--VT  309

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            ++    A  VA  +R+V EPIL SHFGE I+ ++FHR  K  A  +   K  Y N
Sbjct  310  SHEQIKAEYVASLIRSVYEPILASHFGEAIMPDLFHRLAKHAAKVLHMGKGCYNN  364



>ref|XP_007156073.1| hypothetical protein PHAVU_003G256100g [Phaseolus vulgaris]
 gb|ESW28067.1| hypothetical protein PHAVU_003G256100g [Phaseolus vulgaris]
Length=359

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 74/111 (67%), Gaps = 11/111 (10%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYD----NMIGn  263
            G ++EE+++SFN P YTPS +EV+  V  +GSF+I  LE  +++    +++      IG+
Sbjct  244  GMIKEEQVDSFNIPQYTPSPSEVELEVLNEGSFSINRLEVSEMNRDTLDFEPERFESIGD  303

Query  264  nnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTE  416
                    VA+ +RA+ EP+LVSHFGE IIEEVF RY +I+A  +S+EKT+
Sbjct  304  -------DVAQWMRALAEPMLVSHFGEDIIEEVFTRYKQILAHRLSKEKTQ  347



>gb|AAW66849.1| SAMT [Anthocercis littorea]
Length=287

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 70/118 (59%), Gaps = 7/118 (6%)
 Frame = +3

Query  3    FLETNCHDLCIYSFSFLL*VTCIAKSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEK  182
            FL     D C     ++  +  +A +  ++ G +EEEK++SFN P YTPS  EVK +VEK
Sbjct  176  FLGRESEDACSKECCYIWELLAMALNELVVEGLIEEEKVDSFNIPQYTPSPVEVKYVVEK  235

Query  183  DGSFTIECLETFQIHWTGDEYDNMIGnnnnnaaYKVARGLRAVVEPILVSHFGEGIIE  356
            +GSF+I  LE  ++HW   + +N  G       Y V+R +RAV EP+LVS FG  +++
Sbjct  236  EGSFSINHLEATRVHWNASD-ENFNG------GYNVSRCMRAVAEPLLVSQFGNDLMD  286



>gb|AAM18503.1|AF494413_1 N-methyltransferase [Coffea arabica]
Length=378

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-----DEYDNMIG  260
            G +EEEKL+SFN P +TPS  EVK +VE++GS  I  LETF+ H+       D+Y   + 
Sbjct  252  GLLEEEKLDSFNIPFFTPSAEEVKCIVEEEGSCEILYLETFKAHYDAAFSIDDDYP--VR  309

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            ++    A  VA  +R+V EPIL SHFGE I+ ++FHR  K  A  +   K  Y N
Sbjct  310  SHEQIKAEYVASLIRSVYEPILASHFGEAIMPDLFHRLAKHAAKVLHMGKGCYNN  364



>sp|Q9AVJ9.1|MXMT1_COFAR RecName: Full=Monomethylxanthine methyltransferase 1; Short=CaMXMT1; 
AltName: Full=Theobromine synthase 1 [Coffea arabica]
 gb|AAM18501.1|AF494411_1 N-methyltransferase [Coffea arabica]
 gb|AAM18504.1|AF494414_1 N-methyltransferase [Coffea canephora]
 dbj|BAB39216.1| 7-methylxanthine N-methyltransferase [Coffea arabica]
 gb|AAQ16155.1| putative caffeine synthase [Coffea canephora]
 gb|ADR30039.1| 7-methylxanthine N-methyl transferase [Coffea canephora]
 gb|AFV60439.1| 7-methylxanthine methyltransferase 1 [Coffea arabica]
 gb|AFV60447.1| 7-methylxanthine methyltransferase 1 [Coffea arabica]
Length=378

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-----DEYDNMIG  260
            G +EEEKL+SFN P +TPS  EVK +VE++GS  I  LETF+ H+       D+Y   + 
Sbjct  252  GLLEEEKLDSFNIPFFTPSAEEVKCIVEEEGSCEILYLETFKAHYDAAFSIDDDYP--VR  309

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            ++    A  VA  +R+V EPIL SHFGE I+ ++FHR  K  A  +   K  Y N
Sbjct  310  SHEQIKAEYVASLIRSVYEPILASHFGEAIMPDLFHRLAKHAAKVLHMGKGCYNN  364



>ref|XP_006471194.1| PREDICTED: benzoate carboxyl methyltransferase-like [Citrus sinensis]
Length=371

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 68/110 (62%), Gaps = 2/110 (2%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW--TGDEYDNMIGnnn  269
            G VEE  ++SFN P Y P   EVKS+V + GSF ++  E+F+++W  + D  +     N 
Sbjct  243  GLVEEADVDSFNMPCYFPYEGEVKSIVREQGSFNLDTFESFKVNWDPSDDVNNKSFVFNK  302

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEY  419
            +     VA  +RAV EP+L SHFG  +I+ +F R+  ++A+ ++ EKT++
Sbjct  303  DRCGQNVANSIRAVTEPMLASHFGNAVIDPLFARFATLVAEHLAVEKTKH  352



>ref|XP_009776652.1| PREDICTED: salicylate/benzoate carboxyl methyltransferase-like 
[Nicotiana sylvestris]
Length=315

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 83/137 (61%), Gaps = 21/137 (15%)
 Frame = +3

Query  75   KSVALM*GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIH---------  227
            K +A M G +EEEK+NSFN P+Y  S AEVK +VEK+GSFTI+ LET ++H         
Sbjct  171  KELAAM-GLIEEEKVNSFNIPIYHLSPAEVKYIVEKEGSFTIDVLETSELHIDVSDETCS  229

Query  228  ---WTGDEYDNMIGnnnnnaaYK-------VARGLRAVVEPILVSHFGEGI-IEEVFHRY  374
                +G + D+ +  +   A  +       +A  LR + EP+LVSHFG  + +++VF++ 
Sbjct  230  NTGRSGVQSDSHLCKDREKATPRDCINSDNMANSLRPLAEPLLVSHFGTELNMDQVFNKC  289

Query  375  TKIIADSMSREKTEYTN  425
             +I  + M++EKT +TN
Sbjct  290  REIFVNCMAKEKTTFTN  306



>ref|XP_008388029.1| PREDICTED: jasmonate O-methyltransferase-like isoform X1 [Malus 
domestica]
Length=367

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 73/110 (66%), Gaps = 5/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +EEEK++SFN P Y PS  E+K  +EK+GSF I+ LE F+I W G    +++ +    
Sbjct  254  GLIEEEKVDSFNLPYYVPSEEELKMELEKEGSFIIDRLEAFEIDWDGGAEISVVASGQ--  311

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               +VA+ +RAVVE ++ SHFG  I++++F RY +++AD  S+ +T+  N
Sbjct  312  ---RVAKTIRAVVESMIESHFGNDIMDDLFRRYAELVADHFSKSRTKLLN  358



>dbj|BAC43756.1| theobromine synthase 1 [Coffea arabica]
Length=378

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG-----DEYDNMIG  260
            G +EEEKL+SFN P +TPS  EVK +VE++GS  I  LETF+ H+       D+Y   + 
Sbjct  252  GLLEEEKLDSFNIPFFTPSAEEVKCIVEEEGSCEILYLETFKAHYDAAFSIDDDYP--VR  309

Query  261  nnnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
            ++    A  VA  +R+V EPIL SHFGE I+ ++FHR  K  A  +   K  Y N
Sbjct  310  SHEQIKAEYVASLIRSVYEPILASHFGEAIMPDLFHRLAKHAAKVLHMGKGCYNN  364



>gb|EAZ00319.1| hypothetical protein OsI_22336 [Oryza sativa Indica Group]
Length=376

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIG---nn  266
            G VE+EKL+SFN P+Y PS+ E++ +V +D  F ++ +  F+ +W  D YD+  G   ++
Sbjct  256  GLVEKEKLDSFNLPMYGPSVGELEEIVNRDNLFDMDHMHLFECNW--DPYDDSQGDIVHD  313

Query  267  nnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYT  422
            + ++   VA  +RAV EP++ SHFGEGI+  +F  Y   +A  +  EKT++ 
Sbjct  314  SASSGINVANCVRAVTEPLIASHFGEGILSALFTDYAHRVASHLEMEKTKFA  365



>gb|AFQ98271.1| salicylic acid carboxyl methltransferase [Camellia sinensis]
Length=365

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 70/109 (64%), Gaps = 4/109 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDN--MIGnnn  269
            G V++E ++SFN P Y P   EVK+++EK+GSF +E LE  +  W   +YD+      + 
Sbjct  247  GLVQKEAIDSFNFPFYYPYKDEVKAIIEKEGSFNLERLEVSE--WDAIDYDDDEHFVFDK  304

Query  270  nnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTE  416
            +     VA  +RAV EP+LVSHFGE I+++VF ++T  +AD +  EK++
Sbjct  305  DRNGKNVANCVRAVTEPLLVSHFGEFIVDDVFKKFTNYVADHLCSEKSD  353



>gb|AFV60441.1| methyltransferase-like 3 [Coffea arabica]
Length=385

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +EEEKL+SFN PLYTPSL  VK +VE++GSF I  LETF++ +  G   D+     + 
Sbjct  253  GLLEEEKLDSFNLPLYTPSLEVVKCIVEEEGSFEILYLETFKVRYDAGFSIDDDYQVRSL  312

Query  273  naaYK--------VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSM  398
               Y         V    RAV EPIL SHFGE I+ ++FHR+ K  A ++
Sbjct  313  FQVYCDEHVKAAYVTFFFRAVFEPILASHFGEAIMPDLFHRFAKNAAKAL  362



>gb|AFV60436.1| methyltransferase-like 2 [Coffea canephora]
Length=385

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +EEEKL+SFN PLYTPSL  VK +VE++GSF I  LETF++ +  G   D+     + 
Sbjct  253  GLLEEEKLDSFNLPLYTPSLEVVKCIVEEEGSFEILYLETFKVRYDAGFSIDDDYQVRSL  312

Query  273  naaYK--------VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSM  398
               Y         V    RAV EPIL SHFGE I+ ++FHR+ K  A ++
Sbjct  313  FQVYCDEHVKAAYVTFFFRAVFEPILASHFGEAIMPDLFHRFAKNAAKAL  362



>ref|XP_010690843.1| PREDICTED: salicylate carboxymethyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=363

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 68/110 (62%), Gaps = 5/110 (5%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTGDEYDNMIGnnnnn  275
            G +E+EKL+ F+ P Y P+L EV+ LVE +GS++I  LETF + W+ D   ++       
Sbjct  248  GIIEQEKLDRFDMPFYAPTLEEVRKLVEAEGSYSINKLETFTVDWSVDTNQSLNNRAKF-  306

Query  276  aaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
                VA+ +RAV E IL + FGE ++ ++F  +   + + M++E++EY N
Sbjct  307  ----VAKTIRAVTESILATAFGEAVMNDLFVMFEMRVKERMAQERSEYLN  352



>ref|XP_010536341.1| PREDICTED: jasmonate O-methyltransferase-like [Tarenaya hassleriana]
Length=374

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 67/114 (59%), Gaps = 4/114 (4%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHWTG----DEYDNMIGn  263
            G +EEEK+++FN P Y P   EVK  VE +GSF I+ LET +I W G      Y N   +
Sbjct  252  GIIEEEKIDTFNAPYYAPWSEEVKMEVETEGSFAIDRLETMEIDWEGFVVEKSYKNKSES  311

Query  264  nnnnaaYKVARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSMSREKTEYTN  425
               ++  +VA  +RAVVE +L SHFG  +++E+F R+  I+ D + +    + N
Sbjct  312  EAFSSGRRVANTVRAVVESMLQSHFGGNVMDELFQRFGGIVGDYIYKRTARFCN  365



>emb|CDP12639.1| unnamed protein product [Coffea canephora]
Length=385

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = +3

Query  96   GFVEEEKLNSFNTPLYTPSLAEVKSLVEKDGSFTIECLETFQIHW-TGDEYDNMIGnnnn  272
            G +EEEKL+SFN PLYTPSL  VK +VE++GSF I  LETF++ +  G   D+     + 
Sbjct  253  GLLEEEKLDSFNLPLYTPSLEVVKCIVEEEGSFEILYLETFKVRYDAGFSIDDDYQVRSL  312

Query  273  naaYK--------VARGLRAVVEPILVSHFGEGIIEEVFHRYTKIIADSM  398
               Y         V    RAV EPIL SHFGE I+ ++FHR+ K  A ++
Sbjct  313  FQVYCDEHVKAAYVTFFFRAVFEPILASHFGEAIMPDLFHRFAKNAAKAL  362



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1899776125104