BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82153_g1_i1 len=494 path=[472:0-493]

Length=494
                                                                      Score     E

gb|ACU23499.1|  unknown                                                 146   5e-41   Glycine max [soybeans]
emb|CDP13223.1|  unnamed protein product                                153   5e-41   
ref|XP_010528102.1|  PREDICTED: LOW QUALITY PROTEIN: inorganic ph...    153   1e-40   
ref|XP_011034088.1|  PREDICTED: inorganic phosphate transporter 2...    149   1e-40   
gb|EYU30636.1|  hypothetical protein MIMGU_mgv1a003474mg                153   2e-40   
ref|XP_008389727.1|  PREDICTED: inorganic phosphate transporter 2...    153   2e-40   
ref|XP_010556336.1|  PREDICTED: inorganic phosphate transporter 2...    153   2e-40   
ref|XP_002875322.1|  PHT2_1                                             153   2e-40   
ref|XP_008340104.1|  PREDICTED: inorganic phosphate transporter 2...    153   2e-40   
ref|NP_001275167.1|  chloroplast phosphate transporter precursor        152   5e-40   
ref|XP_010100402.1|  Inorganic phosphate transporter 2-1                152   5e-40   
ref|XP_004309979.1|  PREDICTED: inorganic phosphate transporter 2...    152   6e-40   
ref|XP_004239128.1|  PREDICTED: inorganic phosphate transporter 2...    152   6e-40   
ref|NP_850633.1|  inorganic phosphate transporter 2-1                   151   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425359.1|  PREDICTED: inorganic phosphate transporter 2...    151   8e-40   
emb|CBI18644.3|  unnamed protein product                                149   8e-40   
ref|XP_010514299.1|  PREDICTED: inorganic phosphate transporter 2...    151   8e-40   
ref|XP_010502586.1|  PREDICTED: inorganic phosphate transporter 2...    151   8e-40   
ref|NP_189289.2|  inorganic phosphate transporter 2-1                   151   9e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390797.1|  PREDICTED: inorganic phosphate transporter 2...    151   9e-40   
ref|XP_010514300.1|  PREDICTED: inorganic phosphate transporter 2...    151   1e-39   
ref|XP_010502587.1|  PREDICTED: inorganic phosphate transporter 2...    151   1e-39   
ref|XP_006395545.1|  hypothetical protein EUTSA_v10003891mg             151   1e-39   
ref|XP_009758601.1|  PREDICTED: inorganic phosphate transporter 2...    150   1e-39   
ref|NP_001288019.1|  inorganic phosphate transporter 2-1, chlorop...    150   2e-39   
ref|XP_009152045.1|  PREDICTED: inorganic phosphate transporter 2...    150   2e-39   
gb|KFK33583.1|  hypothetical protein AALP_AA5G032600                    150   2e-39   
emb|CDY13641.1|  BnaA06g32820D                                          150   2e-39   
emb|CDX83625.1|  BnaC07g23650D                                          150   2e-39   
ref|XP_006290779.1|  hypothetical protein CARUB_v10016883mg             150   2e-39   
ref|XP_002311765.2|  hypothetical protein POPTR_0008s19070g             150   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006290778.1|  hypothetical protein CARUB_v10016883mg             150   2e-39   
ref|XP_004509674.1|  PREDICTED: inorganic phosphate transporter 2...    150   2e-39   
ref|XP_008446164.1|  PREDICTED: inorganic phosphate transporter 2...    150   2e-39   
ref|XP_008221913.1|  PREDICTED: inorganic phosphate transporter 2...    150   3e-39   
ref|XP_007221992.1|  hypothetical protein PRUPE_ppa003252mg             150   3e-39   
ref|XP_009121505.1|  PREDICTED: inorganic phosphate transporter 2...    150   3e-39   
ref|XP_002271876.1|  PREDICTED: inorganic phosphate transporter 2...    149   3e-39   Vitis vinifera
emb|CDY56366.1|  BnaAnng14200D                                          149   3e-39   
emb|CDY00190.1|  BnaC09g01110D                                          149   4e-39   
ref|XP_002527931.1|  chloroplast phosphate transporter, putative        149   4e-39   Ricinus communis
emb|CAN65936.1|  hypothetical protein VITISV_008965                     149   5e-39   Vitis vinifera
ref|XP_002314598.2|  hypothetical protein POPTR_0010s05630g             149   6e-39   Populus trichocarpa [western balsam poplar]
gb|KDP26660.1|  hypothetical protein JCGZ_17818                         149   6e-39   
gb|AIY24428.1|  phosphate transporter                                   149   6e-39   
ref|XP_010023470.1|  PREDICTED: inorganic phosphate transporter 2...    149   6e-39   
ref|XP_009613955.1|  PREDICTED: inorganic phosphate transporter 2...    148   1e-38   
ref|XP_009359216.1|  PREDICTED: inorganic phosphate transporter 2...    148   1e-38   
ref|XP_009600316.1|  PREDICTED: inorganic phosphate transporter 2...    148   1e-38   
ref|XP_011045259.1|  PREDICTED: inorganic phosphate transporter 2...    148   1e-38   
ref|XP_007044798.1|  Phosphate transporter 2,1                          147   2e-38   
gb|KHN13437.1|  Inorganic phosphate transporter 2-1, chloroplastic      146   3e-38   
ref|XP_006852318.1|  hypothetical protein AMTR_s00049p00201160          147   3e-38   
ref|XP_010248637.1|  PREDICTED: inorganic phosphate transporter 2...    147   3e-38   
ref|XP_003551229.1|  PREDICTED: inorganic phosphate transporter 2...    147   3e-38   
ref|XP_006438300.1|  hypothetical protein CICLE_v10031076mg             146   4e-38   
gb|KCW86657.1|  hypothetical protein EUGRSUZ_B03285                     145   5e-38   
ref|XP_003530627.1|  PREDICTED: inorganic phosphate transporter 2...    146   7e-38   
ref|XP_010682445.1|  PREDICTED: inorganic phosphate transporter 2...    146   7e-38   
ref|XP_007153787.1|  hypothetical protein PHAVU_003G064900g             145   7e-38   
gb|EMS65187.1|  Inorganic phosphate transporter 2-1, chloroplastic      145   8e-38   
ref|NP_001047299.1|  Os02g0593500                                       145   9e-38   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD16885.1|  putative phosphate transporter 2-1                     145   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010046635.1|  PREDICTED: inorganic phosphate transporter 2...    145   1e-37   
emb|CAD36013.1|  phosphate hydrogen transporter                         145   2e-37   Spinacia oleracea
dbj|BAJ87247.1|  predicted protein                                      144   2e-37   
gb|AAB41897.1|  putative phosphate permease                             144   2e-37   Mesembryanthemum crystallinum
gb|EMT15257.1|  Inorganic phosphate transporter 2-1, chloroplastic      143   3e-37   
ref|XP_003628943.1|  Inorganic phosphate transporter 2-1                144   4e-37   
gb|AGJ84129.1|  phosphate transporter 2-1                               144   4e-37   
gb|EPS62117.1|  hypothetical protein M569_12675                         143   5e-37   
ref|XP_006647444.1|  PREDICTED: inorganic phosphate transporter 2...    143   8e-37   
ref|NP_001168344.1|  hypothetical protein                               143   8e-37   Zea mays [maize]
ref|XP_003575270.1|  PREDICTED: inorganic phosphate transporter 2...    142   1e-36   
ref|XP_002452373.1|  hypothetical protein SORBIDRAFT_04g024630          142   2e-36   Sorghum bicolor [broomcorn]
ref|XP_010906717.1|  PREDICTED: inorganic phosphate transporter 2...    142   2e-36   
ref|XP_008809567.1|  PREDICTED: LOW QUALITY PROTEIN: inorganic ph...    141   3e-36   
ref|XP_004952958.1|  PREDICTED: inorganic phosphate transporter 2...    140   1e-35   
ref|XP_001777366.1|  predicted protein                                  138   3e-35   
ref|XP_002973893.1|  hypothetical protein SELMODRAFT_149470             136   1e-34   
ref|XP_002969168.1|  hypothetical protein SELMODRAFT_11493              136   1e-34   
ref|XP_009765547.1|  PREDICTED: LOW QUALITY PROTEIN: inorganic ph...    135   3e-34   
ref|XP_011086632.1|  PREDICTED: inorganic phosphate transporter 2...    133   3e-33   
gb|AAP49821.1|  phosphate transporter 2-1                               127   5e-31   Triticum aestivum [Canadian hard winter wheat]
gb|KHE92769.1|  hypothetical protein SCABRO_01497                       112   4e-26   
ref|WP_034404278.1|  hypothetical protein                               112   4e-26   
ref|WP_032124582.1|  inorganic phosphate transporter                    108   1e-24   
ref|XP_011071298.1|  PREDICTED: inorganic phosphate transporter 2...    108   2e-24   
ref|WP_036989255.1|  phosphate permease                                 106   5e-24   
emb|CDR34622.1|  Putative inorganic phosphate transporter               106   8e-24   
ref|WP_015506492.1|  Phosphate transporter family protein               105   1e-23   
ref|WP_015506335.1|  Phosphate transporter family protein               105   1e-23   
ref|WP_009873301.1|  phosphate permease                                 104   1e-23   
ref|WP_014541189.1|  phosphate permease                                 104   2e-23   
ref|WP_011324832.1|  phosphate permease                                 104   2e-23   
ref|WP_013181393.1|  inorganic phosphate transporter                    105   2e-23   
ref|WP_009872067.1|  phosphate permease                                 104   2e-23   
ref|WP_009872855.1|  phosphate permease                                 104   2e-23   
ref|WP_011174649.1|  hypothetical protein                               104   2e-23   
ref|WP_009020891.1|  phosphate permease                                 103   3e-23   
ref|WP_025567928.1|  phosphate permease                                 103   4e-23   
ref|WP_007236028.1|  phosphate permease                                 102   9e-23   
ref|WP_029756545.1|  hypothetical protein                               103   9e-23   
ref|WP_015590036.1|  Phosphate/sulfate permease                         102   9e-23   
emb|CEA03315.1|  phosphate transporter                                  102   1e-22   
ref|WP_017678384.1|  MULTISPECIES: phosphate permease                   102   2e-22   
gb|KFJ93031.1|  phosphate permease                                      102   2e-22   
emb|CDI93807.1|  putative phosphate transporter                       97.8    2e-22   
ref|WP_018013550.1|  phosphate permease                                 101   2e-22   
ref|WP_015820810.1|  phosphate permease                                 101   2e-22   
ref|WP_018275628.1|  phosphate permease                                 101   2e-22   
gb|EGG98659.1|  putative low-affinity inorganic phosphate transpo...    100   2e-22   
ref|WP_008927940.1|  phosphate permease                                 101   2e-22   
ref|WP_013713562.1|  phosphate permease                                 101   3e-22   
ref|WP_027707159.1|  phosphate permease                                 101   3e-22   
ref|WP_018041021.1|  hypothetical protein                               101   3e-22   
ref|WP_011589579.1|  MULTISPECIES: phosphate permease                   101   3e-22   
ref|WP_024306479.1|  phosphate permease                                 101   3e-22   
ref|WP_037003569.1|  phosphate permease                                 101   3e-22   
ref|WP_004373238.1|  phosphate permease                                 101   3e-22   
emb|CDZ80777.1|  Low-affinity inorganic phosphate transporter 1         101   3e-22   
ref|WP_037024348.1|  phosphate permease                                 100   4e-22   
gb|KIC72598.1|  putative phosphate permease                             101   4e-22   
ref|WP_039383633.1|  inorganic phosphate transporter                    101   4e-22   
ref|WP_008252717.1|  phosphate permease                                 100   5e-22   
ref|WP_013789633.1|  phosphate permease                                 100   5e-22   
ref|WP_014854535.1|  phosphate permease                                 100   5e-22   
ref|WP_027908810.1|  phosphate permease                                 100   5e-22   
ref|WP_027903817.1|  phosphate permease                                 100   5e-22   
ref|WP_007231211.1|  phosphate permease                                 100   6e-22   
ref|WP_022959082.1|  phosphate permease                                 100   6e-22   
ref|WP_022961738.1|  phosphate permease                                 100   7e-22   
ref|WP_027874775.1|  phosphate permease                               99.8    1e-21   
ref|WP_021205132.1|  phosphate permease                               98.2    1e-21   
ref|WP_035234414.1|  phosphate permease                               99.8    1e-21   
ref|WP_022984745.1|  phosphate permease                               99.8    1e-21   
gb|EPJ24472.1|  phosphate transporter family protein                  97.4    1e-21   
ref|WP_039607189.1|  phosphate permease                               99.8    1e-21   
ref|WP_026377419.1|  inorganic phosphate transporter PiT family p...  99.8    1e-21   
ref|WP_007639810.1|  phosphate permease                               99.4    1e-21   
ref|WP_018624110.1|  phosphate permease                               99.4    1e-21   
ref|WP_019340863.1|  phosphate permease                               99.4    2e-21   
ref|WP_028671827.1|  phosphate permease                               99.4    2e-21   
gb|ERI52000.1|  phosphate permease                                    99.0    2e-21   
ref|WP_001888859.1|  Phosphate/sulphate permeases                     95.1    2e-21   
ref|WP_022967481.1|  phosphate permease                               99.0    2e-21   
ref|WP_028490174.1|  phosphate permease                               99.0    2e-21   
ref|WP_003286754.1|  phosphate permease                               99.0    2e-21   
ref|WP_029866569.1|  phosphate permease                               94.0    2e-21   
ref|WP_031303133.1|  phosphate permease                               99.0    2e-21   
ref|WP_007224135.1|  phosphate permease                               99.0    2e-21   
ref|WP_015781167.1|  phosphate permease                               99.0    2e-21   
ref|WP_007150635.1|  phosphate permease                               99.0    2e-21   
ref|WP_039562486.1|  phosphate permease                               99.0    2e-21   
ref|WP_027949922.1|  phosphate permease                               99.0    2e-21   
ref|WP_011458489.1|  phosphate permease                               98.6    3e-21   
ref|WP_021828834.1|  phosphate transporter family protein             98.6    3e-21   
dbj|BAP77709.1|  Pho4 family protein                                  98.6    3e-21   
ref|WP_039806343.1|  phosphate permease                               98.2    3e-21   
ref|WP_000585185.1|  hypothetical protein                             95.5    3e-21   
gb|ETR80606.1|  putative low-affinity inorganic phosphate transpo...  97.1    4e-21   
ref|WP_002537644.1|  putative low-affinity inorganic phosphate tr...  98.2    4e-21   
ref|WP_012486161.1|  phosphate permease                               98.2    4e-21   
ref|WP_027591423.1|  phosphate permease                               98.2    4e-21   
gb|KGK85278.1|  phosphate permease                                    98.2    4e-21   
ref|WP_035245243.1|  phosphate permease                               98.2    4e-21   
ref|WP_008569404.1|  phosphate permease                               98.2    4e-21   
ref|WP_012940626.1|  phosphate permease                               97.4    4e-21   
ref|WP_035015039.1|  inorganic phosphate transporter PiT family p...  98.2    4e-21   
ref|WP_020414287.1|  phosphate permease                               98.2    4e-21   
ref|WP_008044323.1|  phosphate permease                               98.2    4e-21   
ref|WP_029890723.1|  phosphate permease                               97.8    4e-21   
ref|WP_015048026.1|  phosphate permease                               98.2    5e-21   
ref|WP_005571961.1|  hypothetical protein                             95.1    5e-21   
gb|ERS10161.1|  phosphate permease                                    97.8    5e-21   
ref|WP_014945700.1|  phosphate permease                               97.8    5e-21   
ref|WP_020370780.1|  MULTISPECIES: phosphate transporter family p...  97.8    6e-21   
ref|WP_033942028.1|  phosphate permease                               97.8    6e-21   
ref|WP_019528804.1|  phosphate permease                               97.8    6e-21   
ref|WP_026948531.1|  MULTISPECIES: phosphate permease                 97.8    6e-21   
ref|WP_011911511.1|  phosphate permease                               97.4    6e-21   
ref|WP_034069730.1|  phosphate permease                               97.4    6e-21   
ref|WP_034019403.1|  phosphate permease                               97.4    6e-21   
ref|WP_014993005.1|  phosphate permease                               97.4    6e-21   
ref|WP_023087900.1|  phosphate transporter                            97.4    7e-21   
ref|WP_025164044.1|  phosphate permease                               97.4    7e-21   
ref|WP_031689475.1|  phosphate permease                               97.4    7e-21   
ref|WP_008739393.1|  phosphate permease                               97.4    7e-21   
ref|WP_031653120.1|  phosphate permease                               97.4    7e-21   
ref|WP_003096269.1|  phosphate permease                               97.4    7e-21   
ref|WP_010489432.1|  phosphate permease                               97.4    7e-21   
ref|WP_030047074.1|  phosphate permease                               97.4    7e-21   
emb|CEG54081.1|  putative phosphate permease HI_1604                  97.4    7e-21   
ref|WP_016401669.1|  probable low-affinity inorganic phosphate tr...  97.4    7e-21   
ref|WP_034069148.1|  phosphate permease                               97.4    7e-21   
ref|WP_031628724.1|  phosphate permease                               97.4    7e-21   
ref|WP_023092740.1|  phosphate transporter                            97.4    7e-21   
ref|WP_023111981.1|  phosphate transporter                            97.4    7e-21   
ref|WP_003100079.1|  MULTISPECIES: phosphate permease                 97.4    7e-21   
ref|WP_034001041.1|  phosphate permease                               97.4    7e-21   
ref|WP_033983828.1|  phosphate permease                               97.4    7e-21   
ref|WP_023113490.1|  phosphate transporter                            97.4    7e-21   
ref|WP_003296844.1|  phosphate transporter                            97.4    7e-21   
ref|WP_033973377.1|  phosphate permease                               97.4    7e-21   
ref|WP_010793664.1|  MULTISPECIES: hypothetical protein               97.4    7e-21   
ref|WP_034076464.1|  phosphate permease                               97.4    7e-21   
ref|WP_033993377.1|  phosphate permease                               97.4    7e-21   
ref|WP_004347426.1|  phosphate permease                               97.4    7e-21   
ref|WP_003120395.1|  phosphate permease                               97.4    7e-21   
ref|WP_003109992.1|  phosphate permease                               97.4    7e-21   
ref|WP_011006033.1|  phosphate permease                               97.4    7e-21   
ref|WP_003298935.1|  phosphate transporter                            97.4    7e-21   
ref|WP_039027749.1|  phosphate permease                               97.4    7e-21   
ref|WP_034016160.1|  phosphate permease                               97.4    7e-21   
ref|WP_033944845.1|  phosphate permease                               97.4    7e-21   
ref|WP_023117945.1|  phosphate transporter                            97.4    7e-21   
ref|WP_023107373.1|  phosphate transporter                            97.4    7e-21   
ref|WP_023447040.1|  phosphate permease                               97.4    7e-21   
ref|WP_039699136.1|  phosphate permease                               97.4    7e-21   
ref|WP_037050236.1|  phosphate permease                               97.4    7e-21   
ref|WP_023098220.1|  phosphate transporter                            97.4    7e-21   
ref|WP_003118032.1|  phosphate permease                               97.4    7e-21   
gb|KGB88644.1|  phosphate permease                                    97.4    7e-21   
ref|WP_019486462.1|  phosphate permease                               97.4    7e-21   
ref|WP_024917729.1|  phosphate permease                               97.4    7e-21   
ref|WP_014943633.1|  phosphate permease                               97.4    7e-21   
ref|WP_036750028.1|  phosphate permease                               97.4    8e-21   
ref|WP_023103586.1|  phosphate transporter                            97.4    8e-21   
ref|WP_006342736.1|  phosphate permease                               97.4    8e-21   
ref|WP_021020528.1|  phosphate permease                               97.4    8e-21   
ref|WP_014821981.1|  phosphate permease                               97.4    8e-21   
gb|ETV55287.1|  phosphate transporter                                 97.4    8e-21   
ref|WP_016958965.1|  phosphate permease                               97.4    8e-21   
ref|WP_033985201.1|  phosphate permease                               97.4    8e-21   
ref|WP_012614660.1|  phosphate permease                               97.4    8e-21   
ref|WP_009314471.1|  MULTISPECIES: phosphate permease                 97.4    8e-21   
ref|WP_034844020.1|  phosphate permease                               97.4    8e-21   
ref|WP_010895353.1|  phosphate permease                               97.4    8e-21   
ref|WP_014517520.1|  phosphate permease                               97.4    8e-21   
ref|WP_014946393.1|  phosphate permease                               97.4    8e-21   
gb|AHK63711.1|  Putative phosphate permease                           97.4    8e-21   
gb|AJE17125.1|  phosphate permease                                    97.4    8e-21   
ref|WP_014595539.1|  phosphate permease                               97.4    8e-21   
ref|WP_031769374.1|  phosphate permease                               97.4    8e-21   
ref|WP_010883318.1|  phosphate permease                               97.4    8e-21   
ref|WP_020584212.1|  phosphate permease                               97.4    8e-21   
ref|WP_005504008.1|  phosphate permease                               97.1    9e-21   
ref|WP_013942648.1|  putative phosphate permease                      97.8    9e-21   
ref|WP_027852034.1|  phosphate permease                               97.1    9e-21   
ref|WP_013981431.1|  phosphate permease                               97.1    9e-21   
ref|WP_038501115.1|  phosphate permease                               97.4    9e-21   
ref|WP_028241721.1|  phosphate permease                               97.1    9e-21   
ref|WP_021206243.1|  phosphate permease                               97.1    1e-20   
ref|WP_036817479.1|  phosphate permease                               97.1    1e-20   
ref|WP_014944689.1|  phosphate permease                               97.1    1e-20   
ref|WP_032074767.1|  phosphate permease                               97.1    1e-20   
ref|WP_012220885.1|  phosphate permease                               97.1    1e-20   
ref|WP_003281044.1|  phosphate permease                               97.1    1e-20   
ref|WP_011096804.1|  phosphate permease                               97.1    1e-20   
ref|WP_038664386.1|  phosphate permease                               97.1    1e-20   
gb|EUC25238.1|  phosphate transporter family protein                  92.8    1e-20   
ref|WP_009574575.1|  phosphate permease                               97.1    1e-20   
ref|WP_012569689.1|  phosphate permease                               97.1    1e-20   
ref|WP_020355765.1|  phosphate transporter family protein             97.1    1e-20   
ref|WP_028305351.1|  phosphate permease                               97.1    1e-20   
ref|WP_028116035.1|  inorganic phosphate transporter PiT family p...  97.1    1e-20   
ref|WP_010957326.1|  phosphate permease                               96.7    1e-20   
ref|WP_006343736.1|  phosphate permease                               97.1    1e-20   
gb|ADI23268.1|  phosphate/sulphate permeases                          97.1    1e-20   
ref|WP_008933136.1|  phosphate permease                               96.7    1e-20   
ref|WP_007467650.1|  Putative low-affinity inorganic phosphate tr...  96.7    1e-20   
ref|WP_008486999.1|  phosphate permease                               96.7    1e-20   
ref|WP_015278653.1|  phosphate/sulfate permease                       96.7    1e-20   
ref|WP_005772656.1|  phosphate permease                               96.7    1e-20   
ref|WP_005369823.1|  phosphate permease                               96.7    1e-20   
ref|WP_006646109.1|  phosphate permease                               96.7    1e-20   
emb|CDH73953.1|  phosphate transporter                                98.6    1e-20   
emb|CED70455.1|  putative phosphate transporter                       96.7    1e-20   
ref|WP_005301394.1|  phosphate permease                               96.7    2e-20   
ref|WP_008989793.1|  phosphate permease                               96.7    2e-20   
ref|WP_037041945.1|  phosphate permease                               96.7    2e-20   
ref|WP_031829548.1|  phosphate permease                               93.6    2e-20   
ref|WP_033966478.1|  phosphate permease                               96.7    2e-20   
ref|WP_033093289.1|  inorganic phosphate transporter PiT family p...  96.7    2e-20   
ref|WP_033081199.1|  inorganic phosphate transporter PiT family p...  96.7    2e-20   
gb|KEE32632.1|  hypothetical protein EM90_11010                       93.2    2e-20   
ref|WP_016503540.1|  phosphate transporter                            96.3    2e-20   
gb|KEY91109.1|  hypothetical protein CF67_04105                       96.3    2e-20   
ref|WP_010862543.1|  Putative low-affinity inorganic phosphate tr...  96.3    2e-20   
ref|WP_034414485.1|  phosphate permease                               96.3    2e-20   
ref|WP_031843116.1|  phosphate permease                               93.2    2e-20   
emb|CEI13672.1|  phosphate transporter                                98.2    2e-20   
ref|WP_027251924.1|  phosphate permease                               96.3    2e-20   
ref|WP_036796139.1|  phosphate permease                               96.3    2e-20   
ref|WP_028023581.1|  phosphate permease                               96.3    2e-20   
ref|WP_035407397.1|  phosphate permease                               96.3    2e-20   
ref|WP_000404206.1|  MULTISPECIES: phosphate permease                 96.3    2e-20   
ref|WP_000404201.1|  phosphate permease                               96.3    2e-20   
ref|WP_017011930.1|  phosphate permease                               96.3    2e-20   
ref|WP_020288096.1|  putative phosphate transporter                   95.9    3e-20   
ref|WP_039423894.1|  phosphate permease                               95.9    3e-20   
gb|EKE21555.1|  hypothetical protein ACD_7C00190G0002                 96.3    3e-20   
ref|WP_005421003.1|  phosphate permease                               95.9    3e-20   
ref|WP_021756323.1|  putative phosphate permease                      95.9    3e-20   
ref|WP_012551137.1|  phosphate permease                               95.9    3e-20   
ref|WP_017022535.1|  phosphate permease                               95.9    3e-20   
gb|AHL77398.1|  phosphate permease                                    95.5    3e-20   
ref|WP_013712445.1|  phosphate permease                               95.5    3e-20   
ref|WP_024010995.1|  phosphate permease                               95.5    3e-20   
ref|WP_000404207.1|  phosphate permease                               95.5    3e-20   
gb|ELT31755.1|  phosphate transporter family protein                  95.5    3e-20   
ref|WP_011262659.1|  phosphate permease                               95.5    3e-20   
ref|WP_000404204.1|  MULTISPECIES: phosphate permease                 95.5    3e-20   
ref|WP_006717510.1|  phosphate permease                               95.5    3e-20   
ref|WP_011044391.1|  phosphate permease                               95.9    3e-20   
ref|WP_004394292.1|  phosphate permease                               95.5    3e-20   
ref|WP_024010263.1|  phosphate permease                               95.5    4e-20   
ref|WP_000404205.1|  phosphate permease                               95.5    4e-20   
gb|EXJ37694.1|  phosphate transporter family protein                  93.2    4e-20   
ref|WP_000404209.1|  phosphate permease                               95.5    4e-20   
ref|WP_027849259.1|  phosphate permease                               95.5    4e-20   
ref|WP_019621031.1|  phosphate permease                               95.5    4e-20   
ref|WP_039440743.1|  phosphate permease                               95.5    4e-20   
ref|WP_001882122.1|  phosphate permease                               95.5    4e-20   
ref|WP_004729118.1|  phosphate permease                               95.1    4e-20   
ref|WP_028764149.1|  inorganic phosphate transporter PiT family p...  95.5    4e-20   
gb|EJS90341.1|  hypothetical protein AAUPMB_02566                     91.7    4e-20   
ref|WP_012821086.1|  phosphate permease                               95.1    4e-20   
ref|WP_005539270.1|  phosphate permease                               95.1    5e-20   
ref|WP_031840099.1|  phosphate permease                               93.2    5e-20   
ref|WP_005578890.1|  phosphate permease                               95.1    5e-20   
ref|WP_025820850.1|  inorganic phosphate transporter PiT family p...  95.1    5e-20   
ref|WP_005565426.1|  phosphate permease                               95.1    5e-20   
ref|WP_005573962.1|  phosphate permease                               94.7    5e-20   
ref|WP_031578589.1|  phosphate permease                               95.1    5e-20   
ref|WP_000404208.1|  phosphate permease                               95.1    5e-20   
ref|WP_005558031.1|  phosphate permease                               94.7    5e-20   
ref|WP_017421275.1|  phosphate permease                               95.1    5e-20   
ref|WP_011078702.1|  phosphate permease                               95.1    5e-20   
ref|WP_025673462.1|  phosphate permease                               95.1    5e-20   
ref|WP_034733019.1|  inorganic phosphate transporter PiT family p...  95.1    5e-20   
ref|WP_036858927.1|  phosphate permease                               95.1    5e-20   
ref|WP_029189884.1|  phosphate permease                               95.1    5e-20   
ref|WP_005552678.1|  phosphate permease                               95.1    5e-20   
ref|WP_004397675.1|  phosphate permease                               95.1    5e-20   
gb|KDO13092.1|  phosphate permease                                    95.1    5e-20   
ref|WP_038178284.1|  phosphate permease                               95.1    6e-20   
ref|WP_010319786.1|  phosphate permease                               95.1    6e-20   
ref|WP_031822299.1|  phosphate permease                               92.8    6e-20   
ref|WP_034877948.1|  phosphate permease                               95.1    6e-20   
ref|WP_026027278.1|  MULTISPECIES: phosphate permease                 94.7    6e-20   
ref|WP_020332182.1|  putative low-affinity inorganic phosphate tr...  94.7    6e-20   
ref|WP_005761982.1|  phosphate permease                               94.7    6e-20   
ref|WP_007042784.1|  phosphate permease                               94.7    6e-20   
gb|EDL52977.1|  pho4 family protein                                   93.2    6e-20   
ref|WP_032372248.1|  phosphate permease                               94.7    6e-20   
ref|WP_007988390.1|  MULTISPECIES: phosphate permease                 94.7    6e-20   
ref|WP_017024932.1|  phosphate permease                               94.7    7e-20   
ref|WP_026860833.1|  inorganic phosphate transporter PiT family p...  94.7    7e-20   
ref|WP_012278644.1|  phosphate permease                               94.7    7e-20   
ref|WP_027697804.1|  phosphate permease                               94.7    7e-20   
ref|WP_033185883.1|  inorganic phosphate transporter PiT family p...  94.7    7e-20   
ref|WP_013856046.1|  phosphate permease                               95.1    7e-20   
ref|WP_006994494.1|  inorganic phosphate transporter, PiT family      94.7    7e-20   
ref|WP_028761838.1|  inorganic phosphate transporter PiT family p...  94.7    8e-20   
ref|WP_011576055.1|  phosphate permease                               94.7    8e-20   
ref|WP_021706930.1|  putative sodium/phosphate symporter              94.7    8e-20   
ref|WP_011073547.1|  inorganic phosphate transporter PiT family       94.7    8e-20   
ref|WP_005751187.1|  phosphate permease                               94.4    9e-20   
ref|WP_016957222.1|  phosphate permease                               94.4    9e-20   
ref|WP_014326204.1|  phosphate permease                               94.4    9e-20   
ref|WP_028863157.1|  inorganic phosphate transporter PiT family p...  94.4    9e-20   
gb|AHF02777.1|  phosphate permease                                    94.4    1e-19   
ref|WP_017051110.1|  phosphate permease                               94.4    1e-19   
ref|WP_009843356.1|  phosphate permease                               94.4    1e-19   
ref|WP_005721095.1|  phosphate permease                               94.4    1e-19   
ref|WP_008293308.1|  phosphate permease                               94.4    1e-19   
dbj|GAL21389.1|  probable low-affinity inorganic phosphate transp...  94.4    1e-19   
dbj|GAL36381.1|  probable low-affinity inorganic phosphate transp...  94.4    1e-19   
ref|WP_026026786.1|  phosphate permease                               94.4    1e-19   
ref|WP_017041436.1|  phosphate permease                               94.4    1e-19   
ref|WP_009020226.1|  phosphate permease                               94.4    1e-19   
ref|WP_026029556.1|  phosphate permease                               94.0    1e-19   
ref|WP_023404124.1|  putative sodium/phosphate symporter              94.0    1e-19   
ref|WP_011760782.1|  phosphate permease                               94.4    1e-19   
ref|WP_019613567.1|  phosphate permease                               94.0    1e-19   
ref|WP_034833156.1|  phosphate permease                               94.0    1e-19   
ref|WP_012156686.1|  phosphate permease                               94.0    1e-19   
ref|WP_007230576.1|  Phosphate transporter family protein             94.0    1e-19   
ref|WP_005455435.1|  Pho4 family protein                              93.2    1e-19   
ref|WP_019025849.1|  phosphate permease                               94.0    1e-19   
ref|WP_025527204.1|  phosphate permease                               93.2    1e-19   
ref|WP_029858568.1|  phosphate permease                               94.0    1e-19   
ref|WP_025543199.1|  phosphate permease                               93.2    1e-19   
gb|KEK27297.1|  phosphate transporter                                 94.0    1e-19   
ref|WP_008222547.1|  phosphate permease                               94.0    1e-19   
ref|WP_029836132.1|  phosphate permease                               93.2    1e-19   
ref|WP_037421866.1|  MULTISPECIES: inorganic phosphate transporte...  94.0    1e-19   
ref|WP_008080333.1|  phosphate permease                               94.0    2e-19   
ref|WP_011495146.1|  phosphate permease                               94.0    2e-19   
ref|WP_029863773.1|  phosphate permease                               93.2    2e-19   
ref|WP_028299743.1|  phosphate permease                               94.0    2e-19   
ref|WP_014975759.1|  phosphate permease                               94.0    2e-19   
ref|WP_004744741.1|  phosphate permease                               93.6    2e-19   
ref|WP_025626741.1|  phosphate permease                               93.6    2e-19   
ref|WP_021709346.1|  putative sodium/phosphate symporter              93.6    2e-19   
ref|WP_005479165.1|  phosphate permease                               93.6    2e-19   
ref|WP_005703530.1|  phosphate permease                               93.6    2e-19   
ref|WP_039219516.1|  inorganic phosphate transporter PiT family p...  94.0    2e-19   
dbj|GAK23972.1|  LOW QUALITY PROTEIN: probable low-affinity inorg...  93.6    2e-19   
ref|WP_006957777.1|  MULTISPECIES: phosphate permease                 93.6    2e-19   
ref|WP_011636054.1|  phosphate permease                               93.6    2e-19   
ref|WP_029859348.1|  phosphate permease                               93.2    2e-19   
ref|WP_039224609.1|  inorganic phosphate transporter PiT family p...  93.6    2e-19   
ref|WP_014948404.1|  phosphate permease                               93.6    2e-19   
ref|WP_006082932.1|  phosphate permease                               94.0    2e-19   
ref|WP_038202924.1|  phosphate permease                               93.6    2e-19   
ref|WP_006954247.1|  phosphate permease                               93.6    2e-19   
ref|WP_038885785.1|  phosphate permease                               93.6    2e-19   
ref|WP_004415583.1|  phosphate permease                               93.6    2e-19   
ref|WP_004735961.1|  phosphate permease                               93.6    2e-19   
ref|WP_003458703.1|  phosphate permease                               94.0    2e-19   
ref|WP_014978444.1|  phosphate permease                               93.6    2e-19   
ref|WP_006743200.1|  phosphate permease                               93.6    2e-19   
ref|WP_012126961.1|  phosphate permease                               93.6    2e-19   
ref|WP_017820251.1|  phosphate permease                               93.6    2e-19   
ref|WP_006877485.1|  phosphate permease                               93.6    2e-19   
ref|WP_017056011.1|  phosphate permease                               93.6    2e-19   
ref|WP_014997443.1|  phosphate permease                               93.6    2e-19   
ref|WP_005431976.1|  MULTISPECIES: phosphate permease                 93.6    2e-19   
ref|WP_005379898.1|  MULTISPECIES: phosphate permease                 93.6    2e-19   
ref|WP_011235434.1|  phosphate permease                               93.6    2e-19   
ref|WP_038866198.1|  phosphate permease                               93.6    2e-19   
ref|WP_038140731.1|  MULTISPECIES: phosphate permease                 93.6    2e-19   
dbj|GAK85187.1|  probable low-affinity inorganic phosphate transp...  93.6    2e-19   
ref|WP_005472876.1|  MULTISPECIES: phosphate permease                 93.6    2e-19   
ref|WP_017069480.1|  phosphate permease                               93.6    2e-19   
dbj|GAJ69835.1|  LOW QUALITY PROTEIN: probable low-affinity inorg...  93.6    2e-19   
ref|WP_032553082.1|  phosphate permease                               93.6    2e-19   
ref|WP_016783976.1|  phosphate permease                               93.6    2e-19   
ref|WP_005528769.1|  phosphate permease                               93.6    2e-19   
ref|WP_017077661.1|  phosphate permease                               93.6    2e-19   
ref|WP_005702597.1|  phosphate permease                               93.6    2e-19   
ref|WP_014230764.1|  MULTISPECIES: phosphate permease                 93.6    2e-19   
ref|WP_017084749.1|  MULTISPECIES: phosphate permease                 93.6    2e-19   
ref|WP_012771269.1|  phosphate permease                               93.6    2e-19   
dbj|GAJ75720.1|  probable low-affinity inorganic phosphate transp...  93.6    2e-19   
ref|WP_004740776.1|  phosphate permease                               93.6    2e-19   
ref|WP_005395948.1|  pho4 family protein                              93.6    2e-19   
ref|WP_012603189.1|  phosphate permease                               93.6    2e-19   
ref|WP_010434641.1|  phosphate permease                               93.6    2e-19   
ref|WP_004749901.1|  pho4 family protein                              92.8    2e-19   
ref|WP_017062916.1|  phosphate permease                               93.6    2e-19   
ref|WP_017061418.1|  MULTISPECIES: phosphate permease                 93.6    2e-19   
ref|WP_005450407.1|  MULTISPECIES: phosphate permease                 93.6    2e-19   
ref|WP_017080239.1|  phosphate permease                               93.6    2e-19   
gb|AIF97947.1|  inorganic phosphate transporter PiT family protein    93.6    2e-19   
ref|WP_038897782.1|  phosphate permease                               93.6    2e-19   
ref|WP_038893945.1|  phosphate permease                               93.6    2e-19   
ref|WP_038224033.1|  phosphate permease                               93.6    2e-19   
ref|WP_038174226.1|  phosphate permease                               93.6    2e-19   
ref|WP_017031331.1|  phosphate permease                               93.6    2e-19   
ref|WP_033538700.1|  inorganic phosphate transporter PiT family p...  93.6    2e-19   
ref|WP_005436057.1|  phosphate permease                               93.6    2e-19   
ref|WP_017026808.1|  phosphate permease                               93.6    2e-19   
ref|WP_017243604.1|  phosphate permease                               93.6    2e-19   
ref|WP_011864423.1|  phosphate permease                               93.6    2e-19   
ref|WP_018141135.1|  MULTISPECIES: phosphate permease                 93.2    2e-19   
ref|WP_009599763.1|  phosphate permease                               93.2    2e-19   
dbj|GAL13091.1|  probable low-affinity inorganic phosphate transp...  93.6    2e-19   
ref|WP_010879294.1|  phosphate permease                               92.4    2e-19   
ref|WP_037458120.1|  inorganic phosphate transporter PiT family p...  93.2    2e-19   
ref|WP_018878229.1|  phosphate permease                               93.2    2e-19   
ref|WP_021714348.1|  putative sodium/phosphate symporter              93.2    2e-19   
ref|WP_011715968.1|  phosphate permease                               93.6    2e-19   
ref|WP_018867590.1|  MULTISPECIES: phosphate permease                 93.2    2e-19   
ref|WP_005009288.1|  hypothetical protein                             93.2    2e-19   
ref|WP_035516497.1|  phosphate permease                               93.2    2e-19   
ref|WP_025256405.1|  inorganic phosphate transporter PiT family p...  93.2    2e-19   
gb|EGM70947.1|  putative low-affinity inorganic phosphate transpo...  93.2    2e-19   
ref|WP_018948278.1|  phosphate permease                               93.2    2e-19   
ref|WP_011623863.1|  phosphate permease                               93.2    2e-19   
ref|WP_012517384.1|  phosphate permease                               93.2    3e-19   
ref|WP_023268456.1|  phosphate transporter                            93.2    3e-19   
ref|WP_019594589.1|  phosphate permease                               93.2    3e-19   
ref|WP_011625308.1|  phosphate permease                               93.2    3e-19   
ref|WP_024326709.1|  phosphate permease                               93.2    3e-19   
ref|WP_011788224.1|  MULTISPECIES: phosphate permease                 93.2    3e-19   
ref|WP_018168816.1|  MULTISPECIES: phosphate permease                 93.2    3e-19   
ref|WP_007020092.1|  phosphate permease                               93.2    3e-19   
ref|WP_019625262.1|  phosphate permease                               93.2    3e-19   
ref|WP_018871638.1|  phosphate permease                               93.2    3e-19   
ref|WP_017943040.1|  MULTISPECIES: phosphate permease                 93.2    3e-19   
ref|WP_015283950.1|  phosphate/sulfate permease                       92.8    3e-19   
ref|WP_018881984.1|  MULTISPECIES: phosphate permease                 93.2    3e-19   
ref|WP_018144981.1|  MULTISPECIES: phosphate permease                 93.2    3e-19   
ref|WP_018879281.1|  MULTISPECIES: phosphate permease                 93.2    3e-19   
ref|WP_013924493.1|  inorganic phosphate transporter 2-1              93.6    3e-19   
ref|WP_013049815.1|  phosphate permease                               93.2    3e-19   
gb|KIA78678.1|  Inorganic phosphate transporter 2-1                   93.6    3e-19   



>gb|ACU23499.1| unknown [Glycine max]
Length=155

 Score =   146 bits (369),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  54   WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  113

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVR+ETV+EIV SW VTIP GA LSV+YTW+ TK
Sbjct  114  LNSVRSETVKEIVASWVVTIPVGATLSVLYTWILTK  149



>emb|CDP13223.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  321  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  380

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIVTSWAVTIPAGA  +VIYTW+ TK
Sbjct  381  LNSVRAETVREIVTSWAVTIPAGAIFAVIYTWILTK  416



>ref|XP_010528102.1| PREDICTED: LOW QUALITY PROTEIN: inorganic phosphate transporter 
2-1, chloroplastic-like [Tarenaya hassleriana]
Length=593

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  492  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  551

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA L+V+YTWVFTK
Sbjct  552  LNSVRAETVREIVASWAVTIPVGATLAVLYTWVFTK  587



>ref|XP_011034088.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Populus euphratica]
 ref|XP_011034090.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Populus euphratica]
Length=320

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPISATHTLVGAVMGVGFARG
Sbjct  219  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISATHTLVGAVMGVGFARG  278

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIPAGA  +V YTW+ TK
Sbjct  279  LNSVRAETVREIVVSWAVTIPAGAIFAVFYTWILTK  314



>gb|EYU30636.1| hypothetical protein MIMGU_mgv1a003474mg [Erythranthe guttata]
Length=583

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  482  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLGASKLGLPISATHTLVGAVMGVGFARG  541

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIVTSWAVTIPAGA  +VIYTW+ TK
Sbjct  542  LNSVRAETVREIVTSWAVTIPAGATFAVIYTWILTK  577



>ref|XP_008389727.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Malus domestica]
Length=590

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  489  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  548

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SWAVTIPAGA LSV+YTW+FTK
Sbjct  549  LNRVRAETVREIVASWAVTIPAGAFLSVLYTWIFTK  584



>ref|XP_010556336.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Tarenaya hassleriana]
Length=577

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPISATHTLVGAVMGVGFARG
Sbjct  476  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISATHTLVGAVMGVGFARG  535

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA L+V+YTWVFTK
Sbjct  536  LNSVRAETVREIVASWAVTIPVGATLAVLYTWVFTK  571



>ref|XP_002875322.1| PHT2_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51581.1| PHT2_1 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  485  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  544

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIP GA LSVIYTW+FTK
Sbjct  545  LNSVRAETVREIVASWLVTIPVGATLSVIYTWIFTK  580



>ref|XP_008340104.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Malus domestica]
Length=589

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFA A VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  488  WGYRVIATIGKKITELTPTRGFAAEFAGASVVLFASKLGLPISATHTLVGAVMGVGFARG  547

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIVTSW VTIPAGA  SV+YTW+FTK
Sbjct  548  LNSVRAETVREIVTSWVVTIPAGAFFSVLYTWIFTK  583



>ref|NP_001275167.1| chloroplast phosphate transporter precursor [Solanum tuberosum]
 gb|AAT35816.1| chloroplast phosphate transporter precursor [Solanum tuberosum]
Length=581

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPIS THTLVGAVMGVGFARG
Sbjct  480  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLCASKLGLPISGTHTLVGAVMGVGFARG  539

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
             NSVRAETVREI TSWAVTIPAGA  +VIYTW+FTK
Sbjct  540  FNSVRAETVREIATSWAVTIPAGATFAVIYTWIFTK  575



>ref|XP_010100402.1| Inorganic phosphate transporter 2-1 [Morus notabilis]
 gb|EXB82536.1| Inorganic phosphate transporter 2-1 [Morus notabilis]
Length=575

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  474  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  533

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA LSV+YTW+ TK
Sbjct  534  LNSVRAETVREIVVSWAVTIPVGAMLSVLYTWILTK  569



>ref|XP_004309979.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=569

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  468  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  527

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIPAGA  SV+YTW+ TK
Sbjct  528  LNSVRAETVREIVLSWAVTIPAGAFFSVLYTWILTK  563



>ref|XP_004239128.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Solanum lycopersicum]
Length=577

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPIS THTLVGAVMGVGFARG
Sbjct  476  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLCASKLGLPISGTHTLVGAVMGVGFARG  535

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
             NSVRAETVREI TSWAVTIPAGA  +VIYTW+FTK
Sbjct  536  FNSVRAETVREIATSWAVTIPAGATFAVIYTWIFTK  571



>ref|NP_850633.1| inorganic phosphate transporter 2-1 [Arabidopsis thaliana]
 sp|Q38954.1|PHT21_ARATH RecName: Full=Inorganic phosphate transporter 2-1, chloroplastic; 
AltName: Full=H(+)/Pi cotransporter; Short=AtPht2;1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM53960.1|AF515591_1 phosphate transporter precursor [Arabidopsis thaliana]
 emb|CAA66826.1| putative phosphate permease [Arabidopsis thaliana]
 emb|CAA66116.1| orf01 [Arabidopsis thaliana]
 dbj|BAB01839.1| phosphate permease-like protein [Arabidopsis thaliana]
 emb|CAC15560.1| phosphate transporter Pht2;1 [Arabidopsis thaliana]
 gb|AEE77181.1| inorganic phosphate transporter 2-1 [Arabidopsis thaliana]
Length=587

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  486  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  545

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIP GA L+VIYTW+FTK
Sbjct  546  LNSVRAETVREIVASWLVTIPVGATLAVIYTWIFTK  581



>ref|XP_010425359.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Camelina sativa]
Length=587

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  486  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  545

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIP GA L+VIYTW+FTK
Sbjct  546  LNSVRAETVREIVASWLVTIPVGATLAVIYTWIFTK  581



>emb|CBI18644.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVI+TIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  287  WGYRVISTIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  346

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA LSV YTW+ TK
Sbjct  347  LNSVRAETVREIVVSWAVTIPVGALLSVFYTWILTK  382



>ref|XP_010514299.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
isoform X1 [Camelina sativa]
Length=587

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  486  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  545

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIP GA L+VIYTW+FTK
Sbjct  546  LNSVRAETVREIVASWLVTIPVGATLAVIYTWIFTK  581



>ref|XP_010502586.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=587

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  486  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  545

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIP GA L+VIYTW+FTK
Sbjct  546  LNSVRAETVREIVASWLVTIPVGATLAVIYTWIFTK  581



>ref|NP_189289.2| inorganic phosphate transporter 2-1 [Arabidopsis thaliana]
 gb|AEE77180.1| inorganic phosphate transporter 2-1 [Arabidopsis thaliana]
Length=613

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  512  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  571

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIP GA L+VIYTW+FTK
Sbjct  572  LNSVRAETVREIVASWLVTIPVGATLAVIYTWIFTK  607



>ref|XP_009390797.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=578

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPISATHTLVGAVMGVGFARG
Sbjct  477  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISATHTLVGAVMGVGFARG  536

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIVTSWAVTIP GA LSV YTW+ TK
Sbjct  537  LNSVRAETVREIVTSWAVTIPVGAVLSVFYTWISTK  572



>ref|XP_010514300.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
isoform X2 [Camelina sativa]
Length=610

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  509  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  568

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIP GA L+VIYTW+FTK
Sbjct  569  LNSVRAETVREIVASWLVTIPVGATLAVIYTWIFTK  604



>ref|XP_010502587.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=610

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  509  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  568

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIP GA L+VIYTW+FTK
Sbjct  569  LNSVRAETVREIVASWLVTIPVGATLAVIYTWIFTK  604



>ref|XP_006395545.1| hypothetical protein EUTSA_v10003891mg [Eutrema salsugineum]
 gb|ESQ32831.1| hypothetical protein EUTSA_v10003891mg [Eutrema salsugineum]
Length=586

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  485  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  544

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SW VTIP GA L+VIYTWVFTK
Sbjct  545  LNSVRAETVKEIVASWLVTIPVGATLAVIYTWVFTK  580



>ref|XP_009758601.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Nicotiana sylvestris]
Length=587

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPIS THTLVGAVMGVGFARG
Sbjct  486  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLCASKLGLPISGTHTLVGAVMGVGFARG  545

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIVTSW VTIPAGA  +VIYTW+FTK
Sbjct  546  LNSVRAETVKEIVTSWLVTIPAGATFAVIYTWIFTK  581



>ref|NP_001288019.1| inorganic phosphate transporter 2-1, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004155367.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Cucumis sativus]
 gb|AIA09900.1| inorganic phosphate transporter 2-1 [Cucumis sativus]
 gb|KGN51756.1| hypothetical protein Csa_5G598640 [Cucumis sativus]
Length=585

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL+ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  484  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLIASKLGLPISATHTLVGAVMGVGFARG  543

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA LSV+YTW+ TK
Sbjct  544  LNSVRAETVREIVLSWAVTIPVGAFLSVLYTWILTK  579



>ref|XP_009152045.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Brassica rapa]
Length=585

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  484  WGYRVIATIGKKITELTPTRGFAAEFAAATVVLFASKLGLPISATHTLVGAVMGVGFARG  543

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SW VTIP GA L+VIYTWVFTK
Sbjct  544  LNSVRAETVKEIVASWLVTIPVGATLAVIYTWVFTK  579



>gb|KFK33583.1| hypothetical protein AALP_AA5G032600 [Arabis alpina]
Length=583

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  482  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  541

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIP GA L+V YTW+FTK
Sbjct  542  LNSVRAETVREIVASWLVTIPVGATLAVFYTWIFTK  577



>emb|CDY13641.1| BnaA06g32820D [Brassica napus]
Length=586

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  485  WGYRVIATIGKKITELTPTRGFAAEFAAATVVLFASKLGLPISATHTLVGAVMGVGFARG  544

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SW VTIP GA L+VIYTWVFTK
Sbjct  545  LNSVRAETVKEIVASWLVTIPVGATLAVIYTWVFTK  580



>emb|CDX83625.1| BnaC07g23650D [Brassica napus]
Length=606

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  505  WGYRVIATIGKKITELTPTRGFAAEFAAATVVLFASKLGLPISATHTLVGAVMGVGFARG  564

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SW VTIP GA L+VIYTWVFTK
Sbjct  565  LNSVRAETVKEIVASWLVTIPVGATLAVIYTWVFTK  600



>ref|XP_006290779.1| hypothetical protein CARUB_v10016883mg [Capsella rubella]
 gb|EOA23677.1| hypothetical protein CARUB_v10016883mg [Capsella rubella]
Length=601

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  485  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  544

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SW VTIP GA L+VIYTW+FTK
Sbjct  545  LNSVRAETVKEIVASWLVTIPVGATLAVIYTWIFTK  580



>ref|XP_002311765.2| hypothetical protein POPTR_0008s19070g [Populus trichocarpa]
 gb|EEE89132.2| hypothetical protein POPTR_0008s19070g [Populus trichocarpa]
Length=590

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPISATHTLVGAVMGVGFARG
Sbjct  489  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISATHTLVGAVMGVGFARG  548

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIPAGA  +V YTW+ TK
Sbjct  549  LNSVRAETVREIVVSWAVTIPAGAIFAVFYTWILTK  584



>ref|XP_006290778.1| hypothetical protein CARUB_v10016883mg [Capsella rubella]
 gb|EOA23676.1| hypothetical protein CARUB_v10016883mg [Capsella rubella]
Length=586

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  485  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  544

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SW VTIP GA L+VIYTW+FTK
Sbjct  545  LNSVRAETVKEIVASWLVTIPVGATLAVIYTWIFTK  580



>ref|XP_004509674.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Cicer arietinum]
Length=587

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  486  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  545

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVR+ETV+EIV SWAVTIP GA LSVIYTW+ TK
Sbjct  546  LNSVRSETVKEIVASWAVTIPVGATLSVIYTWILTK  581



>ref|XP_008446164.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Cucumis melo]
Length=584

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL+ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  483  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLIASKLGLPISATHTLVGAVMGVGFARG  542

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA LSV YTW+ TK
Sbjct  543  LNSVRAETVREIVLSWAVTIPVGAFLSVFYTWILTK  578



>ref|XP_008221913.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Prunus mume]
Length=589

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  488  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  547

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SWAVTIPAGA  SV+YTW+ TK
Sbjct  548  LNRVRAETVREIVASWAVTIPAGAFFSVVYTWILTK  583



>ref|XP_007221992.1| hypothetical protein PRUPE_ppa003252mg [Prunus persica]
 gb|EMJ23191.1| hypothetical protein PRUPE_ppa003252mg [Prunus persica]
Length=589

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  488  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  547

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SWAVTIPAGA  SV+YTW+ TK
Sbjct  548  LNRVRAETVREIVASWAVTIPAGAFFSVVYTWILTK  583



>ref|XP_009121505.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Brassica rapa]
Length=573

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  472  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  531

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SW VTIP G  L+VIYTWVFTK
Sbjct  532  LNSVRAETVKEIVASWLVTIPVGGTLAVIYTWVFTK  567



>ref|XP_002271876.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Vitis vinifera]
Length=574

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVI+TIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  473  WGYRVISTIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  532

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA LSV YTW+ TK
Sbjct  533  LNSVRAETVREIVVSWAVTIPVGALLSVFYTWILTK  568



>emb|CDY56366.1| BnaAnng14200D [Brassica napus]
Length=573

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  472  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  531

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SW VTIP G  L+VIYTWVFTK
Sbjct  532  LNSVRAETVKEIVASWLVTIPVGGTLAVIYTWVFTK  567



>emb|CDY00190.1| BnaC09g01110D [Brassica napus]
Length=573

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  472  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  531

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SW VTIP G  L+VIYTWVFTK
Sbjct  532  LNSVRAETVKEIVASWLVTIPVGGTLAVIYTWVFTK  567



>ref|XP_002527931.1| chloroplast phosphate transporter, putative [Ricinus communis]
 gb|EEF34488.1| chloroplast phosphate transporter, putative [Ricinus communis]
Length=476

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPISATHTLVGAVMGVGFARG
Sbjct  375  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISATHTLVGAVMGVGFARG  434

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIPAGA  +V+YTW+ TK
Sbjct  435  LNSVRAETVREIVASWLVTIPAGATFAVLYTWILTK  470



>emb|CAN65936.1| hypothetical protein VITISV_008965 [Vitis vinifera]
Length=567

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVI+TIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  466  WGYRVISTIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  525

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA LSV YTW+ TK
Sbjct  526  LNSVRAETVREIVVSWAVTIPVGALLSVFYTWILTK  561



>ref|XP_002314598.2| hypothetical protein POPTR_0010s05630g [Populus trichocarpa]
 gb|EEF00769.2| hypothetical protein POPTR_0010s05630g [Populus trichocarpa]
Length=590

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPISATHTLVGAVMGVGFARG
Sbjct  489  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISATHTLVGAVMGVGFARG  548

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA  +V YTW+ TK
Sbjct  549  LNSVRAETVREIVVSWAVTIPVGAIFAVFYTWILTK  584



>gb|KDP26660.1| hypothetical protein JCGZ_17818 [Jatropha curcas]
Length=579

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPISATHTLVGAVMGVGFARG
Sbjct  478  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISATHTLVGAVMGVGFARG  537

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIPAGA  +V+YTW+ TK
Sbjct  538  LNSVRAETVREIVASWVVTIPAGATFAVLYTWILTK  573



>gb|AIY24428.1| phosphate transporter [Manihot esculenta]
Length=579

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  478  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  537

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIPAGA  +VIYTW+ TK
Sbjct  538  LNSVRAETVREIVASWLVTIPAGALFAVIYTWIMTK  573



>ref|XP_010023470.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW59750.1| hypothetical protein EUGRSUZ_H02499 [Eucalyptus grandis]
Length=572

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  471  WGYRVIATIGKKITELTPTRGFAAEFAAATVVLFASKLGLPISATHTLVGAVMGVGFARG  530

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA  +V+YTW+ TK
Sbjct  531  LNSVRAETVREIVASWAVTIPVGAFFAVVYTWILTK  566



>ref|XP_009613955.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=587

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPIS THTLVGAVMGVGFARG
Sbjct  486  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLCASKLGLPISGTHTLVGAVMGVGFARG  545

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIVTSW VTIPAGA  +V YTW+FTK
Sbjct  546  LNSVRAETVKEIVTSWLVTIPAGATFAVSYTWIFTK  581



>ref|XP_009359216.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Pyrus x bretschneideri]
Length=589

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFA A VVL AS LG PISATHTLVGAVMGVGFARG
Sbjct  488  WGYRVIATIGKKITELTPTRGFAAEFAGASVVLFASNLGQPISATHTLVGAVMGVGFARG  547

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIVTSW VT+PAGA  SV+YTW+FTK
Sbjct  548  LNSVRAETVREIVTSWVVTMPAGAFFSVLYTWIFTK  583



>ref|XP_009600316.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=568

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  467  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  526

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIVTSW VTIPAGA  +V YTW+ TK
Sbjct  527  LNSVRAETVKEIVTSWIVTIPAGAFFAVTYTWILTK  562



>ref|XP_011045259.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Populus euphratica]
Length=590

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRV+ATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPISATHTLVGAVMGVGFARG
Sbjct  489  WGYRVMATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISATHTLVGAVMGVGFARG  548

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA  +V YTW+ TK
Sbjct  549  LNSVRAETVREIVVSWAVTIPVGAIFAVFYTWILTK  584



>ref|XP_007044798.1| Phosphate transporter 2,1 [Theobroma cacao]
 gb|EOY00630.1| Phosphate transporter 2,1 [Theobroma cacao]
Length=585

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  484  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  543

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIVTSW +TIP GA L+V+YTW+ TK
Sbjct  544  LNRVRAETVREIVTSWVITIPVGASLAVLYTWILTK  579



>gb|KHN13437.1| Inorganic phosphate transporter 2-1, chloroplastic [Glycine soja]
Length=458

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  357  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  416

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
             NSVR+ETV+EIV SW VTIP GA LSV+YTW+ TK
Sbjct  417  FNSVRSETVKEIVASWVVTIPVGASLSVLYTWILTK  452



>ref|XP_006852318.1| hypothetical protein AMTR_s00049p00201160 [Amborella trichopoda]
 gb|ERN13785.1| hypothetical protein AMTR_s00049p00201160 [Amborella trichopoda]
Length=565

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRV+ATIGKKITELTPTRGFAAEFAAA VV+VASKLGLPISATHTLVGAVMGVGFARG
Sbjct  464  WGYRVMATIGKKITELTPTRGFAAEFAAASVVIVASKLGLPISATHTLVGAVMGVGFARG  523

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SW VTIP GA LSV+YTW+ T+
Sbjct  524  LNSVRAETVREIVASWVVTIPVGAGLSVVYTWLLTR  559



>ref|XP_010248637.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Nelumbo nucifera]
Length=583

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  482  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  541

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIV SWAVTIP GA  +V YTW+ T+
Sbjct  542  LNSVRAETVREIVASWAVTIPVGAFFAVFYTWILTR  577



>ref|XP_003551229.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Glycine max]
 gb|KHN34848.1| Inorganic phosphate transporter 2-1, chloroplastic [Glycine soja]
Length=576

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  475  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  534

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVR+ETV+EIV SW VTIP GA LSV+YTW+ TK
Sbjct  535  LNSVRSETVKEIVASWVVTIPVGATLSVLYTWILTK  570



>ref|XP_006438300.1| hypothetical protein CICLE_v10031076mg [Citrus clementina]
 ref|XP_006483925.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR51540.1| hypothetical protein CICLE_v10031076mg [Citrus clementina]
Length=575

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  474  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  533

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SWAVTIP GA  +V YTW+ TK
Sbjct  534  LNSVRAETVKEIVLSWAVTIPVGATFAVFYTWILTK  569



>gb|KCW86657.1| hypothetical protein EUGRSUZ_B03285 [Eucalyptus grandis]
Length=475

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAV+GVGFARG
Sbjct  374  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVLGVGFARG  433

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SWAVTIP GA  +V YTW+ TK
Sbjct  434  LNSVRAETVKEIVVSWAVTIPVGAVFAVFYTWILTK  469



>ref|XP_003530627.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Glycine max]
Length=575

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  474  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  533

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
             NSVR+ETV+EIV SW VTIP GA LSV+YTW+ TK
Sbjct  534  FNSVRSETVKEIVASWVVTIPVGASLSVLYTWILTK  569



>ref|XP_010682445.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=585

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVI+TIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  484  WGYRVISTIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  543

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIVTSWAVTIP G  L+V+YT +FTK
Sbjct  544  LNSVRAETVKEIVTSWAVTIPVGGILAVLYTAIFTK  579



>ref|XP_007153787.1| hypothetical protein PHAVU_003G064900g [Phaseolus vulgaris]
 gb|ESW25781.1| hypothetical protein PHAVU_003G064900g [Phaseolus vulgaris]
Length=568

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  467  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  526

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
             NSVR+ETV+EIV SW VTIP GA LSVIYTW+ T+
Sbjct  527  FNSVRSETVKEIVASWVVTIPVGAVLSVIYTWILTR  562



>gb|EMS65187.1| Inorganic phosphate transporter 2-1, chloroplastic [Triticum 
urartu]
Length=472

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  371  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  430

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SW VTIP GA LSVIYT + TK
Sbjct  431  LNRVRAETVREIVVSWVVTIPVGALLSVIYTLILTK  466



>ref|NP_001047299.1| Os02g0593500 [Oryza sativa Japonica Group]
 dbj|BAD16886.1| putative phosphate transporter 2-1 [Oryza sativa Japonica Group]
 dbj|BAD34093.1| putative phosphate transporter 2-1 [Oryza sativa Japonica Group]
 dbj|BAF09213.1| Os02g0593500 [Oryza sativa Japonica Group]
 gb|EAY86504.1| hypothetical protein OsI_07884 [Oryza sativa Indica Group]
 gb|EAZ23644.1| hypothetical protein OsJ_07345 [Oryza sativa Japonica Group]
 dbj|BAG90449.1| unnamed protein product [Oryza sativa Japonica Group]
Length=572

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  471  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  530

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SW VTIP GA LS+ YT +FTK
Sbjct  531  LNRVRAETVREIVASWLVTIPVGAVLSIFYTLLFTK  566



>dbj|BAD16885.1| putative phosphate transporter 2-1 [Oryza sativa Japonica Group]
 dbj|BAD34092.1| putative phosphate transporter 2-1 [Oryza sativa Japonica Group]
Length=509

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  408  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  467

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SW VTIP GA LS+ YT +FTK
Sbjct  468  LNRVRAETVREIVASWLVTIPVGAVLSIFYTLLFTK  503



>ref|XP_010046635.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Eucalyptus grandis]
Length=607

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAV+GVGFARG
Sbjct  506  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVLGVGFARG  565

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETV+EIV SWAVTIP GA  +V YTW+ TK
Sbjct  566  LNSVRAETVKEIVVSWAVTIPVGAVFAVFYTWILTK  601



>emb|CAD36013.1| phosphate hydrogen transporter [Spinacia oleracea]
Length=575

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVI+TIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  474  WGYRVISTIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  533

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIVTSWAVTIP G  L+V+YT + TK
Sbjct  534  LNSVRAETVREIVTSWAVTIPVGGVLAVLYTAILTK  569



>dbj|BAJ87247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=548

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  447  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  506

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SW VTIP GA LSV+YT + TK
Sbjct  507  LNRVRAETVREIVVSWVVTIPVGALLSVVYTLILTK  542



>gb|AAB41897.1| putative phosphate permease [Mesembryanthemum crystallinum]
Length=583

 Score =   144 bits (364),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 86/96 (90%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  482  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  541

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIVTSWAVTIP GA L+  YT + TK
Sbjct  542  LNSVRAETVREIVTSWAVTIPVGAALAAFYTTILTK  577



>gb|EMT15257.1| Inorganic phosphate transporter 2-1, chloroplastic [Aegilops 
tauschii]
Length=472

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  371  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  430

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SW VTIP GA LSV YT + TK
Sbjct  431  LNRVRAETVREIVVSWVVTIPVGALLSVFYTLILTK  466



>ref|XP_003628943.1| Inorganic phosphate transporter 2-1 [Medicago truncatula]
 gb|AAN46087.1| phosphate transporter PHT2-1 [Medicago truncatula]
 gb|AET03419.1| phosphate transporter 2-1 [Medicago truncatula]
Length=574

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPIS THTLVGAVMGVGFARG
Sbjct  473  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISGTHTLVGAVMGVGFARG  532

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
             N+VR+ETV+EI  SWAVTIP GA LSVIYTW+ TK
Sbjct  533  FNNVRSETVKEICASWAVTIPVGATLSVIYTWILTK  568



>gb|AGJ84129.1| phosphate transporter 2-1 [Ziziphus jujuba]
Length=567

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  466  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  525

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SW VTIP GA LSV YT + TK
Sbjct  526  LNRVRAETVREIVVSWVVTIPVGALLSVFYTLILTK  561



>gb|EPS62117.1| hypothetical protein M569_12675, partial [Genlisea aurea]
Length=488

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVI+TIGKKITELTPTRGFAAE AAA VV+ ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  387  WGYRVISTIGKKITELTPTRGFAAEIAAASVVVGASKLGLPISATHTLVGAVMGVGFARG  446

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
             NSVRAETV++IV SW VT+PAGA L+V YTW+ TK
Sbjct  447  FNSVRAETVKQIVASWVVTVPAGAVLAVAYTWILTK  482



>ref|XP_006647444.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Oryza brachyantha]
Length=569

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  468  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  527

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SW VTIP GA LS+ YT + TK
Sbjct  528  LNRVRAETVREIVASWVVTIPVGAILSIFYTLLLTK  563



>ref|NP_001168344.1| hypothetical protein [Zea mays]
 gb|ACN27894.1| unknown [Zea mays]
 gb|AFW72113.1| hypothetical protein ZEAMMB73_765000 [Zea mays]
Length=577

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  476  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  535

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SW VTIP GA LS+ YT + TK
Sbjct  536  LNRVRAETVREIVASWLVTIPVGAVLSIFYTLILTK  571



>ref|XP_003575270.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Brachypodium distachyon]
Length=569

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  468  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  527

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVREIV SW VTIP GA L+V YT + TK
Sbjct  528  LNRVRAETVREIVVSWVVTIPVGALLAVFYTLILTK  563



>ref|XP_002452373.1| hypothetical protein SORBIDRAFT_04g024630 [Sorghum bicolor]
 gb|EES05349.1| hypothetical protein SORBIDRAFT_04g024630 [Sorghum bicolor]
Length=572

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  471  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFARG  530

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VRAETVR+IV SW VTIP GA LS+ YT + TK
Sbjct  531  LNRVRAETVRDIVASWLVTIPVGAVLSIFYTLILTK  566



>ref|XP_010906717.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic 
[Elaeis guineensis]
Length=582

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPISATHTLVGAVMGVGFARG
Sbjct  481  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISATHTLVGAVMGVGFARG  540

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN+VRAETVREIV SW VTIP GA LSV Y  + TK
Sbjct  541  LNNVRAETVREIVASWVVTIPVGAVLSVFYALILTK  576



>ref|XP_008809567.1| PREDICTED: LOW QUALITY PROTEIN: inorganic phosphate transporter 
2-1, chloroplastic, partial [Phoenix dactylifera]
Length=524

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPISATHTLVGAVMGVGFARG
Sbjct  423  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISATHTLVGAVMGVGFARG  482

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            L SVR ETVREIV SW VTIP GA LSV YT + TK
Sbjct  483  LKSVRTETVREIVASWVVTIPVGAVLSVFYTLILTK  518



>ref|XP_004952958.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Setaria italica]
Length=572

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGF+RG
Sbjct  471  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFSRG  530

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN VR ETVREIV SW VTIPAGA L V+YT + TK
Sbjct  531  LNRVRVETVREIVVSWLVTIPAGAVLCVLYTTILTK  566



>ref|XP_001777366.1| predicted protein [Physcomitrella patens]
 gb|EDQ57770.1| predicted protein [Physcomitrella patens]
Length=471

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIG+KITELTPTRGFAAEFAAA VV++AS+LGLPISATHTLVGAVMGVGFARG
Sbjct  370  WGYRVIATIGQKITELTPTRGFAAEFAAATVVVLASRLGLPISATHTLVGAVMGVGFARG  429

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVR + VREIV SW VTIP GA LSV YT++F K
Sbjct  430  LNSVRTDVVREIVASWVVTIPVGAALSVAYTFIFIK  465



>ref|XP_002973893.1| hypothetical protein SELMODRAFT_149470 [Selaginella moellendorffii]
 gb|EFJ24848.1| hypothetical protein SELMODRAFT_149470 [Selaginella moellendorffii]
Length=479

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIG KITELTPTRGFAAEFAAA VV+ AS+LGLPISATHTLVGAVMGVGFARG
Sbjct  378  WGYRVIATIGNKITELTPTRGFAAEFAAASVVVGASRLGLPISATHTLVGAVMGVGFARG  437

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            LNSVR ETVREIV SW VTIP GA L+V+YT +F
Sbjct  438  LNSVRGETVREIVASWVVTIPVGALLTVLYTSLF  471



>ref|XP_002969168.1| hypothetical protein SELMODRAFT_11493, partial [Selaginella moellendorffii]
 gb|EFJ30284.1| hypothetical protein SELMODRAFT_11493, partial [Selaginella moellendorffii]
Length=481

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIG KITELTPTRGFAAEFAAA VV+ AS+LGLPISATHTLVGAVMGVGFARG
Sbjct  384  WGYRVIATIGNKITELTPTRGFAAEFAAASVVVGASRLGLPISATHTLVGAVMGVGFARG  443

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            LNSVR ETVREIV SW VTIP GA L+V+YT +F
Sbjct  444  LNSVRGETVREIVASWVVTIPVGALLTVLYTSLF  477



>ref|XP_009765547.1| PREDICTED: LOW QUALITY PROTEIN: inorganic phosphate transporter 
2-1, chloroplastic-like [Nicotiana sylvestris]
Length=565

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 80/97 (82%), Gaps = 5/97 (5%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVI+TIGKKITEL PTRGFAA     F     SKLGLPISATHTLVGAVMGVGFARG
Sbjct  467  WGYRVISTIGKKITELMPTRGFAAASVVLFA----SKLGLPISATHTLVGAVMGVGFARG  522

Query  182  LN-SVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LN SVRAETV+EIVTSW VTIPAGA  +V YTW+ TK
Sbjct  523  LNSSVRAETVKEIVTSWIVTIPAGAFFAVTYTWILTK  559



>ref|XP_011086632.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Sesamum indicum]
Length=572

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 84/96 (88%), Gaps = 8/96 (8%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFARG
Sbjct  479  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLGASKLGLPISATHTLVGAVMGVGFARG  538

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            LNSVRAETVREIVTSWA         +VIYTW+ TK
Sbjct  539  LNSVRAETVREIVTSWA--------FAVIYTWILTK  566



>gb|AAP49821.1| phosphate transporter 2-1 [Triticum aestivum]
Length=568

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    WGYRVIATI-GKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFAR  178
            WGYRVIAT   +K  ELTPTRGFAAEFAAA VVL ASKLGLPISATHTLVGAVMGVGFAR
Sbjct  466  WGYRVIATNWQEKSPELTPTRGFAAEFAAASVVLFASKLGLPISATHTLVGAVMGVGFAR  525

Query  179  GLNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            GLN VRAETVREIV SW VTIP GA LSV YT + TK
Sbjct  526  GLNRVRAETVREIVVSWVVTIPVGALLSVFYTLILTK  562



>gb|KHE92769.1| hypothetical protein SCABRO_01497 [Candidatus Scalindua brodae]
Length=474

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGK ITELTPTRGFAAEF AA  +++ASKL LP+S THTLVGAV+GVG ARG
Sbjct  376  WGWRVIETIGKCITELTPTRGFAAEFGAAITIVLASKLALPVSTTHTLVGAVLGVGLARG  435

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWV  280
            LNS+   T+R+IV SW +TIPAGA ++V++ ++
Sbjct  436  LNSLNLSTIRDIVISWVITIPAGAAITVVFYFI  468



>ref|WP_034404278.1| hypothetical protein [Candidatus Scalindua brodae]
Length=467

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGK ITELTPTRGFAAEF AA  +++ASKL LP+S THTLVGAV+GVG ARG
Sbjct  369  WGWRVIETIGKCITELTPTRGFAAEFGAAITIVLASKLALPVSTTHTLVGAVLGVGLARG  428

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWV  280
            LNS+   T+R+IV SW +TIPAGA ++V++ ++
Sbjct  429  LNSLNLSTIRDIVISWVITIPAGAAITVVFYFI  461



>ref|WP_032124582.1| inorganic phosphate transporter [Chlamydia sp. 'Diamant']
Length=471

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELTP+RGFAAEF AA  +++AS+LGLPIS THTLVGAV+GVGFARG
Sbjct  373  WGWRVIETIGKKITELTPSRGFAAEFGAATTIVLASRLGLPISTTHTLVGAVLGVGFARG  432

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSV  265
            L +V   T R+I+ SW VT+P GA L+V
Sbjct  433  LEAVNLTTTRDILISWVVTVPIGALLAV  460



>ref|XP_011071298.1| PREDICTED: inorganic phosphate transporter 2-1, chloroplastic-like 
[Sesamum indicum]
Length=567

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVIATIGKKITELTPTRGFAAEFAAA VVLVASKLGLPIS THTLVGAVMGVGFARG
Sbjct  479  WGYRVIATIGKKITELTPTRGFAAEFAAASVVLVASKLGLPISGTHTLVGAVMGVGFARG  538

Query  182  LNSVRAETVRE  214
            LNSVRAETV E
Sbjct  539  LNSVRAETVAE  549



>ref|WP_036989255.1| phosphate permease [Pseudomonas bauzanensis]
 gb|EZQ19673.1| phosphate permease [Pseudomonas bauzanensis]
Length=416

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG+ ITELTP+RGFAAE AAA  V+ AS LGLP+S THTLVGA++GVG ARG
Sbjct  318  YGYRVIATIGRHITELTPSRGFAAELAAASTVVGASGLGLPVSTTHTLVGAILGVGMARG  377

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            + ++    +  I TSW VT+PAGA LS+IY  +F+ 
Sbjct  378  IAALNLRVIGTIFTSWVVTLPAGAILSIIYFLIFSA  413



>emb|CDR34622.1| Putative inorganic phosphate transporter [Criblamydia sequanensis 
CRIB-18]
Length=473

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKK+TELTP+RGFAAEF AA  ++ AS+LGLPIS THTLVGAV+G+G ARG
Sbjct  375  WGWRVIETIGKKLTELTPSRGFAAEFGAALTIVFASRLGLPISTTHTLVGAVLGIGLARG  434

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSV  265
            + ++   T R+IV SW VT+PAGA +S+
Sbjct  435  IEALDLSTTRDIVVSWIVTVPAGALISI  462



>ref|WP_015506492.1| Phosphate transporter family protein [Chlamydia trachomatis]
 ref|YP_007734226.1| Phosphate transporter family protein [Chlamydia trachomatis D/SotonD6]
 emb|CCP54671.1| Phosphate transporter family protein [Chlamydia trachomatis D/SotonD6]
Length=426

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELTP+RGF+   ++A  +  AS LG PIS TH +VG+V+G+GFARG
Sbjct  328  WGWRVIDTIGKKITELTPSRGFSVGMSSAITIAAASSLGFPISTTHVVVGSVLGIGFARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            L ++    +++IV SW +T+PAGA LS+++
Sbjct  388  LRAINLRIIKDIVLSWFITVPAGAALSIVF  417



>ref|WP_015506335.1| Phosphate transporter family protein [Chlamydia trachomatis]
 ref|YP_007732441.1| Phosphate transporter family protein [Chlamydia trachomatis A/363]
 ref|YP_007728724.1| Phosphate transporter family protein [Chlamydia trachomatis A/7249]
 emb|CCP49887.1| Phosphate transporter family protein [Chlamydia trachomatis A/7249]
 emb|CCP48090.1| Phosphate transporter family protein [Chlamydia trachomatis A/363]
Length=426

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELTP+RGF+   ++A  +  AS LG PIS TH +VG+V+G+GFARG
Sbjct  328  WGWRVIDTIGKKITELTPSRGFSVGMSSAITIAAASSLGFPISTTHVVVGSVLGIGFARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            L ++    +++IV SW +T+PAGA LS+++
Sbjct  388  LRAINLRIIKDIVLSWFITVPAGAALSIVF  417



>ref|WP_009873301.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_001654152.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
434/Bu]
 ref|YP_001653164.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
L2b/UCH-1/proctitis]
 ref|YP_007716222.1| Phosphate transporter family protein [Chlamydia trachomatis L2/25667R]
 ref|YP_007722461.1| Phosphate transporter family protein [Chlamydia trachomatis L1/440/LN]
 ref|YP_007719782.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Ams2]
 ref|YP_007721568.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Ams5]
 ref|YP_007715332.1| Phosphate transporter family protein [Chlamydia trachomatis L1/115]
 ref|YP_007720674.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Canada1]
 ref|YP_007718001.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Canada2]
 ref|YP_007717110.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/UCH-2]
 ref|YP_007738686.1| Phosphate transporter family protein [Chlamydia trachomatis L1/224]
 ref|YP_007739575.1| Phosphate transporter family protein [Chlamydia trachomatis L3/404/LN]
 ref|YP_007741353.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/CV204]
 ref|YP_007742243.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Ams3]
 ref|YP_007718892.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Ams1]
 ref|YP_007743133.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Ams4]
 ref|YP_007737796.1| Phosphate transporter family protein [Chlamydia trachomatis L1/1322/p2]
 ref|YP_007723349.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/795]
 ref|YP_007729610.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/8200/07]
 ref|YP_007740463.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/LST]
 ref|YP_007851068.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
L2/434/Bu(i)]
 ref|YP_007852008.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
L2/434/Bu(f)]
 ref|YP_008344736.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
RC-L2(s)/46]
 ref|YP_008350380.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
RC-L2/55]
 ref|YP_008353357.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
RC-L2(s)/3]
 ref|YP_008355206.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
RC-J/971]
 emb|CAP03505.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
434/Bu]
 emb|CAP06459.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
L2b/UCH-1/proctitis]
 emb|CCP51991.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/8200/07]
 emb|CCP61844.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/795]
 emb|CCP62739.1| Phosphate transporter family protein [Chlamydia trachomatis L1/440/LN]
 emb|CCP63628.1| Phosphate transporter family protein [Chlamydia trachomatis L1/1322/p2]
 emb|CCP64518.1| Phosphate transporter family protein [Chlamydia trachomatis L1/115]
 emb|CCP65407.1| Phosphate transporter family protein [Chlamydia trachomatis L1/224]
 emb|CCP66298.1| Phosphate transporter family protein [Chlamydia trachomatis L2/25667R]
 emb|CCP67186.1| Phosphate transporter family protein [Chlamydia trachomatis L3/404/LN]
 emb|CCP68074.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/UCH-2]
 emb|CCP68965.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Canada2]
 emb|CCP69856.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/LST]
 emb|CCP70746.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Ams1]
 emb|CCP71636.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/CV204]
 emb|CCP90801.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Ams2]
 emb|CCP91691.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Ams3]
 emb|CCP92583.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Canada1]
 emb|CCP93476.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Ams4]
 emb|CCP94367.1| Phosphate transporter family protein [Chlamydia trachomatis L2b/Ams5]
 gb|AGJ65086.1| phosphate permease [Chlamydia trachomatis L2/434/Bu(f)]
 gb|AGJ64146.1| phosphate permease [Chlamydia trachomatis L2/434/Bu(i)]
 gb|AGR95058.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
RC-L2(s)/46]
 gb|AGR98779.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
RC-L2(s)/3]
 gb|AGS03471.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
RC-J/971]
 gb|AGS04399.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
RC-L2/55]
Length=426

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELTP+RGF+   ++A  +  AS LG PIS TH +VG+V+G+GFARG
Sbjct  328  WGWRVIDTIGKKITELTPSRGFSVGMSSAITIAAASSLGFPISTTHVVVGSVLGIGFARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            L ++    +++IV SW +T+PAGA LS+++
Sbjct  388  LRAINLRIIKDIVLSWFITVPAGAALSIVF  417



>ref|WP_014541189.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_005808998.1| inorganic phosphate transporter [Chlamydia trachomatis G/11222]
 gb|ADH19335.1| inorganic phosphate transporter [Chlamydia trachomatis G/11222]
Length=426

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELTP+RGF+   ++A  +  AS LG PIS TH +VG+V+G+GFARG
Sbjct  328  WGWRVIDTIGKKITELTPSRGFSVGMSSAITIAAASSLGFPISTTHVVVGSVLGIGFARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            L ++    +++IV SW +T+PAGA LS+++
Sbjct  388  LRAINLRIIKDIVLSWFITVPAGAALSIVF  417



>ref|WP_011324832.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_328518.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
A/HAR-13]
 ref|YP_002888316.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
B/Jali20/OT]
 ref|YP_002889197.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
B/TZ1A828/OT]
 ref|YP_005156528.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
A2497]
 ref|YP_005813578.1| Low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
A2497]
 ref|YP_007724252.1| Phosphate transporter family protein [Chlamydia trachomatis A/5291]
 ref|YP_008921572.1| phosphate permease [Chlamydia trachomatis C/TW-3]
 gb|AAX50970.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
A/HAR-13]
 emb|CAX10258.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
B/TZ1A828/OT]
 emb|CAX11151.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
B/Jali20/OT]
 gb|AEP35579.1| Low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
A2497]
 emb|CAX09364.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
A2497]
 emb|CCP48989.1| Phosphate transporter family protein [Chlamydia trachomatis A/5291]
 gb|AHC17553.1| phosphate permease [Chlamydia trachomatis C/TW-3]
Length=426

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELTP+RGF+   ++A  +  AS LG PIS TH +VG+V+G+GFARG
Sbjct  328  WGWRVIDTIGKKITELTPSRGFSVGMSSAITIAAASSLGFPISTTHVVVGSVLGIGFARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            L ++    +++IV SW +T+PAGA LS+++
Sbjct  388  LRAINLRIIKDIVLSWFITVPAGAALSIVF  417



>ref|WP_013181393.1| inorganic phosphate transporter [Waddlia chondrophila]
 ref|YP_003708671.1| inorganic phosphate transporter [Waddlia chondrophila WSU 86-1044]
 gb|ADI37665.1| putative inorganic phosphate transporter [Waddlia chondrophila 
WSU 86-1044]
 emb|CCB90512.1| putative phosphate permease CT_962 [Waddlia chondrophila 2032/99]
Length=475

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+GKKITELTPTRGF AEF AA  +LVAS++G+PIS THTLVG+V+GVG ARG
Sbjct  377  WGWRVIETVGKKITELTPTRGFVAEFCAATTILVASRMGMPISTTHTLVGSVLGVGLARG  436

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSV----IYTWVF  283
            + ++     R+IV SW VT+PAGA LSV    +  W+F
Sbjct  437  IEALNLGMTRDIVISWVVTVPAGAGLSVCIFYVIQWIF  474



>ref|WP_009872067.1| phosphate permease [Chlamydia trachomatis]
 ref|NP_220211.1| phosphate permease [Chlamydia trachomatis D/UW-3/CX]
 ref|YP_004716917.1| phosphate transporter family protein [Chlamydia trachomatis L2c]
 ref|YP_005808073.1| inorganic phosphate transporter [Chlamydia trachomatis G/9768]
 ref|YP_005810848.1| inorganic phosphate transporter [Chlamydia trachomatis G/9301]
 ref|YP_005811746.1| Low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
D-EC]
 ref|YP_005812624.1| Low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
D-LC]
 ref|YP_005815439.1| inorganic phosphate transporter [Chlamydia trachomatis G/11074]
 ref|YP_007727826.1| Phosphate transporter family protein [Chlamydia trachomatis D/SotonD5]
 ref|YP_007726038.1| Phosphate transporter family protein [Chlamydia trachomatis G/SotonG1]
 ref|YP_007731540.1| Phosphate transporter family protein [Chlamydia trachomatis K/SotonK1]
 ref|YP_007736013.1| Phosphate transporter family protein [Chlamydia trachomatis Ia/SotonIa1]
 ref|YP_007725146.1| Phosphate transporter family protein [Chlamydia trachomatis Ia/SotonIa3]
 ref|YP_008346612.1| inorganic phosphate transporter [Chlamydia trachomatis RC-J/953]
 ref|YP_008348480.1| inorganic phosphate transporter [Chlamydia trachomatis RC-J(s)/122]
 ref|YP_008349425.1| inorganic phosphate transporter [Chlamydia trachomatis J/6276tet1]
 ref|YP_008352436.1| inorganic phosphate transporter [Chlamydia trachomatis RC-J/943]
 ref|YP_008354281.1| inorganic phosphate transporter [Chlamydia trachomatis RC-J/966]
 ref|YP_008442844.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_008469071.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_008469995.1| phosphate permease [Chlamydia trachomatis]
 sp|O84698.1|Y962_CHLTR RecName: Full=Putative phosphate permease CT_962 [Chlamydia trachomatis 
D/UW-3/CX]
 gb|AAC68287.1| Phosphate Permease [Chlamydia trachomatis D/UW-3/CX]
 gb|ADH18410.1| inorganic phosphate transporter [Chlamydia trachomatis G/9768]
 gb|ADH20257.1| inorganic phosphate transporter [Chlamydia trachomatis G/11074]
 gb|ADH97355.1| inorganic phosphate transporter [Chlamydia trachomatis G/9301]
 gb|ADI51369.1| Low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
D-EC]
 gb|ADI52381.1| Low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
D-LC]
 gb|AEJ77708.1| phosphate transporter family protein [Chlamydia trachomatis L2c]
 emb|CCP50871.1| Phosphate transporter family protein [Chlamydia trachomatis K/SotonK1]
 emb|CCP53780.1| Phosphate transporter family protein [Chlamydia trachomatis D/SotonD5]
 emb|CCP58271.1| Phosphate transporter family protein [Chlamydia trachomatis G/SotonG1]
 emb|CCP59165.1| Phosphate transporter family protein [Chlamydia trachomatis Ia/SotonIa1]
 emb|CCP60059.1| Phosphate transporter family protein [Chlamydia trachomatis Ia/SotonIa3]
 gb|AGR96938.1| inorganic phosphate transporter [Chlamydia trachomatis RC-J/943]
 gb|AGR97860.1| inorganic phosphate transporter [Chlamydia trachomatis RC-J/953]
 gb|AGS00648.1| inorganic phosphate transporter [Chlamydia trachomatis RC-J(s)/122]
 gb|AGS01590.1| inorganic phosphate transporter [Chlamydia trachomatis RC-J/966]
 gb|AGS02519.1| inorganic phosphate transporter [Chlamydia trachomatis J/6276tet1]
 gb|AGT70223.1| phosphate permease [Chlamydia trachomatis]
 gb|AGT71147.1| phosphate permease [Chlamydia trachomatis]
 gb|AGT72989.1| phosphate permease [Chlamydia trachomatis]
Length=426

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELTP+RGF+   ++A  +  AS LG PIS TH +VG+V+G+GFARG
Sbjct  328  WGWRVIDTIGKKITELTPSRGFSVGMSSAITIAAASSLGFPISTTHVVVGSVLGIGFARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            L ++    +++IV SW +T+PAGA LS+++
Sbjct  388  LRAINLRIIKDIVLSWFITVPAGAALSIVF  417



>ref|WP_009872855.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_005809922.1| inorganic phosphate transporter [Chlamydia trachomatis E/11023]
 ref|YP_005814514.1| inorganic phosphate transporter [Chlamydia trachomatis E/150]
 ref|YP_005816327.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
Sweden2]
 ref|YP_006360629.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
F/SW4]
 ref|YP_006361504.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
E/SW3]
 ref|YP_006362379.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
F/SW5]
 ref|YP_007540392.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
IU824]
 ref|YP_007541268.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
IU888]
 ref|YP_007726934.1| Phosphate transporter family protein [Chlamydia trachomatis E/SotonE8]
 ref|YP_007736908.1| Phosphate transporter family protein [Chlamydia trachomatis E/Bour]
 ref|YP_007733334.1| Phosphate transporter family protein [Chlamydia trachomatis D/SotonD1]
 ref|YP_007735116.1| Phosphate transporter family protein [Chlamydia trachomatis E/SotonE4]
 ref|YP_007730648.1| Phosphate transporter family protein [Chlamydia trachomatis F/SotonF3]
 ref|YP_008345661.1| inorganic phosphate transporter [Chlamydia trachomatis RC-F(s)/852]
 ref|YP_008347534.1| inorganic phosphate transporter [Chlamydia trachomatis RC-F(s)/342]
 ref|YP_008351511.1| inorganic phosphate transporter [Chlamydia trachomatis RC-F/69]
 ref|YP_008440078.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_008441004.1| phosphate permease [Chlamydia trachomatis F/11-96]
 ref|YP_008441924.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_008466284.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_008467211.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_008468143.1| phosphate permease [Chlamydia trachomatis]
 ref|YP_008635206.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
E/C599]
 ref|YP_008655862.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
F/SWFPminus]
 emb|CBJ15217.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
Sweden2]
 gb|ADH17485.1| inorganic phosphate transporter [Chlamydia trachomatis E/150]
 gb|ADH21178.1| inorganic phosphate transporter [Chlamydia trachomatis E/11023]
 emb|CCE14755.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
F/SW5]
 emb|CCE13866.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
F/SW4]
 emb|CCE12977.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
E/SW3]
 emb|CCP52888.1| Phosphate transporter family protein [Chlamydia trachomatis D/SotonD1]
 emb|CCP55561.1| Phosphate transporter family protein [Chlamydia trachomatis E/SotonE4]
 emb|CCP56460.1| Phosphate transporter family protein [Chlamydia trachomatis E/SotonE8]
 emb|CCP57378.1| Phosphate transporter family protein [Chlamydia trachomatis F/SotonF3]
 emb|CCP60954.1| Phosphate transporter family protein [Chlamydia trachomatis E/Bour]
 emb|CCP28491.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
IU824]
 emb|CCP29392.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
IU888]
 gb|AGR94134.1| inorganic phosphate transporter [Chlamydia trachomatis RC-F/69]
 gb|AGR95983.1| inorganic phosphate transporter [Chlamydia trachomatis RC-F(s)/852]
 gb|AGR99701.1| inorganic phosphate transporter [Chlamydia trachomatis RC-F(s)/342]
 gb|AGT64664.1| phosphate permease [Chlamydia trachomatis]
 gb|AGT65593.1| phosphate permease [Chlamydia trachomatis]
 gb|AGT66519.1| phosphate permease [Chlamydia trachomatis]
 gb|AGT67448.1| phosphate permease [Chlamydia trachomatis F/11-96]
 gb|AGT68370.1| phosphate permease [Chlamydia trachomatis]
 gb|AGT69301.1| phosphate permease [Chlamydia trachomatis]
 gb|AGT72062.1| phosphate permease [Chlamydia trachomatis]
 emb|CDG43594.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
E/C599]
 emb|CDG42705.1| low-affinity inorganic phosphate transporter [Chlamydia trachomatis 
F/SWFPminus]
Length=426

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELTP+RGF+   ++A  +  AS LG PIS TH +VG+V+G+GFARG
Sbjct  328  WGWRVIDTIGKKITELTPSRGFSVGMSSAITIAAASSLGFPISTTHVVVGSVLGIGFARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            L ++    +++IV SW +T+PAGA LS+++
Sbjct  388  LRAINLRIIKDIVLSWFITVPAGAALSIVF  417



>ref|WP_011174649.1| hypothetical protein [Candidatus Protochlamydia amoebophila]
 ref|YP_007098.1| hypothetical protein pc0099 [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF22823.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila 
UWE25]
 gb|KIC74388.1| putative phosphate permease [Candidatus Protochlamydia amoebophila]
Length=471

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELT +RGFAAEF AA  +++AS+ GLPIS THTLVGAV+GVGFARG
Sbjct  373  WGWRVIETIGKKITELTASRGFAAEFGAATTIVIASRFGLPISTTHTLVGAVLGVGFARG  432

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTW  277
            L +V   T R+I+ SW VT+P GA L++I  +
Sbjct  433  LEAVNLTTTRDILVSWIVTVPIGALLAIILIY  464



>ref|WP_009020891.1| phosphate permease [Luminiphilus syltensis]
 gb|EED36147.1| phosphate transporter [Luminiphilus syltensis NOR5-1B]
Length=425

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G+RVI T+G+KITELTP+RGFAAE AAA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  327  YGWRVIQTVGRKITELTPSRGFAAELAAASTVVLASATGLPISTTHTLVGAVLGVGLARG  386

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + +V   TV  IVTSW VT+PAGA LSVI+ ++ 
Sbjct  387  VEAVHLPTVGAIVTSWLVTLPAGATLSVIFFFIL  420



>ref|WP_025567928.1| phosphate permease [Gammaproteobacteria bacterium SCGC AAA003-E02]
Length=425

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            GY+V+ TIGKKITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGAV+GVG ARG+
Sbjct  327  GYKVMGTIGKKITELTPSRGFAAELGAATTVVIASGTGLPISTTHTLVGAVLGVGLARGM  386

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            +S+    + +IVTSW +T+PAGA LS+++  +F
Sbjct  387  SSLNLAVIGQIVTSWVITLPAGALLSILFFSMF  419



>ref|WP_007236028.1| phosphate permease [marine gamma proteobacterium HTCC2080]
 gb|EAW39810.1| probable phosphate transporter [marine gamma proteobacterium 
HTCC2080]
Length=426

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G+RVI TIG+KITELTP+RGFAAE AAA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  327  YGWRVIQTIGRKITELTPSRGFAAELAAATTVVLASATGLPISTTHTLVGAVLGVGLARG  386

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++   TV  IVTSW +T+PAGA LSVI+ ++ 
Sbjct  387  VEALHLPTVGAIVTSWVITLPAGATLSVIFFFIL  420



>ref|WP_029756545.1| hypothetical protein [Planctomycetes bacterium SCGC AAA282-C19]
Length=474

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++V+ TIGKKITELTP+RGF A+F AA  +++ASKL LPIS THTLVGAV+GVG ARG
Sbjct  376  YGWKVMETIGKKITELTPSRGFCAQFGAATTIVIASKLALPISTTHTLVGAVLGVGLARG  435

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++   TVR+I  SW +TIPAGA L++I+
Sbjct  436  IGAINLTTVRDIAISWVITIPAGALLAIIF  465



>ref|WP_015590036.1| Phosphate/sulfate permease [Archaeoglobus sulfaticallidus]
 ref|YP_007906430.1| Phosphate/sulfate permease [Archaeoglobus sulfaticallidus PM70-1]
 gb|AGK60437.1| Phosphate/sulfate permease [Archaeoglobus sulfaticallidus PM70-1]
Length=333

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVI T+GK+ITELTPTRGF+AEFA A  VL AS  G+PIS THTLVG+V+GVGFA G
Sbjct  236  WGYRVIETVGKRITELTPTRGFSAEFATATTVLSASYFGMPISTTHTLVGSVLGVGFAGG  295

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSV-IYT  274
            L SV    V+ I+ SW +TIPA A L++ IYT
Sbjct  296  LASVDISVVKRIIYSWVLTIPAAATLTITIYT  327



>emb|CEA03315.1| phosphate transporter [Pseudomonas sp. 12M76_air]
 emb|CEF26149.1| phosphate transporter [Pseudomonas sp. 12M76_air]
Length=417

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG+ ITELTP+RGFAAE A A  V+ AS +GLPIS THTLVGAV+GVG ARG
Sbjct  319  YGYRVIATIGQHITELTPSRGFAAELATAATVVGASGIGLPISTTHTLVGAVLGVGMARG  378

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++  + V  I TSW VT+PAGA LS+++ ++ 
Sbjct  379  IAALNLKVVGTIFTSWVVTLPAGAILSIVFFFIL  412



>ref|WP_017678384.1| MULTISPECIES: phosphate permease [Pseudomonas]
 gb|ERH52781.1| phosphate permease [Pseudomonas mendocina EGD-AQ5]
Length=423

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE AAA  V+ AS LGLPIS THTLVGA++GVG ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELAAATTVVSASGLGLPISTTHTLVGAILGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I  SW +T+PAGA LS+I+ ++ 
Sbjct  383  IGALNLGMIGKIFLSWIITLPAGAILSIIFFFIL  416



>gb|KFJ93031.1| phosphate permease [Pseudomonas sp. 1-7]
Length=423

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE AAA  V+ AS LGLPIS THTLVGA++GVG ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELAAATTVVSASGLGLPISTTHTLVGAILGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I  SW +T+PAGA LS+I+ ++ 
Sbjct  383  IGALNLGMIGKIFLSWIITLPAGAILSIIFFFIL  416



>emb|CDI93807.1| putative phosphate transporter [Pseudomonas aeruginosa PA38182]
Length=140

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  41   YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  100

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I  SW VT+PAGA L++++  V 
Sbjct  101  IGALNLRVIGSIFLSWVVTLPAGAVLAILFFLVL  134



>ref|WP_018013550.1| phosphate permease [Teredinibacter turnerae]
Length=425

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIG+KITELTP+RGFAAE  AA  V+VAS LGLPIS THTLVGAV+GVG ARG
Sbjct  326  YGYKVIATIGRKITELTPSRGFAAELGAASTVVVASGLGLPISTTHTLVGAVLGVGMARG  385

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I  SW VT+PAGA L++++ ++F
Sbjct  386  IGALNLGVIGSIFLSWLVTLPAGAGLAIVFFFMF  419



>ref|WP_015820810.1| phosphate permease [Teredinibacter turnerae]
 ref|YP_003072079.1| phosphate transporter family protein [Teredinibacter turnerae 
T7901]
 gb|ACR14696.1| phosphate transporter family protein [Teredinibacter turnerae 
T7901]
Length=425

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIG+KITELTP+RGFAAE  AA  V+VAS LGLPIS THTLVGAV+GVG ARG
Sbjct  326  YGYKVIATIGRKITELTPSRGFAAELGAASTVVVASGLGLPISTTHTLVGAVLGVGMARG  385

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I  SW VT+PAGA L++++ ++F
Sbjct  386  IGALNLGVIGSIFLSWLVTLPAGAGLAIVFFFMF  419



>ref|WP_018275628.1| phosphate permease [Teredinibacter turnerae]
Length=425

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIG+KITELTP+RGFAAE  AA  V+VAS LGLPIS THTLVGAV+GVG ARG
Sbjct  326  YGYKVIATIGRKITELTPSRGFAAELGAASTVVVASGLGLPISTTHTLVGAVLGVGMARG  385

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I  SW VT+PAGA L++++ ++F
Sbjct  386  IGALNLGVIGSIFLSWLVTLPAGAGLAIVFFFMF  419



>gb|EGG98659.1| putative low-affinity inorganic phosphate transporter [gamma 
proteobacterium IMCC2047]
Length=280

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++VIATIG+KIT LTP+RGFAAE  AA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  182  YGFKVIATIGRKITHLTPSRGFAAELGAATTVVIASGTGLPISTTHTLVGAVLGVGLARG  241

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            ++++    +R I  SW +T+PAGA L++I+ ++F
Sbjct  242  ISALNMRMIRTIFASWIITLPAGAGLAIIFFFMF  275



>ref|WP_008927940.1| phosphate permease [Alcanivorax hongdengensis]
 gb|EKF75444.1| phosphate transporter [Alcanivorax hongdengensis A-11-3]
Length=422

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G RV+AT+GKKITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGA++GVG ARG
Sbjct  323  FGARVMATVGKKITELTPSRGFAAELGAASTVVLASGTGLPISTTHTLVGAILGVGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + S+   T+  I TSW VT+PAGA LS+++ + F
Sbjct  383  IGSLNMRTIGAIFTSWIVTLPAGALLSILFFYFF  416



>ref|WP_013713562.1| phosphate permease [Pseudomonas mendocina]
 ref|YP_004378194.1| phosphate transporter [Pseudomonas mendocina NK-01]
 gb|AEB56442.1| phosphate transporter [Pseudomonas mendocina NK-01]
 gb|KES02550.1| phosphate permease [Pseudomonas mendocina]
 gb|KFB13009.1| phosphate permease [Pseudomonas mendocina S5.2]
Length=423

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE AAA  V+ AS LGLP+S THTLVGA++GVG ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELAAATTVVSASGLGLPVSTTHTLVGAILGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I  SW +T+PAGA LS+I+ ++ 
Sbjct  383  IGALNLGMIGKIFLSWIITLPAGAILSIIFFFIL  416



>ref|WP_027707159.1| phosphate permease [Zooshikella ganghwensis]
Length=423

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+V+ TIGKKITELTP+RGFAAE AAA  V++AS  GLP+S THTLVGAV+GVG ARG
Sbjct  325  YGYKVMQTIGKKITELTPSRGFAAELAAATTVVLASGTGLPVSTTHTLVGAVLGVGLARG  384

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I+ SW +T+PAGACL++++ ++ 
Sbjct  385  IGALNLRVIGSIIMSWVITLPAGACLAILFFFIL  418



>ref|WP_018041021.1| hypothetical protein [gamma proteobacterium SCGC AB-629-K02]
Length=417

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRV+ T+GK+ITELTP+RGF+A+ AAA  +++AS+LG+PIS THTLVGAV+GVG ARG
Sbjct  318  WGYRVMETVGKRITELTPSRGFSAQLAAATTIVLASRLGIPISTTHTLVGAVLGVGLARG  377

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            +++V    V +IV SW  T+P  A LS+ + + F
Sbjct  378  ISAVDLRVVGKIVVSWVATLPIAAGLSIFFYFFF  411



>ref|WP_011589579.1| MULTISPECIES: phosphate permease [Alcanivorax]
 ref|YP_694025.1| phosphate transporter [Alcanivorax borkumensis SK2]
 emb|CAL17753.1| phosphate transporter, putative [Alcanivorax borkumensis SK2]
 gb|EUC67844.1| phosphate permease [Alcanivorax sp. 97CO-5]
 dbj|BAP15219.1| phosphate transporter [Alcanivorax sp. NBRC 101098]
Length=422

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G RV+AT+GKKITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  323  FGARVMATVGKKITELTPSRGFAAELGAATTVVLASSTGLPISTTHTLVGAVLGVGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + S+    +  I TSW VT+PAGA LS+++ + F
Sbjct  383  IGSLNLRVISTIFTSWVVTLPAGALLSILFFYFF  416



>ref|WP_024306479.1| phosphate permease [Pseudomonas sp. P818]
Length=423

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE AAA  V+ AS LGLP+S THTLVGA++GVG ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELAAATTVVSASGLGLPVSTTHTLVGAILGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I  SW +T+PAGA LS+I+ ++ 
Sbjct  383  IGALNLGMIGKIFLSWIITLPAGAILSIIFFFIL  416



>ref|WP_037003569.1| phosphate permease [Pseudomonas pseudoalcaligenes]
 gb|EZH78321.1| phosphate permease [Pseudomonas pseudoalcaligenes AD6]
Length=423

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE AAA  V+ AS LGLP+S THTLVGA++GVG ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELAAATTVVSASGLGLPVSTTHTLVGAILGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I  SW +T+PAGA LS+I+ ++ 
Sbjct  383  IGALNLGMIGKIFLSWIITLPAGAILSIIFFFIL  416



>ref|WP_004373238.1| phosphate permease [Pseudomonas mendocina]
 ref|YP_001185857.1| phosphate transporter [Pseudomonas mendocina ymp]
 gb|ABP83125.1| phosphate transporter [Pseudomonas mendocina ymp]
 gb|EJO92305.1| phosphate transporter [Pseudomonas mendocina DLHK]
Length=423

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE AAA  V+ AS LGLP+S THTLVGA++GVG ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELAAATTVVSASGLGLPVSTTHTLVGAILGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I  SW +T+PAGA LS+I+ ++ 
Sbjct  383  IGALNLGMIGKIFLSWIITLPAGAILSIIFFFIL  416



>emb|CDZ80777.1| Low-affinity inorganic phosphate transporter 1 [Chlamydia sp. 
'Rubis']
Length=468

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG++VI TIGKKITELTP+RGF+AEF AA  V++AS LGLPIS THTLVG+V+GVG ARG
Sbjct  371  WGWKVIETIGKKITELTPSRGFSAEFGAALTVVLASGLGLPISTTHTLVGSVIGVGLARG  430

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFT  286
            + ++     R+I+ SW VT+PAGA L+VI  ++ +
Sbjct  431  IEALNLGMTRDILISWFVTVPAGAILAVISYYLLS  465



>ref|WP_037024348.1| phosphate permease [Pseudomonas sp. 20_BN]
 emb|CDZ94930.1| phosphate transporter [Pseudomonas sp. 20_BN]
Length=421

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIG++ITELTP+RGFAAE A A  V+ AS LGLPIS THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGREITELTPSRGFAAELATATTVVSASALGLPISTTHTLVGAVLGIGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    + +I TSW VT+P GA LS+++
Sbjct  383  IGALNLGVIGKIFTSWLVTLPVGAALSIVF  412



>gb|KIC72598.1| putative phosphate permease [Neochlamydia sp. EPS4]
 gb|KIC76922.1| putative phosphate permease [Neochlamydia sp. TUME1]
Length=482

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELTPTRGFAAEF AA  V++AS+LGLP+S THTLVG+V+GVG ARG
Sbjct  382  WGWRVIETIGKKITELTPTRGFAAEFGAATTVVLASRLGLPVSTTHTLVGSVVGVGLARG  441

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSV  265
            L ++     R+I+ SW VT+P GA ++V
Sbjct  442  LEALDLSMTRDIMISWLVTVPTGALIAV  469



>ref|WP_039383633.1| inorganic phosphate transporter [Neochlamydia sp. TUME1]
Length=471

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIGKKITELTPTRGFAAEF AA  V++AS+LGLP+S THTLVG+V+GVG ARG
Sbjct  371  WGWRVIETIGKKITELTPTRGFAAEFGAATTVVLASRLGLPVSTTHTLVGSVVGVGLARG  430

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSV  265
            L ++     R+I+ SW VT+P GA ++V
Sbjct  431  LEALDLSMTRDIMISWLVTVPTGALIAV  458



>ref|WP_008252717.1| phosphate permease [gamma proteobacterium BDW918]
 gb|EIF41766.1| phosphate transporter [gamma proteobacterium BDW918]
Length=421

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++VIATIG KITELTP+RGFAAE  AA  V+VAS  GLPIS THTLVGAV+GVG ARG
Sbjct  323  YGFKVIATIGTKITELTPSRGFAAELGAASTVVVASATGLPISTTHTLVGAVLGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +R I  SW +T+PAGA L++++ ++F
Sbjct  383  IAALNLSVIRNIFMSWIITLPAGAGLAIVFFFIF  416



>ref|WP_013789633.1| phosphate permease [Pseudomonas fulva]
 ref|YP_004472585.1| phosphate transporter [Pseudomonas fulva 12-X]
 gb|AEF20491.1| phosphate transporter [Pseudomonas fulva 12-X]
Length=421

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++VIATIGKKITELTP+RGFAAE A A  V+ AS +GLPIS THTLVGAV+G+G ARG
Sbjct  323  YGWKVIATIGKKITELTPSRGFAAELATAATVVAASGIGLPISTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    V  I TSW VT+P GA L++IY  +F
Sbjct  383  IGALNLAVVGRIFTSWVVTLPIGAALAIIYLEIF  416



>ref|WP_014854535.1| phosphate permease [Pseudomonas stutzeri]
 ref|YP_006526109.1| phosphate transporter [Pseudomonas stutzeri DSM 10701]
 gb|AFN79751.1| phosphate transporter [Pseudomonas stutzeri DSM 10701]
Length=421

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIG++ITELTP+RGFAAE A A  V+ AS LGLPIS THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGREITELTPSRGFAAELATATTVVTASALGLPISTTHTLVGAVLGIGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    + +I TSW VT+P GA LS+++
Sbjct  383  IGALNLGVIGKIFTSWLVTLPVGAALSIVF  412



>ref|WP_027908810.1| phosphate permease [Pseudomonas sp. URMO17WK12:I4]
Length=421

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++VIATIGKKITELTP+RGFAAE A A  V+ AS +GLPIS THTLVGAV+G+G ARG
Sbjct  323  YGWKVIATIGKKITELTPSRGFAAELATAATVVAASGIGLPISTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    V  I TSW VT+P GA L++IY  +F
Sbjct  383  IGALNLAVVGRIFTSWVVTLPIGAALAIIYLEIF  416



>ref|WP_027903817.1| phosphate permease [Pseudomonas sp. URMO17WK12:I3]
Length=421

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++VIATIGKKITELTP+RGFAAE A A  V+ AS +GLPIS THTLVGAV+G+G ARG
Sbjct  323  YGWKVIATIGKKITELTPSRGFAAELATAATVVAASGIGLPISTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    V  I TSW VT+P GA L++IY  +F
Sbjct  383  IGALNLAVVGRIFTSWVVTLPIGAALAIIYLEIF  416



>ref|WP_007231211.1| phosphate permease [gamma proteobacterium HTCC2207]
 gb|EAS47960.1| probable phosphate transporter [marine gamma proteobacterium 
HTCC2207]
Length=426

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+V+ TIG+KITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  327  YGYKVMGTIGRKITELTPSRGFAAELGAAATVVIASGTGLPISTTHTLVGAVLGVGLARG  386

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    V  I  SW VT+PAGA LS+++ +VF
Sbjct  387  IGAIDLRMVGSIFLSWLVTLPAGAGLSIMFFFVF  420



>ref|WP_022959082.1| phosphate permease [Spongiibacter tropicus]
Length=421

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++VIAT+G KITELTP+RGFAAE  AA  V+VAS  GLPIS THTLVGAV+GVG ARG
Sbjct  323  YGFKVIATVGTKITELTPSRGFAAELGAASTVVVASATGLPISTTHTLVGAVLGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +R I  SW VT+PAGA L++++ ++F
Sbjct  383  IAALNLSVIRNIFMSWIVTLPAGAGLAIVFFYIF  416



>ref|WP_022961738.1| phosphate permease [Pseudomonas pelagia]
Length=418

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 4/98 (4%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG+ ITELTP+RGFAAE A A  V+ AS +GLPIS THTLVGAV+GVG ARG
Sbjct  320  YGYRVIATIGRHITELTPSRGFAAELATAITVVGASGIGLPISTTHTLVGAVLGVGIARG  379

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY----TWVF  283
            + ++    +  I +SW +T+PAGA  S+ Y    TW+F
Sbjct  380  IGALNLRVIGTIFSSWLITLPAGAGFSIAYFFILTWIF  417



>ref|WP_027874775.1| phosphate permease [Melitea salexigens]
Length=421

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++VIAT+G KITELTP+RGFAAE  AA  V+ AS  GLPIS THTLVGAV+GVG ARG
Sbjct  323  YGFKVIATVGTKITELTPSRGFAAELGAATTVVFASATGLPISTTHTLVGAVLGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +R I  SW VT+PAGA L++I+ ++F
Sbjct  383  IAALNLRVIRNIFMSWIVTLPAGAGLAIIFFFLF  416



>ref|WP_021205132.1| phosphate permease, partial [Pseudomonas aeruginosa]
 gb|EQM88931.1| phosphate permease, partial [Pseudomonas aeruginosa WC55]
Length=246

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  147  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  206

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I  SW VT+PAGA L++++  V 
Sbjct  207  IGALNLRVIGSIFLSWVVTLPAGALLAILFFLVL  240



>ref|WP_035234414.1| phosphate permease [Alcanivorax sp. 19-m-6]
 gb|KGD63505.1| phosphate transporter [Alcanivorax sp. 19-m-6]
Length=422

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G RV+AT+GKKITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGA++GVG ARG
Sbjct  323  FGARVMATVGKKITELTPSRGFAAELGAATTVVLASGTGLPISTTHTLVGAILGVGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + S+    +  I TSW VT+PAGA LS+++ + F
Sbjct  383  IGSLNLRVIGTIFTSWVVTLPAGALLSILFFYFF  416



>ref|WP_022984745.1| phosphate permease [Alcanivorax sp. P2S70]
 gb|ERP91807.1| phosphate permease [Alcanivorax sp. P2S70]
Length=422

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G RV+AT+GKKITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGA++GVG ARG
Sbjct  323  FGARVMATVGKKITELTPSRGFAAELGAATTVVLASGTGLPISTTHTLVGAILGVGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + S+    +  I TSW VT+PAGA LS+++ + F
Sbjct  383  IGSLNLRVIGTIFTSWVVTLPAGALLSILFFYFF  416



>gb|EPJ24472.1| phosphate transporter family protein [Chlamydia psittaci 03DC29]
Length=204

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+   ++A  + +AS +GLPIS TH +VGAV+G+G ARG
Sbjct  106  WGWRVIETVGCKITELTPSRGFSVGLSSAVTIALASAIGLPISTTHVVVGAVLGIGLARG  165

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTW  277
            ++++    +++I+ SW +T+PAGA LS+++ +
Sbjct  166  IHAINLNIIKDIIMSWFITLPAGAVLSILFFF  197



>ref|WP_039607189.1| phosphate permease [Pseudomonas tuomuerensis]
 gb|KHO63964.1| phosphate permease [Pseudomonas tuomuerensis]
Length=421

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G+RVIATIGK ITELTP+RGFAAE A A  V+ AS LGLPIS THTLVGAV+G+G ARG
Sbjct  323  YGWRVIATIGKGITELTPSRGFAAELATATTVVAASALGLPISTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I TSW VT+P GA  S+++  +F
Sbjct  383  IGALNLGVIGKIFTSWLVTLPVGAAFSILFFLIF  416



>ref|WP_026377419.1| inorganic phosphate transporter PiT family protein [Aestuariibacter 
salexigens]
Length=422

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G+RVIATIGK IT LTP+RGFAAE AAA  V++AS  GLPIS T TLVGAV+GVG ARG
Sbjct  323  FGHRVIATIGKGITHLTPSRGFAAELAAATTVVIASGTGLPISTTQTLVGAVLGVGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    VR IV SW VT+PAGA LS+I+ ++F
Sbjct  383  IAALNLGVVRNIVVSWVVTLPAGAGLSIIFFYIF  416



>ref|WP_007639810.1| phosphate permease [Cellvibrio sp. BR]
 gb|EIK46883.1| pho4 family protein [Cellvibrio sp. BR]
Length=424

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+V+ TIGKKITELTP+RGFAAE +AA  V++AS LGLPIS THTLVGAV+GVG ARG
Sbjct  326  YGYKVMQTIGKKITELTPSRGFAAEMSAAATVVIASGLGLPISTTHTLVGAVLGVGLARG  385

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTW  277
            + ++    +  I  SW +T+PAGA LS+++ +
Sbjct  386  IGALNLRVIGGIFASWVITLPAGAGLSILFFY  417



>ref|WP_018624110.1| phosphate permease [Kangiella aquimarina]
Length=426

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G RV+ATIGKKIT LTP+RGFAAE AAA  V++AS  GLPIS T TLVGAV+GVG ARG+
Sbjct  328  GSRVMATIGKKITHLTPSRGFAAELAAASTVIIASGAGLPISTTQTLVGAVLGVGMARGI  387

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             ++    VR I  SW VT+PAGA LSVI+ ++F
Sbjct  388  AALNLGVVRNIFVSWVVTLPAGAILSVIFFFIF  420



>ref|WP_019340863.1| phosphate permease [Pseudomonas stutzeri]
Length=421

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA LS+I+
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAILSIIF  412



>ref|WP_028671827.1| phosphate permease [Saccharospirillum impatiens]
Length=421

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+V+ TIG+KITELTP+RGFAAE AAA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  323  YGYKVMGTIGRKITELTPSRGFAAELAAATTVVMASGTGLPISTTHTLVGAVLGVGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            ++++    V  I  SW VT+PAGA L++I+ ++F
Sbjct  383  ISALNLRVVGTIFASWIVTLPAGAFLAIIFFFMF  416



>gb|ERI52000.1| phosphate permease [Pseudomonas sp. EGD-AK9]
Length=389

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE AAA  V+ AS LGLP+S THTLVGA++GVG ARG
Sbjct  289  YGYKVIATIGKEITELTPSRGFAAELAAATTVVSASGLGLPVSTTHTLVGAILGVGLARG  348

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I  SW +T+P GA LS+++ ++ 
Sbjct  349  IGALNLGMIGKIFLSWIITLPVGAALSILFFFIL  382



>ref|WP_001888859.1| Phosphate/sulphate permeases, partial [Vibrio cholerae]
 gb|EAZ48763.1| Phosphate/sulphate permeases [Vibrio cholerae V51]
Length=127

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G++V+ATIG  ITELTP+RGFAA+ A A  V++AS  GLPIS T TLVGAV+GVGFARG+
Sbjct  29   GHKVMATIGTGITELTPSRGFAAQLATASTVVLASGTGLPISTTQTLVGAVLGVGFARGI  88

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIY  271
             ++    VR IV SW VT+PAGA L+V++
Sbjct  89   AALNLGVVRNIVASWVVTLPAGALLAVVF  117



>ref|WP_022967481.1| phosphate permease [Pseudomonas caeni]
Length=421

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIAT+G+ ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATVGRGITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            ++++    +  I  SWA+T+PAGA LS+++
Sbjct  383  ISALNLRVIGSIFMSWAITLPAGAFLSIVF  412



>ref|WP_028490174.1| phosphate permease [Thiothrix lacustris]
Length=420

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VI T+G KITELTPTRGF+AE A A  V++AS  G+P+S THTLVGA++GVGFARG
Sbjct  322  YGYKVIQTVGNKITELTPTRGFSAEIATAMTVVMASYTGIPVSTTHTLVGAILGVGFARG  381

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    V  I  SW VT+PAGA LSV++ ++ 
Sbjct  382  IAAIDLRVVGGIFMSWVVTLPAGALLSVLFFYLL  415



>ref|WP_003286754.1| phosphate permease [Pseudomonas stutzeri]
 gb|EIK54573.1| phosphate transporter [Pseudomonas stutzeri TS44]
Length=421

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIAT+GK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATVGKEITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    + +I  SW VT+PAGA LS+++
Sbjct  383  IGALNLSVIGKIFVSWIVTLPAGALLSILF  412



>ref|WP_029866569.1| phosphate permease, partial [Vibrio parahaemolyticus]
Length=102

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G++V+AT+G  ITELTP+RGFAA+ A A  V++AS  GLPIS T TLVGAV+GVGFARG+
Sbjct  5    GHKVMATVGTGITELTPSRGFAAQLATACTVVLASGTGLPISTTQTLVGAVLGVGFARGI  64

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTW  277
             ++    VR IV SW VT+PAGA L+V++ +
Sbjct  65   AALNLGVVRNIVASWIVTLPAGALLAVVFFY  95



>ref|WP_031303133.1| phosphate permease [Pseudomonas sp. EGD-AK9]
Length=423

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE AAA  V+ AS LGLP+S THTLVGA++GVG ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELAAATTVVSASGLGLPVSTTHTLVGAILGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I  SW +T+P GA LS+++ ++ 
Sbjct  383  IGALNLGMIGKIFLSWIITLPVGAALSILFFFIL  416



>ref|WP_007224135.1| phosphate permease [marine gamma proteobacterium HTCC2143]
 gb|EAW32761.1| probable phosphate transporter [marine gamma proteobacterium 
HTCC2143]
Length=427

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++V+ATIGKKITELTP+RGFAAE AAA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  329  YGFKVMATIGKKITELTPSRGFAAELAAATTVVLASATGLPISTTHTLVGAVLGVGLARG  388

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    V  I  SW +T+PAGA L++++ + F
Sbjct  389  IGALNLRVVGSIFMSWVITLPAGAGLAILFFFTF  422



>ref|WP_015781167.1| phosphate permease [Kangiella koreensis]
 ref|YP_003147330.1| phosphate transporter [Kangiella koreensis DSM 16069]
 gb|ACV27562.1| phosphate transporter [Kangiella koreensis DSM 16069]
Length=426

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G RV+ATIG+KIT LTP+RGFAAE AAA  V++AS  GLPIS T TLVGAV+GVG ARG+
Sbjct  328  GSRVMATIGQKITHLTPSRGFAAELAAASTVIIASGAGLPISTTQTLVGAVLGVGMARGI  387

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             ++    VR I+ SW VT+PAGA LSVI+ ++F
Sbjct  388  AALNLGVVRNILVSWVVTLPAGAILSVIFFFIF  420



>ref|WP_007150635.1| phosphate permease [Alcanivorax sp. DG881]
 gb|EDX90228.1| Phosphate transporter family [Alcanivorax sp. DG881]
Length=422

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G RV+AT+GK ITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGAV+GVG ARG+
Sbjct  324  GARVMATVGKNITELTPSRGFAAELGAAGTVILASGTGLPISTTHTLVGAVLGVGMARGI  383

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             S+    V  I TSW VT+PAGA LS+++ + F
Sbjct  384  GSLNLRVVSTIFTSWVVTLPAGALLSILFFYFF  416



>ref|WP_039562486.1| phosphate permease [Serpens flexibilis]
 gb|KHL68020.1| phosphate permease [Serpens flexibilis]
Length=421

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++VIATIGK ITELTP+RGFAAE A A  V+ AS LGLPIS THTLVGAV+G+G ARG
Sbjct  323  YGWKVIATIGKGITELTPSRGFAAELATATTVVAASALGLPISTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I TSW VT+P GA LS+++  +F
Sbjct  383  IGALNLGVIGKIFTSWLVTLPVGAGLSILFFLIF  416



>ref|WP_027949922.1| phosphate permease [Haliea salexigens]
Length=425

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++VI T+G+KITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGA++GVGFARG
Sbjct  327  YGWKVIMTVGRKITELTPSRGFAAELGAASTVVLASGTGLPISTTHTLVGAILGVGFARG  386

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++   T+  I  SW +T+PAGA LS+I+ + F
Sbjct  387  IAALNLRTIGTIFMSWIITLPAGAALSIIFFFTF  420



>ref|WP_011458489.1| phosphate permease [Chlamydophila felis]
 ref|YP_515861.1| phosphate permease [Chlamydophila felis Fe/C-56]
 dbj|BAE81716.1| phosphate permease [Chlamydophila felis Fe/C-56]
Length=426

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+A  ++A  + +AS LGLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETVGCKITELTPSRGFSAGLSSAVTIALASALGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            ++++    +++IV SW +T+PAGA LS+++
Sbjct  388  IHAINLNIIKDIVMSWFITLPAGAILSILF  417



>ref|WP_021828834.1| phosphate transporter family protein [Chlamydia gallinacea]
 gb|ERL53813.1| phosphate transporter family protein [Chlamydia gallinacea 08-1274/3]
Length=426

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI TIG KITELTP+RGF+    AA  + +AS LGLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETIGCKITELTPSRGFSVGLGAAITIALASALGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            ++++    +++I+ SW +T+PAGA LS+++
Sbjct  388  IHAINLNIIKDIIMSWFITLPAGAILSILF  417



>dbj|BAP77709.1| Pho4 family protein [Pseudomonas sp. MT-1]
Length=421

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA LS+++
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAFLSIVF  412



>ref|WP_039806343.1| phosphate permease [Azotobacter chroococcum]
 gb|AJE23016.1| Phosphate transporter family protein [Azotobacter chroococcum 
NCIMB 8003]
Length=421

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW +T+PAGA LS+++
Sbjct  383  IGALNLGVIGSIFVSWIITLPAGAILSIVF  412



>ref|WP_000585185.1| hypothetical protein, partial [Vibrio cholerae]
 gb|EDL71177.1| pho4 family protein [Vibrio cholerae 623-39]
Length=182

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G++V+ATIG  ITELTP+RGFAA+ A A  V++AS  GLPIS T TLVGAV+GVGFARG+
Sbjct  84   GHKVMATIGTGITELTPSRGFAAQLATASTVVLASGTGLPISTTQTLVGAVLGVGFARGI  143

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTW  277
             ++    VR IV SW VT+PAGA L+V++ +
Sbjct  144  AALNLGVVRNIVASWVVTLPAGALLAVVFFY  174



>gb|ETR80606.1| putative low-affinity inorganic phosphate transporter [Chlamydia 
pneumoniae B21]
Length=279

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+    +A  + +AS LGLPIS TH +VGAV+G+G ARG
Sbjct  181  WGWRVIETVGCKITELTPSRGFSVGMGSALTIALASILGLPISTTHVVVGAVLGIGLARG  240

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTW  277
            + ++    +++IV SW +T+PAGA LS+++ +
Sbjct  241  IRAINLNIIKDIVLSWFITLPAGALLSILFFF  272



>ref|WP_002537644.1| putative low-affinity inorganic phosphate transporter [Grimontia 
indica]
 gb|EOD80316.1| putative low-affinity inorganic phosphate transporter [Grimontia 
indica]
Length=421

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G++V+AT+G  ITELTP+RGFAA+ A A  V++AS  GLPIS T TLVGAV+GVGFARG+
Sbjct  323  GHKVMATVGSGITELTPSRGFAAQLATASTVVLASGTGLPISTTQTLVGAVLGVGFARGI  382

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             ++    VR IV SW VT+PAGA L+VI+ +V 
Sbjct  383  GALNLGVVRNIVASWVVTLPAGALLAVIFFYVM  415



>ref|WP_012486161.1| phosphate permease [Cellvibrio japonicus]
 ref|YP_001981004.1| pho4 family protein [Cellvibrio japonicus Ueda107]
 gb|ACE84111.1| pho4 family protein [Cellvibrio japonicus Ueda107]
Length=424

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+V+ TIGKKITELTP+RGFAAE AAA  V++AS +GLPIS THTLVGAV+GVG ARG
Sbjct  326  YGYKVMVTIGKKITELTPSRGFAAEMAAAATVVIASGIGLPISTTHTLVGAVLGVGLARG  385

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I  SW +T+PAGA LS+++ + F
Sbjct  386  IGALNLGVIGGIFASWVITLPAGAGLSILFFYFF  419



>ref|WP_027591423.1| phosphate permease [Pseudomonas sp. RL]
Length=421

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++VIATIGK ITELTP+RGFAAE A A  V+ AS LGLPIS THTLVGAV+G+G ARG
Sbjct  323  YGWKVIATIGKGITELTPSRGFAAELATATTVVAASALGLPISTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I TSW VT+P GA  S+++  +F
Sbjct  383  IGALNLGVIGKIFTSWLVTLPVGAAFSILFFLIF  416



>gb|KGK85278.1| phosphate permease [Pseudomonas sp. HMP271]
Length=421

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIAT+GK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATVGKEITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    + +I  SW VT+PAGA LS+++
Sbjct  383  IGALNLGVIGKIFVSWIVTLPAGALLSILF  412



>ref|WP_035245243.1| phosphate permease [Alcanivorax jadensis]
 gb|KGD62480.1| phosphate transporter [Alcanivorax jadensis T9]
Length=422

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G RV+AT+GK ITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGA++GVG ARG+
Sbjct  324  GARVMATVGKNITELTPSRGFAAELGAAGTVILASGTGLPISTTHTLVGAILGVGMARGI  383

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             S+    V  I TSW VT+PAGA LS+++ + F
Sbjct  384  GSLNLRVVSTIFTSWVVTLPAGALLSILFFYFF  416



>ref|WP_008569404.1| phosphate permease [Pseudomonas sp. Chol1]
 gb|EKM95089.1| phosphate transporter [Pseudomonas sp. Chol1]
Length=421

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIAT+GK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATVGKEITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    + +I  SW VT+PAGA LS+++
Sbjct  383  IGALNLGVIGKIFVSWIVTLPAGALLSILF  412



>ref|WP_012940626.1| phosphate permease [Archaeoglobus profundus]
 ref|YP_003400963.1| phosphate transporter [Archaeoglobus profundus DSM 5631]
 gb|ADB58290.1| phosphate transporter [Archaeoglobus profundus DSM 5631]
Length=334

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGYRVI T+G++ITELTPTRGF+AEFA A  VL+AS LG+PIS THTLVG+V+GVG A G
Sbjct  237  WGYRVIETVGRRITELTPTRGFSAEFATATTVLLASYLGMPISTTHTLVGSVIGVGLAGG  296

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSV-IYT  274
            L SV  + V+ IV SW +T+P    LS+ IYT
Sbjct  297  LASVNLKIVQRIVASWVLTVPVACVLSIAIYT  328



>ref|WP_035015039.1| inorganic phosphate transporter PiT family protein [Catenovulum 
agarivorans]
 gb|EWH09543.1| phosphate transporter [Catenovulum agarivorans DS-2]
Length=425

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G+RV+ATIGK IT LTP+RGFAAE AAA  V++AS  GLPIS T TLVGAV+GVGFARG
Sbjct  327  FGHRVMATIGKGITHLTPSRGFAAELAAATTVVIASGTGLPISTTQTLVGAVLGVGFARG  386

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
            + ++   TVR IV SW VT+PAGA L++I   + T 
Sbjct  387  IAALNLGTVRNIVVSWVVTLPAGAGLAIIAYLILTS  422



>ref|WP_020414287.1| phosphate permease [Microbulbifer variabilis]
Length=424

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++V+ATIGKKITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  326  YGFKVMATIGKKITELTPSRGFAAELGAAATVVLASGTGLPISTTHTLVGAVLGVGLARG  385

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I  SW VT+PAGA +++++ ++F
Sbjct  386  IGALNLRMITTIAASWVVTLPAGAGIAILFFYLF  419



>ref|WP_008044323.1| phosphate permease [Reinekea blandensis]
 gb|EAR09369.1| phosphate transporter, putative [Reinekea sp. MED297]
Length=421

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+V+ TIG+KITELTP+RGFAAE AAA  V++AS  GLP+S THTLVGAV+GVG ARG
Sbjct  323  FGYKVMGTIGRKITELTPSRGFAAELAAATTVVIASGTGLPVSTTHTLVGAVLGVGLARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            ++++    +  IV+SW +T+PAGA LS+++
Sbjct  383  ISALNLRVIGSIVSSWIITLPAGAFLSILF  412



>ref|WP_029890723.1| phosphate permease [Polycyclovorans algicola]
Length=416

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G RV+AT+G +IT+LTP+RGFAA  AAA  V+VAS  GLPIS THTLVGAV+GVG ARG
Sbjct  318  FGQRVMATVGTRITDLTPSRGFAATLAAAGTVVVASGTGLPISTTHTLVGAVLGVGLARG  377

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +R I  SW +T+PAGA LSVI+ +V 
Sbjct  378  IGALNMSVIRSIFASWIITLPAGAILSVIFFYVL  411



>ref|WP_015048026.1| phosphate permease [Simiduia agarivorans]
 ref|YP_006917594.1| phosphate transporter family protein [Simiduia agarivorans SA1 
= DSM 21679]
 gb|AFU99864.1| phosphate transporter family protein [Simiduia agarivorans SA1 
= DSM 21679]
Length=422

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G+RV+ATIGKKIT LTP+RGFAAE  AA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  324  YGHRVMATIGKKITHLTPSRGFAAELGAAGTVVLASGTGLPISTTHTLVGAVLGVGLARG  383

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I  SW VT+PAGA L+V++ + F
Sbjct  384  IGALNLRVIGSIFMSWIVTLPAGALLAVVFFYFF  417



>ref|WP_005571961.1| hypothetical protein [Aggregatibacter actinomycetemcomitans]
 gb|EGY49357.1| LOW QUALITY PROTEIN: phosphate permease [Aggregatibacter actinomycetemcomitans 
serotype b str. I23C]
 gb|ELT55240.1| phosphate permease [Aggregatibacter actinomycetemcomitans serotype 
b str. SCC4092]
 gb|ELT58896.1| phosphate permease [Aggregatibacter actinomycetemcomitans serotype 
a str. A160]
Length=177

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            GY+V+ATIG  IT+LTP+RGFAA+FA A  V+VAS  GLPIS T TLVGAV+G+GFARG+
Sbjct  80   GYKVMATIGTGITDLTPSRGFAAQFATAMTVVVASGTGLPISTTQTLVGAVLGIGFARGI  139

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             ++    +R IV SW VT+PAGA  S+I  ++ 
Sbjct  140  AAINLTVIRNIVVSWVVTLPAGALFSIIIYYLL  172



>gb|ERS10161.1| phosphate permease [Alcanivorax sp. PN-3]
Length=419

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G RV+AT+G KITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGAV+GVG ARG+
Sbjct  321  GARVMATVGTKITELTPSRGFAAELGAATTVVLASGTGLPISTTHTLVGAVLGVGMARGI  380

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             S+    +  I TSW VT+PAGA LS+++ + F
Sbjct  381  GSLNLRVISTIFTSWIVTLPAGALLSILFFYFF  413



>ref|WP_014945700.1| phosphate permease [Chlamydia psittaci]
 ref|YP_006739053.1| phosphate transporter family protein [Chlamydia psittaci CP3]
 ref|YP_006741211.1| phosphate transporter family protein [Chlamydia psittaci MN]
 ref|YP_006973989.1| putative phosphate permease [Chlamydia psittaci 01DC12]
 gb|AFS21148.1| phosphate transporter family protein [Chlamydia psittaci MN]
 gb|AFS26488.1| phosphate transporter family protein [Chlamydia psittaci CP3]
 emb|CCO01587.1| putative phosphate permease [Chlamydia psittaci 01DC12]
Length=426

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+   ++A  + +AS +GLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETVGCKITELTPSRGFSVGLSSAVTIALASAIGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            ++++    +++I+ SW +T+PAGA LSV++
Sbjct  388  IHAINLNIIKDIIMSWFITLPAGAVLSVLF  417



>ref|WP_020370780.1| MULTISPECIES: phosphate transporter family protein [Chlamydia]
 gb|EPP34841.1| phosphate transporter family protein [Chlamydia psittaci 10_1398_11]
 gb|EQM63123.1| phosphate transporter family protein [Chlamydia ibidis 10-1398/6]
Length=426

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+    AA  + VAS +GLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETVGCKITELTPSRGFSVGLGAAITIAVASAIGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +++IV SW +T+PAGA LS+++
Sbjct  388  IQAINLNIIKDIVMSWFITLPAGAILSILF  417



>ref|WP_033942028.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAALAILF  412



>ref|WP_019528804.1| phosphate permease [Dasania marina]
Length=427

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G++V+ TIGKKITELTP+RGFAAE  AA  V+ AS  GLPIS THTLVGAV+GVG ARG
Sbjct  329  YGFKVMGTIGKKITELTPSRGFAAELGAATTVVFASATGLPISTTHTLVGAVLGVGMARG  388

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I  SW +T+PAGA L++I+ ++F
Sbjct  389  IGALNLRVISTIFMSWIITLPAGAGLAIIFFFLF  422



>ref|WP_026948531.1| MULTISPECIES: phosphate permease [Alcanivorax]
Length=422

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G RV+AT+G KITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGAV+GVG ARG+
Sbjct  324  GARVMATVGTKITELTPSRGFAAELGAATTVVLASGTGLPISTTHTLVGAVLGVGMARGI  383

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             S+    +  I TSW VT+PAGA LS+++ + F
Sbjct  384  GSLNLRVISTIFTSWIVTLPAGALLSILFFYFF  416



>ref|WP_011911511.1| phosphate permease [Pseudomonas stutzeri]
 ref|YP_001170821.1| phosphate transporter [Pseudomonas stutzeri A1501]
 gb|ABP77979.1| probable phosphate transporter [Pseudomonas stutzeri A1501]
Length=421

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVSASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA L++++
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAFLAIVF  412



>ref|WP_034069730.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_034019403.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_014993005.1| phosphate permease [Alcanivorax dieselolei]
 ref|YP_006819267.1| phosphate transporter [Alcanivorax dieselolei B5]
 gb|AFT68924.1| Phosphate transporter, putative [Alcanivorax dieselolei B5]
Length=422

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G RV+AT+G KITELTP+RGFAAE  AA  V++AS  GLPIS THTLVGAV+GVG ARG+
Sbjct  324  GARVMATVGTKITELTPSRGFAAELGAATTVVLASGTGLPISTTHTLVGAVLGVGMARGI  383

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             S+    +  I TSW VT+PAGA LS+++ + F
Sbjct  384  GSLNLRVISTIFTSWIVTLPAGALLSILFFYFF  416



>ref|WP_023087900.1| phosphate transporter [Pseudomonas aeruginosa]
 gb|ERU72550.1| phosphate transporter [Pseudomonas aeruginosa C23]
 gb|ERU75745.1| phosphate transporter [Pseudomonas aeruginosa C20]
 gb|ERW00644.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA024]
 gb|ERW15493.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA023]
 gb|ERW78078.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA005]
 gb|ERY61136.1| phosphate transporter [Pseudomonas aeruginosa BL02]
 gb|ETU83405.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA048]
 gb|EWH24703.1| phosphate permease [Pseudomonas aeruginosa SG17M]
 gb|EZN43922.1| phosphate transporter [Pseudomonas aeruginosa BWH036]
 gb|EZN75501.1| phosphate transporter [Pseudomonas aeruginosa BWH031]
 gb|EZP09325.1| phosphate transporter [Pseudomonas aeruginosa BWH051]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_025164044.1| phosphate permease [Pseudomonas taeanensis]
 gb|KFX71208.1| phosphate permease [Pseudomonas taeanensis MS-3]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+GVG ARG
Sbjct  322  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGVGIARG  381

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V +I  SW +T+P GA LS+++
Sbjct  382  IGALNLGVVGKIFMSWIITLPVGAALSILF  411



>ref|WP_031689475.1| phosphate permease [Pseudomonas aeruginosa]
 gb|EZO96807.1| phosphate transporter [Pseudomonas aeruginosa BWH052]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_008739393.1| phosphate permease [Alcanivorax pacificus]
 gb|AJD46867.1| phosphate transporter [Alcanivorax pacificus W11-5]
Length=421

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G RV++T+G KITELTP+RGFAAE  AA  V++AS +GLPIS THTLVGAV+GVG ARG+
Sbjct  324  GARVMSTVGSKITELTPSRGFAAELGAASTVVIASGIGLPISTTHTLVGAVLGVGMARGI  383

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVFT  286
            +++    +  I TSW VT+PAGA LS+++ ++ T
Sbjct  384  SALNLRVISTIFTSWIVTLPAGAGLSILFFYMLT  417



>ref|WP_031653120.1| phosphate permease [Pseudomonas aeruginosa]
 gb|EZO66188.1| phosphate transporter [Pseudomonas aeruginosa BWH057]
 gb|EZO79278.1| phosphate transporter [Pseudomonas aeruginosa BWH056]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_003096269.1| phosphate permease [Pseudomonas aeruginosa]
 ref|YP_005984162.1| phosphate transporter [Pseudomonas aeruginosa NCGM2.S1]
 gb|EFQ41265.1| putative phosphate transporter [Pseudomonas aeruginosa 39016]
 dbj|BAK92777.1| phosphate transporter [Pseudomonas aeruginosa NCGM2.S1]
 gb|ERV07960.1| phosphate transporter [Pseudomonas aeruginosa BL17]
 gb|ERV27787.1| phosphate transporter [Pseudomonas aeruginosa BL14]
 gb|ERV52825.1| phosphate transporter [Pseudomonas aeruginosa BL08]
 gb|ERW77255.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA006]
 gb|ERX31482.1| phosphate transporter [Pseudomonas aeruginosa 6077]
 gb|ERX33287.1| phosphate transporter [Pseudomonas aeruginosa U2504]
 gb|ERZ07603.1| phosphate transporter [Pseudomonas aeruginosa JJ692]
 emb|CDH80296.1| putative phosphate transporter [Pseudomonas aeruginosa MH27]
 gb|EZN68333.1| phosphate transporter [Pseudomonas aeruginosa BWH030]
 dbj|BAP25062.1| phosphate transporter [Pseudomonas aeruginosa]
 dbj|BAP53872.1| phosphate transporter [Pseudomonas aeruginosa]
 emb|CDM54801.1| putative phosphate transporter [Pseudomonas aeruginosa WS394]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_010489432.1| phosphate permease [Pseudomonas sp. S9]
Length=423

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+GVG ARG
Sbjct  322  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGVGIARG  381

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWV  280
            + ++    + +I  SW +T+P GA LS+ + ++
Sbjct  382  IGALNLGVIGKIFMSWLITLPVGAALSIFFFFI  414



>ref|WP_030047074.1| phosphate permease [Pseudomonas aeruginosa]
 dbj|GAJ53312.1| probable low-affinity inorganic phosphate transporter [Pseudomonas 
aeruginosa RB]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>emb|CEG54081.1| putative phosphate permease HI_1604 [Pseudomonas xanthomarina]
Length=421

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA L++++
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAFLAIVF  412



>ref|WP_016401669.1| probable low-affinity inorganic phosphate transporter [Agarivorans 
albus]
 dbj|GAD01901.1| probable low-affinity inorganic phosphate transporter [Agarivorans 
albus MKT 106]
Length=421

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G+RVIATIGK IT LTP+RGFAAE AAA  V+VAS  GLPIS T TLVGAV+GVG ARG
Sbjct  323  FGHRVIATIGKGITHLTPSRGFAAELAAATTVVVASGTGLPISTTQTLVGAVLGVGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    VR IV SW VT+PAGA LS+++ ++ 
Sbjct  383  IAALNLGVVRSIVVSWVVTLPAGAALSIVFYYIM  416



>ref|WP_034069148.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_031628724.1| phosphate permease [Pseudomonas aeruginosa]
 gb|KEF92255.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_023092740.1| phosphate transporter [Pseudomonas aeruginosa]
 gb|ERX91545.1| phosphate transporter [Pseudomonas aeruginosa BL25]
 gb|ETD54349.1| phosphate permease [Pseudomonas aeruginosa VRFPA07]
 gb|ETV25308.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA043]
 gb|EZP18584.1| phosphate transporter [Pseudomonas aeruginosa BWH050]
 gb|EZP22208.1| phosphate transporter [Pseudomonas aeruginosa BWH049]
 gb|KHE36334.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_023111981.1| phosphate transporter [Pseudomonas aeruginosa]
 gb|ERV91512.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA026]
 gb|ETU72545.1| phosphate transporter [Pseudomonas aeruginosa PS50]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_003100079.1| MULTISPECIES: phosphate permease [Pseudomonas]
 ref|NP_253894.1| phosphate transporter [Pseudomonas aeruginosa PAO1]
 ref|YP_793679.1| phosphate transporter [Pseudomonas aeruginosa UCBPP-PA14]
 ref|YP_008135865.1| phosphate permease [Pseudomonas aeruginosa RP73]
 ref|YP_008984925.1| putative low-affinity inorganic phosphate transporter [Pseudomonas 
aeruginosa SCV20265]
 ref|YP_008555485.1| phosphate transporter family protein [Pseudomonas aeruginosa 
c7447m]
 ref|YP_008560986.1| phosphate transporter family protein [Pseudomonas aeruginosa 
PAO581]
 ref|YP_008697126.1| phosphate transporter family protein [Pseudomonas aeruginosa 
PAO1-VE2]
 ref|YP_008709407.1| phosphate transporter family protein [Pseudomonas aeruginosa 
PAO1-VE13]
 gb|AAG08592.1|AE004933_8 probable phosphate transporter [Pseudomonas aeruginosa PAO1]
 gb|ABJ14591.1| probable phosphate transporter [Pseudomonas aeruginosa UCBPP-PA14]
 dbj|GAA20321.1| probable phosphate transporter [Pseudomonas aeruginosa NCMG1179]
 gb|EHS35597.1| phosphate transporter [Pseudomonas aeruginosa MPAO1/P1]
 gb|EHS43738.1| phosphate transporter [Pseudomonas aeruginosa MPAO1/P2]
 gb|EJZ72047.1| phosphate transporter [Pseudomonas aeruginosa PAO579]
 gb|EKA29490.1| phosphate transporter [Pseudomonas aeruginosa ATCC 14886]
 gb|EKA39625.1| phosphate transporter [Pseudomonas aeruginosa CI27]
 gb|EKA49933.1| phosphate transporter [Pseudomonas aeruginosa E2]
 emb|CCQ87651.1| Probable low-affinity inorganic phosphate transporter [Pseudomonas 
aeruginosa 18A]
 gb|EME94436.1| phosphate transporter [Pseudomonas aeruginosa PA21_ST175]
 gb|ENH90540.1| phosphate transporter [Pseudomonas aeruginosa PA45]
 gb|EOQ76802.1| phosphate transporter [Pseudomonas aeruginosa VRFPA02]
 gb|EOT06582.1| phosphate transporter [Pseudomonas aeruginosa PA14]
 gb|EOT09011.1| phosphate transporter [Pseudomonas aeruginosa MSH-10]
 gb|AGO42673.1| phosphate permease [Pseudomonas aeruginosa RP73]
 gb|ERF06185.1| phosphate permease [Pseudomonas aeruginosa HB13]
 gb|AGV64974.1| phosphate transporter family protein [Pseudomonas aeruginosa 
c7447m]
 gb|AGV57575.1| phosphate transporter family protein [Pseudomonas aeruginosa 
PAO581]
 gb|ERU31916.1| phosphate transporter [Pseudomonas aeruginosa CF614]
 gb|ERU39586.1| phosphate transporter [Pseudomonas aeruginosa CF77]
 gb|ERU46861.1| phosphate transporter [Pseudomonas aeruginosa C52]
 gb|ERU53917.1| phosphate transporter [Pseudomonas aeruginosa C48]
 gb|ERU54979.1| phosphate transporter [Pseudomonas aeruginosa C51]
 gb|ERU59091.1| phosphate transporter [Pseudomonas aeruginosa C41]
 gb|ERU62139.1| phosphate transporter [Pseudomonas aeruginosa C40]
 gb|ERU87547.1| phosphate transporter [Pseudomonas aeruginosa M9A.1]
 gb|ERU99115.1| phosphate transporter [Pseudomonas aeruginosa M8A.1]
 gb|ERV28481.1| phosphate transporter [Pseudomonas aeruginosa BL16]
 gb|ERV39922.1| phosphate transporter [Pseudomonas aeruginosa BL11]
 gb|ERV65757.1| phosphate transporter [Pseudomonas aeruginosa BL07]
 gb|ERV80881.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA027]
 gb|ERW11029.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA022]
 gb|ERW42379.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA020]
 gb|ERW49308.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA017]
 gb|ERW59032.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA013]
 gb|ERW71588.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA011]
 gb|ERW97967.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA003]
 gb|ERW99496.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA002]
 gb|ERX03089.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA001]
 gb|ERX26344.1| phosphate transporter [Pseudomonas aeruginosa S35004]
 gb|ERX44124.1| phosphate transporter [Pseudomonas aeruginosa UDL]
 gb|ERX49278.1| phosphate transporter [Pseudomonas aeruginosa CF18]
 gb|ERX54990.1| phosphate transporter [Pseudomonas aeruginosa X24509]
 gb|ERX62220.1| phosphate transporter [Pseudomonas aeruginosa MSH3]
 gb|ERX73525.1| phosphate transporter [Pseudomonas aeruginosa E2]
 gb|ERX83355.1| phosphate transporter [Pseudomonas aeruginosa M8A.4]
 gb|ERY02150.1| phosphate transporter [Pseudomonas aeruginosa BL24]
 gb|ERY38607.1| phosphate transporter [Pseudomonas aeruginosa BL12]
 gb|ERY42888.1| phosphate transporter [Pseudomonas aeruginosa BL05]
 gb|ERY51370.1| phosphate transporter [Pseudomonas aeruginosa BL06]
 gb|ERY59324.1| phosphate transporter [Pseudomonas aeruginosa BL03]
 gb|ERY74863.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA015]
 gb|ERY87840.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA009]
 gb|ERY92765.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA008]
 gb|ERZ23778.1| phosphate transporter [Pseudomonas aeruginosa CF27]
 gb|ERZ34227.1| phosphate transporter [Pseudomonas aeruginosa MSH10]
 gb|ERZ38365.1| phosphate transporter [Pseudomonas aeruginosa CF127]
 gb|AGY64912.1| phosphate transporter family protein [Pseudomonas aeruginosa 
PAO1-VE2]
 gb|AGY71919.1| phosphate transporter family protein [Pseudomonas aeruginosa 
PAO1-VE13]
 gb|AHC80031.1| putative low-affinity inorganic phosphate transporter [Pseudomonas 
aeruginosa SCV20265]
 gb|ETU86265.1| phosphate transporter [Pseudomonas aeruginosa PS42]
 gb|ETU99345.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA046]
 gb|ETV13950.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA044]
 gb|ETV23649.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA042]
 gb|ETV32919.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA041]
 gb|ETV40194.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA039]
 gb|ETV48751.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA038]
 gb|EVT83872.1| phosphate permease [Pseudomonas aeruginosa VRFPA09]
 gb|EYU04776.1| putative low-affinity inorganic phosphate transporter [Pseudomonas 
aeruginosa PA99]
 gb|AHW73954.1| phosphate transporter [Pseudomonas aeruginosa PA96]
 gb|EZN62506.1| phosphate transporter [Pseudomonas aeruginosa BWH032]
 gb|EZN82207.1| phosphate transporter [Pseudomonas aeruginosa BWH029]
 gb|EZO02415.1| phosphate transporter [Pseudomonas aeruginosa 3577]
 gb|EZO18451.1| phosphate transporter [Pseudomonas aeruginosa 3576]
 gb|EZO28384.1| phosphate transporter [Pseudomonas aeruginosa 3575]
 gb|EZO35185.1| phosphate transporter [Pseudomonas aeruginosa PAO1-GFP]
 gb|EZO39555.1| phosphate transporter [Pseudomonas aeruginosa 3574]
 gb|EZO61170.1| phosphate transporter [Pseudomonas aeruginosa BWH058]
 gb|EZO80520.1| phosphate transporter [Pseudomonas aeruginosa BWH055]
 gb|KAJ13529.1| phosphate permease [Pseudomonas aeruginosa IGB83]
 gb|KAJ25313.1| phosphate permease [Pseudomonas aeruginosa M10]
 gb|KDR46447.1| phosphate permease [Pseudomonas aeruginosa]
 gb|KEA10829.1| phosphate permease [Pseudomonas aeruginosa C2773C]
 gb|KEA19527.1| phosphate permease [Pseudomonas aeruginosa C2159M]
 gb|KEA31089.1| phosphate permease [Pseudomonas aeruginosa C0324C]
 gb|KEI27033.1| phosphate permease [Pseudomonas aeruginosa]
 gb|AID76412.1| putative phosphate transporter [Pseudomonas aeruginosa PAO1H2O]
 gb|KFB20773.1| phosphate permease [Pseudomonas aeruginosa PGPR2]
 gb|KFL12115.1| phosphate transporter family protein [Pseudomonas aeruginosa]
 gb|KGD91363.1| phosphate permease [Pseudomonas sp. YS-1p]
 gb|KHE66393.1| phosphate permease [Pseudomonas aeruginosa]
 gb|AJD60917.1| phosphate permease [Pseudomonas aeruginosa]
 emb|CDM48651.1| putative phosphate transporter [Pseudomonas aeruginosa WS136]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_034001041.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_033983828.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_023113490.1| phosphate transporter [Pseudomonas aeruginosa]
 gb|ERV98475.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA025]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_003296844.1| phosphate transporter [Pseudomonas stutzeri]
 gb|EWC43346.1| phosphate permease [Pseudomonas stutzeri KOS6]
Length=421

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA L++++
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAFLAIVF  412



>ref|WP_033973377.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_010793664.1| MULTISPECIES: hypothetical protein [Pseudomonas]
 gb|EMZ51389.1| hypothetical protein HMPREF1224_08778 [Pseudomonas sp. P179]
 gb|ERY72342.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA016]
 gb|ERZ19972.1| phosphate transporter [Pseudomonas aeruginosa CF5]
 gb|ETU73855.1| phosphate transporter [Pseudomonas aeruginosa Z61]
 gb|AHH48395.1| phosphate permease [Pseudomonas aeruginosa YL84]
 gb|EZN56174.1| phosphate transporter [Pseudomonas aeruginosa BWH033]
 emb|CDO84327.1| phosphate transporter [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_034076464.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_033993377.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_004347426.1| phosphate permease [Pseudomonas aeruginosa]
 ref|YP_005977904.1| putative phosphate transporter [Pseudomonas aeruginosa M18]
 ref|YP_006485474.1| phosphate transporter [Pseudomonas aeruginosa DK2]
 gb|EAZ55538.1| hypothetical protein PACG_04212 [Pseudomonas aeruginosa C3719]
 gb|AEO77802.1| putative phosphate transporter [Pseudomonas aeruginosa M18]
 gb|AFM67772.1| phosphate transporter [Pseudomonas aeruginosa DK2]
 gb|ERU91880.1| phosphate transporter [Pseudomonas aeruginosa M8A.2]
 gb|ERY87466.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA010]
 gb|ERZ46301.1| phosphate transporter [Pseudomonas aeruginosa M8A.3]
 gb|ESR94422.1| phosphate permease [Pseudomonas aeruginosa DHS01]
 gb|ESZ79325.1| phosphate permease [Pseudomonas aeruginosa DHS29]
 gb|ETV06826.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA045]
 gb|EZN94219.1| phosphate transporter [Pseudomonas aeruginosa 3580]
 gb|EZN96261.1| phosphate transporter [Pseudomonas aeruginosa 3581]
 gb|EZO65965.1| phosphate transporter [Pseudomonas aeruginosa BWH059]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_003120395.1| phosphate permease [Pseudomonas aeruginosa]
 gb|EJY60476.1| phosphate transporter [Pseudomonas aeruginosa CIG1]
 gb|EKA49300.1| phosphate transporter [Pseudomonas aeruginosa ATCC 25324]
 gb|EMZ50783.1| hypothetical protein HMPREF1223_12068 [Pseudomonas aeruginosa 
str. Stone 130]
 gb|ERY10892.1| phosphate transporter [Pseudomonas aeruginosa BL23]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_003109992.1| phosphate permease [Pseudomonas aeruginosa]
 ref|YP_008888168.1| phosphate permease [Pseudomonas aeruginosa MTB-1]
 gb|EKA32020.1| phosphate transporter [Pseudomonas aeruginosa ATCC 700888]
 gb|ERV31133.1| phosphate transporter [Pseudomonas aeruginosa BL15]
 gb|ERV58537.1| phosphate transporter [Pseudomonas aeruginosa BL09]
 gb|ERX18858.1| phosphate transporter [Pseudomonas aeruginosa X13273]
 gb|ERX76453.1| phosphate transporter [Pseudomonas aeruginosa 62]
 gb|ERY13974.1| phosphate transporter [Pseudomonas aeruginosa BL21]
 gb|ERY22772.1| phosphate transporter [Pseudomonas aeruginosa BL20]
 gb|ERZ14010.1| phosphate transporter [Pseudomonas aeruginosa S54485]
 gb|ESQ63595.1| phosphate permease [Pseudomonas aeruginosa HB15]
 gb|AHB58954.1| phosphate permease [Pseudomonas aeruginosa MTB-1]
 gb|ETD73810.1| phosphate permease [Pseudomonas aeruginosa VRFPA06]
 gb|ETU93982.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA047]
 gb|EZN99544.1| phosphate transporter [Pseudomonas aeruginosa 3579]
 gb|EZO15771.1| phosphate transporter [Pseudomonas aeruginosa 3578]
 gb|KAJ06451.1| phosphate permease [Pseudomonas aeruginosa ID4365]
 gb|KAJ23344.1| phosphate permease [Pseudomonas aeruginosa 148]
 gb|KEA41874.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_011006033.1| phosphate permease [Chlamydophila caviae]
 ref|NP_828934.1| phosphate permease [Chlamydophila caviae GPIC]
 gb|AAP04812.1| phosphate permease family protein [Chlamydophila caviae GPIC]
Length=426

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+   +AA  + +AS +GLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETVGCKITELTPSRGFSVGLSAAVTIALASAMGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            ++++    +++I+ SW +T+PAGA LS+++
Sbjct  388  IHAINLNIIKDIIMSWFITLPAGAILSILF  417



>ref|WP_003298935.1| phosphate transporter [Pseudomonas stutzeri]
 gb|EME01299.1| phosphate transporter [Pseudomonas stutzeri NF13]
Length=421

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA L++++
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAFLAIVF  412



>ref|WP_039027749.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    +  I  SW VT+PAGA L++++  V 
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILFFLVL  416



>ref|WP_034016160.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_033944845.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_023117945.1| phosphate transporter [Pseudomonas aeruginosa]
 gb|ERW42915.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA018]
 gb|EZN58838.1| phosphate transporter [Pseudomonas aeruginosa BWH035]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_023107373.1| phosphate transporter [Pseudomonas aeruginosa]
 ref|YP_008805759.1| putative low-affinity inorganic phosphate transporter [Pseudomonas 
aeruginosa PA1R]
 ref|YP_008812108.1| putative low-affinity inorganic phosphate transporter [Pseudomonas 
aeruginosa PA1]
 gb|ERV75599.1| phosphate transporter [Pseudomonas aeruginosa BL04]
 gb|ERW14556.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA021]
 gb|ERW33502.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA019]
 gb|ERW43571.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA014]
 gb|ERW61068.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA012]
 gb|ERW90579.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA004]
 gb|ERX28468.1| phosphate transporter [Pseudomonas aeruginosa 19660]
 gb|ERY61614.1| phosphate transporter [Pseudomonas aeruginosa BL01]
 gb|ESR67299.1| phosphate permease [Pseudomonas aeruginosa VRFPA05]
 gb|AHA19065.1| putative low-affinity inorganic phosphate transporter [Pseudomonas 
aeruginosa PA1]
 gb|AHA24864.1| putative low-affinity inorganic phosphate transporter [Pseudomonas 
aeruginosa PA1R]
 gb|ETV34411.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA040]
 gb|EZO41910.1| phosphate transporter [Pseudomonas aeruginosa PS75]
 gb|EZO97570.1| phosphate transporter [Pseudomonas aeruginosa BWH054]
 gb|KEA12111.1| phosphate permease [Pseudomonas aeruginosa C1913C]
 emb|CEI80138.1| Phosphate transporter [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_023447040.1| phosphate permease [Pseudomonas chloritidismutans]
 gb|ESQ97016.1| phosphate permease [Pseudomonas chloritidismutans AW-1]
Length=421

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA L++++
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAFLAIVF  412



>ref|WP_039699136.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_037050236.1| phosphate permease [Pseudomonas oleovorans]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+GVG ARG
Sbjct  322  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGVGIARG  381

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
            + ++    + +I  SW +T+P GA LS+ + ++ 
Sbjct  382  IGALNLGVIGKIFMSWLITLPVGAALSIFFFFIL  415



>ref|WP_023098220.1| phosphate transporter [Pseudomonas aeruginosa]
 gb|ERV07214.1| phosphate transporter [Pseudomonas aeruginosa BL18]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_003118032.1| phosphate permease [Pseudomonas aeruginosa]
 gb|EIE43768.1| phosphate transporter [Pseudomonas aeruginosa PADK2_CF510]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>gb|KGB88644.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_019486462.1| phosphate permease [Pseudomonas aeruginosa]
 gb|ERY10302.1| phosphate transporter [Pseudomonas aeruginosa BL22]
 gb|EYU08605.1| putative low-affinity inorganic phosphate transporter [Pseudomonas 
aeruginosa PA103]
 gb|EZO44215.1| phosphate transporter [Pseudomonas aeruginosa BWH060]
 gb|EZO93135.1| phosphate transporter [Pseudomonas aeruginosa BWH053]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_024917729.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_014943633.1| phosphate permease [Chlamydia psittaci]
 ref|YP_006733771.1| phosphate transporter family protein [Chlamydia psittaci GR9]
 ref|YP_006734814.1| phosphate transporter family protein [Chlamydia psittaci VS225]
 ref|YP_006735918.1| phosphate transporter family protein [Chlamydia psittaci WS/RT/E30]
 ref|YP_006738006.1| phosphate transporter family protein [Chlamydia psittaci WC]
 ref|YP_007437784.1| putative phosphate permease [Chlamydia psittaci Mat116]
 gb|AFS20172.1| phosphate transporter family protein [Chlamydia psittaci GR9]
 gb|AFS22249.1| phosphate transporter family protein [Chlamydia psittaci VS225]
 gb|AFS23974.1| phosphate transporter family protein [Chlamydia psittaci WS/RT/E30]
 gb|AFS25919.1| phosphate transporter family protein [Chlamydia psittaci WC]
 gb|AGE74636.1| putative phosphate permease [Chlamydia psittaci Mat116]
 gb|EPJ25407.1| phosphate transporter family protein [Chlamydia psittaci 09DC77]
 gb|EPJ26899.1| phosphate transporter family protein [Chlamydia psittaci 09DC80]
 gb|EPJ28398.1| phosphate transporter family protein [Chlamydia psittaci 99DC5]
 gb|EPJ30395.1| phosphate transporter family protein [Chlamydia psittaci 09DC78]
 gb|EPL01431.1| phosphate transporter family protein [Chlamydia psittaci 09DC79]
 gb|EPP30024.1| phosphate transporter family protein [Chlamydia psittaci 08-2626_L3]
 gb|EPP32512.1| phosphate transporter family protein [Chlamydia psittaci C1/97]
Length=426

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+   ++A  + +AS +GLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETVGCKITELTPSRGFSVGLSSAVTIALASAIGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            ++++    +++I+ SW +T+PAGA LS+++
Sbjct  388  IHAINLNIIKDIIMSWFITLPAGAVLSILF  417



>ref|WP_036750028.1| phosphate permease [Photobacterium halotolerans]
 gb|KDM92450.1| phosphate permease [Photobacterium halotolerans]
Length=422

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G++V+AT+G  ITELTP+RGFAA+ A A  V++AS  GLPIS T TLVGAV+GVGFARG+
Sbjct  325  GHKVMATVGTGITELTPSRGFAAQLATASTVVLASGTGLPISTTQTLVGAVLGVGFARGI  384

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             ++    VR IV SW +T+PAGA LSVI+ +V 
Sbjct  385  AALNLGVVRNIVASWIITLPAGALLSVIFFYVM  417



>ref|WP_023103586.1| phosphate transporter [Pseudomonas aeruginosa]
 gb|ERV38882.1| phosphate transporter [Pseudomonas aeruginosa BL10]
Length=422

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGAVLAILF  412



>ref|WP_006342736.1| phosphate permease [Chlamydia psittaci]
 ref|YP_004421922.1| phosphate transporter family protein [Chlamydia psittaci 6BC]
 ref|YP_005662758.1| phosphate permease family protein [Chlamydia psittaci 6BC]
 ref|YP_005663766.1| phosphate transporter family protein [Chlamydia psittaci 01DC11]
 ref|YP_005664741.1| phosphate transporter family protein [Chlamydia psittaci 08DC60]
 ref|YP_005665714.1| phosphate transporter family protein [Chlamydia psittaci C19/98]
 ref|YP_005666692.1| phosphate transporter family protein [Chlamydia psittaci 02DC15]
 ref|YP_004064052.1| putative phosphate permease [Chlamydia psittaci RD1]
 ref|YP_006732655.1| phosphate transporter family protein [Chlamydia psittaci 84/55]
 emb|CBY16605.1| putative phosphate permease [Chlamydia psittaci RD1]
 gb|ADZ18546.1| phosphate transporter family protein [Chlamydia psittaci 6BC]
 gb|EGF85277.1| phosphate transporter family protein [Chlamydia psittaci Cal10]
 gb|AEB55085.1| phosphate permease family protein [Chlamydia psittaci 6BC]
 gb|AEG85118.1| phosphate transporter family protein [Chlamydia psittaci C19/98]
 gb|AEG86096.1| phosphate transporter family protein [Chlamydia psittaci 01DC11]
 gb|AEG87071.1| phosphate transporter family protein [Chlamydia psittaci 02DC15]
 gb|AEG88049.1| phosphate transporter family protein [Chlamydia psittaci 08DC60]
 gb|AFS19056.1| phosphate transporter family protein [Chlamydia psittaci 84/55]
 gb|EPJ13491.1| phosphate transporter family protein [Chlamydia psittaci 02DC15]
 gb|EPJ14121.1| phosphate transporter family protein [Chlamydia psittaci 02DC16]
 gb|EPJ15887.1| phosphate transporter family protein [Chlamydia psittaci 02DC18]
 gb|EPJ17084.1| phosphate transporter family protein [Chlamydia psittaci 02DC22]
 gb|EPJ18164.1| phosphate transporter family protein [Chlamydia psittaci 01DC11]
 gb|EPJ19744.1| phosphate transporter family protein [Chlamydia psittaci 02DC23]
 gb|EPJ20846.1| phosphate transporter family protein [Chlamydia psittaci 02DC21]
 gb|EPJ22303.1| phosphate transporter family protein [Chlamydia psittaci 04DC42]
 gb|EPJ23156.1| phosphate transporter family protein [Chlamydia psittaci 08DC60]
 gb|EPJ27838.1| phosphate transporter family protein [Chlamydia psittaci C19/98]
 gb|EPJ31504.1| phosphate transporter family protein [Chlamydia psittaci 03DC35]
 gb|EPJ98432.1| phosphate transporter family protein [Chlamydia psittaci 02DC24]
 gb|EPJ99739.1| phosphate transporter family protein [Chlamydia psittaci 02DC14]
 gb|EPP33907.1| phosphate transporter family protein [Chlamydia psittaci C6/98]
Length=426

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+   ++A  + +AS +GLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETVGCKITELTPSRGFSVGLSSAVTIALASAIGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            ++++    +++I+ SW +T+PAGA LS+++
Sbjct  388  IHAINLNIIKDIIMSWFITLPAGAVLSILF  417



>ref|WP_021020528.1| phosphate permease [Vibrio gazogenes]
Length=419

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G++V+AT+G  ITELTP+RGFAA+ A A  V++AS  GLPIS T TLVGAV+GVGFARG+
Sbjct  322  GHKVMATVGTGITELTPSRGFAAQLATASTVVLASGTGLPISTTQTLVGAVLGVGFARGI  381

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVFTK  289
             ++    VR IV SW VT+PAGA L+VI+ ++  K
Sbjct  382  AALNLGVVRNIVASWIVTLPAGALLAVIFYYMLEK  416



>ref|WP_014821981.1| phosphate permease [Pseudomonas stutzeri]
 ref|YP_006459652.1| phosphate transporter [Pseudomonas stutzeri CCUG 29243]
 gb|AFM35229.1| phosphate transporter [Pseudomonas stutzeri CCUG 29243]
Length=421

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA L++++
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAFLAIVF  412



>gb|ETV55287.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA037]
Length=422

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_016958965.1| phosphate permease [Enterovibrio norvegicus]
Length=421

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G++V+AT+G  ITELTP+RGFAA+ A A  V++AS  GLPIS T TLVGAV+GVGFARG+
Sbjct  323  GHKVMATVGTGITELTPSRGFAAQLATASTVVLASGTGLPISTTQTLVGAVLGVGFARGI  382

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             ++    VR IV SW VT+PAGA L+VI+ ++ 
Sbjct  383  GALNLGVVRNIVASWVVTLPAGALLAVIFFYIM  415



>ref|WP_033985201.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_012614660.1| phosphate permease [Pseudomonas aeruginosa]
 ref|YP_002443179.1| putative phosphate transporter [Pseudomonas aeruginosa LESB58]
 ref|YP_008945727.1| phosphate permease [Pseudomonas aeruginosa LES431]
 emb|CAW30355.1| probable phosphate transporter [Pseudomonas aeruginosa LESB58]
 gb|EOT07234.1| phosphate transporter [Pseudomonas aeruginosa PAK]
 gb|ERV08363.1| phosphate transporter [Pseudomonas aeruginosa BL19]
 gb|ERV84283.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA028]
 gb|AHC68234.1| phosphate permease [Pseudomonas aeruginosa LES431]
 gb|AHK86466.1| phosphate permease [Pseudomonas aeruginosa LESlike5]
 gb|AHK92343.1| phosphate permease [Pseudomonas aeruginosa LESlike7]
 gb|AHK98339.1| phosphate permease [Pseudomonas aeruginosa LES400]
 gb|AHL04306.1| phosphate permease [Pseudomonas aeruginosa LESB65]
 gb|AHL10229.1| phosphate permease [Pseudomonas aeruginosa LESlike1]
 gb|AHL16186.1| phosphate permease [Pseudomonas aeruginosa LESlike4]
 gb|EZO37747.1| phosphate transporter [Pseudomonas aeruginosa 3573]
 gb|KAJ90184.1| phosphate permease [Pseudomonas aeruginosa PAK]
Length=422

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_009314471.1| MULTISPECIES: phosphate permease [Pseudomonas]
 ref|YP_007712312.1| phosphate transporter [Pseudomonas aeruginosa B136-33]
 gb|EHF13758.1| hypothetical protein HMPREF1030_02428 [Pseudomonas sp. 2_1_26]
 gb|AGI84388.1| phosphate transporter [Pseudomonas aeruginosa B136-33]
 gb|EQL44437.1| phosphate permease [Pseudomonas aeruginosa VRFPA03]
 gb|ERY24363.1| phosphate transporter [Pseudomonas aeruginosa BL13]
 gb|ERZ06823.1| phosphate transporter [Pseudomonas aeruginosa BWHPSA007]
 gb|ETD50700.1| phosphate permease [Pseudomonas aeruginosa VRFPA08]
 gb|AID87164.1| phosphate permease [Pseudomonas aeruginosa VRFPA04]
 gb|KHE64076.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELATASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_034844020.1| phosphate permease [Endozoicomonas elysicola]
 gb|KEI70051.1| phosphate permease [Endozoicomonas elysicola]
Length=423

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGY+V+ATIG  ITELTP+RGFAAE AAA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  325  WGYKVMATIGSHITELTPSRGFAAELAAASTVVMASGTGLPISTTHTLVGAVLGVGLARG  384

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW +T+PAGA L++++
Sbjct  385  IGALNLRVISTIFMSWLITLPAGALLAIVF  414



>ref|WP_010895353.1| phosphate permease [Chlamydia pneumoniae]
 ref|NP_300736.1| phosphate permease [Chlamydophila pneumoniae J138]
 dbj|BAA98887.1| phosphate permease [Chlamydophila pneumoniae J138]
Length=426

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+    +A  + +AS LGLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETVGCKITELTPSRGFSVGMGSALTIALASILGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +++IV SW +T+PAGA LS+++
Sbjct  388  IRAINLNIIKDIVLSWFITLPAGALLSILF  417



>ref|WP_014517520.1| phosphate permease [Chlamydia pneumoniae]
 ref|YP_005661659.1| phosphate transporter family protein [Chlamydophila pneumoniae 
LPCoLN]
 gb|ACZ32565.1| phosphate transporter family protein [Chlamydophila pneumoniae 
LPCoLN]
Length=426

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+    +A  + +AS LGLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETVGCKITELTPSRGFSVGMGSALTIALASILGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +++IV SW +T+PAGA LS+++
Sbjct  388  IRAINLNIIKDIVLSWFITLPAGALLSILF  417



>ref|WP_014946393.1| phosphate permease [Chlamydia psittaci]
 ref|YP_006740166.1| phosphate transporter family protein [Chlamydia psittaci NJ1]
 gb|AFS27601.1| phosphate transporter family protein [Chlamydia psittaci NJ1]
Length=426

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+   ++A  + +AS +GLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETVGCKITELTPSRGFSVGLSSAVTIALASAIGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            ++++    +++I+ SW +T+PAGA LS+++
Sbjct  388  IHAINLNIIKDIIMSWFITLPAGAVLSILF  417



>gb|AHK63711.1| Putative phosphate permease [Chlamydia avium 10DC88]
Length=427

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+    AA  + +AS  GLPIS TH +VGAV+G+G ARG
Sbjct  329  WGWRVIETVGCKITELTPSRGFSVGLGAAITIALASAFGLPISTTHVVVGAVLGIGLARG  388

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            ++++    +++IV SW +T+PAGA LS+++
Sbjct  389  IHAINLNIIKDIVMSWFITLPAGAILSILF  418



>gb|AJE17125.1| phosphate permease [Pseudomonas balearica DSM 6083]
Length=421

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA L++++
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAFLAIVF  412



>ref|WP_014595539.1| phosphate permease [Pseudomonas stutzeri]
 ref|YP_005936985.1| phosphate transporter [Pseudomonas stutzeri DSM 4166]
 gb|AEA82243.1| phosphate transporter [Pseudomonas stutzeri DSM 4166]
 gb|EPL63041.1| phosphate transporter [Pseudomonas stutzeri B1SMN1]
Length=421

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA L++++
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAFLAIVF  412



>ref|WP_031769374.1| phosphate permease [Pseudomonas aeruginosa]
Length=422

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GYRVIATIG++ITELTP+RGFAAE   A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYRVIATIGREITELTPSRGFAAELVTASTVVGASAIGLPVSTTHTLVGAVLGIGMARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW VT+PAGA L++++
Sbjct  383  IGALNLRVIGSIFLSWVVTLPAGALLAILF  412



>ref|WP_010883318.1| phosphate permease [Chlamydia pneumoniae]
 ref|NP_224876.1| phosphate permease [Chlamydophila pneumoniae CWL029]
 ref|NP_444619.1| phosphate permease family protein [Chlamydophila pneumoniae AR39]
 ref|NP_876979.1| phosphate permease [Chlamydophila pneumoniae TW-183]
 sp|Q9Z7M4.1|Y680_CHLPN RecName: Full=Putative phosphate permease CPn_0680/CP_0067/CPj0680/CpB0707 
[Chlamydia pneumoniae]
 gb|AAD18819.1| Phosphate Permease [Chlamydophila pneumoniae CWL029]
 gb|AAF73624.1| phosphate permease family protein [Chlamydophila pneumoniae AR39]
 gb|AAP98636.1| phosphate permease [Chlamydophila pneumoniae TW-183]
Length=426

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RVI T+G KITELTP+RGF+    +A  + +AS LGLPIS TH +VGAV+G+G ARG
Sbjct  328  WGWRVIETVGCKITELTPSRGFSVGMGSALTIALASILGLPISTTHVVVGAVLGIGLARG  387

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +++IV SW +T+PAGA LS+++
Sbjct  388  IRAINLNIIKDIVLSWFITLPAGALLSILF  417



>ref|WP_020584212.1| phosphate permease [Endozoicomonas elysicola]
Length=423

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WGY+V+ATIG  ITELTP+RGFAAE AAA  V++AS  GLPIS THTLVGAV+GVG ARG
Sbjct  325  WGYKVMATIGSHITELTPSRGFAAELAAASTVVMASGTGLPISTTHTLVGAVLGVGLARG  384

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    +  I  SW +T+PAGA L++++
Sbjct  385  IGALNLRVISTIFMSWLITLPAGALLAIVF  414



>ref|WP_005504008.1| phosphate permease [Grimontia hollisae]
 gb|EEY72886.1| probable low-affinity inorganic phosphate transporter [Grimontia 
hollisae CIP 101886]
Length=421

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  5    GYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARGL  184
            G++V+AT+G  ITELTP+RGFAA+ A A  V++AS  GLPIS T TLVGAV+GVGFARG+
Sbjct  323  GHKVMATVGTGITELTPSRGFAAQLATASTVVLASGTGLPISTTQTLVGAVLGVGFARGI  382

Query  185  NSVRAETVREIVTSWAVTIPAGACLSVIYTWVF  283
             ++    VR IV SW VT+PAGA L+VI+ +V 
Sbjct  383  AALNLGVVRNIVASWVVTLPAGALLAVIFFYVM  415



>ref|WP_013942648.1| putative phosphate permease [Simkania negevensis]
 ref|YP_004670672.1| putative phosphate permease [Simkania negevensis Z]
 emb|CCB88181.1| putative phosphate permease CPn_0680/CP_0067/CPj0680/CpB0707 
[Simkania negevensis Z]
Length=474

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            WG+RV+ TIG KITELTPTRGF+AEF AA  +L+ASKLGLPIS TH +VGAV+GVG ARG
Sbjct  376  WGWRVMETIGSKITELTPTRGFSAEFGAAITILLASKLGLPISTTHCIVGAVLGVGLARG  435

Query  182  LNSVRAETVREIVTSWAVTIPAGA--CLSVIY  271
            ++++    +R+IV SW +TIP+ A  C+ + Y
Sbjct  436  ISALNLRVLRDIVLSWVITIPSSAIVCILLFY  467



>ref|WP_027852034.1| phosphate permease [Marinospirillum insulare]
Length=420

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +G+RVIAT+G  ITELTP+RGFAA  A A  V+VAS +G+PIS THTLVGAV+GVG ARG
Sbjct  322  YGHRVIATVGTNITELTPSRGFAATLATASTVVVASGIGMPISTTHTLVGAVLGVGLARG  381

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVI  268
            L ++    V  I  SW VT+PAGA LSVI
Sbjct  382  LAAINMRVVGSIFASWLVTLPAGAILSVI  410



>ref|WP_013981431.1| phosphate permease [Pseudomonas stutzeri]
 ref|YP_004712672.1| phosphate transporter [Pseudomonas stutzeri ATCC 17588 = LMG 
11199]
 gb|AEJ03583.1| phosphate transporter [Pseudomonas stutzeri ATCC 17588 = LMG 
11199]
Length=421

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    WGYRVIATIGKKITELTPTRGfaaefaaafvvlvaSKLGLPISATHTLVGAVMGVGFARG  181
            +GY+VIATIGK+ITELTP+RGFAAE A A  V+ AS +GLP+S THTLVGAV+G+G ARG
Sbjct  323  YGYKVIATIGKEITELTPSRGFAAELATATTVVGASAIGLPVSTTHTLVGAVLGIGIARG  382

Query  182  LNSVRAETVREIVTSWAVTIPAGACLSVIY  271
            + ++    V  I  SW +T+PAGA L++++
Sbjct  383  IGALNLGVVGSIFMSWLITLPAGAFLAIVF  412



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511129456992