BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82115_g1_i1 len=864 path=[1:0-863]

Length=864
                                                                      Score     E

gb|AAQ62571.1|  glycosyltransferase 5                                   350   8e-114   Ipomoea trifida
gb|AAQ62570.1|  glycosyltransferase 1                                   350   1e-113   Ipomoea trifida
gb|AAQ62572.1|  glycosyltransferase 10                                  347   1e-112   Ipomoea trifida
ref|XP_004241301.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    322   9e-103   
ref|XP_006347222.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    322   9e-103   
ref|XP_009629011.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    322   1e-102   
ref|XP_009794211.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    320   2e-102   
emb|CDP06989.1|  unnamed protein product                                321   3e-102   
ref|XP_009590983.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    320   3e-102   
gb|ACF33171.1|  mannan synthase                                         320   4e-102   Coffea canephora [robusta coffee]
gb|ACV71015.1|  UPA15                                                   320   5e-102   Capsicum annuum
ref|XP_009769755.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    320   6e-102   
ref|XP_004251009.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    318   2e-101   
ref|XP_006349077.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    317   6e-101   
ref|XP_011089999.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    316   2e-100   
gb|EYU36101.1|  hypothetical protein MIMGU_mgv1a0044822mg               304   2e-97    
ref|XP_011088835.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    305   2e-96    
ref|XP_006484970.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    303   3e-95    
gb|KDO45609.1|  hypothetical protein CISIN_1g040333mg                   301   5e-95    
ref|XP_004160102.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    295   2e-94    
ref|XP_006424348.1|  hypothetical protein CICLE_v10028164mg             300   2e-94    
gb|EYU36982.1|  hypothetical protein MIMGU_mgv1a004240mg                300   5e-94    
gb|KDP34366.1|  hypothetical protein JCGZ_11249                         297   4e-93    
ref|XP_003606275.1|  Glucomannan 4-beta-mannosyltransferase             294   8e-93    
gb|KGN46914.1|  hypothetical protein Csa_6G150530                       296   8e-93    
ref|XP_004145779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    296   8e-93    
ref|XP_008458630.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    296   8e-93    
emb|CBI17089.3|  unnamed protein product                                292   2e-92    
ref|XP_003606273.1|  Glucomannan 4-beta-mannosyltransferase             294   7e-92    
gb|KHG21024.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    294   8e-92    
ref|XP_010089159.1|  hypothetical protein L484_003290                   293   2e-91    
ref|XP_002269677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    293   2e-91    Vitis vinifera
emb|CAN82595.1|  hypothetical protein VITISV_013708                     292   3e-91    Vitis vinifera
ref|XP_002527445.1|  transferase, transferring glycosyl groups, p...    292   3e-91    Ricinus communis
ref|XP_006384673.1|  glycosyl transferase family 2 family protein       292   4e-91    
ref|XP_011005673.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    291   5e-91    
ref|XP_008363527.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    290   7e-91    
ref|XP_008385455.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    291   7e-91    
ref|XP_009337395.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    291   8e-91    
ref|XP_008360269.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    290   3e-90    
ref|XP_010031452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    290   3e-90    
ref|XP_004506130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    290   3e-90    
ref|XP_004294040.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    289   6e-90    
ref|XP_003539806.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    289   8e-90    
ref|XP_007015961.1|  Cellulose synthase-like A02 isoform 1              288   9e-90    
gb|AFZ78579.1|  cellulose synthase-like protein                         288   1e-89    
ref|XP_003538146.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    288   1e-89    
ref|XP_003551076.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    288   1e-89    
ref|XP_007208459.1|  hypothetical protein PRUPE_ppa003918mg             287   2e-89    
ref|XP_007208460.1|  hypothetical protein PRUPE_ppa003918mg             287   2e-89    
ref|XP_007132379.1|  hypothetical protein PHAVU_011G089900g             287   3e-89    
gb|KHN38673.1|  Glucomannan 4-beta-mannosyltransferase 2                287   3e-89    
ref|XP_011044347.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    287   3e-89    
ref|XP_008227108.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    287   4e-89    
ref|XP_009364844.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    287   5e-89    
ref|XP_002312893.1|  glycosyl transferase family 2 family protein       285   1e-88    Populus trichocarpa [western balsam poplar]
gb|KHF98868.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    283   1e-87    
ref|XP_010690012.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    280   1e-86    
emb|CDP15350.1|  unnamed protein product                                280   2e-86    
gb|KCW89263.1|  hypothetical protein EUGRSUZ_A01558                     276   3e-86    
ref|NP_197666.1|  glucomannan 4-beta-mannosyltransferase 2              278   7e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874083.1|  hypothetical protein ARALYDRAFT_489123             278   7e-86    
gb|KFK39910.1|  hypothetical protein AALP_AA3G305000                    278   7e-86    
gb|AEZ00898.1|  putative beta-14-mannan synthase                        268   1e-85    
ref|XP_009120642.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    276   3e-85    
ref|XP_010050059.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    276   4e-85    
ref|XP_009126562.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    276   6e-85    
ref|XP_010535659.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    276   7e-85    
ref|XP_009769757.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    275   8e-85    
ref|XP_002530892.1|  transferase, transferring glycosyl groups, p...    272   9e-85    Ricinus communis
gb|AFW66233.1|  hypothetical protein ZEAMMB73_021965                    266   1e-84    
ref|XP_002437311.1|  hypothetical protein SORBIDRAFT_10g024640          272   1e-84    Sorghum bicolor [broomcorn]
ref|XP_010520406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    275   2e-84    
ref|XP_002315357.1|  4-mannan synthase family protein                   274   2e-84    Populus trichocarpa [western balsam poplar]
ref|XP_006400777.1|  hypothetical protein EUTSA_v10013221mg             274   2e-84    
gb|KDP42759.1|  hypothetical protein JCGZ_23699                         274   3e-84    
emb|CDY11268.1|  BnaA03g01040D                                          274   3e-84    
ref|XP_006606290.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    271   3e-84    
gb|ACR38199.1|  unknown                                                 266   3e-84    Zea mays [maize]
ref|XP_004249461.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    274   3e-84    
ref|XP_006381326.1|  hypothetical protein POPTR_0006s11810g             274   3e-84    
ref|XP_007143832.1|  hypothetical protein PHAVU_007G105400g             273   5e-84    
sp|Q67VS7.1|CSLA9_ORYSJ  RecName: Full=Probable mannan synthase 9...    273   5e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007010197.1|  Nucleotide-diphospho-sugar transferases supe...    273   7e-84    
gb|KDP45030.1|  hypothetical protein JCGZ_01530                         273   7e-84    
ref|XP_006287469.1|  hypothetical protein CARUB_v10000681mg             273   7e-84    
gb|EPS66478.1|  hypothetical protein M569_08299                         263   8e-84    
ref|XP_007027600.1|  Nucleotide-diphospho-sugar transferases supe...    273   8e-84    
ref|XP_010454539.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    272   1e-83    
ref|XP_011018871.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    272   1e-83    
ref|XP_009130779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    272   1e-83    
ref|XP_010493365.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    272   1e-83    
ref|NP_195996.1|  glucomannan 4-beta-mannosyltransferase 9              272   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421063.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    272   1e-83    
ref|XP_006287471.1|  hypothetical protein CARUB_v10000683mg             272   1e-83    
ref|XP_002873112.1|  ATCSLA09                                           272   2e-83    
ref|XP_003554414.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    272   2e-83    
gb|AGE09561.1|  CSLA9-like protein                                      272   2e-83    
ref|XP_006606289.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    270   2e-83    
ref|XP_010452272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    272   2e-83    
gb|KCW89261.1|  hypothetical protein EUGRSUZ_A01558                     272   2e-83    
ref|XP_010490868.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    272   2e-83    
ref|XP_003556282.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    271   2e-83    
ref|XP_002311972.2|  4-mannan synthase family protein                   271   2e-83    Populus trichocarpa [western balsam poplar]
ref|XP_011024272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    271   3e-83    
gb|KHN00923.1|  Glucomannan 4-beta-mannosyltransferase 9                271   3e-83    
ref|XP_010423663.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    271   3e-83    
ref|XP_009390016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    271   4e-83    
ref|XP_006339112.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    271   4e-83    
dbj|BAE98718.1|  hypothetical protein                                   271   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521436.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    271   5e-83    
ref|XP_007162846.1|  hypothetical protein PHAVU_001G185800g             271   6e-83    
ref|XP_002283672.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    270   6e-83    Vitis vinifera
gb|KHG19821.1|  Glucomannan 4-beta-mannosyltransferase 9 -like pr...    270   7e-83    
emb|CDX80885.1|  BnaC03g01390D                                          270   7e-83    
ref|XP_011094427.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    270   1e-82    
ref|XP_010694523.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    270   1e-82    
gb|KHN37850.1|  Glucomannan 4-beta-mannosyltransferase 9                269   1e-82    
ref|XP_003535494.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    270   1e-82    
ref|XP_009771587.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    270   2e-82    
gb|ABR16486.1|  unknown                                                 265   2e-82    Picea sitchensis
gb|AFZ78578.1|  cellulose synthase-like protein                         269   2e-82    
gb|EEE56486.1|  hypothetical protein OsJ_05716                          268   2e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006589371.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    268   2e-82    
ref|XP_009601859.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    269   2e-82    
ref|XP_009122674.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    269   2e-82    
emb|CDX70286.1|  BnaA10g26350D                                          269   3e-82    
ref|XP_006656269.1|  PREDICTED: probable mannan synthase 9-like         268   3e-82    
ref|XP_010940677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    269   3e-82    
ref|NP_001046164.1|  Os02g0192500                                       268   3e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009623019.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    268   3e-82    
ref|XP_004494136.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    269   3e-82    
ref|XP_004143299.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    269   3e-82    
gb|KFK24842.1|  hypothetical protein AALP_AA8G031700                    268   3e-82    
ref|XP_011010407.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    268   4e-82    
ref|XP_004170553.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    268   4e-82    
ref|XP_010112526.1|  hypothetical protein L484_012804                   269   5e-82    
gb|AFW73370.1|  hypothetical protein ZEAMMB73_956340                    261   5e-82    
ref|XP_006398833.1|  hypothetical protein EUTSA_v10013220mg             268   6e-82    
ref|XP_006436686.1|  hypothetical protein CICLE_v10031284mg             267   8e-82    
gb|KDO40534.1|  hypothetical protein CISIN_1g009761mg                   267   8e-82    
ref|XP_004496174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    267   9e-82    
ref|XP_006492171.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    267   9e-82    
ref|XP_010067160.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    266   1e-81    
ref|XP_009774056.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    267   1e-81    
ref|XP_010912225.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    266   1e-81    
ref|XP_008804385.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    267   1e-81    
ref|XP_008647195.1|  PREDICTED: uncharacterized protein LOC103628848    276   1e-81    
ref|XP_010110184.1|  hypothetical protein L484_016805                   267   1e-81    
dbj|BAK03076.1|  predicted protein                                      267   1e-81    
ref|XP_006646997.1|  PREDICTED: LOW QUALITY PROTEIN: glucomannan ...    266   2e-81    
ref|XP_010912224.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    266   2e-81    
ref|NP_001131007.1|  uncharacterized protein LOC100192112               266   3e-81    Zea mays [maize]
ref|XP_004307031.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    265   3e-81    
gb|KEH43412.1|  cellulose synthase-like protein A1                      266   4e-81    
ref|XP_002453460.1|  hypothetical protein SORBIDRAFT_04g006260          265   5e-81    Sorghum bicolor [broomcorn]
ref|XP_003560565.2|  PREDICTED: probable mannan synthase 9              264   5e-81    
emb|CBI30236.3|  unnamed protein product                                265   8e-81    
ref|XP_010278246.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    265   1e-80    
ref|XP_003571119.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    264   1e-80    
gb|EAY84833.1|  hypothetical protein OsI_06199                          264   2e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_009353016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    263   2e-80    
gb|KCW48370.1|  hypothetical protein EUGRSUZ_K02079                     257   2e-80    
gb|KEH24115.1|  cellulose synthase-like protein A1                      264   2e-80    
ref|XP_008456578.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    264   2e-80    
ref|XP_009361452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    263   2e-80    
ref|XP_009335111.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    263   2e-80    
ref|XP_009365313.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    263   3e-80    
ref|XP_010325940.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    262   3e-80    
gb|EYU41550.1|  hypothetical protein MIMGU_mgv1a004346mg                263   3e-80    
ref|XP_009353014.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    263   4e-80    
ref|XP_009404378.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    263   4e-80    
ref|XP_004151323.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    262   5e-80    
emb|CBI40224.3|  unnamed protein product                                260   6e-80    
ref|XP_010325939.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    263   6e-80    
ref|XP_009401015.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    263   7e-80    
gb|AFW87395.1|  hypothetical protein ZEAMMB73_638072                    261   8e-80    
ref|XP_010243535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    262   9e-80    
ref|XP_008659807.1|  PREDICTED: probable mannan synthase 9              262   1e-79    
ref|XP_008232025.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    261   2e-79    
ref|XP_004951606.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    261   2e-79    
ref|XP_007219015.1|  hypothetical protein PRUPE_ppa004315mg             261   2e-79    
ref|XP_006341174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    261   2e-79    
ref|XP_007220072.1|  hypothetical protein PRUPE_ppa024741mg             261   3e-79    
ref|XP_004164074.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    261   3e-79    
gb|ABG34548.1|  cellulose synthase-like A2                              261   3e-79    Pinus taeda
gb|ABG34547.1|  cellulose synthase-like A1                              261   3e-79    Pinus taeda
dbj|BAF36300.1|  hypothetical protein                                   262   4e-79    Ipomoea trifida
ref|XP_008241312.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    261   4e-79    
ref|XP_002269110.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    260   4e-79    Vitis vinifera
ref|XP_004965827.1|  PREDICTED: probable mannan synthase 9-like         261   5e-79    
ref|XP_008363207.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    257   5e-79    
ref|XP_008462529.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    260   6e-79    
ref|XP_004143300.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    260   6e-79    
ref|XP_008359466.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    260   6e-79    
ref|XP_009379774.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    259   1e-78    
ref|XP_004303037.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    259   1e-78    
ref|XP_008363208.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    258   1e-78    
ref|XP_004137864.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    259   2e-78    
ref|XP_010543471.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    259   2e-78    
gb|AES60635.2|  cellulose synthase-like protein A1                      259   2e-78    
ref|XP_007203625.1|  hypothetical protein PRUPE_ppa004037mg             258   4e-78    
ref|XP_009403735.1|  PREDICTED: probable mannan synthase 9 isofor...    258   5e-78    
emb|CDY10358.1|  BnaCnng02590D                                          258   5e-78    
ref|XP_010038980.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    257   8e-78    
ref|XP_009603325.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    257   9e-78    
emb|CDO99850.1|  unnamed protein product                                255   9e-78    
ref|XP_006851749.1|  hypothetical protein AMTR_s00040p00223350          257   1e-77    
ref|XP_009421122.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    256   3e-77    
ref|XP_008442792.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    255   5e-77    
ref|XP_009760346.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    254   2e-76    
gb|KGN63048.1|  hypothetical protein Csa_2G386160                       258   2e-76    
ref|XP_010558212.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    253   2e-76    
ref|XP_010911245.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   3e-76    
ref|XP_010937165.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    251   2e-75    
ref|XP_007145259.1|  hypothetical protein PHAVU_007G223800g             250   3e-75    
ref|XP_008800552.1|  PREDICTED: mannan synthase 1-like                  249   6e-75    
ref|XP_002890585.1|  hypothetical protein ARALYDRAFT_889889             250   7e-75    
ref|XP_010521855.1|  PREDICTED: probable mannan synthase 3              250   8e-75    
ref|NP_001031084.1|  putative mannan synthase 3                         248   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525611.1|  PREDICTED: probable mannan synthase 3 isofor...    245   1e-74    
ref|XP_004239715.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    248   1e-74    
ref|XP_006345855.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    247   2e-74    
ref|XP_008232088.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    247   2e-74    
emb|CDY04707.1|  BnaC05g18820D                                          249   2e-74    
emb|CDY44151.1|  BnaA09g31010D                                          249   3e-74    
ref|XP_009115523.1|  PREDICTED: probable mannan synthase 3              249   3e-74    
ref|XP_006430317.1|  hypothetical protein CICLE_v10011455mg             248   3e-74    
ref|XP_006416081.1|  hypothetical protein EUTSA_v10007266mg             248   4e-74    
ref|XP_009793132.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   4e-74    
gb|EMS67675.1|  hypothetical protein TRIUR3_27071                       247   5e-74    
ref|XP_010935702.1|  PREDICTED: mannan synthase 1-like isoform X1       247   6e-74    
ref|NP_850952.1|  putative mannan synthase 3                            248   7e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009793131.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    247   7e-74    
ref|XP_006481909.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    247   8e-74    
emb|CDX88785.1|  BnaA03g08640D                                          246   1e-73    
emb|CDX71011.1|  BnaC03g10950D                                          246   1e-73    
ref|XP_001764061.1|  cellulose synthase-like A1, glycosyltransfer...    246   2e-73    
ref|XP_004497598.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   2e-73    
ref|XP_009603536.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    244   2e-73    
ref|XP_010683891.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   2e-73    
ref|XP_009793130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    246   3e-73    
ref|XP_010525610.1|  PREDICTED: probable mannan synthase 3 isofor...    245   3e-73    
gb|EMT23763.1|  hypothetical protein F775_17087                         251   3e-73    
ref|XP_009603535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    245   4e-73    
ref|XP_010525608.1|  PREDICTED: probable mannan synthase 3 isofor...    245   4e-73    
emb|CDY35710.1|  BnaC02g09760D                                          244   4e-73    
ref|XP_006307154.1|  hypothetical protein CARUB_v10008745mg             245   6e-73    
ref|XP_001759209.1|  cellulose synthase-like A3, glycosyltransfer...    244   7e-73    
emb|CDY09164.1|  BnaA02g05900D                                          243   8e-73    
gb|ABD79100.1|  cellulose synthase-like A2                              243   2e-72    Physcomitrella patens
gb|KEH42109.1|  cellulose synthase-like protein A1                      243   2e-72    
gb|KEH42113.1|  cellulose synthase-like protein A1                      243   2e-72    
emb|CDY26949.1|  BnaC09g36340D                                          243   2e-72    
ref|XP_011088832.1|  PREDICTED: probable mannan synthase 11             244   2e-72    
ref|XP_009403734.1|  PREDICTED: probable mannan synthase 9 isofor...    243   3e-72    
ref|XP_009597672.1|  PREDICTED: mannan synthase 1-like isoform X2       243   3e-72    
ref|XP_009765562.1|  PREDICTED: mannan synthase 1-like isoform X2       243   3e-72    
ref|XP_008783951.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    241   3e-72    
ref|XP_008783968.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    242   4e-72    
ref|XP_001759264.1|  cellulose synthase-like A2, glycosyltransfer...    242   5e-72    
gb|EYU36103.1|  hypothetical protein MIMGU_mgv1a004186mg                242   6e-72    
gb|KHN09524.1|  Mannan synthase 1                                       241   6e-72    
gb|EYU38560.1|  hypothetical protein MIMGU_mgv1a017694mg                242   6e-72    
ref|XP_008783962.1|  PREDICTED: probable mannan synthase 9 isofor...    242   9e-72    
gb|EMT24748.1|  hypothetical protein F775_52670                         241   1e-71    
gb|AAC98005.1|  Similar to gi|2245014 glucosyltransferase homolog...    239   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003520655.1|  PREDICTED: mannan synthase 1-like                  241   2e-71    
ref|XP_006360487.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    240   2e-71    
ref|XP_011094610.1|  PREDICTED: mannan synthase 1-like                  240   2e-71    
ref|XP_010498857.1|  PREDICTED: probable mannan synthase 3              241   3e-71    
ref|XP_010477641.1|  PREDICTED: probable mannan synthase 3              240   4e-71    
sp|Q6UDF0.1|CSLA1_CYATE  RecName: Full=Mannan synthase 1; AltName...    239   4e-71    Cyamopsis tetragonoloba [cluster bean]
ref|XP_010937163.1|  PREDICTED: probable mannan synthase 11 isofo...    233   5e-71    
ref|XP_002963530.1|  glycosyltransferase family 2 protein               239   5e-71    
ref|XP_006354365.1|  PREDICTED: mannan synthase 1-like                  239   5e-71    
ref|XP_004246627.1|  PREDICTED: mannan synthase 1-like                  238   1e-70    
ref|XP_010937167.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    239   1e-70    
ref|XP_002981551.1|  family 2 glycosyltransferase                       238   1e-70    
emb|CDP06773.1|  unnamed protein product                                238   2e-70    
emb|CDX92340.1|  BnaA10g13790D                                          244   2e-70    
gb|KEH42110.1|  cellulose synthase-like protein A1                      238   2e-70    
gb|EYU36983.1|  hypothetical protein MIMGU_mgv1a004073mg                238   4e-70    
gb|ACE60600.1|  mannan synthase                                         237   5e-70    
ref|XP_004250002.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    237   5e-70    
ref|XP_010937162.1|  PREDICTED: probable mannan synthase 11 isofo...    233   6e-70    
ref|XP_008783921.1|  PREDICTED: probable mannan synthase 3 isofor...    238   7e-70    
ref|XP_008783930.1|  PREDICTED: probable mannan synthase 3 isofor...    238   7e-70    
ref|XP_003606274.1|  Glucomannan 4-beta-mannosyltransferase             235   8e-70    
ref|XP_010917051.1|  PREDICTED: probable mannan synthase 4 isofor...    238   1e-69    
ref|XP_010917052.1|  PREDICTED: probable mannan synthase 4 isofor...    237   1e-69    
ref|XP_010096071.1|  hypothetical protein L484_000910                   236   1e-69    
ref|XP_009419094.1|  PREDICTED: probable mannan synthase 4              236   2e-69    
gb|ACE60601.1|  mannan synthase                                         235   2e-69    
gb|KEH24032.1|  cellulose synthase-like protein A1                      235   3e-69    
ref|XP_003553558.1|  PREDICTED: mannan synthase 1-like                  234   3e-69    
ref|XP_010937164.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    235   4e-69    
ref|XP_006403035.1|  hypothetical protein EUTSA_v10005891mg             234   5e-69    
ref|XP_002277171.1|  PREDICTED: mannan synthase 1-like                  234   6e-69    
ref|XP_010516195.1|  PREDICTED: probable mannan synthase 14 isofo...    230   7e-69    
ref|XP_008787126.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    233   1e-68    
ref|XP_002528577.1|  conserved hypothetical protein                     232   1e-68    
ref|XP_010427404.1|  PREDICTED: probable mannan synthase 14             233   2e-68    
ref|XP_004497599.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    232   2e-68    
gb|ADW77641.1|  putative mannan synthase                                232   2e-68    
ref|XP_010554515.1|  PREDICTED: probable mannan synthase 7 isofor...    230   2e-68    
ref|XP_010504474.1|  PREDICTED: probable mannan synthase 14             232   3e-68    
ref|XP_010937357.1|  PREDICTED: probable mannan synthase 9              230   3e-68    
gb|AFV79650.1|  mannan synthase                                         232   4e-68    
ref|XP_010554516.1|  PREDICTED: probable mannan synthase 7 isofor...    230   5e-68    
ref|XP_011089998.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    230   6e-68    
ref|XP_008802588.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    232   8e-68    
ref|XP_007015962.1|  Cellulose synthase-like A02 isoform 2              230   9e-68    
ref|XP_004493996.1|  PREDICTED: mannan synthase 1-like                  231   9e-68    
ref|XP_010516194.1|  PREDICTED: probable mannan synthase 14 isofo...    231   1e-67    
ref|XP_009410012.1|  PREDICTED: probable mannan synthase 9 isofor...    230   2e-67    
ref|XP_006290419.1|  hypothetical protein CARUB_v10019203mg             230   2e-67    
emb|CDY54604.1|  BnaA05g28600D                                          229   2e-67    
ref|XP_010554514.1|  PREDICTED: probable mannan synthase 7 isofor...    231   2e-67    
ref|XP_009116294.1|  PREDICTED: probable mannan synthase 14             229   2e-67    
ref|XP_009410011.1|  PREDICTED: probable mannan synthase 9 isofor...    231   3e-67    
emb|CDX72181.1|  BnaC08g26930D                                          229   4e-67    
ref|XP_008673321.1|  PREDICTED: hypothetical protein isoform X1         227   5e-67    
ref|XP_008787118.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    228   7e-67    
gb|EMT02496.1|  hypothetical protein F775_10659                         224   7e-67    
ref|XP_009139629.1|  PREDICTED: probable mannan synthase 15 isofo...    225   8e-67    
ref|XP_009403159.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    228   1e-66    
ref|XP_008806011.1|  PREDICTED: probable mannan synthase 4              229   1e-66    
ref|XP_008787138.1|  PREDICTED: probable mannan synthase 11             227   2e-66    
ref|XP_009410399.1|  PREDICTED: probable mannan synthase 11 isofo...    228   2e-66    
ref|XP_009597671.1|  PREDICTED: mannan synthase 1-like isoform X1       228   2e-66    
ref|XP_009765561.1|  PREDICTED: mannan synthase 1-like isoform X1       228   2e-66    
ref|XP_009410398.1|  PREDICTED: probable mannan synthase 11 isofo...    228   2e-66    
ref|XP_002878056.1|  hypothetical protein ARALYDRAFT_907034             227   3e-66    
ref|NP_001183100.1|  hypothetical protein                               227   4e-66    
ref|XP_009382953.1|  PREDICTED: probable mannan synthase 11             226   6e-66    
ref|XP_009139627.1|  PREDICTED: probable mannan synthase 15 isofo...    226   8e-66    
ref|XP_009139628.1|  PREDICTED: probable mannan synthase 15 isofo...    226   8e-66    
ref|XP_003542549.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    225   9e-66    
ref|XP_003535285.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    225   1e-65    
gb|KHN45690.1|  Glucomannan 4-beta-mannosyltransferase 9                224   1e-65    
gb|KHN48194.1|  Glucomannan 4-beta-mannosyltransferase 9                224   1e-65    
emb|CAB87854.1|  putative protein                                       224   2e-65    
ref|XP_007027601.1|  Nucleotide-diphospho-sugar transferases supe...    223   3e-65    
ref|NP_191159.2|  cellulose synthase like A14                           224   3e-65    
gb|AAO42815.1|  At3g56000                                               224   3e-65    
ref|XP_010453775.1|  PREDICTED: probable mannan synthase 11             224   3e-65    
dbj|BAK04119.1|  predicted protein                                      221   3e-65    
emb|CAN74410.1|  hypothetical protein VITISV_013215                     224   5e-65    
gb|AFW73371.1|  hypothetical protein ZEAMMB73_956340                    229   5e-65    
gb|AED99880.1|  glycosyltransferase                                     222   6e-65    
emb|CDY26505.1|  BnaC09g41630D                                          223   6e-65    
ref|XP_010492500.1|  PREDICTED: probable mannan synthase 11             223   6e-65    
ref|XP_010420302.1|  PREDICTED: probable mannan synthase 11             223   7e-65    
ref|XP_002459874.1|  hypothetical protein SORBIDRAFT_02g012870          223   7e-65    
gb|KFK34844.1|  hypothetical protein AALP_AA5G200500                    223   8e-65    
ref|XP_010939804.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    216   1e-64    
emb|CDY01129.1|  BnaA04g06900D                                          223   1e-64    
emb|CDX69464.1|  BnaA10g18130D                                          220   1e-64    
emb|CAN74357.1|  hypothetical protein VITISV_042153                     223   1e-64    
gb|EMS50576.1|  hypothetical protein TRIUR3_00182                       221   2e-64    
ref|XP_009385870.1|  PREDICTED: mannan synthase 1-like                  222   2e-64    
dbj|BAC43295.1|  putative glucosyltransferase                           217   2e-64    
ref|XP_006287553.1|  hypothetical protein CARUB_v10000762mg             221   3e-64    
gb|EMS51579.1|  hypothetical protein TRIUR3_28386                       223   3e-64    
ref|XP_010540229.1|  PREDICTED: probable mannan synthase 3 isofor...    221   4e-64    
ref|XP_011010406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    221   4e-64    
ref|NP_193077.2|  putative mannan synthase 15                           221   5e-64    
ref|XP_010937166.1|  PREDICTED: probable mannan synthase 11             221   7e-64    
ref|XP_010540227.1|  PREDICTED: probable mannan synthase 11 isofo...    221   8e-64    
ref|XP_010540228.1|  PREDICTED: probable mannan synthase 11 isofo...    221   8e-64    
ref|XP_009121507.1|  PREDICTED: probable mannan synthase 11             220   8e-64    
emb|CDP15609.1|  unnamed protein product                                219   8e-64    
ref|XP_010516765.1|  PREDICTED: probable mannan synthase 7 isofor...    219   1e-63    
emb|CDY68733.1|  BnaUnng03000D                                          212   3e-63    
ref|XP_009131529.1|  PREDICTED: probable mannan synthase 11             218   3e-63    
emb|CDX70677.1|  BnaC03g07610D                                          217   3e-63    
ref|XP_010440588.1|  PREDICTED: probable mannan synthase 15 isofo...    217   3e-63    
ref|XP_010440586.1|  PREDICTED: probable mannan synthase 15 isofo...    217   3e-63    
ref|XP_010450209.1|  PREDICTED: probable mannan synthase 15 isofo...    216   3e-63    
ref|NP_173818.1|  cellulose synthase-like A10                           219   4e-63    
ref|XP_010509580.1|  PREDICTED: probable mannan synthase 7              219   4e-63    
ref|XP_010516764.1|  PREDICTED: probable mannan synthase 7 isofor...    219   4e-63    
ref|XP_003590384.1|  Glucomannan 4-beta-mannosyltransferase             216   6e-63    
emb|CAB10434.1|  cellulose synthase like protein                        213   6e-63    
ref|XP_010505088.1|  PREDICTED: probable mannan synthase 7              219   6e-63    
ref|XP_010435268.1|  PREDICTED: probable mannan synthase 15 isofo...    216   8e-63    
ref|XP_006416032.1|  hypothetical protein EUTSA_v10007269mg             218   9e-63    
ref|XP_010435267.1|  PREDICTED: probable mannan synthase 15 isofo...    216   1e-62    
ref|XP_006283494.1|  hypothetical protein CARUB_v10004546mg             217   1e-62    
gb|AFW76791.1|  hypothetical protein ZEAMMB73_274552                    211   2e-62    
ref|XP_003578707.1|  PREDICTED: mannan synthase 1-like                  217   2e-62    
ref|XP_010440585.1|  PREDICTED: probable mannan synthase 15 isofo...    217   2e-62    
gb|KFK26523.1|  hypothetical protein AALP_AA8G260200                    217   2e-62    
ref|NP_193392.3|  cellulose synthase-like A01                           213   2e-62    
ref|XP_010440584.1|  PREDICTED: probable mannan synthase 15 isofo...    217   2e-62    
ref|XP_006651080.1|  PREDICTED: probable mannan synthase 4-like         216   2e-62    
ref|XP_002893324.1|  hypothetical protein ARALYDRAFT_313253             217   3e-62    
gb|KDO49989.1|  hypothetical protein CISIN_1g044519mg                   216   3e-62    
ref|XP_010450207.1|  PREDICTED: probable mannan synthase 15 isofo...    216   3e-62    
ref|XP_010450208.1|  PREDICTED: probable mannan synthase 15 isofo...    216   4e-62    
dbj|BAJ89328.1|  predicted protein                                      208   4e-62    
ref|XP_010435266.1|  PREDICTED: probable mannan synthase 15 isofo...    216   5e-62    
ref|XP_008780571.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    213   6e-62    
gb|EMS62877.1|  hypothetical protein TRIUR3_33379                       214   7e-62    
ref|XP_006307167.1|  hypothetical protein CARUB_v10008757mg             216   8e-62    
ref|XP_002870144.1|  hypothetical protein ARALYDRAFT_915064             216   9e-62    
ref|NP_001064564.1|  Os10g0406400                                       207   9e-62    
ref|XP_010926632.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    212   1e-61    
ref|XP_002873761.1|  hypothetical protein ARALYDRAFT_488470             212   1e-61    
ref|XP_009133031.1|  PREDICTED: probable mannan synthase 7              214   2e-61    
gb|EMT15170.1|  hypothetical protein F775_14200                         214   2e-61    
emb|CDX79614.1|  BnaC03g19500D                                          214   2e-61    
ref|XP_010440127.1|  PREDICTED: probable mannan synthase 1              214   2e-61    
ref|XP_009103139.1|  PREDICTED: probable mannan synthase 10             214   2e-61    
ref|XP_010234713.1|  PREDICTED: probable mannan synthase 4              214   3e-61    
ref|XP_010434799.1|  PREDICTED: probable mannan synthase 1 isofor...    214   4e-61    
ref|XP_008780554.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    214   4e-61    
ref|XP_010434800.1|  PREDICTED: probable mannan synthase 1 isofor...    214   4e-61    
ref|XP_010449754.1|  PREDICTED: probable mannan synthase 1              214   4e-61    
ref|XP_004959258.1|  PREDICTED: mannan synthase 1-like                  214   4e-61    
ref|XP_004973516.1|  PREDICTED: probable mannan synthase 11-like        214   4e-61    
sp|Q84W54.1|CSLA1_ARATH  RecName: Full=Probable mannan synthase 1...    214   5e-61    
ref|XP_010477728.1|  PREDICTED: probable mannan synthase 10             213   6e-61    
ref|XP_010554517.1|  PREDICTED: probable mannan synthase 11             213   7e-61    
gb|KFK44470.1|  hypothetical protein AALP_AA1G260600                    213   7e-61    
tpg|DAA57949.1|  TPA: hypothetical protein ZEAMMB73_988025              209   8e-61    
ref|XP_010460178.1|  PREDICTED: probable mannan synthase 10             213   1e-60    
ref|NP_197123.3|  cellulose synthase like A11                           210   1e-60    
ref|XP_010498927.1|  PREDICTED: probable mannan synthase 10             212   1e-60    
ref|XP_004966838.1|  PREDICTED: probable mannan synthase 3-like         212   2e-60    
ref|XP_002879565.1|  hypothetical protein ARALYDRAFT_482526             212   2e-60    
ref|XP_006282581.1|  hypothetical protein CARUB_v10004510mg             212   3e-60    
ref|NP_001136470.1|  uncharacterized protein LOC100216582               207   3e-60    
sp|Q8S7W0.1|CSLA4_ORYSJ  RecName: Full=Probable mannan synthase 4...    211   3e-60    
emb|CDY40295.1|  BnaA07g09050D                                          211   4e-60    
ref|XP_008649262.1|  PREDICTED: probable mannan synthase 3 isofor...    211   5e-60    
ref|XP_006410731.1|  hypothetical protein EUTSA_v10016754mg             207   5e-60    
ref|XP_002863134.1|  predicted protein                                  210   5e-60    
ref|XP_009136796.1|  PREDICTED: probable mannan synthase 1              211   7e-60    
ref|XP_006414326.1|  hypothetical protein EUTSA_v10024828mg             211   7e-60    
ref|XP_010227824.1|  PREDICTED: probable mannan synthase 3 isofor...    209   8e-60    
gb|EEC66918.1|  hypothetical protein OsI_33517                          207   8e-60    
gb|AFW62286.1|  hypothetical protein ZEAMMB73_786937                    207   8e-60    
ref|NP_001130786.1|  hypothetical protein                               204   8e-60    
emb|CDM86569.1|  unnamed protein product                                211   9e-60    
dbj|BAK08066.1|  predicted protein                                      210   9e-60    
gb|EEE50933.1|  hypothetical protein OsJ_31468                          207   1e-59    
ref|XP_006662343.1|  PREDICTED: probable mannan synthase 2-like         208   1e-59    
emb|CDX90506.1|  BnaA03g42750D                                          210   1e-59    
ref|XP_006660158.1|  PREDICTED: LOW QUALITY PROTEIN: probable man...    209   2e-59    
gb|EMS57245.1|  hypothetical protein TRIUR3_28392                       207   2e-59    
ref|XP_010227823.1|  PREDICTED: probable mannan synthase 3 isofor...    208   3e-59    
gb|AAK98678.1|AC021893_12  Putative glucosyltransferase                 207   3e-59    
ref|XP_003560885.1|  PREDICTED: probable mannan synthase 3 isofor...    208   3e-59    
ref|XP_008649263.1|  PREDICTED: probable mannan synthase 3 isofor...    208   5e-59    
tpg|DAA01755.1|  TPA: cellulose synthase-like A2                        207   5e-59    
gb|EEE68748.1|  hypothetical protein OsJ_27439                          207   5e-59    
ref|XP_006656810.1|  PREDICTED: probable mannan synthase 3-like         206   7e-59    
sp|Q67X45.1|CSLA3_ORYSJ  RecName: Full=Probable mannan synthase 3...    207   9e-59    
gb|EEC80274.1|  hypothetical protein OsI_22257                          207   1e-58    
sp|Q7PC67.2|CSLA2_ORYSJ  RecName: Full=Probable mannan synthase 2...    208   1e-58    
sp|Q6YWK8.1|CSLAB_ORYSJ  RecName: Full=Probable mannan synthase 1...    207   1e-58    
tpg|DAA50026.1|  TPA: hypothetical protein ZEAMMB73_959739              201   1e-58    
gb|EEE65380.1|  hypothetical protein OsJ_20691                          207   1e-58    
gb|KFK25839.1|  hypothetical protein AALP_AA8G168900                    206   1e-58    
gb|KFK36462.1|  hypothetical protein AALP_AA4G127800                    206   1e-58    
ref|XP_008677729.1|  PREDICTED: uncharacterized protein LOC100501...    207   1e-58    
ref|XP_003572230.2|  PREDICTED: probable mannan synthase 11 isofo...    207   1e-58    
gb|EMT01783.1|  hypothetical protein F775_21241                         207   2e-58    
emb|CDY40448.1|  BnaA04g20690D                                          207   2e-58    
ref|XP_008664730.1|  PREDICTED: uncharacterized protein LOC100216...    207   2e-58    
ref|XP_009380154.1|  PREDICTED: probable mannan synthase 4              207   2e-58    
ref|XP_002464637.1|  hypothetical protein SORBIDRAFT_01g022320          204   3e-58    
gb|EEC83623.1|  hypothetical protein OsI_29346                          207   4e-58    
ref|NP_565813.1|  putative mannan synthase 7                            206   5e-58    
ref|XP_006661580.1|  PREDICTED: mannan synthase 1-like                  204   7e-58    
ref|XP_008658026.1|  PREDICTED: hypothetical protein isoform X1         204   1e-57    
gb|EEC85104.1|  hypothetical protein OsI_32487                          204   1e-57    
ref|XP_009141504.1|  PREDICTED: probable mannan synthase 7              204   1e-57    
gb|EMT23300.1|  hypothetical protein F775_52157                         202   4e-57    
gb|EMT17077.1|  hypothetical protein F775_09797                         203   5e-57    
tpg|DAA50027.1|  TPA: hypothetical protein ZEAMMB73_959739              202   5e-57    
ref|XP_002468429.1|  hypothetical protein SORBIDRAFT_01g045850          202   5e-57    
ref|XP_010935704.1|  PREDICTED: mannan synthase 1-like isoform X3       201   7e-57    
ref|XP_010935703.1|  PREDICTED: mannan synthase 1-like isoform X2       201   7e-57    
gb|AAF87149.1|AC002423_14  T23E23.23                                    202   7e-57    
ref|XP_004983152.1|  PREDICTED: probable mannan synthase 2-like         203   8e-57    
gb|AAM61171.1|  putative glucosyltransferase                            202   8e-57    
ref|XP_008664978.1|  PREDICTED: probable mannan synthase 2 isofor...    202   2e-56    
ref|XP_008664977.1|  PREDICTED: probable mannan synthase 4 isofor...    202   2e-56    
ref|XP_008671633.1|  PREDICTED: mannan synthase 1-like                  192   2e-56    
ref|XP_009390887.1|  PREDICTED: probable mannan synthase 11             197   4e-55    
gb|KFK25838.1|  hypothetical protein AALP_AA8G168800                    192   1e-54    
gb|EMS51475.1|  hypothetical protein TRIUR3_09357                       194   3e-54    
dbj|BAK05964.1|  predicted protein                                      195   3e-54    
dbj|BAK06422.1|  predicted protein                                      195   3e-54    
emb|CDY32098.1|  BnaC04g44680D                                          195   4e-54    
gb|EMT22485.1|  hypothetical protein F775_13089                         193   5e-54    
gb|KHN02317.1|  Mannan synthase 1                                       193   1e-53    



>gb|AAQ62571.1| glycosyltransferase 5, partial [Ipomoea trifida]
Length=508

 Score =   350 bits (897),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 205/221 (93%), Gaps = 4/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKMF+EIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFF
Sbjct  292  TFKAFRFQQHRWSCGPANLFRKMFMEIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFF  351

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV+VPKWGAIYIPCI+TILNSVGTPRSIHLLFYWILFENVMSFHRTKA
Sbjct  352  YCVVLPLTILVPEVEVPKWGAIYIPCIITILNSVGTPRSIHLLFYWILFENVMSFHRTKA  411

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLEFKRANEWVVTEKLGDAI    N NK N+     K KSIFRDRIL  ELGFAVF
Sbjct  412  TLIGLLEFKRANEWVVTEKLGDAI----NNNKSNSKPAPKKTKSIFRDRILLHELGFAVF  467

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CGVYD+L+GKNHYYIYLFLQVITFTIAGVG++GTIVPS
Sbjct  468  LFVCGVYDYLHGKNHYYIYLFLQVITFTIAGVGWVGTIVPS  508



>gb|AAQ62570.1| glycosyltransferase 1 [Ipomoea trifida]
 gb|AAS79578.1| putative glycosyltransferase [Ipomoea trifida]
Length=537

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 198/221 (90%), Positives = 206/221 (93%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKMFIEIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFF
Sbjct  320  TFKAFRFQQHRWSCGPANLFRKMFIEIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV+VPKWGAIYIPCI+TILNSVGTPRSIHLLFYWILFENVMSFHRTKA
Sbjct  380  YCVVLPLTILVPEVEVPKWGAIYIPCIITILNSVGTPRSIHLLFYWILFENVMSFHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLEFKRANEWVVTEKLGDAI   NN NK N+     K KS+FRDRIL  ELGFAVF
Sbjct  440  TLIGLLEFKRANEWVVTEKLGDAI---NNNNKSNSKPAPKKSKSMFRDRILLHELGFAVF  496

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CGVYDFL+GKNHYYIYLFLQVITFTIAGVG++GTIVPS
Sbjct  497  LFVCGVYDFLHGKNHYYIYLFLQVITFTIAGVGWVGTIVPS  537



>gb|AAQ62572.1| glycosyltransferase 10 [Ipomoea trifida]
 dbj|BAF36343.1| hypothetical protein [Ipomoea trifida]
Length=537

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 206/221 (93%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKMF+EIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFF
Sbjct  320  TFKAFRFQQHRWSCGPANLFRKMFMEIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV+VPKWGAIYIPCI+TILNSVGTPRSIHLLFYWILFENVMSFHRTKA
Sbjct  380  YCVVLPLTILVPEVEVPKWGAIYIPCIITILNSVGTPRSIHLLFYWILFENVMSFHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLEFKRANEWVVTEKLGDAI   NN NK N+     K KSIF+DRIL  ELGFAVF
Sbjct  440  TLIGLLEFKRANEWVVTEKLGDAI---NNNNKSNSKPAPKKTKSIFKDRILLHELGFAVF  496

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CGVYD+L+GKNHYYIYLFLQVITFTIAGVG++GTIVPS
Sbjct  497  LFVCGVYDYLHGKNHYYIYLFLQVITFTIAGVGWVGTIVPS  537



>ref|XP_004241301.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
lycopersicum]
Length=533

 Score =   322 bits (825),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 192/221 (87%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRVN+WKK YVIYSFF VRKI AHMVTFFF
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNIWKKFYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVVLPL++LVPEV++P WGAIYIPCI+T LNSVGTPRSIHLLFYWILFENVM+F RTKA
Sbjct  378  FCVVLPLSLLVPEVEIPTWGAIYIPCIITTLNSVGTPRSIHLLFYWILFENVMAFQRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGDA+     KNK    +    + S+F DRILPQELGFAVF
Sbjct  438  TFIGLLEAKRANEWVVTEKLGDAL-----KNKEKTKQTKKPRGSLFGDRILPQELGFAVF  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD LYGK+ Y++Y+FLQVITFTIAG GY+GTIVPS
Sbjct  493  LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS  533



>ref|XP_006347222.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
tuberosum]
Length=533

 Score =   322 bits (825),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 192/221 (87%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRVN+WKK YVIYSFF VRKI AHMVTFFF
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNIWKKFYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVVLPL++LVPEV++P WGAIYIPCI+T LNSVGTPRSIHLLFYWILFENVM+F RTKA
Sbjct  378  FCVVLPLSLLVPEVEIPTWGAIYIPCIITTLNSVGTPRSIHLLFYWILFENVMAFQRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGDA+     KNK    +    + S+F DRILPQELGFAVF
Sbjct  438  TFIGLLEAKRANEWVVTEKLGDAL-----KNKEKTKQTKKPRGSLFGDRILPQELGFAVF  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD LYGK+ Y++Y+FLQVITFTIAG GY+GTIVPS
Sbjct  493  LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS  533



>ref|XP_009629011.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 193/221 (87%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRVN+WKK YVIYSFF VRKI AHMVTFFF
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNIWKKFYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVVLPL++LVPEV++P W AIYIPCI+TILNSVGTPRSIHLLFYWILFENVM+FHRTKA
Sbjct  378  FCVVLPLSLLVPEVEIPVWAAIYIPCIITILNSVGTPRSIHLLFYWILFENVMAFHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGDA+     KNK    +    + S+F DRILPQELGFA+F
Sbjct  438  TFIGLLEAKRANEWVVTEKLGDAL-----KNKDKTKQTKKPRGSLFGDRILPQELGFALF  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD LYGK+ Y++Y+FLQV+TFTIAG GY+GTIVPS
Sbjct  493  LFFCGCYDVLYGKSQYFLYIFLQVVTFTIAGFGYIGTIVPS  533



>ref|XP_009794211.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
sylvestris]
Length=526

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 191/221 (86%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRVNVWKK YVIYSFF VRKI AHMVTFFF
Sbjct  311  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNVWKKFYVIYSFFFVRKIIAHMVTFFF  370

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVVLPLT+LVPEV+VP WGAIYIPCI+T LNSVGTPRSIHLLFYWILFENVM+FHRTKA
Sbjct  371  FCVVLPLTLLVPEVEVPLWGAIYIPCIITTLNSVGTPRSIHLLFYWILFENVMAFHRTKA  430

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGD +     KNK  +      +  +F DRILPQELGFAVF
Sbjct  431  TFIGLLEAKRANEWVVTEKLGDTL-----KNKEKSKPAKKARGPLFGDRILPQELGFAVF  485

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG+YD LYGK  Y+IY+FLQVITFTIAG GY+GTIVPS
Sbjct  486  LFFCGLYDVLYGKRVYFIYVFLQVITFTIAGFGYVGTIVPS  526



>emb|CDP06989.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 190/221 (86%), Gaps = 4/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK++ VWKKVYVIYSFF VRK+ AHMVTFFF
Sbjct  320  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKIAVWKKVYVIYSFFFVRKVIAHMVTFFF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV+VPKWGAIYIPCI+T LNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  380  YCVVLPLTILVPEVEVPKWGAIYIPCIITALNSVGTPRSIHLLFYWILFENVMSLHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGDA+ N +N  K    K   K      DRI   ELGFAVF
Sbjct  440  TFIGLLEAKRANEWVVTEKLGDALKNKSNVVKAKPKKIGLKIG----DRIHLTELGFAVF  495

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YDFLYGKN+Y+IYLFLQVITFTIAG GY+GTIVP+
Sbjct  496  LFFCGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPT  536



>ref|XP_009590983.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=526

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 176/221 (80%), Positives = 190/221 (86%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRVN WKK YVIYSFF VRKI AHMVTFFF
Sbjct  311  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNFWKKFYVIYSFFFVRKIIAHMVTFFF  370

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVVLPLT+LVPEV+VP WGAIYIPCI+T LNSVGTPRSIHLLFYWILFENVM+FHRTKA
Sbjct  371  FCVVLPLTLLVPEVEVPLWGAIYIPCIITTLNSVGTPRSIHLLFYWILFENVMAFHRTKA  430

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGD +     KNK  +      +  +F DRILPQELGFAVF
Sbjct  431  TFIGLLEAKRANEWVVTEKLGDTL-----KNKEKSKPAKKARGPLFGDRILPQELGFAVF  485

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG+YD LYGK  Y+IY+FLQVITFTIAG GY+GTIVPS
Sbjct  486  LFFCGLYDVLYGKRVYFIYVFLQVITFTIAGFGYVGTIVPS  526



>gb|ACF33171.1| mannan synthase [Coffea canephora]
Length=537

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 190/221 (86%), Gaps = 4/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK++ VWKKVYVIYSFF VRK+ AHMVTFFF
Sbjct  320  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKIAVWKKVYVIYSFFFVRKVIAHMVTFFF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV+VPKWGAIYIPCI+T LNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  380  YCVVLPLTILVPEVEVPKWGAIYIPCIITALNSVGTPRSIHLLFYWILFENVMSLHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGDA+ N +N  K    K   K      DRI   ELGFAVF
Sbjct  440  TFIGLLEAKRANEWVVTEKLGDALKNKSNVVKAKPKKIGLKIG----DRIHLTELGFAVF  495

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YDFLYGKN+Y+IYLFLQVITFTIAG GY+GTIVP+
Sbjct  496  LFFCGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPT  536



>gb|ACV71015.1| UPA15 [Capsicum annuum]
Length=528

 Score =   320 bits (820),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 188/221 (85%), Gaps = 4/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRVNVWKK YVIYSFF VRKI AHMVTFFF
Sbjct  312  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNVWKKFYVIYSFFFVRKIIAHMVTFFF  371

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVVLPLT+LVPEV+VP W AIYIPCI+T LNSVGTPRSIHLLFYWILFENVM++HRTKA
Sbjct  372  FCVVLPLTLLVPEVEVPIWAAIYIPCIITTLNSVGTPRSIHLLFYWILFENVMAYHRTKA  431

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGDA+          A      +  +F DRILPQELGFAVF
Sbjct  432  TFIGLLEAKRANEWVVTEKLGDAL----KNKDKAAKPVKKARGPLFGDRILPQELGFAVF  487

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG+YD LYGK  Y++Y+FLQVITFTIAG GY+GTIVPS
Sbjct  488  LFFCGLYDVLYGKRQYFVYVFLQVITFTIAGFGYVGTIVPS  528



>ref|XP_009769755.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like isoform 
X1 [Nicotiana sylvestris]
Length=533

 Score =   320 bits (819),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 191/221 (86%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRVN+WKK YVIYSFF VRKI AHMVTFFF
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNIWKKFYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVVLPL++LVPEV++P W AIYIPCI+TILNSVGTPRSIHLLFYWILFENVM+FHRTKA
Sbjct  378  FCVVLPLSLLVPEVEIPVWAAIYIPCIITILNSVGTPRSIHLLFYWILFENVMAFHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGDA+     KNK         + S+F DRILPQELGFA F
Sbjct  438  TFIGLLEAKRANEWVVTEKLGDAL-----KNKDKTKPTKKPRGSLFGDRILPQELGFAAF  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD LYGK+ Y++Y+FLQVITFTIAG GY+GTI+PS
Sbjct  493  LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIIPS  533



>ref|XP_004251009.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Solanum 
lycopersicum]
Length=524

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 189/221 (86%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EI+RNKRVN WKK YVIYSFF VRKI AHMVTFFF
Sbjct  309  TFKAFRFQQHRWSCGPANLFRKMVMEIIRNKRVNFWKKFYVIYSFFFVRKIIAHMVTFFF  368

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVVLPLT+LVPEV+VP W AIYIPCI+T LNSVGTPRSIHLLFYWILFENVM++HRTKA
Sbjct  369  FCVVLPLTLLVPEVEVPIWAAIYIPCIITTLNSVGTPRSIHLLFYWILFENVMAYHRTKA  428

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGDA+     KNK  +      +  +F DRILPQELGFA F
Sbjct  429  TFIGLLEAKRANEWVVTEKLGDAL-----KNKDKSKPVKKARGPLFGDRILPQELGFAAF  483

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG+YD LYGK  Y++Y+FLQVITFTIAG GY+GTIVPS
Sbjct  484  LFFCGLYDVLYGKRQYFVYVFLQVITFTIAGFGYIGTIVPS  524



>ref|XP_006349077.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
tuberosum]
Length=524

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 188/221 (85%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRVN WKK YVIYSFF VRKI AHMVTFFF
Sbjct  309  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNFWKKFYVIYSFFFVRKIIAHMVTFFF  368

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVVLPLT+LVPEV+VP W AIYIPCI+T LNSVGTPRSIHLLFYWILFENVM++HRTKA
Sbjct  369  FCVVLPLTLLVPEVEVPIWAAIYIPCIITTLNSVGTPRSIHLLFYWILFENVMAYHRTKA  428

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL E KRANEWVVTEKLGDA+     KNK  +      +  +F DRILPQELGFA F
Sbjct  429  TFIGLFEAKRANEWVVTEKLGDAL-----KNKDKSKPVKKARGPLFGDRILPQELGFAAF  483

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG+YD LYGK  Y++Y+FLQVITFTIAG GY+GTIVPS
Sbjct  484  LFFCGLYDVLYGKRQYFVYVFLQVITFTIAGFGYIGTIVPS  524



>ref|XP_011089999.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Sesamum 
indicum]
Length=536

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 185/221 (84%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM ++I  NK+V+++KK YVIYSFF VRK+ AHM TFFF
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMDIATNKKVSLYKKFYVIYSFFFVRKLIAHMFTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPL+ILVPEVDVPKWGAIYIPCI+T LNSVGTPRS HLLFYW+LFENVMSFHRTKA
Sbjct  378  YCVVLPLSILVPEVDVPKWGAIYIPCIITTLNSVGTPRSFHLLFYWVLFENVMSFHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KR NEWVVTEKLGD +    NK+   +A P         DRI  QELGFA+F
Sbjct  438  TFIGLLEAKRVNEWVVTEKLGDTL---KNKSHSKSAAPRRSLSKFLGDRIQLQELGFALF  494

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YDFLYGKN+Y+IYLFLQVITFTIAG GY+GTIVPS
Sbjct  495  LFICGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPS  535



>gb|EYU36101.1| hypothetical protein MIMGU_mgv1a0044822mg, partial [Erythranthe 
guttata]
Length=406

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 180/221 (81%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM ++I  NK+V ++KK YVIYSFF VRKI AHM TF F
Sbjct  190  TFKAFRFQQHRWSCGPANLFRKMMMDIAMNKKVTLYKKFYVIYSFFFVRKIIAHMFTFVF  249

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VPKWGAIY+PCI+T+LNSVGTPRS HLLFYW+LFENVMSFHRTKA
Sbjct  250  YCVVLPLTILVPEVYVPKWGAIYLPCIITLLNSVGTPRSFHLLFYWVLFENVMSFHRTKA  309

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE KR NEWVVTEKLGD +     KNK  ++ P         DR+L  ELGFAV 
Sbjct  310  TIIGLLEAKRVNEWVVTEKLGDTL-----KNKSKSSAPRRSLSKFIGDRVLVHELGFAVL  364

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L   G YDFLYGKN+Y++YLFLQ ITFTIAG GY+GTIVP 
Sbjct  365  LFVSGCYDFLYGKNYYFVYLFLQTITFTIAGFGYIGTIVPG  405



>ref|XP_011088835.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Sesamum 
indicum]
Length=536

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 178/221 (81%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EI  NK+V ++KK YVIYSFF+VRK+ AHM TFFF
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIAMNKKVTLYKKFYVIYSFFIVRKLVAHMFTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPL ILVPEV+VPKWG+IY+PCI+T LNSVGTPRS +LLFYW+LFENVMSFHRTKA
Sbjct  378  YCVVLPLAILVPEVEVPKWGSIYLPCIITALNSVGTPRSFYLLFYWVLFENVMSFHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KR NEWVVTEKLGD +    NK+             +  DRI   ELGFA F
Sbjct  438  TFIGLLEAKRVNEWVVTEKLGDTL---KNKSDNKVPAKKRSISKLLGDRIQVHELGFAAF  494

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  C  YDFLYGKN Y+IYLFLQV+TFTI G+GY+GTIVPS
Sbjct  495  LFICACYDFLYGKNKYFIYLFLQVVTFTITGLGYVGTIVPS  535



>ref|XP_006484970.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Citrus 
sinensis]
Length=537

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 182/220 (83%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRKI AHMVTF F
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIIRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFSF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI-FRDRILPQELGFAV  538
            T IGLLE  RANEWVVTEKLGDA+ N     K      APKK  I F DR+   ELGF V
Sbjct  438  TFIGLLEAGRANEWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFADRMHTLELGFGV  497

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            FL FCG YDF++GKN+Y+IYLFLQ ITF IAG GY+GTIV
Sbjct  498  FLFFCGCYDFVHGKNNYFIYLFLQTITFLIAGFGYIGTIV  537



>gb|KDO45609.1| hypothetical protein CISIN_1g040333mg [Citrus sinensis]
Length=513

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 182/220 (83%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRKI AHMVTF F
Sbjct  294  TFKAFRFQQHRWSCGPANLFRKMVMEIIRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFSF  353

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  354  YCVVLPLTILVPEVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  413

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI-FRDRILPQELGFAV  538
            T IGLLE  RANEWVVTEKLGDA+ N     K      APKK  I F +R+   ELGF V
Sbjct  414  TFIGLLEAGRANEWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFAERMHTLELGFGV  473

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            FL FCG YDF++GKN+Y+IYLFLQ ITF IAG GY+GTIV
Sbjct  474  FLFFCGCYDFVHGKNNYFIYLFLQTITFLIAGFGYIGTIV  513



>ref|XP_004160102.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cucumis 
sativus]
Length=359

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 182/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  137  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFF  196

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  197  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  256

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI-FRDRILPQELGFAV  538
            T+IGLLE  RANEWVVTEKLGDA+ N    +K    K    +    F DRI   ELGFA 
Sbjct  257  TLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKVRLRCKFGDRINTLELGFAA  316

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            FL  CG YDF++GKN+Y+IYLFLQ  +F I G+GY+GTI+PS
Sbjct  317  FLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPS  358



>ref|XP_006424348.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
 gb|ESR37588.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
Length=537

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 182/220 (83%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRKI AHMVTF F
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIIRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFSF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI-FRDRILPQELGFAV  538
            T IGLLE  RANEWVVTEKLGDA+ N     K      APKK  I F +R+   ELGF V
Sbjct  438  TFIGLLEAGRANEWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFAERMHTLELGFGV  497

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            FL FCG YDF++GKN+Y+IYLFLQ ITF IAG GY+GTIV
Sbjct  498  FLFFCGCYDFVHGKNNYFIYLFLQTITFLIAGFGYIGTIV  537



>gb|EYU36982.1| hypothetical protein MIMGU_mgv1a004240mg [Erythranthe guttata]
Length=538

 Score =   300 bits (767),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 180/224 (80%), Gaps = 9/224 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM ++I  NK+V ++KK YVIYSFF VRKI AH  TFFF
Sbjct  321  TFKAFRFQQHRWSCGPANLFRKMVMDIATNKKVTLYKKCYVIYSFFFVRKIIAHFFTFFF  380

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LPLTILVPEV VPKWG+IYIPCI+T+LNSVGTPRS HLLFYW+LFENVMSFHRTKA
Sbjct  381  YCLILPLTILVPEVYVPKWGSIYIPCIITMLNSVGTPRSFHLLFYWVLFENVMSFHRTKA  440

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR---DRILPQELGF  532
            T+IGL E KR NEWVVTEKLGD +         +  K    KKSIF+   DR+   ELGF
Sbjct  441  TLIGLFEAKRVNEWVVTEKLGDGV------KNKSNNKSIGFKKSIFKFLGDRVSVHELGF  494

Query  533  AVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            A FL  CG YDFLY KN+Y+IYLFLQ ITFTIAG GY+GT VPS
Sbjct  495  AAFLFVCGCYDFLYWKNNYFIYLFLQTITFTIAGFGYVGTFVPS  538



>gb|KDP34366.1| hypothetical protein JCGZ_11249 [Jatropha curcas]
Length=538

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 181/221 (82%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTF+F
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFWF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVTEKLG+ +  N    K N   P   +   F DR+   ELGFA F
Sbjct  438  TLIGLLEAGRANEWVVTEKLGNTLQKNAEAKKNNLKPPRKLRFK-FGDRLNTLELGFAAF  496

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YDF+ GKN+Y++YLFLQ ITF I G+GY+GTI+PS
Sbjct  497  LFLCGCYDFVNGKNNYFVYLFLQTITFFITGIGYVGTIIPS  537



>ref|XP_003606275.1| Glucomannan 4-beta-mannosyltransferase [Medicago truncatula]
 gb|AES88472.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=462

 Score =   294 bits (752),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 187/226 (83%), Gaps = 7/226 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T +AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFFLVRKI AHMVTFFF
Sbjct  237  TLRAFRFQQHRWSCGPANLFRKMAMEIIRNKKVKFWKKVYVIYSFFLVRKIVAHMVTFFF  296

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+PLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  297  YCLVIPLTILVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  356

Query  362  TIIGLLEFKRANEWVVTEKLGDAI-------nnnnnknkpnaakpapkkkSIFRDRILPQ  520
            T+IGLLE+ RANEWVVTEKLGD++       + + +  K    K   K +S F +R+   
Sbjct  357  TLIGLLEYGRANEWVVTEKLGDSVNNNNNKKDKSGDAAKKTNVKVQKKTRSKFMERLNFL  416

Query  521  ELGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            ELGFAVFL FCG YD+++GK++Y+IYLFLQ +TFTI G GY+GTIV
Sbjct  417  ELGFAVFLFFCGCYDYVHGKHNYFIYLFLQTLTFTIVGFGYVGTIV  462



>gb|KGN46914.1| hypothetical protein Csa_6G150530 [Cucumis sativus]
Length=525

 Score =   296 bits (757),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 182/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  303  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFF  362

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  363  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  422

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI-FRDRILPQELGFAV  538
            T+IGLLE  RANEWVVTEKLGDA+ N    +K    K    +    F DRI   ELGFA 
Sbjct  423  TLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKVRLRCKFGDRINTLELGFAA  482

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            FL  CG YDF++GKN+Y+IYLFLQ  +F I G+GY+GTI+PS
Sbjct  483  FLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPS  524



>ref|XP_004145779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cucumis 
sativus]
Length=539

 Score =   296 bits (758),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 182/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  317  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFF  376

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  377  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  436

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI-FRDRILPQELGFAV  538
            T+IGLLE  RANEWVVTEKLGDA+ N    +K    K    +    F DRI   ELGFA 
Sbjct  437  TLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKVRLRCKFGDRINTLELGFAA  496

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            FL  CG YDF++GKN+Y+IYLFLQ  +F I G+GY+GTI+PS
Sbjct  497  FLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPS  538



>ref|XP_008458630.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Cucumis 
melo]
Length=539

 Score =   296 bits (758),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 182/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  317  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFFF  376

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  377  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  436

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI-FRDRILPQELGFAV  538
            T+IGLLE  RANEWVVTEKLGDA+ N    +K    K    +    F DRI   ELGFA 
Sbjct  437  TLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKIRLRCKFGDRINTLELGFAA  496

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            FL  CG YDF++GKN+Y+IYLFLQ  +F I G+GY+GTI+PS
Sbjct  497  FLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPS  538



>emb|CBI17089.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 176/221 (80%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFFLVRKI AHMVTF  
Sbjct  214  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFLVRKIVAHMVTFCL  273

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTIL+PEV++P WG +YIP I+T LN+VGTPRSIHLLFYWILFENVMSFHRTKA
Sbjct  274  YCVVLPLTILIPEVEIPIWGIVYIPSIITTLNAVGTPRSIHLLFYWILFENVMSFHRTKA  333

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVTEKLGD + N  N                  DRI   ELGF+ F
Sbjct  334  TLIGLLEAGRANEWVVTEKLGDTLKNKANTKAAAKRPRFKIG-----DRINTMELGFSAF  388

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YDFLYGK ++Y+YLFLQ IT+ I G+GY+GTIVPS
Sbjct  389  LFFCACYDFLYGKYYFYVYLFLQTITYFIVGIGYVGTIVPS  429



>ref|XP_003606273.1| Glucomannan 4-beta-mannosyltransferase [Medicago truncatula]
 gb|AES88470.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=542

 Score =   294 bits (752),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 187/226 (83%), Gaps = 7/226 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T +AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFFLVRKI AHMVTFFF
Sbjct  317  TLRAFRFQQHRWSCGPANLFRKMAMEIIRNKKVKFWKKVYVIYSFFLVRKIVAHMVTFFF  376

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+PLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  377  YCLVIPLTILVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  436

Query  362  TIIGLLEFKRANEWVVTEKLGDAI-------nnnnnknkpnaakpapkkkSIFRDRILPQ  520
            T+IGLLE+ RANEWVVTEKLGD++       + + +  K    K   K +S F +R+   
Sbjct  437  TLIGLLEYGRANEWVVTEKLGDSVNNNNNKKDKSGDAAKKTNVKVQKKTRSKFMERLNFL  496

Query  521  ELGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            ELGFAVFL FCG YD+++GK++Y+IYLFLQ +TFTI G GY+GTIV
Sbjct  497  ELGFAVFLFFCGCYDYVHGKHNYFIYLFLQTLTFTIVGFGYVGTIV  542



>gb|KHG21024.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
 gb|KHG23680.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=537

 Score =   294 bits (752),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 177/220 (80%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM  EI+ NK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVCEIITNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGD-AInnnnnknkpnaakpapkkkSIFRDRILPQELGFAV  538
            T+IGL E  RANEWVVTEKLGD A            +K   + +S F DR+   ELGF+ 
Sbjct  438  TLIGLFETGRANEWVVTEKLGDVAKKVAEANKNKTNSKAIKRYRSKFIDRLNTLELGFSA  497

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            FL  CG +DF+YGKN+Y+IYL+LQ ITF I G+GY+GTI+
Sbjct  498  FLFLCGCFDFMYGKNNYFIYLWLQTITFFITGIGYVGTII  537



>ref|XP_010089159.1| hypothetical protein L484_003290 [Morus notabilis]
 gb|EXB37420.1| hypothetical protein L484_003290 [Morus notabilis]
Length=541

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 177/224 (79%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIV+NK+V  WKKVYVIYSFF VRKI AHMVTF F
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIVKNKKVKFWKKVYVIYSFFFVRKIIAHMVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkS---IFRDRILPQELGF  532
            T IGLLE  RANEWVVTEKLGD +      +  N   P    K     F DR+   ELGF
Sbjct  438  TFIGLLEAGRANEWVVTEKLGDTLKKKAESDAANKKTPFKLFKKPRFKFGDRLHLLELGF  497

Query  533  AVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             VFL  CG YDF++GKN+Y++YLFLQ  TF I G GY+GTI+PS
Sbjct  498  GVFLFLCGCYDFVHGKNNYFVYLFLQTFTFLICGFGYVGTIIPS  541



>ref|XP_002269677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Vitis vinifera]
Length=533

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 176/221 (80%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFFLVRKI AHMVTF  
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFLVRKIVAHMVTFCL  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTIL+PEV++P WG +YIP I+T LN+VGTPRSIHLLFYWILFENVMSFHRTKA
Sbjct  378  YCVVLPLTILIPEVEIPIWGIVYIPSIITTLNAVGTPRSIHLLFYWILFENVMSFHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVTEKLGD + N  N                  DRI   ELGF+ F
Sbjct  438  TLIGLLEAGRANEWVVTEKLGDTLKNKANTKAAAKRPRFKIG-----DRINTMELGFSAF  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YDFLYGK ++Y+YLFLQ IT+ I G+GY+GTIVPS
Sbjct  493  LFFCACYDFLYGKYYFYVYLFLQTITYFIVGIGYVGTIVPS  533



>emb|CAN82595.1| hypothetical protein VITISV_013708 [Vitis vinifera]
Length=534

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 176/221 (80%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFFLVRKI AHMVTF  
Sbjct  319  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFLVRKIVAHMVTFCL  378

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTIL+PEV++P WG +YIP I+T LN+VGTPRSIHLLFYWILFENVMSFHRTKA
Sbjct  379  YCVVLPLTILIPEVEIPIWGIVYIPSIITTLNAVGTPRSIHLLFYWILFENVMSFHRTKA  438

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVTEKLGD + N  N                  DRI   ELGF+ F
Sbjct  439  TLIGLLEAGRANEWVVTEKLGDTLKNKANTKAAAKRPRFKIG-----DRINTMELGFSAF  493

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YDFLYGK ++Y+YLFLQ IT+ I G+GY+GTIVPS
Sbjct  494  LFFCACYDFLYGKYYFYVYLFLQTITYFIVGIGYVGTIVPS  534



>ref|XP_002527445.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF34937.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=535

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 180/219 (82%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTF+F
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFWF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVT+K+G+ +  N +  K         + + F DR+   ELGFA F
Sbjct  438  TLIGLLEAGRANEWVVTQKIGNTLQKNADAKKAGLKVFKRPRFT-FTDRLNTLELGFAAF  496

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L  CG YDF++GKN+Y++YLFLQ ITF I GVGY+GTI+
Sbjct  497  LFLCGCYDFVHGKNNYFVYLFLQTITFFITGVGYVGTII  535



>ref|XP_006384673.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|ERP62470.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=540

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 179/221 (81%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRVN WKKVYVIYSFF VRKI AHMVTF F
Sbjct  320  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNFWKKVYVIYSFFFVRKIIAHMVTFCF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  380  YCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
             +IGLLE  R NEWVVTEKLG+ +    +  K N   P   +   F DRI   ELGFA F
Sbjct  440  ALIGLLEAGRVNEWVVTEKLGNTLQKAADARKANTKAPRKFRFK-FTDRINTLELGFAAF  498

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YDF+ GKN+Y+IYL+LQ +TF I G+GY+GTI+PS
Sbjct  499  LFLCGCYDFVNGKNNYFIYLWLQTVTFFITGIGYVGTIIPS  539



>ref|XP_011005673.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=540

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 179/221 (81%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRV  WKKVYVIYSFF VRKI AHMVTF F
Sbjct  320  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVKFWKKVYVIYSFFFVRKIIAHMVTFCF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  380  YCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  R NEWVVTEKLG+ +    +  K N   P   +   F DR+   ELGFA F
Sbjct  440  TLIGLLEAGRVNEWVVTEKLGNTVQKAADARKANTKAPRKFRFK-FTDRLNTLELGFAAF  498

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG +DF+ GKN+Y+IYL+LQ +TF I G+GY+GTI+PS
Sbjct  499  LFLCGCFDFVNGKNNYFIYLWLQTVTFFITGIGYVGTIIPS  539



>ref|XP_008363527.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Malus 
domestica]
Length=499

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 179/231 (77%), Gaps = 10/231 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF AFRFQQHRWSCGPANLFRKM +EI++ K+V VWKK Y IYSFF VRKI AHMVTFFF
Sbjct  268  TFNAFRFQQHRWSCGPANLFRKMAMEIIKTKKVTVWKKFYTIYSFFFVRKIIAHMVTFFF  327

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  328  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  387

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI----------FRDRI  511
            T+IGLLE  R+NEWVVTEKLGD + N   +   N    A K K            F +R+
Sbjct  388  TLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKVADANKTKPASKLFKRPRFKFGNRL  447

Query  512  LPQELGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
               ELGF VFL  CG YDF++GKN+Y++YLFLQ ITF I G GY+GTI+PS
Sbjct  448  HLLELGFGVFLFMCGCYDFVHGKNNYFVYLFLQTITFLICGFGYVGTIIPS  498



>ref|XP_008385455.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Malus domestica]
Length=549

 Score =   291 bits (746),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 179/231 (77%), Gaps = 10/231 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF AFRFQQHRWSCGPANLFRKM +EI+R K+V VWKK Y IYSFF VRKI AHMVTFFF
Sbjct  318  TFNAFRFQQHRWSCGPANLFRKMAMEIIRTKKVTVWKKFYTIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI----------FRDRI  511
            T+IGLLE  R+NEWVVTEKLGD + N   +   N    A K K            F +R+
Sbjct  438  TLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKTADANKTKPASKLFKRPRFKFGNRL  497

Query  512  LPQELGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
               ELGF VFL  CG YDF++GKN+Y+IYLFLQ ITF I G GY+GTI+PS
Sbjct  498  HLLELGFGVFLFICGCYDFVHGKNNYFIYLFLQTITFLICGFGYVGTIIPS  548



>ref|XP_009337395.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   291 bits (746),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 179/231 (77%), Gaps = 10/231 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF AFRFQQHRWSCGPANLFRKM +EI+R K+V +WKK Y IYSFF VRKI AHMVTFFF
Sbjct  318  TFNAFRFQQHRWSCGPANLFRKMAMEIIRTKKVTLWKKFYTIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI----------FRDRI  511
            T+IGLLE  R+NEWVVTEKLGD + N   +   N    A K K            F +R+
Sbjct  438  TLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKTADANKTKPASKLFKKPRFKFGNRL  497

Query  512  LPQELGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
               ELGF VFL  CG YDF++GKN+Y+IYLFLQ ITF I G GY+GTI+PS
Sbjct  498  HLLELGFGVFLFICGCYDFVHGKNNYFIYLFLQTITFLICGFGYVGTIIPS  548



>ref|XP_008360269.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Malus 
domestica]
Length=549

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 179/231 (77%), Gaps = 10/231 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF AFRFQQHRWSCGPANLFRKM +EI++ K+V VWKK Y IYSFF VRKI AHMVTFFF
Sbjct  318  TFNAFRFQQHRWSCGPANLFRKMAMEIIKTKKVTVWKKFYTIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI----------FRDRI  511
            T+IGLLE  R+NEWVVTEKLGD + N   +   N    A K K            F +R+
Sbjct  438  TLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKVADANKTKPASKLFKRPRFKFGNRL  497

Query  512  LPQELGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
               ELGF VFL  CG YDF++GKN+Y++YLFLQ ITF I G GY+GTI+PS
Sbjct  498  HLLELGFGVFLFMCGCYDFVHGKNNYFVYLFLQTITFLICGFGYVGTIIPS  548



>ref|XP_010031452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW50751.1| hypothetical protein EUGRSUZ_J00420 [Eucalyptus grandis]
Length=527

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 176/219 (80%), Gaps = 9/219 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTI VPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTIWVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSMHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  RANEWVVTEKLGD + N + K +             F DR+   ELGF VF
Sbjct  438  TFIGLLEAGRANEWVVTEKLGDTLKNKSKKLRFTFN---------FADRLHLLELGFGVF  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L   G YDFLYGKN+Y++YL+LQ ITF IAG GY+GTIV
Sbjct  489  LFVTGCYDFLYGKNNYFVYLWLQTITFFIAGFGYIGTIV  527



>ref|XP_004506130.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cicer 
arietinum]
Length=538

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 185/222 (83%), Gaps = 3/222 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T +AFRFQQHRWSCGPANLFRKM ++I+RNK+V  WKKVYVIYSFFLVRKI AHMVTFFF
Sbjct  317  TLRAFRFQQHRWSCGPANLFRKMAMDIIRNKKVKFWKKVYVIYSFFLVRKIVAHMVTFFF  376

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+PLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  377  YCLVIPLTILVPEVYVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  436

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnn---knkpnaakpapkkkSIFRDRILPQELGF  532
            T+IGLLE+ RANEWVVTEKLGD++NN        K   AK   K +S F +R+   ELGF
Sbjct  437  TLIGLLEYGRANEWVVTEKLGDSVNNKTKSGDAAKKTNAKVQKKTRSKFVERLNFLELGF  496

Query  533  AVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            A FL FCG YDF +GK++Y+IYLFLQ ++F+I G GY+GTIV
Sbjct  497  AAFLFFCGCYDFQHGKHNYFIYLFLQSLSFSIVGFGYVGTIV  538



>ref|XP_004294040.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=540

 Score =   289 bits (739),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 176/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF AFRFQQHRWSCGPANLFRKM  EI  NK+V +WKK YVIYSFF VRKI AHMVTFFF
Sbjct  318  TFNAFRFQQHRWSCGPANLFRKMVWEIAMNKKVTLWKKFYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR-DRILPQELGFAV  538
            T+IGL E  RANEWVVTEKLGD +    +  K   A    KK      +R+   ELGF +
Sbjct  438  TLIGLFEAGRANEWVVTEKLGDTVKKAADAAKNKPAPKFFKKPKFKFGNRLHMLELGFGL  497

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            FL FCG YD+++GKN+Y++YLFLQ ITF I G GY+GTI+PS
Sbjct  498  FLFFCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPS  539



>ref|XP_003539806.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21108.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   289 bits (739),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 182/226 (81%), Gaps = 7/226 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T +AFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  318  TLRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+PLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVIPLTILVPEVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAI-------nnnnnknkpnaakpapkkkSIFRDRILPQ  520
            T IGLLE+ RANEWVVTEKLGD++       + +  K          K +S F +R+   
Sbjct  438  TFIGLLEYGRANEWVVTEKLGDSVNNNNKNKSGDAAKKNNAIKATPKKTRSKFVERLNLL  497

Query  521  ELGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            ELGFAVFL  CG YD+++GK++Y+IYLFLQ +TF+I G GY+GTIV
Sbjct  498  ELGFAVFLFVCGCYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGTIV  543



>ref|XP_007015961.1| Cellulose synthase-like A02 isoform 1 [Theobroma cacao]
 gb|EOY33580.1| Cellulose synthase-like A02 isoform 1 [Theobroma cacao]
Length=537

 Score =   288 bits (738),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 180/220 (82%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM  EI++NK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVWEIIQNKKVKFWKKVYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI-FRDRILPQELGFAV  538
            T IGLLE  RANEWVVTEKLGDA+    +  K      AP+K    F DR+   ELGFA 
Sbjct  438  TFIGLLEAGRANEWVVTEKLGDAVKKAADAAKNKTNAKAPRKFRFKFTDRLNTLELGFAA  497

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            FL  CG YDF++GKN+Y++YLFLQ ITF I G+GY+GTI+
Sbjct  498  FLFICGCYDFVHGKNNYFVYLFLQTITFFITGIGYVGTII  537



>gb|AFZ78579.1| cellulose synthase-like protein [Populus tomentosa]
Length=540

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 178/221 (81%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EIVRNKRV  WKKVYVIYSFF VRKI AHMVTF F
Sbjct  320  TFQAFRFQQHRWSCGPANLFRKMVMEIVRNKRVKFWKKVYVIYSFFFVRKIIAHMVTFCF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  380  YCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  R NEWVVTEKLG+ +    +  K N   P   +   F +R+   ELGFA F
Sbjct  440  TLIGLLEAGRVNEWVVTEKLGNTLQKAADARKANTKAPRKFRFK-FTERLNTLELGFAAF  498

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YDF+ GKN+Y+IYL+LQ +TF I G+GY+GTI PS
Sbjct  499  LFLCGCYDFVNGKNNYFIYLWLQTVTFFITGIGYVGTIFPS  539



>ref|XP_003538146.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
Length=542

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 186/225 (83%), Gaps = 6/225 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T +AFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  318  TLRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+PLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVIPLTILVPEVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpap------kkkSIFRDRILPQE  523
            T IGLLE+ RANEWVVTEKLGD++NNN NK+   A K         K +S F +R+   E
Sbjct  438  TFIGLLEYGRANEWVVTEKLGDSVNNNKNKSGDAAKKNNAIKATPKKTRSKFVERLNLLE  497

Query  524  LGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            LGFA FL  CG YD+++GK++Y+IYLFLQ +TF+I G GY+GTIV
Sbjct  498  LGFAAFLFVCGCYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGTIV  542



>ref|XP_003551076.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21460.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=533

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 180/219 (82%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T +AFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  318  TLRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+T LNSVGTPRSIHLLFYWILFEN MS HRTKA
Sbjct  378  YCVVLPLTILVPEVRVPIWGAVYIPSIITTLNSVGTPRSIHLLFYWILFENAMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  RANEWVVTEKLGD++NN N  N   A + +  K   F +R+   ELGFA F
Sbjct  438  TFIGLLEAGRANEWVVTEKLGDSVNNKNKSNVTKAIRKSRFK---FGERLHLLELGFAAF  494

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L  CG YD+++GKN+Y++YLFLQ ITF+I G GY+GTIV
Sbjct  495  LFLCGCYDYVHGKNNYFLYLFLQTITFSIVGFGYVGTIV  533



>ref|XP_007208459.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09658.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=516

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 177/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF AFRFQQHRWSCGPANLFRKM +EIV+ K+V +WKK YVIYSFF VRKI AHMVTFFF
Sbjct  294  TFNAFRFQQHRWSCGPANLFRKMVMEIVKTKKVTLWKKFYVIYSFFFVRKIIAHMVTFFF  353

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  354  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  413

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR-DRILPQELGFAV  538
            T+IGLLE  RANEWVVTEKLGD + N   +     A    K+      +R+   ELGF  
Sbjct  414  TLIGLLETGRANEWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGNRLHLLELGFGA  473

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            FL  CG YD+++GKN+Y++YLFLQ ITF I G GY+GTI+PS
Sbjct  474  FLFVCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPS  515



>ref|XP_007208460.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09659.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=540

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 177/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF AFRFQQHRWSCGPANLFRKM +EIV+ K+V +WKK YVIYSFF VRKI AHMVTFFF
Sbjct  318  TFNAFRFQQHRWSCGPANLFRKMVMEIVKTKKVTLWKKFYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR-DRILPQELGFAV  538
            T+IGLLE  RANEWVVTEKLGD + N   +     A    K+      +R+   ELGF  
Sbjct  438  TLIGLLETGRANEWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGNRLHLLELGFGA  497

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            FL  CG YD+++GKN+Y++YLFLQ ITF I G GY+GTI+PS
Sbjct  498  FLFVCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPS  539



>ref|XP_007132379.1| hypothetical protein PHAVU_011G089900g [Phaseolus vulgaris]
 gb|ESW04373.1| hypothetical protein PHAVU_011G089900g [Phaseolus vulgaris]
Length=542

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 186/225 (83%), Gaps = 6/225 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T +AFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  318  TLRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVV+P+TIL+PEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  FCVVIPITILIPEVYVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnn------nknkpnaakpapkkkSIFRDRILPQE  523
            T IGLLE+ RANEWVVTEKLGD++N+N          K N +K   K +S F +R+   E
Sbjct  438  TFIGLLEYGRANEWVVTEKLGDSVNSNTKNKTGDAAKKNNVSKAPKKTRSKFVERLNFLE  497

Query  524  LGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            LGFA FL FCG YDF++GK++Y+IYLFLQ ITF+I G GY+GTIV
Sbjct  498  LGFAAFLFFCGCYDFVHGKHNYFIYLFLQTITFSIVGFGYVGTIV  542



>gb|KHN38673.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 181/226 (80%), Gaps = 7/226 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T +AFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTFFF
Sbjct  318  TLRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+PLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVIPLTILVPEVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAI-------nnnnnknkpnaakpapkkkSIFRDRILPQ  520
            T IGLLE+ RANEWVVTEKLGD++       + +  K          K +S F +R+   
Sbjct  438  TFIGLLEYGRANEWVVTEKLGDSVNNNNKNKSGDAAKKNNAIKATPKKTRSKFVERLNLL  497

Query  521  ELGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            ELGFA FL  CG YD+++GK++Y+IYLFLQ +TF+I G GY+GTIV
Sbjct  498  ELGFAAFLFVCGCYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGTIV  543



>ref|XP_011044347.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=537

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 174/219 (79%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKK YVIYSFF VRKI AHMVTF F
Sbjct  320  TFKAFRFQQHRWSCGPANLFRKMAMEIVRNKKVRFWKKFYVIYSFFFVRKIIAHMVTFSF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  380  YCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  RANEWVVTEKLG+ +       K N   P   +   F DR+   ELGF+ F
Sbjct  440  TFIGLLEAGRANEWVVTEKLGNTLQKAAEAKKSNLKAPRKFRFK-FTDRLNTLELGFSAF  498

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L  CG YDF  GKN+Y+IYL+LQ +TF I G+GY+GTI+
Sbjct  499  LFLCGCYDFANGKNNYFIYLWLQTVTFFITGIGYVGTII  537



>ref|XP_008227108.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Prunus mume]
Length=540

 Score =   287 bits (734),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 177/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF AFRFQQHRWSCGPANLFRKM +EIV+ K+V +WKK YVIYSFF VRKI AHMVTFFF
Sbjct  318  TFNAFRFQQHRWSCGPANLFRKMVMEIVKTKKVTLWKKFYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR-DRILPQELGFAV  538
            T+IGLLE  RANEWVVTEKLGD + N   +     A    K+      +R+   ELGF  
Sbjct  438  TLIGLLETGRANEWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGNRLHLLELGFGA  497

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            FL  CG YD+++GKN+Y++YLFLQ ITF I G GY+GTI+PS
Sbjct  498  FLFVCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPS  539



>ref|XP_009364844.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 180/231 (78%), Gaps = 10/231 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF AFRFQQHRWSCGPANLFRKM +EI++ K+V VWKK Y IYSFF VRKI AHMVTFFF
Sbjct  318  TFNAFRFQQHRWSCGPANLFRKMAMEIIKTKKVTVWKKFYTIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI----------FRDRI  511
            T+IGLLE  R+NEWVVTEKLGD + N   +   N A  A K K            F +R+
Sbjct  438  TLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKAADANKTKPASKLFKRPRFKFGNRL  497

Query  512  LPQELGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
               ELGF VFL  CG YDF++GKN+Y++YLFLQ ITF I G GY+GTI+PS
Sbjct  498  HLLELGFGVFLFICGCYDFVHGKNNYFVYLFLQTITFLICGFGYVGTIIPS  548



>ref|XP_002312893.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|EEE86848.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=537

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AHMVTF F
Sbjct  320  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFSF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  380  YCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  RANEWVVTEKLG+ +       K N   P   +   F DR+   ELGF+ F
Sbjct  440  TFIGLLEAGRANEWVVTEKLGNTLQKAAEAKKSNPKAPRKFRFK-FTDRLNTLELGFSAF  498

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L  CG YDF+ GKN Y++YL+LQ +TF I G+GY+GTI+
Sbjct  499  LFLCGCYDFVNGKNCYFVYLWLQTVTFFITGIGYVGTII  537



>gb|KHF98868.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=537

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 179/220 (81%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM  EI++NK+V  WKKVYVIYSFF VRKI AHMVTF F
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVWEIIQNKKVKFWKKVYVIYSFFFVRKIIAHMVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTIL+PEV VP WGA+YIP ++TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILIPEVWVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSI-FRDRILPQELGFAV  538
            T IGLLE  RANEWVVTEKLGDA+    +  K      AP+K    F DR+   ELGFA 
Sbjct  438  TFIGLLEAGRANEWVVTEKLGDAVKKAADAAKNKNNAKAPRKLKFKFTDRLNTLELGFAA  497

Query  539  FLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            FL  CG YDF++GKN+Y++YLFLQ ITF I G+GY+GTI+
Sbjct  498  FLFLCGCYDFVHGKNNYFVYLFLQTITFFITGIGYVGTII  537



>ref|XP_010690012.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Beta 
vulgaris subsp. vulgaris]
Length=537

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 174/221 (79%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK V  WKKVYVIYSFFLVRKITAHMVTFFF
Sbjct  317  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKNVRFWKKVYVIYSFFLVRKITAHMVTFFF  376

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LPLTILVPEV+VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  377  YCVILPLTILVPEVEVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  436

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkp--naakpapkkkSIFRDRILPQELGFA  535
            T+IGL E  RANEWVVTEKLGD+     +  +   +      K +S   DR+   EL   
Sbjct  437  TLIGLFEAGRANEWVVTEKLGDSQKAKAHAKEKPGSFKTAVRKLRSKILDRMNLLELVVG  496

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            VFL   G YDF+YGK  YY+Y FLQ ITF I G GY+GTI+
Sbjct  497  VFLFCIGCYDFMYGKWSYYVYFFLQSITFFIVGFGYVGTII  537



>emb|CDP15350.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 174/221 (79%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V +WKKV+VIYSFFLVRKI AH++TF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVTLWKKVHVIYSFFLVRKIIAHLITFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIPC++T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVLLPSTVLVPEVQVPKWGAVYIPCVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T +GLLE  R NEWVVTEKLGDA+ N +        +        F +R+   ELG   +
Sbjct  438  TFVGLLESSRVNEWVVTEKLGDALKNKSAVKAIRKPRFR------FGERLHLLELGTGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKNHYY+YLF Q I F IAG GY+GT VP+
Sbjct  492  LFFCGCYDVAFGKNHYYLYLFTQAIAFFIAGFGYIGTFVPN  532



>gb|KCW89263.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=425

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLFRKM +EI+RNK+V +WKKV+VIYSFFLVRKI AH+VTF F
Sbjct  210  TFKAYRFQQHRWSCGPANLFRKMAMEIIRNKKVTLWKKVHVIYSFFLVRKIVAHIVTFIF  269

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+ VPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMSFHRTKA
Sbjct  270  YCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKA  329

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+    +   P   K        F DR+   ELG   +
Sbjct  330  TFIGLLEAGRVNEWIVTEKLGDALKVKASNKVPKKPKFR------FGDRLHVLELGVGAY  383

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +G+NHY++YLF Q I F I G GY+GT VP+
Sbjct  384  LFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPN  424



>ref|NP_197666.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 sp|Q9FNI7.1|CSLA2_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 2; AltName: 
Full=Cellulose synthase-like protein A2; Short=AtCslA2; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
2 [Arabidopsis thaliana]
 dbj|BAB11680.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL25573.1| AT5g22740/MDJ22_16 [Arabidopsis thaliana]
 gb|AAL24334.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM13292.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AED93069.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38612.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=534

 Score =   278 bits (712),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 177/223 (79%), Gaps = 8/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL E  RANEWVVT KLG        ++     K   +   IF+  DR+   ELGFA
Sbjct  438  TLIGLFEAGRANEWVVTAKLGSG------QSAKGNTKGIKRFPRIFKLPDRLNTLELGFA  491

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             FL  CG YDF++GKN+Y+IYLFLQ ++F I+G+G++GT VPS
Sbjct  492  AFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|XP_002874083.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50342.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   278 bits (712),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 177/223 (79%), Gaps = 8/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRKI AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL E  RANEWVVT KLG        ++     K   +   IF+  DR+   ELGFA
Sbjct  438  TLIGLFEAGRANEWVVTAKLGSG------QSAKGNTKGLKRFPRIFKLPDRLNTLELGFA  491

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             FL  CG YDF++GKN+Y+IYLFLQ ++F I+G+G++GT VPS
Sbjct  492  AFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>gb|KFK39910.1| hypothetical protein AALP_AA3G305000 [Arabis alpina]
Length=537

 Score =   278 bits (712),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 176/223 (79%), Gaps = 7/223 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRKI AH VTF F
Sbjct  320  TFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  380  YCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL E  RANEWVVT KLG         N     K   +   IF+  DR+   ELGFA
Sbjct  440  TLIGLFEAGRANEWVVTAKLGSG-----QTNAKGNTKGLKRFPRIFKLPDRLNTLELGFA  494

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             FL  CG YDF++GKN+Y+IYLFLQ ++F I+G+G++GT VPS
Sbjct  495  AFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYVPS  537



>gb|AEZ00898.1| putative beta-14-mannan synthase, partial [Elaeis guineensis]
Length=243

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI +NK+V+++KKV+VIY+FFLVRKI AH+VT  F
Sbjct  28   TLKAYRYQQHRWSCGPANLFRKMLLEIAKNKKVSLFKKVHVIYNFFLVRKIVAHIVTSVF  87

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV++PKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  88   YCMVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  147

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA             +          DR+   ELG   +
Sbjct  148  TFIGLLEAGRVNEWVVTEKLGDASKTKVAAKAARKPRIRIG------DRLHLLELGVGAY  201

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L FCG YD  +GKNHY+IYLFLQ I F I G GY+GT V
Sbjct  202  LFFCGCYDVAFGKNHYFIYLFLQAIAFFIVGFGYVGTFV  240



>ref|XP_009120642.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Brassica 
rapa]
Length=534

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 176/223 (79%), Gaps = 8/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRK+ AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKVIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+T+LNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGSVYIPSIITVLNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL E  RANEWVVT KLG        ++     +   K   IF+  DR+   ELGFA
Sbjct  438  TLIGLFEADRANEWVVTAKLGSG------QSAKGNTEGLKKFPRIFKLPDRLNTLELGFA  491

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             FL  CG YD+ +GKN+Y+IYLFLQ ++F I+G+G++GT VPS
Sbjct  492  AFLFVCGCYDYAHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|XP_010050059.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Eucalyptus 
grandis]
 gb|KCW89262.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=533

 Score =   276 bits (706),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLFRKM +EI+RNK+V +WKKV+VIYSFFLVRKI AH+VTF F
Sbjct  318  TFKAYRFQQHRWSCGPANLFRKMAMEIIRNKKVTLWKKVHVIYSFFLVRKIVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+ VPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMSFHRTKA
Sbjct  378  YCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+    +   P   K        F DR+   ELG   +
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDALKVKASNKVPKKPKFR------FGDRLHVLELGVGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +G+NHY++YLF Q I F I G GY+GT VP+
Sbjct  492  LFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPN  532



>ref|XP_009126562.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Brassica 
rapa]
Length=534

 Score =   276 bits (705),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 175/223 (78%), Gaps = 8/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRK+ AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKVIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+T+LNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGSVYIPSIITVLNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL E  RANEWVVT KLG        +      K   K   IF+  DR+   ELGFA
Sbjct  438  TLIGLFEAGRANEWVVTAKLGSG------QGAKGNTKGLKKFPRIFKLPDRLNTLELGFA  491

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             FL  CG YD+ +GKN+Y+IYLFLQ ++F I+G+G++GT VPS
Sbjct  492  AFLFVCGCYDYAHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|XP_010535659.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Tarenaya 
hassleriana]
Length=532

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 170/219 (78%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLF+KM +EI+ NK+V  WKKVYVIYSFF VRKI AH VTF F
Sbjct  317  TFKAFRFQQHRWSCGPANLFKKMVMEIISNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCF  376

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV+VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  377  YCVVLPLTILVPEVEVPMWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  436

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLL+  RANEWVVT KLG  ++   +  K         K     DR+   ELGFA F
Sbjct  437  TLIGLLDAGRANEWVVTAKLGSGVSAKVSNAKGVKKLTRFFKLP---DRLNTLELGFAAF  493

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L  CG YDF++GKN YY+YLFLQ  +F I G G++GT V
Sbjct  494  LFVCGCYDFVHGKNSYYVYLFLQTASFFITGFGWVGTYV  532



>ref|XP_009769757.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like isoform 
X2 [Nicotiana sylvestris]
Length=519

 Score =   275 bits (703),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 165/193 (85%), Gaps = 5/193 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNKRVN+WKK YVIYSFF VRKI AHMVTFFF
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNIWKKFYVIYSFFFVRKIIAHMVTFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +CVVLPL++LVPEV++P W AIYIPCI+TILNSVGTPRSIHLLFYWILFENVM+FHRTKA
Sbjct  378  FCVVLPLSLLVPEVEIPVWAAIYIPCIITILNSVGTPRSIHLLFYWILFENVMAFHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE KRANEWVVTEKLGDA+     KNK         + S+F DRILPQELGFA F
Sbjct  438  TFIGLLEAKRANEWVVTEKLGDAL-----KNKDKTKPTKKPRGSLFGDRILPQELGFAAF  492

Query  542  LLFCGVYDFLYGK  580
            L FCG YD LYGK
Sbjct  493  LFFCGCYDVLYGK  505



>ref|XP_002530892.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF31498.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=425

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM +EI RNK+V++WKK YVIYSFF VRKI AH+VTF F
Sbjct  210  TFKAYRYQQHRWSCGPANLFKKMAMEICRNKKVSLWKKFYVIYSFFFVRKIVAHIVTFLF  269

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV+VPKWG++YIP  VTILN+VGTPRS+HLL +W+LFENVMS HRTKA
Sbjct  270  YCVVLPATVLVPEVEVPKWGSVYIPSTVTILNAVGTPRSLHLLVFWVLFENVMSLHRTKA  329

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  R NEWVVTEKLGDA+   +    P   +          +R+   ELG   +
Sbjct  330  TLIGLLEAGRVNEWVVTEKLGDALKTKSTAKAPRKPRIRIG------ERLHLLELGVGAY  383

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YDF +GKN Y+IYLFLQ I F I+G+GY+GT VP+
Sbjct  384  LFICGCYDFTFGKNRYFIYLFLQSIAFFISGIGYVGTFVPN  424



>gb|AFW66233.1| hypothetical protein ZEAMMB73_021965 [Zea mays]
Length=245

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 166/221 (75%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIV NK+V +WKK++VIY+FFL+RKI AH++TF F
Sbjct  29   TFKAFRFQQHRWSCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSF  88

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P TI VPEV +PKWG +YIP  +T+LNSVGTPRS HLLF+W+ FENVMS HRTKA
Sbjct  89   YCVIIPATIFVPEVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAFENVMSLHRTKA  148

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVT KLG A+   +        +          +R+   ELG A F
Sbjct  149  TLIGLLEAGRANEWVVTAKLGSAMKMKSANKAGLRKQFMRIW-----ERLHVTELGVAAF  203

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  YG++H++IYLF Q + F I GVGY+GTIVP 
Sbjct  204  LFSCGWYDLAYGRDHFFIYLFFQSVAFFIVGVGYVGTIVPQ  244



>ref|XP_002437311.1| hypothetical protein SORBIDRAFT_10g024640 [Sorghum bicolor]
 gb|EER88678.1| hypothetical protein SORBIDRAFT_10g024640 [Sorghum bicolor]
Length=429

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 170/220 (77%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EIVRNK+V +WKK++VIY+FFLVRKI AH+VTF F
Sbjct  214  TLKAYRYQQHRWSCGPANLFRKMLMEIVRNKKVTLWKKIHVIYNFFLVRKIIAHIVTFVF  273

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV++PKWG++YIP I+++LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  274  YCIVIPATVLVPEVEIPKWGSVYIPTIISLLNAVGTPRSVHLIVFWILFENVMSLHRTKA  333

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+            +          DR+   ELG A +
Sbjct  334  TFIGLLEAGRVNEWVVTEKLGDALRMKMPAKACKKPRIK------IGDRLHILELGVAAY  387

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YD  +G NHYYI+LFLQ I F I G+GY+GT VP
Sbjct  388  LFFCGCYDIAFGNNHYYIFLFLQSIAFFIVGIGYVGTFVP  427



>ref|XP_010520406.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Tarenaya 
hassleriana]
Length=536

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 170/221 (77%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+ NKRV  WKKVYVIYSFF VRKI AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIISNKRVKFWKKVYVIYSFFFVRKIIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVQVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            ++IGLLE  RANEWVVT KLG  + +     K         K     DR+   ELGFA F
Sbjct  438  SLIGLLEAGRANEWVVTAKLGSGVGSKAANAKGAKKLIRFFKLP---DRLNTLELGFAAF  494

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YDF++GKN YY+YLFLQ  ++ I G G++GT VP+
Sbjct  495  LFTCGCYDFVHGKNSYYVYLFLQTASYFITGFGWIGTYVPN  535



>ref|XP_002315357.1| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEF01528.1| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 170/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM IEI++NK+V++WKK YVIYSFF VRKI AH+VTF F
Sbjct  315  TFKAYRYQQHRWSCGPANLFKKMAIEIIKNKKVSLWKKCYVIYSFFFVRKIVAHIVTFVF  374

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP IVT+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  375  YCVVLPSTVLVPEVSVPKWGAVYIPSIVTLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  434

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+            +         R+R+   EL    +
Sbjct  435  TFIGLLEIGRVNEWVVTEKLGDALKGKLPAKATKKPRIR------IRERLHLLELCAGAY  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YDF +GKN YYI+LFLQ I F IAG GY+GT VP+
Sbjct  489  LFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPN  529



>ref|XP_006400777.1| hypothetical protein EUTSA_v10013221mg [Eutrema salsugineum]
 gb|ESQ42230.1| hypothetical protein EUTSA_v10013221mg [Eutrema salsugineum]
Length=532

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 175/221 (79%), Gaps = 8/221 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRKI AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL E  RANEWVVT KLG        ++     K   K   IF+  DR+   ELGFA
Sbjct  438  TLIGLFEAGRANEWVVTAKLGSG------QSAKGNTKGLKKFPRIFKLPDRLNTLELGFA  491

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
             FL  CG YDF++GKN+Y+IYLFLQ ++F I+G+G++GT V
Sbjct  492  AFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYV  532



>gb|KDP42759.1| hypothetical protein JCGZ_23699 [Jatropha curcas]
Length=532

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 169/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI+ NK+V +WKKV+VIYSFFLVRKI AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMVMEIIINKKVTLWKKVHVIYSFFLVRKIVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+ +   K               F +R+   ELG   +
Sbjct  438  TFIGLLEASRVNEWIVTEKLGDAVKSKAVKAPKKPRFK-------FGERLHLLELGTGAY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKNHY++YLF Q I F I G GY+GT VP 
Sbjct  491  LFFCGCYDVAFGKNHYFLYLFAQAIAFFIIGFGYVGTFVPQ  531



>emb|CDY11268.1| BnaA03g01040D [Brassica napus]
Length=532

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 169/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+ NK V +WKKV+VIYSFF+VRKI AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMALEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +  K               F DRI   ELG  ++
Sbjct  438  TFIGLLEGGRVNEWIVTEKLGDLKAKSATKTLKKLRFR-------FGDRIHVLELGVGMY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L F G YD  +GKNHYY+YLF Q I F IAG+G +GTIVP+
Sbjct  491  LFFVGCYDVFFGKNHYYLYLFAQAIAFFIAGLGQIGTIVPN  531



>ref|XP_006606290.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X3 [Glycine max]
 ref|XP_006606291.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X4 [Glycine max]
Length=436

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM +EI+RNK+V++WKK+YVIYSFF VRKI AH+VTF F
Sbjct  221  TFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVF  280

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  281  YCVIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKA  340

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+ GLLE  R NEWVVTEKLGDA+   +        +          +R+   EL    +
Sbjct  341  TLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKPRIR------IGERLHFLELLVGAY  394

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  YGKNHY+IYLFLQ + F +AGVGY+GT VP+
Sbjct  395  LFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPN  435



>gb|ACR38199.1| unknown [Zea mays]
 gb|AFW66232.1| hypothetical protein ZEAMMB73_021965 [Zea mays]
Length=300

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 166/221 (75%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIV NK+V +WKK++VIY+FFL+RKI AH++TF F
Sbjct  84   TFKAFRFQQHRWSCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSF  143

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P TI VPEV +PKWG +YIP  +T+LNSVGTPRS HLLF+W+ FENVMS HRTKA
Sbjct  144  YCVIIPATIFVPEVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAFENVMSLHRTKA  203

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVT KLG A+   +        +          +R+   ELG A F
Sbjct  204  TLIGLLEAGRANEWVVTAKLGSAMKMKSANKAGLRKQFMRIW-----ERLHVTELGVAAF  258

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  YG++H++IYLF Q + F I GVGY+GTIVP 
Sbjct  259  LFSCGWYDLAYGRDHFFIYLFFQSVAFFIVGVGYVGTIVPQ  299



>ref|XP_004249461.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Solanum 
lycopersicum]
Length=533

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKMF+EI+RNK+V++WKK++VIYSFF VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMFMEIIRNKKVSLWKKIHVIYSFFFVRKVVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV+VPKWGA+YIP I+TILN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSLHLIIFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD +   +        +        F DR+L  EL    +
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDVLKMKSAIKAVKKPRFR------FGDRLLLLELATGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKNHY++YLFLQ   F I G G++GT VP+
Sbjct  492  LFFCGCYDVAFGKNHYFLYLFLQAFAFFIIGFGHIGTFVPN  532



>ref|XP_006381326.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
 gb|ERP59123.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
Length=532

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 171/220 (78%), Gaps = 7/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKMF+EI+ NK +  WKKV+VIYSFFLVRKI AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMFMEIITNKAMTSWKKVHVIYSFFLVRKIVAHLVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV+VPKWGA+YIP I+TILN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+ +  NK               F +R+   ELG   +
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDALKSKANKAAKKPRFR-------FGERLHLLELGTGAY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YD ++GKNHY+IYL+ Q I F I G+G +GTIVP
Sbjct  491  LFFCGCYDVVFGKNHYFIYLYAQAIAFFIVGLGCVGTIVP  530



>ref|XP_007143832.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
 gb|ESW15826.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
Length=530

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 170/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFR+QQHRWSCGPANLF+KM +EI+RNK+V+ WKK YVIYSFF VRKI AH+VTF F
Sbjct  315  TFKAFRYQQHRWSCGPANLFKKMAMEIMRNKKVSTWKKFYVIYSFFFVRKIVAHVVTFVF  374

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  375  YCVVMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKA  434

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+ GLLE  R NEWVVTEKLGDA+   +        +          +R+   EL    +
Sbjct  435  TLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAVRKPRIK------IGERLHFLELLVGAY  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  YGKNHY+IYLFLQ I F + GVGY+GT VP+
Sbjct  489  LFFCGCYDLTYGKNHYFIYLFLQSIAFFVVGVGYVGTFVPN  529



>sp|Q67VS7.1|CSLA9_ORYSJ RecName: Full=Probable mannan synthase 9; AltName: Full=Cellulose 
synthase-like protein A9; AltName: Full=OsCslA9 [Oryza 
sativa Japonica Group]
 gb|AAL25128.1|AF432499_1 cellulose synthase-like protein OsCslA9 [Oryza sativa]
 dbj|BAD37742.1| putative glycosyltransferase 1 [Oryza sativa Japonica Group]
 gb|EEC81007.1| hypothetical protein OsI_23768 [Oryza sativa Indica Group]
 gb|EEE66045.1| hypothetical protein OsJ_22033 [Oryza sativa Japonica Group]
Length=527

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 170/220 (77%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFR+QQHRWSCGPANLFRKM +EI  NK+V +WKK+YVIY+FFLVRKI  H+VTF F
Sbjct  313  TFKAFRYQQHRWSCGPANLFRKMLVEIATNKKVTLWKKIYVIYNFFLVRKIIGHIVTFVF  372

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+L+PEV++P+WG +Y+P IVTILNS+GTPRS+HLL +W+LFENVMS HRTKA
Sbjct  373  YCLVVPATVLIPEVEIPRWGYVYLPSIVTILNSIGTPRSLHLLIFWVLFENVMSLHRTKA  432

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  R NEWVVTEKLGDA+            +          DR+   ELGF+ +
Sbjct  433  TLIGLLETGRVNEWVVTEKLGDALKLKLPGKAFRRPRMR------IGDRVNALELGFSAY  486

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YD  YGK +Y ++LFLQ ITF I GVGY+GTIVP
Sbjct  487  LSFCGCYDIAYGKGYYSLFLFLQSITFFIIGVGYVGTIVP  526



>ref|XP_007010197.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOY19007.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=535

 Score =   273 bits (698),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 170/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RN++V++WKK YVIYSFF VRKI AH+VTF F
Sbjct  320  TFKAYRYQQHRWSCGPANLFRKMAVEIIRNRKVSLWKKFYVIYSFFFVRKIVAHLVTFIF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+ VPEV+VPKWGA+YIP IVT+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  380  YCVVLPATVFVPEVEVPKWGAVYIPSIVTLLNAVGTPRSLHLLIFWILFENVMSLHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+        P   +          +RI   EL    +
Sbjct  440  TFIGLLEAGRVNEWVVTEKLGDALKTKLGGKAPRKPRIQ------IGERIHLLELAVGAY  493

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKN Y+I+LFLQ I F IAGVGY+GT VP+
Sbjct  494  LFFCGCYDLAFGKNRYFIFLFLQSIAFFIAGVGYVGTFVPT  534



>gb|KDP45030.1| hypothetical protein JCGZ_01530 [Jatropha curcas]
Length=533

 Score =   273 bits (698),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 174/221 (79%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM +EIVRNK+V++WKK+YVIYSFF VRKI AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFKKMAMEIVRNKKVSLWKKLYVIYSFFFVRKIVAHIVTFLF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWG++YIP  +T+LN+VGTPRS+HLL +W+LFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVQVPKWGSVYIPSTITLLNAVGTPRSLHLLIFWVLFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL+E  R NEWVVTEKLGDA+ +  +   P   +          +RI   ELG   +
Sbjct  438  TFIGLVEAGRVNEWVVTEKLGDALKSKGSAKAPKKPRIR------IGERIHLLELGVGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YDF +GKN Y+IYLFLQ I F +AG+GY+GT VP+
Sbjct  492  LFFCGCYDFAFGKNSYFIYLFLQSIAFFVAGIGYVGTFVPN  532



>ref|XP_006287469.1| hypothetical protein CARUB_v10000681mg [Capsella rubella]
 gb|EOA20367.1| hypothetical protein CARUB_v10000681mg [Capsella rubella]
Length=533

 Score =   273 bits (698),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 168/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRKI AH+VTF F
Sbjct  319  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIF  378

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP ++T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  379  YCVVLPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  438

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +    K             F DRI   ELG  ++
Sbjct  439  TFIGLLEGGRVNEWIVTEKLGDLKAKSAKAPKKILRFR-------FGDRIHVLELGVGMY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LLF G YD  +GKNHYYIYLF Q I F IAG G +GTIVP+
Sbjct  492  LLFVGCYDAFFGKNHYYIYLFAQAIAFFIAGFGQIGTIVPN  532



>gb|EPS66478.1| hypothetical protein M569_08299, partial [Genlisea aurea]
Length=230

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 165/220 (75%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+A+R+QQHRWSCGPANLFRKM +EI+RNK+V+ WKK++VIYSFF VRKI AH+VTFFF
Sbjct  16   TFQAYRYQQHRWSCGPANLFRKMVVEIIRNKKVSTWKKIHVIYSFFFVRKIVAHIVTFFF  75

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V P T+LVP+V +PKW ++YIP  +TILNSVGTPRS+HLL +WILFENVMS HR KA
Sbjct  76   YCIVFPATVLVPQVQIPKWASVYIPFTITILNSVGTPRSLHLLVFWILFENVMSLHRAKA  135

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGL   +R NEW+VTEKLGD             A       ++FR R    E+   V+
Sbjct  136  TIIGLFGARRVNEWIVTEKLGDV----RKSKPVKKAFYTSMSFNLFR-RFYSLEVATGVY  190

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YDF+YG NHYYIYLFLQ   F I G GY+GT VP
Sbjct  191  LSFCGCYDFIYGNNHYYIYLFLQAAAFLIVGFGYVGTFVP  230



>ref|XP_007027600.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY08102.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
Length=533

 Score =   273 bits (698),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 171/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI+ NK+V+ WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMVMEIITNKKVSSWKKVHVIYSFFVVRKLVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV+VPKWGA+YIP I+TILN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVEVPKWGAVYIPTIITILNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+        P   +        F +R+   EL    +
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDALKAKAGTKAPRKPRFR------FGERLHLLELCVGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD ++GKNHY+IYLF Q I F I G GY+GTIVP+
Sbjct  492  LFFCGCYDVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPN  532



>ref|XP_010454539.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 isoform X2 
[Camelina sativa]
Length=533

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 175/221 (79%), Gaps = 8/221 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRKI AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL E  RANEWVVT KLG        ++     K   +   IF+  DR+   ELGFA
Sbjct  438  TLIGLFEAGRANEWVVTAKLGSG------QSAKGNTKGLKRFPRIFKLPDRLNTLELGFA  491

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
             FL  CG YDF++GKN+Y+IYLFLQ ++F I+G+G++GT V
Sbjct  492  AFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>ref|XP_011018871.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Populus 
euphratica]
Length=532

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 170/220 (77%), Gaps = 7/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI+ NK+V  WKKV+VIYSFFLVRKI AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMLMEIITNKKVTSWKKVHVIYSFFLVRKIVAHLVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV+VPKWGA+YIP I+TILN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+ +  NK               F +R+   ELG   +
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDALKSKANKASKKPRFR-------FGERLHLLELGTGAY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YD ++GKNHY+IYL+ Q I F I G+G +GT VP
Sbjct  491  LFFCGCYDVVFGKNHYFIYLYAQAIAFFIVGLGCVGTFVP  530



>ref|XP_009130779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 168/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRKI AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVILPATVLVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +  K               F DRI   ELG  ++
Sbjct  438  TFIGLLEGGRVNEWIVTEKLGDLKAKSATKTLKKLRFR-------FGDRIHVLELGVGMY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L F G YD  +GKNHYY+YLF Q I F IAG+G +GTIVP+
Sbjct  491  LFFVGCYDVFFGKNHYYLYLFAQAIAFFIAGLGQIGTIVPN  531



>ref|XP_010493365.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
 ref|XP_010493366.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
Length=533

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 175/221 (79%), Gaps = 8/221 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRKI AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL E  RANEWVVT KLG        ++     K   +   IF+  DR+   ELGFA
Sbjct  438  TLIGLFEAGRANEWVVTAKLGSG------QSAKGNTKGLKRFPRIFKLPDRLNTLELGFA  491

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
             FL  CG YDF++GKN+Y+IYLFLQ ++F I+G+G++GT V
Sbjct  492  AFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>ref|NP_195996.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 sp|Q9LZR3.1|CSLA9_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 9; AltName: 
Full=Cellulose synthase-like protein A9; Short=AtCslA9; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
9; AltName: Full=Protein RESISTANT TO AGROBACTERIUM TRANSFORMATION 
4 [Arabidopsis thaliana]
 emb|CAB82941.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08601.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL31192.1| AT5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AAN31089.1| At5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AED90651.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 gb|AHL38649.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=533

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP ++T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVILPATVLVPEVTVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +  K      +        F DRI   ELG  ++
Sbjct  438  TFIGLLEGGRVNEWIVTEKLGDVKAKSATKTSKKVIRFR------FGDRIHVLELGVGMY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LLF G YD  +GKNHYY+YLF Q I F IAG G +GTIVP+
Sbjct  492  LLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  532



>ref|XP_010421063.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
 ref|XP_010454538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 isoform X1 
[Camelina sativa]
Length=533

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 175/221 (79%), Gaps = 8/221 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRKI AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL E  RANEWVVT KLG        ++     K   +   IF+  DR+   ELGFA
Sbjct  438  TLIGLFEAGRANEWVVTAKLGSG------QSAKGNTKGLKRFPRIFKLPDRLNTLELGFA  491

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
             FL  CG YDF++GKN+Y+IYLFLQ ++F I+G+G++GT V
Sbjct  492  AFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>ref|XP_006287471.1| hypothetical protein CARUB_v10000683mg [Capsella rubella]
 gb|EOA20369.1| hypothetical protein CARUB_v10000683mg [Capsella rubella]
Length=533

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 175/221 (79%), Gaps = 8/221 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRKI AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL E  RANEWVVT KLG        ++     K   +   IF+  DR+   ELGFA
Sbjct  438  TLIGLFEAGRANEWVVTAKLGSG------QSAKGNTKGLKRFPRIFKLPDRLNTLELGFA  491

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
             FL  CG YDF++GKN+Y+IYLFLQ ++F I+G+G++GT V
Sbjct  492  AFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>ref|XP_002873112.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49371.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  319  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIF  378

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP ++T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  379  YCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  438

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +  K      +        F DRI   ELG  ++
Sbjct  439  TFIGLLEGGRVNEWIVTEKLGDVKAKSATKTPKKVLRFR------FGDRIHVLELGVGMY  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LLF G YD  +GKNHYY+YLF Q I F IAG G +GTIVP+
Sbjct  493  LLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  533



>ref|XP_003554414.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN02265.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 174/223 (78%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+ NK+V++WKK++VIYSFF VRK+ AH+ TF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIINNKKVSLWKKIHVIYSFFFVRKVVAHINTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV VPKWGA+YIP I+TILN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCIVLPATVLVPEVVVPKWGAVYIPSIITILNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            TIIGLLE  R NEWVVTEKLGDA+        P   +        FR  DRI   ELG A
Sbjct  438  TIIGLLEASRVNEWVVTEKLGDALKTKAGGKAPKKPR--------FRIGDRIHLLELGVA  489

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG YD ++GKNH++I+LF+Q + F I   GY+GTIVP+
Sbjct  490  FYLFFCGCYDIMFGKNHFFIFLFIQSLAFLIMAFGYVGTIVPN  532



>gb|AGE09561.1| CSLA9-like protein [Eucalyptus cladocalyx]
Length=532

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 164/221 (74%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLFRKM +EI+RNK     K    IYSFFLVRKI AH+VTF F
Sbjct  318  TFKAYRFQQHRWSCGPANLFRKMAMEIIRNKVTLWKKLHV-IYSFFLVRKIVAHIVTFIF  376

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+ VPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMSFHRTKA
Sbjct  377  YCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKA  436

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+    +   P   K        F DR+   ELG   +
Sbjct  437  TFIGLLEAGRVNEWIVTEKLGDALKVKASSKVPKKPKFR------FGDRLHVLELGVGAY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +G+NHY++YLF Q I F I G GY+GT VP+
Sbjct  491  LFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPN  531



>ref|XP_006606289.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Glycine max]
Length=472

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM +EI+RNK+V++WKK+YVIYSFF VRKI AH+VTF F
Sbjct  257  TFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVF  316

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  317  YCVIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKA  376

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+ GLLE  R NEWVVTEKLGDA+   +        +          +R+   EL    +
Sbjct  377  TLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKPRIRIG------ERLHFLELLVGAY  430

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  YGKNHY+IYLFLQ + F +AGVGY+GT VP+
Sbjct  431  LFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPN  471



>ref|XP_010452272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Camelina 
sativa]
Length=534

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 170/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  319  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIF  378

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP ++T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  379  YCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  438

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    + +K      +        F DRI   ELG  ++
Sbjct  439  TFIGLLEGGRVNEWIVTEKLGDLKAKSASKTPKKLLRFR------FGDRIHVLELGVGMY  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LLF G YD  +GKNHYY+YLF Q I F IAG G +GTIVP+
Sbjct  493  LLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  533



>gb|KCW89261.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=532

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 164/221 (74%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLFRKM +EI+RNK     K    IYSFFLVRKI AH+VTF F
Sbjct  318  TFKAYRFQQHRWSCGPANLFRKMAMEIIRNKVTLWKKVHV-IYSFFLVRKIVAHIVTFIF  376

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+ VPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMSFHRTKA
Sbjct  377  YCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFHRTKA  436

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+    +   P   K        F DR+   ELG   +
Sbjct  437  TFIGLLEAGRVNEWIVTEKLGDALKVKASNKVPKKPKFR------FGDRLHVLELGVGAY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +G+NHY++YLF Q I F I G GY+GT VP+
Sbjct  491  LFFCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPN  531



>ref|XP_010490868.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 170/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  319  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIF  378

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP ++T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  379  YCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  438

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    ++ K      +        F DRI   ELG  ++
Sbjct  439  TFIGLLEGGRVNEWIVTEKLGDLKAKSSGKTPKKLLRFR------FGDRIHVLELGVGMY  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LLF G YD  +GKNHYY+YLF Q I F IAG G +GTIVP+
Sbjct  493  LLFVGCYDVFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  533



>ref|XP_003556282.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoformX1 
[Glycine max]
Length=529

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM +EI+RNK+V++WKK+YVIYSFF VRKI AH+VTF F
Sbjct  314  TFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVF  373

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  374  YCVIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKA  433

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+ GLLE  R NEWVVTEKLGDA+   +        +          +R+   EL    +
Sbjct  434  TLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKPRIR------IGERLHFLELLVGAY  487

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  YGKNHY+IYLFLQ + F +AGVGY+GT VP+
Sbjct  488  LFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPN  528



>ref|XP_002311972.2| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEE89339.2| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 168/220 (76%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM IEIV+NK+V++WKK YVIYSFF VRKI AH+VTF F
Sbjct  315  TFKAYRYQQHRWSCGPANLFRKMAIEIVKNKKVSLWKKCYVIYSFFFVRKIVAHIVTFLF  374

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP +VT+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  375  YCVVLPATVLVPEVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  434

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+            +          +R+   EL    +
Sbjct  435  TFIGLLEAGRVNEWVVTEKLGDALKAKLPAKATKKPRIR------IGERLHLLELCAGAY  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YDF +GKN YYI+LFLQ I F IAG GY+GT VP
Sbjct  489  LFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVP  528



>ref|XP_011024272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Populus 
euphratica]
Length=530

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM IEIV+NK+V++WKK YVIYSFF VRKI AH+VTF F
Sbjct  315  TFKAYRYQQHRWSCGPANLFKKMAIEIVKNKKVSLWKKCYVIYSFFFVRKIVAHIVTFVF  374

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP IVT+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  375  YCVVLPSTVLVPEVSVPKWGAVYIPSIVTLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  434

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+            +          +R+   EL    +
Sbjct  435  TFIGLLEVGRVNEWVVTEKLGDALKAKLPAKATKKPRIR------IGERLHLLELCAGAY  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YDF +GKN YYI+LFLQ I F IAG GY+GT VP+
Sbjct  489  LFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPN  529



>gb|KHN00923.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM +EI+RNK+V++WKK+YVIYSFF VRKI AH+VTF F
Sbjct  302  TFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVF  361

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  362  YCVIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKA  421

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+ GLLE  R NEWVVTEKLGDA+   +        +          +R+   EL    +
Sbjct  422  TLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKPRIR------IGERLHFLELLVGAY  475

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  YGKNHY+IYLFLQ + F +AGVGY+GT VP+
Sbjct  476  LFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPN  516



>ref|XP_010423663.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  319  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIF  378

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP ++T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  379  YCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  438

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    + +K      +        F DRI   ELG  ++
Sbjct  439  TFIGLLEGGRVNEWIVTEKLGDLKAKSASKTPKKLLRFR------FGDRIHVLELGVGIY  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LLF G YD   GKNHYY+YLF Q I F IAG G +GTIVP+
Sbjct  493  LLFVGCYDAFLGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  533



>ref|XP_009390016.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 170/221 (77%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANL RKM +EI  NK+VN+WKKV+VIYSFF VRK+ AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLLRKMLMEIASNKKVNLWKKVHVIYSFFFVRKVVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV++PKWGA+YIP ++T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCIVIPATVLVPEVEIPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  RANEW+VTEKLGD +     K K          ++   DR+   ELG   F
Sbjct  438  TFIGLLEGGRANEWIVTEKLGDTM-----KVKMATKAVKKPPRTRIGDRLHLLELGTGAF  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKNHY+IYLFLQ I F + G G++GT VPS
Sbjct  493  LFFCGCYDVAFGKNHYFIYLFLQAIAFFVVGFGHVGTFVPS  533



>ref|XP_006339112.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 172/223 (77%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKMF+EI+RNK+V++WKK++VIYSFF VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMFMEIIRNKKVSLWKKIHVIYSFFFVRKVVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV+VPKWGA+YIP I+TILN+VGTPRS HL+ +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLIIFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T IGLLE  R NEW+VTEKLGD +   +        +        FR  DR+L  EL   
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDVLKMKSASKAVKKPR--------FRVGDRLLLLELATG  489

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG YD  +GKNHY++YLF+Q   F I G G++GT VP+
Sbjct  490  AYLFFCGCYDVAFGKNHYFLYLFIQAFAFFIIGFGHIGTFVPN  532



>dbj|BAE98718.1| hypothetical protein [Arabidopsis thaliana]
Length=533

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 168/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA YIP ++T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVILPATVLVPEVTVPKWGAFYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +  K      +        F DRI   ELG  ++
Sbjct  438  TFIGLLEGGRVNEWIVTEKLGDVKAKSATKTSKKVIRFR------FGDRIHVLELGVGMY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LLF G YD  +GKNHYY+YLF Q I F IAG G +GTIVP+
Sbjct  492  LLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIVPN  532



>ref|XP_003521436.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN18723.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 173/223 (78%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+ NK+V++WKK++VIYSFF VRK+ AH+ TF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMAMEIINNKKVSLWKKIHVIYSFFFVRKVVAHINTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV VPKWGA+YIP I+TILN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCIVLPATVLVPEVVVPKWGAVYIPSIITILNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            TIIGLLE  R NEWVVTEKLGDA+        P   +        FR  DRI   ELG A
Sbjct  438  TIIGLLEASRVNEWVVTEKLGDALKAKAGGKAPKKPR--------FRIGDRIHLLELGVA  489

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG YD ++GKNH++I+LF+Q   F I   GY+GTIVP+
Sbjct  490  FYLFFCGCYDVMFGKNHFFIFLFIQSFAFLIMAFGYVGTIVPN  532



>ref|XP_007162846.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
 gb|ESW34840.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
Length=533

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 170/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI+ NK+V++WKK++VIYSFF VRK+ AH+ TF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMVLEIINNKKVSLWKKIHVIYSFFFVRKVVAHINTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV VPKWGA+YIP ++TILN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCIVLPATVLVPEVVVPKWGAVYIPSVITILNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEWVVTEKLGDA+        P   +          DRI   ELG A +
Sbjct  438  TIIGLLEASRVNEWVVTEKLGDALKAKAGGKAPKKPRFK------IGDRIHLLELGVAFY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD ++GKNHY+I+LF+Q + F I   GY+GTIVP 
Sbjct  492  LFFCGCYDVMFGKNHYFIFLFIQALAFFIMAFGYVGTIVPQ  532



>ref|XP_002283672.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
Length=533

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V++WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSLWKKVHVIYSFFIVRKLVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVP+V+VP+WGA+YIP I+TILN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPDVEVPRWGAVYIPTIITILNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+        P   +          +R+   ELG   F
Sbjct  438  TFIGLLEGGRVNEWVVTEKLGDALKVKAATKAPKKPRFK------IGERLHLLELGVGAF  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +G+NHY+IYL++Q I F I G GY+GT VP 
Sbjct  492  LFFCGCYDVAFGRNHYFIYLYVQAIAFFIVGFGYVGTFVPK  532



>gb|KHG19821.1| Glucomannan 4-beta-mannosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=529

 Score =   270 bits (691),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 171/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI++NK+V+ WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  314  TLKAYRYQQHRWSCGPANLFRKMVMEIIKNKKVSTWKKVHVIYSFFVVRKLVAHIVTFIF  373

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV+VPKWGA+YIP I+TILN+VGTPRS HLL +WILFENVMS HRTKA
Sbjct  374  YCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHRTKA  433

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA  +      P   +        F +R+   EL    +
Sbjct  434  TFIGLLEAGRVNEWIVTEKLGDAFKSKAAAKAPRKPRFR------FGERLHVLELCVGAY  487

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD ++GKNHY+IYLF Q I F I G GY+GTIVP+
Sbjct  488  LFFCGCYDVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPN  528



>emb|CDX80885.1| BnaC03g01390D [Brassica napus]
Length=525

 Score =   270 bits (691),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 167/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRKI AH+VTF F
Sbjct  311  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIF  370

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+ VPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  371  YCVILPATVFVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  430

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +  K               F DRI   ELG  ++
Sbjct  431  TFIGLLEGGRVNEWIVTEKLGDLKAKSATKTSKKLRFR-------FGDRIHVLELGVGMY  483

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L F G YD  +GKNHYY+YLF Q I F IAG+G +GTIVP+
Sbjct  484  LFFVGCYDVFFGKNHYYLYLFAQAIAFFIAGLGQIGTIVPN  524



>ref|XP_011094427.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Sesamum 
indicum]
Length=532

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 171/223 (77%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RN +V++WKKV+VIYSFF +RKI AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMLVEIIRNTKVSLWKKVHVIYSFFFIRKIVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV +PKWGA+Y+P I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVQIPKWGAVYVPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T IGLLE  R NEW+VTEKLGDA            +     ++  FR  +RI   EL   
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDA--------HKLKSALKAFRRPRFRLGERIHLLELATG  489

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG YD ++GKNHY+IYLFLQ   F I G GY+GT VPS
Sbjct  490  GYLFFCGCYDIVFGKNHYFIYLFLQATAFFIMGFGYIGTFVPS  532



>ref|XP_010694523.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Beta 
vulgaris subsp. vulgaris]
Length=526

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 171/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI++NK+V++WKKV+VIYSFF VRKI AH+VTF F
Sbjct  311  TFKAYRYQQHRWSCGPANLFRKMVNEIIKNKKVSIWKKVHVIYSFFFVRKIVAHVVTFIF  370

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV+VPKWGAIYIP I+T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  371  YCVVLPTTVLVPEVEVPKWGAIYIPMIITLLNAVGTPRSLHLVVFWILFENVMSLHRTKA  430

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+            K   K +S   D+I   EL    +
Sbjct  431  TFIGLLEAGRVNEWVVTEKLGDAL------KNKFDTKSFKKPRSRIIDKIYMLELVVGAY  484

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD   GKNHY+IYLFLQ   F IAG GY+G IVP+
Sbjct  485  LFFCGCYDIALGKNHYFIYLFLQSFAFFIAGFGYVGIIVPT  525



>gb|KHN37850.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM +EI+RNK+V++WKK+YVIYSFF VRKI AH+VTF F
Sbjct  302  TFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVF  361

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P T+L PEV+VPKWGA+YIP I+T+LN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  362  YCVIMPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKA  421

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+ GLLE  R NEWVVTEKLGDA+   +       ++          +R+   EL    +
Sbjct  422  TLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKSRIR------IGERLHFLELLVGAY  475

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  YGKNHY+IYLFLQ + F +AGVGY+GT VP+
Sbjct  476  LFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPN  516



>ref|XP_003535494.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Glycine max]
Length=529

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM +EI+RNK+V++WKK+YVIYSFF VRKI AH+VTF F
Sbjct  314  TFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVF  373

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P T+L PEV+VPKWGA+YIP I+T+LN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  374  YCVIMPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKA  433

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+ GLLE  R NEWVVTEKLGDA+   +       ++          +R+   EL    +
Sbjct  434  TLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKSRIRIG------ERLHFLELLVGAY  487

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  YGKNHY+IYLFLQ + F +AGVGY+GT VP+
Sbjct  488  LFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPN  528



>ref|XP_009771587.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=533

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKMF+EIVRNK+V++WKKV+VIYSFF VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMFMEIVRNKKVSLWKKVHVIYSFFFVRKVVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            Y VVLP T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+   +        +          DRI   EL    +
Sbjct  438  TFIGLLEVGRVNEWIVTEKLGDALKLKSAAKAFRKHRMR------LGDRIHLLELAAGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +G NHY++YLF+Q   F I G GY+GT VP+
Sbjct  492  LFFCGCYDIAFGNNHYFLYLFIQAFAFFIVGFGYVGTFVPN  532



>gb|ABR16486.1| unknown [Picea sitchensis]
Length=385

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 171/221 (77%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V  WKK++VIY+FF VRKI AH+VTF F
Sbjct  171  TFKAYRYQQHRWSCGPANLFRKMVMEILRNKKVTAWKKLHVIYAFFFVRKIVAHIVTFAF  230

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+LVPEV VPKWGA+YIP I+T+LN+V TP+S+HLL +WILFENVMS HRTKA
Sbjct  231  YCVVIPATVLVPEVQVPKWGAVYIPSIITLLNAVSTPKSLHLLVFWILFENVMSLHRTKA  290

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEWVVTEKLGDA+       K  + K   K +S   +R+   EL   V+
Sbjct  291  TIIGLLEAGRVNEWVVTEKLGDAM-------KHKSGKQMKKSRSRIGERLHVLELLAGVY  343

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  +GKNH+YIYL+LQ   F + G GY+GT +P+
Sbjct  344  LFFCASYDLAFGKNHFYIYLYLQAAAFFVMGFGYIGTFIPT  384



>gb|AFZ78578.1| cellulose synthase-like protein [Populus tomentosa]
Length=530

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 167/220 (76%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM IEIV+NK+V+VWKK YVIYSFF VRKI AH+VTF F
Sbjct  315  TFKAYRYQQHRWSCGPANLFRKMAIEIVKNKKVSVWKKCYVIYSFFFVRKIVAHIVTFLF  374

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+L PEV VPKWGA+YIP +VT+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  375  YCVVLPATVLFPEVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  434

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+            +          +R+   EL    +
Sbjct  435  TFIGLLEAGRVNEWVVTEKLGDALKAKLPAKATKKPRIR------IGERLHLLELCAGAY  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YDF +GKN YYI+LFLQ I F IAG GY+GT VP
Sbjct  489  LFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVP  528



>gb|EEE56486.1| hypothetical protein OsJ_05716 [Oryza sativa Japonica Group]
Length=485

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 170/221 (77%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V +WKK++VIY+FFL+RKI AH+VTF F
Sbjct  269  TFKAFRFQQHRWSCGPANLFRKMLMEIVRNKKVTIWKKIHVIYNFFLIRKIIAHIVTFAF  328

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+++P TI VPEV +PKWG +YIP I+T+LNSVGTPRS HLLF+WILFENVMS HRTKA
Sbjct  329  YCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKA  388

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVTEKLG+A+   ++                  DR+   ELG A F
Sbjct  389  TLIGLLEAGRANEWVVTEKLGNALKMKSSSKSSAKKSFMRVW-----DRLNVTELGVAAF  443

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  +GK+H++IYLF Q   F I G+GY+GTIVP 
Sbjct  444  LFSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQ  484



>ref|XP_006589371.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Glycine max]
Length=502

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 172/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM +EI+RNK+V++WKK+YVIYSFF VRKI AH+VTF F
Sbjct  287  TFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVF  346

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P T+L PEV+VPKWGA+YIP I+T+LN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  347  YCVIMPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKA  406

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+ GLLE  R NEWVVTEKLGDA+   +       ++          +R+   EL    +
Sbjct  407  TLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKSRIRIG------ERLHFLELLVGAY  460

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  YGKNHY+IYLFLQ + F +AGVGY+GT VP+
Sbjct  461  LFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPN  501



>ref|XP_009601859.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKMF+EIVRNK+V++WKKV+VIYSFF VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMFMEIVRNKKVSLWKKVHVIYSFFFVRKVIAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            Y VVLP T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+   +        +          DRI   EL    +
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDALKLKSAAKAFRKHRMR------LGDRIHLLELAAGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +G NHY++YLF+Q   F I G GY+GT VP+
Sbjct  492  LFFCGCYDIAFGNNHYFLYLFIQAFAFFIVGFGYVGTFVPN  532



>ref|XP_009122674.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 167/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRKI AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVIVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +  K               F DRI   ELG  ++
Sbjct  438  TFIGLLEGGRVNEWIVTEKLGDLKAKSATKAPKKLRFR-------FGDRIHVLELGVGMY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L   G YD L+GKNHYY+YLF Q I F IAG G +GT+VP+
Sbjct  491  LFSIGCYDALFGKNHYYLYLFAQAIAFFIAGCGQIGTVVPN  531



>emb|CDX70286.1| BnaA10g26350D [Brassica napus]
Length=532

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 167/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRKI AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVIVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +  K               F DRI   ELG  ++
Sbjct  438  TFIGLLEGGRVNEWIVTEKLGDLKAKSATKAPKKLRFR-------FGDRIHVLELGVGMY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L   G YD L+GKNHYY+YLF Q I F IAG G +GT+VP+
Sbjct  491  LFSIGCYDALFGKNHYYLYLFAQAIAFFIAGCGQIGTVVPN  531



>ref|XP_006656269.1| PREDICTED: probable mannan synthase 9-like [Oryza brachyantha]
Length=520

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 171/220 (78%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFR+QQHRWSCG ANLFRKMF+EI RNK+V +WKK+Y+IY+FFLVRKI  H+VTF F
Sbjct  306  TFKAFRYQQHRWSCGRANLFRKMFVEIFRNKKVTLWKKIYLIYNFFLVRKIIGHIVTFVF  365

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+L+PEV++P+WG +Y+P IVTILNS+GTPRS+HLL +W+LFENVMS HRTKA
Sbjct  366  YCLVVPATVLIPEVEIPRWGYVYLPSIVTILNSIGTPRSLHLLIFWVLFENVMSLHRTKA  425

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  R NEWVVTEKLGDA+            +          DR+   ELGF+ +
Sbjct  426  TLIGLLETGRVNEWVVTEKLGDALKIKLPGKAFRRPRMRMG------DRLNALELGFSAY  479

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YD  +GK +Y ++LFLQ ITF I GVGY+GTIVP
Sbjct  480  LCFCGCYDIAFGKGYYSLFLFLQSITFFIIGVGYVGTIVP  519



>ref|XP_010940677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Elaeis 
guineensis]
Length=533

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI +NK+V+++KKV+VIY+FFLVRKI AH+VT  F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMLLEIAKNKKVSLFKKVHVIYNFFLVRKIVAHIVTSVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV++PKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCMVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA             +          DR+   ELG   +
Sbjct  438  TFIGLLEAGRVNEWVVTEKLGDASKTKVAAKAARKPRIR------IGDRLHLLELGVGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L FCG YD  +GKNHY+IYLFLQ I F I G GY+GT V
Sbjct  492  LFFCGCYDVAFGKNHYFIYLFLQAIAFFIVGFGYVGTFV  530



>ref|NP_001046164.1| Os02g0192500 [Oryza sativa Japonica Group]
 sp|Q7PC76.1|CSLA1_ORYSJ RecName: Full=Glucomannan 4-beta-mannosyltransferase 1; AltName: 
Full=Cellulose synthase-like protein A1; AltName: Full=Glucomannan-synthase 
1; Short=Mannan synthase 1; AltName: Full=OsCslA1; 
AltName: Full=OsCslA9 [Oryza sativa Japonica Group]
 tpg|DAA01743.1| TPA_exp: cellulose synthase-like A1 [Oryza sativa (japonica cultivar-group)]
 dbj|BAD15390.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAD34025.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAF08078.1| Os02g0192500 [Oryza sativa Japonica Group]
 dbj|BAG95675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 170/221 (77%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIVRNK+V +WKK++VIY+FFL+RKI AH+VTF F
Sbjct  305  TFKAFRFQQHRWSCGPANLFRKMLMEIVRNKKVTIWKKIHVIYNFFLIRKIIAHIVTFAF  364

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+++P TI VPEV +PKWG +YIP I+T+LNSVGTPRS HLLF+WILFENVMS HRTKA
Sbjct  365  YCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKA  424

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVTEKLG+A+   ++                  DR+   ELG A F
Sbjct  425  TLIGLLEAGRANEWVVTEKLGNALKMKSSSKSSAKKSFMRVW-----DRLNVTELGVAAF  479

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  +GK+H++IYLF Q   F I G+GY+GTIVP 
Sbjct  480  LFSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQ  520



>ref|XP_009623019.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=526

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKMF EI+RN++V++WKK++VIYSFF VRK+ AH+VTF F
Sbjct  311  TFKAYRYQQHRWSCGPANLFRKMFTEIIRNRKVSLWKKIHVIYSFFFVRKVIAHIVTFVF  370

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRS HL+ +WILFENVMS HRTKA
Sbjct  371  YCIVLPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSFHLIIFWILFENVMSLHRTKA  430

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA    +        +        F DR+   EL    +
Sbjct  431  TFIGLLEAGRVNEWIVTEKLGDAFKIKSAMKAFKKPRFR------FGDRLHLLELATGAY  484

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKNHY++YLF+Q   F I G G++GT VP+
Sbjct  485  LFFCGCYDIAFGKNHYFLYLFIQAFAFLIMGFGHVGTFVPN  525



>ref|XP_004494136.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=533

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 171/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V++WKK++VIYSFF VRK+ AH+ TF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVSLWKKIHVIYSFFFVRKVIAHINTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV VPKWGA+YIP ++T+LN+VGTPRS+HLL +WI+FENVMS HR KA
Sbjct  378  YCIVLPATVLVPEVSVPKWGAVYIPSLITLLNAVGTPRSLHLLVFWIMFENVMSLHRAKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEW+VTEKLGDA+            +         +DRI   ELG  ++
Sbjct  438  TIIGLLEASRVNEWIVTEKLGDAVKTKVRTKALKKPRFK------IQDRIHLLELGVGMY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L+ CG YD ++GKNH+YI+LF+Q + F I   GY+GT VP+
Sbjct  492  LVICGCYDVMFGKNHFYIFLFIQAMAFFIMAFGYVGTFVPN  532



>ref|XP_004143299.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48230.1| hypothetical protein Csa_6G450350 [Cucumis sativus]
Length=537

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 166/221 (75%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KAFR+QQHRWSCGPANLFRKM +EI+ N RV  WKKV+VIYSFF VRK+ AH+ TF F
Sbjct  320  TLKAFRYQQHRWSCGPANLFRKMVVEIITNNRVTTWKKVHVIYSFFFVRKVVAHINTFIF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LV +V+VPKWG +YIP I+T+LNSVGTPRS HLL YWILFENVM+ HRTK 
Sbjct  380  YCLVLPATVLVQDVEVPKWGYVYIPAIITLLNSVGTPRSFHLLVYWILFENVMAMHRTKG  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEW+VTEKLGDA    +   +         +     +R+L  ELG  ++
Sbjct  440  TIIGLLEASRVNEWIVTEKLGDASKPKSTDLRTPLIATPRLRIG---ERVLMWELGVGMY  496

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LL CGVYD  +GKN +YI+LFLQ ITF I G GY+GT VPS
Sbjct  497  LLLCGVYDIFFGKNQFYIFLFLQAITFFIVGFGYVGTYVPS  537



>gb|KFK24842.1| hypothetical protein AALP_AA8G031700 [Arabis alpina]
Length=533

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP ++T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVILPATVLVPEVTVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    + +K      +        F DRI   ELG  ++
Sbjct  438  TFIGLLEGGRVNEWIVTEKLGDLKAKSASKAPKKIIRFR------FGDRIHVLELGVGMY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L F G YD  +GKNHYY+YLF Q I F IAG G +GTIVP+
Sbjct  492  LFFVGCYDAFFGKNHYYLYLFAQSIAFFIAGFGQIGTIVPN  532



>ref|XP_011010407.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Populus euphratica]
Length=530

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 167/220 (76%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM IEIV+NK+V+VWKK YVIYSFF VRKI AH+VTF F
Sbjct  315  TFKAYRYQQHRWSCGPANLFRKMAIEIVKNKKVSVWKKCYVIYSFFFVRKIVAHIVTFLF  374

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP +VT+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  375  YCVVLPATVLVPEVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  434

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEK+GDA+            +          +R+   E     +
Sbjct  435  TFIGLLEGGRVNEWVVTEKIGDALKAKLPAKATKKPRIRIG------ERLHLLEFCAGAY  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YDF +GKN YYI+LFLQ I F IAG GY+GT VP
Sbjct  489  LFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVP  528



>ref|XP_004170553.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 166/221 (75%), Gaps = 3/221 (1%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KAFR+QQHRWSCGPANLFRKM +EI+ N RV  WKKV+VIYSFF VRK+ AH+ TF F
Sbjct  320  TLKAFRYQQHRWSCGPANLFRKMVVEIITNNRVTTWKKVHVIYSFFFVRKVVAHINTFIF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LV +V+VPKWG +YIP I+T+LNSVGTPRS HLL YWILFENVM+ HRTK 
Sbjct  380  YCLVLPATVLVQDVEVPKWGYVYIPAIITLLNSVGTPRSFHLLVYWILFENVMAMHRTKG  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEW+VTEKLGDA    +   +         +     +R+L  ELG  ++
Sbjct  440  TIIGLLEASRVNEWIVTEKLGDASKPKSTDLRTPLIATPRLRIG---ERVLMWELGVGMY  496

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LL CGVYD  +GKN +YI+LFLQ ITF I G GY+GT VPS
Sbjct  497  LLLCGVYDIFFGKNQFYIFLFLQAITFFIVGFGYVGTYVPS  537



>ref|XP_010112526.1| hypothetical protein L484_012804 [Morus notabilis]
 gb|EXC33914.1| hypothetical protein L484_012804 [Morus notabilis]
Length=574

 Score =   269 bits (688),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 170/221 (77%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI RNK+V +WKKV+VIYSFF VRKI AH++TF F
Sbjct  360  TLKAYRYQQHRWSCGPANLFRKMVMEIARNKKVTLWKKVHVIYSFFFVRKIVAHIITFVF  419

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  420  YCVVLPATVLVPEVHVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  479

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEWVVTEKLGDA+     K                 +R+   ELG  V+
Sbjct  480  TIIGLLEASRVNEWVVTEKLGDALKGKAAKAPKKPRFK-------IGERLHLLELGVGVY  532

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD L+GKNH++IYLF+Q I F I G GY+GT VP+
Sbjct  533  LFFCGWYDVLFGKNHFFIYLFVQAIAFFIMGFGYVGTFVPN  573



>gb|AFW73370.1| hypothetical protein ZEAMMB73_956340 [Zea mays]
Length=295

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 165/220 (75%), Gaps = 9/220 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRK  +EIVRNK+V +WKK++VIY+FFLVRKI AH VTF F
Sbjct  84   TLKAYRYQQHRWSCGPANLFRKTLVEIVRNKKVTLWKKIHVIYNFFLVRKIVAHAVTFVF  143

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV VPKWG++YIP ++T+L++V TPRS HL+ +W LFENVMS HRTKA
Sbjct  144  YCIVIPTTVLVPEVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLFENVMSLHRTKA  203

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+       KP              DR+   ELG A +
Sbjct  204  TFIGLLEAGRVNEWVVTEKLGDALRTKVPGKKPRMRIG---------DRLHVLELGVAAY  254

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            LLFCG YD  +G N YYI+LFLQ I F I G+GY+GT VP
Sbjct  255  LLFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTFVP  294



>ref|XP_006398833.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
 dbj|BAJ34228.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40286.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
Length=532

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 166/221 (75%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP ++T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +  K               F DRI   ELG  ++
Sbjct  438  TFIGLLEGGRVNEWIVTEKLGDLKAKSATKTPKKLRFR-------FGDRIHVLELGVGMY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L F G YD  +GKNHYY+YLF Q I F IAG G +GT VP+
Sbjct  491  LFFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTFVPN  531



>ref|XP_006436686.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
 gb|ESR49926.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
Length=508

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 167/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM  EI+R K+V +WKK+YVIYSFF VRK+ AH+VTF F
Sbjct  294  TFKAYRYQQHRWSCGPANLFKKMVGEIMRTKKVTLWKKLYVIYSFFFVRKVVAHIVTFVF  353

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+L PEV+VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  354  YCVLLPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  413

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD  +    K                 +R+   ELG   +
Sbjct  414  TFIGLLEAGRVNEWVVTEKLGDVKSKLGGKTLKKPRIR-------IGERVHVLELGVGAY  466

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  +GKNHY+IYLFLQ I F +AGVGY+GT VP+
Sbjct  467  LFLCGCYDVAFGKNHYFIYLFLQSIAFFVAGVGYVGTFVPN  507



>gb|KDO40534.1| hypothetical protein CISIN_1g009761mg [Citrus sinensis]
Length=526

 Score =   267 bits (683),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 167/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM  EI+R K+V +WKK+YVIYSFF VRK+ AH+VTF F
Sbjct  312  TFKAYRYQQHRWSCGPANLFKKMVGEIMRTKKVTLWKKLYVIYSFFFVRKVVAHIVTFVF  371

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+L PEV+VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  372  YCVLLPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  431

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD  +    K                 +R+   ELG   +
Sbjct  432  TFIGLLEAGRVNEWVVTEKLGDVKSKLGGKTLKKPRIR-------IGERVHVLELGVGAY  484

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  +GKNHY+IYLFLQ I F +AGVGY+GT VP+
Sbjct  485  LFLCGCYDVAFGKNHYFIYLFLQSIAFFVAGVGYVGTFVPN  525



>ref|XP_004496174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=529

 Score =   267 bits (683),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNKRV++WKK YVIYSFF VRKI AH+VTF F
Sbjct  314  TFKAYRYQQHRWSCGPANLFRKMAMEIIRNKRVSMWKKFYVIYSFFFVRKIIAHVVTFTF  373

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV+VPKWGA+YIPCI+T+LN+VGTPRS+HLL  WILFENVMS HRTKA
Sbjct  374  YCVILPATVLVPEVEVPKWGAVYIPCIITLLNAVGTPRSLHLLILWILFENVMSMHRTKA  433

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  R NEWVVTEKLGD +   +        +           R+   ELG  V+
Sbjct  434  TLIGLLEVGRVNEWVVTEKLGDVLKTKSGGKAARKPRIR------LDGRLHFLELGVGVY  487

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L F G YD  +GKNH +IYLF+Q I F + GVGY+G  VPS
Sbjct  488  LFFIGCYDVAFGKNHCFIYLFMQSIAFFVVGVGYVGIFVPS  528



>ref|XP_006492171.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=526

 Score =   267 bits (683),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 167/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM  EI+R K+V +WKK+YVIYSFF VRK+ AH+VTF F
Sbjct  312  TFKAYRYQQHRWSCGPANLFKKMVGEIMRTKKVTLWKKLYVIYSFFFVRKVVAHIVTFVF  371

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+L PEV+VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  372  YCVLLPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  431

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD  +    K                 +R+   ELG   +
Sbjct  432  TFIGLLEAGRVNEWVVTEKLGDVKSKLGGKTLKKPRIR-------IGERVHVLELGVGAY  484

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  +GKNHY+IYLFLQ I F +AGVGY+GT VP+
Sbjct  485  LFLCGCYDVAFGKNHYFIYLFLQSIAFFVAGVGYVGTFVPN  525



>ref|XP_010067160.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
 gb|KCW65234.1| hypothetical protein EUGRSUZ_G02715 [Eucalyptus grandis]
Length=482

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 167/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI++NK+V++WKK YVIYSFF VRKI AH+VTF F
Sbjct  268  TFKAYRYQQHRWSCGPANLFRKMAVEIIQNKKVSMWKKFYVIYSFFFVRKIVAHVVTFVF  327

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV+VPKWGA+YIPC VT+LNSVGTPRS+HLL +W+LFENVM+ HRTKA
Sbjct  328  YCIVMPATVLVPEVEVPKWGAVYIPCTVTLLNSVGTPRSLHLLVFWVLFENVMALHRTKA  387

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVT+KLGDA+     K                  R+   EL    +
Sbjct  388  TFIGLLEAGRVNEWVVTQKLGDALKTKPGKAHRRLRIWIG-------QRVHVVELCVGAY  440

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  +GKN Y++YLFLQ   F +AG+GY+GT +PS
Sbjct  441  LFVCGCYDLAHGKNRYFLYLFLQSFAFFVAGIGYVGTFIPS  481



>ref|XP_009774056.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=526

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKMF EI+RN++V++WKK++VIYSFF VRK+ AH+VTF F
Sbjct  311  TFKAYRYQQHRWSCGPANLFRKMFTEIIRNRKVSLWKKIHVIYSFFFVRKVVAHIVTFVF  370

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRS HL+ +WILFENVMS HRTKA
Sbjct  371  YCIVLPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSFHLIIFWILFENVMSLHRTKA  430

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA    +        +        F DR+   EL    +
Sbjct  431  TFIGLLEAGRVNEWIVTEKLGDAFKIKSAIKAFKKPRFR------FGDRLHLLELATGAY  484

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKNHY++YLF+Q   F I G G++GT VP+
Sbjct  485  LFFCGCYDIAFGKNHYFLYLFIQAFAFFIIGFGHVGTFVPN  525



>ref|XP_010912225.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Elaeis guineensis]
Length=500

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EIVRNK+V+++KKV+VIY+FF VRKI AH+VTF F
Sbjct  285  TLKAYRYQQHRWSCGPANLFRKMLLEIVRNKKVSLFKKVHVIYNFFFVRKIVAHIVTFVF  344

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV +PKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  345  YCLVIPATVLVPEVQIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  404

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+            +          DR+   ELG   +
Sbjct  405  TFIGLLEVGRVNEWVVTEKLGDALKMKMAAKAARKPRIRIG------DRLHLLELGVGAY  458

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L FCG YD  +GKNH++IYLFLQ   F I G GY+GT V
Sbjct  459  LFFCGCYDVAFGKNHFFIYLFLQATAFFIVGFGYVGTFV  497



>ref|XP_008804385.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Phoenix 
dactylifera]
Length=533

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI RNK+V+++KKV+VIY+FF VRKI AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMLLEIARNKKVSLFKKVHVIYNFFFVRKIVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV++PKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCLVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  R NEWVVTEKLGDA+            +          DR+   ELG   +
Sbjct  438  TLIGLLEAGRVNEWVVTEKLGDALKMKMATKSARKPRIR------IGDRLHLLELGVGSY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L FCG YD   GKNHY+IYLF+Q   F I G GY+GT V
Sbjct  492  LFFCGCYDVALGKNHYFIYLFVQAAAFFIVGFGYVGTFV  530



>ref|XP_008647195.1| PREDICTED: uncharacterized protein LOC103628848 [Zea mays]
Length=949

 Score =   276 bits (705),  Expect = 1e-81, Method: Composition-based stats.
 Identities = 138/220 (63%), Positives = 165/220 (75%), Gaps = 9/220 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRK  +EIVRNK+V +WKK++VIY+FFLVRKI AH VTF F
Sbjct  738  TLKAYRYQQHRWSCGPANLFRKTLVEIVRNKKVTLWKKIHVIYNFFLVRKIVAHAVTFVF  797

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV VPKWG++YIP ++T+L++V TPRS HL+ +W LFENVMS HRTKA
Sbjct  798  YCIVIPTTVLVPEVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLFENVMSLHRTKA  857

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+       KP              DR+   ELG A +
Sbjct  858  TFIGLLEAGRVNEWVVTEKLGDALRTKVPGKKPRMR---------IGDRLHVLELGVAAY  908

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            LLFCG YD  +G N YYI+LFLQ I F I G+GY+GT VP
Sbjct  909  LLFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTFVP  948



>ref|XP_010110184.1| hypothetical protein L484_016805 [Morus notabilis]
 gb|EXC25422.1| hypothetical protein L484_016805 [Morus notabilis]
Length=541

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 167/223 (75%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFR+QQHRWSCGPANLF+KM +EIVRNK+V+  KK +V+YSFF VRKI AH+VTF F
Sbjct  326  TFKAFRYQQHRWSCGPANLFKKMAMEIVRNKKVSPLKKFHVLYSFFFVRKIVAHIVTFVF  385

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+L PEV+VPKWGA+YIP ++T+LN+VGTPRS HLL +WILFENVMS HRTKA
Sbjct  386  YCVVLPATVLAPEVEVPKWGAVYIPSVITLLNAVGTPRSFHLLIFWILFENVMSLHRTKA  445

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T IGLLE  R NEW+VT+KLGDA+            +        FR  +R+   EL   
Sbjct  446  TFIGLLEAGRVNEWIVTDKLGDALKTKAGAKSFKKPR--------FRIGERLHLLELTVG  497

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG YD  +GKN Y+IYLFLQ   F IAGVGY+GT VPS
Sbjct  498  AYLFFCGCYDLSFGKNRYFIYLFLQSFAFFIAGVGYVGTFVPS  540



>dbj|BAK03076.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 173/222 (78%), Gaps = 9/222 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIV NK+V +WKK +VIY+FFLVRKI AH+VTF F
Sbjct  302  TFKAFRFQQHRWSCGPANLFRKMLLEIVTNKKVTIWKKFHVIYNFFLVRKIVAHIVTFTF  361

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+++P TI VPEV +PKWG +YIP I+T+LNSVGTPRS HLLF+WILFENVMS HRTKA
Sbjct  362  YCIIIPTTIFVPEVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKA  421

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGLLE  RANEWVVTEKLG A+       K  +A  A  +KS  R  +R+   ELG  
Sbjct  422  TLIGLLEAGRANEWVVTEKLGSAM-------KMKSANKASARKSFMRMWERLNVPELGVG  474

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
             FL  CG YD  +GK++++IYLF Q + F + GVGY+GTIVP
Sbjct  475  AFLFSCGWYDVAFGKDNFFIYLFFQSMAFFVVGVGYVGTIVP  516



>ref|XP_006646997.1| PREDICTED: LOW QUALITY PROTEIN: glucomannan 4-beta-mannosyltransferase 
1-like [Oryza brachyantha]
Length=520

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 169/221 (76%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIV+NK+V +WKK++VIY+FFL+RKI AH+VTF F
Sbjct  304  TFKAFRFQQHRWSCGPANLFRKMLMEIVKNKKVTIWKKIHVIYNFFLIRKIVAHIVTFTF  363

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+++P TI VPEV +PKWG +YIP I+T+LNSVGTPRS HLLF+WILFENVMS HRTKA
Sbjct  364  YCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKA  423

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVT KLG+A+   ++                  DR+   ELG A F
Sbjct  424  TLIGLLEAGRANEWVVTAKLGNALKMKSSNKSSFKKSFMRIW-----DRLNVTELGVAAF  478

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  +GK+H++IYLF Q   F I G+GY+GTIVP 
Sbjct  479  LFSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQ  519



>ref|XP_010912224.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Elaeis guineensis]
Length=533

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 166/219 (76%), Gaps = 6/219 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EIVRNK+V+++KKV+VIY+FF VRKI AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMLLEIVRNKKVSLFKKVHVIYNFFFVRKIVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV +PKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCLVIPATVLVPEVQIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+            +          DR+   ELG   +
Sbjct  438  TFIGLLEVGRVNEWVVTEKLGDALKMKMAAKAARKPRIRIG------DRLHLLELGVGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L FCG YD  +GKNH++IYLFLQ   F I G GY+GT V
Sbjct  492  LFFCGCYDVAFGKNHFFIYLFLQATAFFIVGFGYVGTFV  530



>ref|NP_001131007.1| uncharacterized protein LOC100192112 [Zea mays]
 gb|ACF79431.1| unknown [Zea mays]
 gb|ACG40011.1| CSLA1 - cellulose synthase-like family A; mannan synthase [Zea 
mays]
 gb|AFW66229.1| CSLA1-cellulose synthase-like family isoform 1 [Zea mays]
 gb|AFW66230.1| CSLA1-cellulose synthase-like family isoform 2 [Zea mays]
Length=514

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 166/221 (75%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIV NK+V +WKK++VIY+FFL+RKI AH++TF F
Sbjct  298  TFKAFRFQQHRWSCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSF  357

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P TI VPEV +PKWG +YIP  +T+LNSVGTPRS HLLF+W+ FENVMS HRTKA
Sbjct  358  YCVIIPATIFVPEVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAFENVMSLHRTKA  417

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVT KLG A+   +        +          +R+   ELG A F
Sbjct  418  TLIGLLEAGRANEWVVTAKLGSAMKMKSANKAGLRKQFMRIW-----ERLHVTELGVAAF  472

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  YG++H++IYLF Q + F I GVGY+GTIVP 
Sbjct  473  LFSCGWYDLAYGRDHFFIYLFFQSVAFFIVGVGYVGTIVPQ  513



>ref|XP_004307031.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V+  KK +VIYSFF VRKI AH+VTF F
Sbjct  268  TFKAYRYQQHRWSCGPANLFRKMIMEILRNKKVSPLKKFHVIYSFFFVRKIVAHIVTFVF  327

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  328  YCVILPATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKA  387

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL E  R +EWVVTEKLGDA+   +        +          +R+   EL   ++
Sbjct  388  TFIGLFEAGRVDEWVVTEKLGDALKTKSAVKAHRKPRVRIG------ERLHLLELIVGLY  441

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  YGKN ++IYLFLQ I F IAGVGY+GT VPS
Sbjct  442  LFFCGCYDLAYGKNRFFIYLFLQSIAFFIAGVGYVGTFVPS  482



>gb|KEH43412.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=530

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 163/220 (74%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V + KK YVIYSFF VRKI AH+VTF F
Sbjct  315  TFKAYRYQQHRWSCGPANLFRKMAMEIIRNKKVTMLKKFYVIYSFFFVRKIIAHVVTFTF  374

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV+VPKWGA+YIPCI+T+LN+VGTPRS HL+  WILFENVMS HRTKA
Sbjct  375  YCVILPATVLVPEVEVPKWGAVYIPCIITLLNAVGTPRSFHLVILWILFENVMSMHRTKA  434

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGL E  R NEWVVTEKLGDA+   +        +           RI   ELG   +
Sbjct  435  TLIGLFEAGRVNEWVVTEKLGDALKIKSGGKAARKPRI------TIDGRIHFLELGVGAY  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L  CG YD  +GKN  YIYLFLQ I F + GVGY+G  VP
Sbjct  489  LFLCGCYDLAFGKNQCYIYLFLQSIAFFVVGVGYVGIYVP  528



>ref|XP_002453460.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
 gb|EES06436.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
Length=521

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 166/221 (75%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIV NK+V +WKK++VIY+FFL+RKI AH++TF F
Sbjct  305  TFKAFRFQQHRWSCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSF  364

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P TI VPEV +PKWG +YIP  +T++NSVGTPRS HLLF+W+ FENVMS HRTKA
Sbjct  365  YCLVIPATIFVPEVRIPKWGCVYIPSAITLMNSVGTPRSFHLLFFWVAFENVMSLHRTKA  424

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVT KLG A+            +          +R+   ELG A F
Sbjct  425  TLIGLLEAGRANEWVVTAKLGSAMKMKAANKAGLRKQFMRIW-----ERLHVTELGVAAF  479

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YDF YG++H++IYLF Q + F I G+GY+GTIVP 
Sbjct  480  LFSCGWYDFAYGRDHFFIYLFFQSVAFFIVGIGYVGTIVPQ  520



>ref|XP_003560565.2| PREDICTED: probable mannan synthase 9 [Brachypodium distachyon]
Length=488

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 169/220 (77%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFR+QQHRWSCGPANLFRKM ++IVRNK+V +W+K++VIY+FFLVRKI  H+VTF F
Sbjct  274  TFKAFRYQQHRWSCGPANLFRKMLMDIVRNKKVTLWRKIHVIYNFFLVRKIIGHVVTFVF  333

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
             C+V+P T+LVPEV++PKWG IYIP I+T+LN+VGTPRS+HLL +W LFENVMS HRTKA
Sbjct  334  CCLVIPATVLVPEVEIPKWGYIYIPSIITLLNAVGTPRSVHLLVFWTLFENVMSLHRTKA  393

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+        P   +          +R+   ELG A +
Sbjct  394  TFIGLLEIGRVNEWVVTEKLGDALKMKTPSKVPKKLRMRIG------ERLHLLELGVAAY  447

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YD  +G NHY+I+LF+Q ITF + GVGY+GT VP
Sbjct  448  LFFCGCYDISFGNNHYFIFLFMQSITFFVVGVGYVGTFVP  487



>emb|CBI30236.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   265 bits (678),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 170/218 (78%), Gaps = 6/218 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V++WKKV+VIYSFF+VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSLWKKVHVIYSFFIVRKLVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVP+V+VP+WGA+YIP I+TILN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPDVEVPRWGAVYIPTIITILNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+        P   +          +R+   ELG   F
Sbjct  438  TFIGLLEGGRVNEWVVTEKLGDALKVKAATKAPKKPRFK------IGERLHLLELGVGAF  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTI  655
            L FCG YD  +G+NHY+IYL++Q I F I G GY+ T+
Sbjct  492  LFFCGCYDVAFGRNHYFIYLYVQAIAFFIVGFGYVATL  529



>ref|XP_010278246.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nelumbo 
nucifera]
Length=527

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 170/221 (77%), Gaps = 9/221 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF AFR QQ RWSCGPANLFRKM +EI+RNK V  +KK YVIYSFFLVRKI AH++TF F
Sbjct  316  TFNAFRHQQDRWSCGPANLFRKMAMEIIRNKNVTTFKKFYVIYSFFLVRKIIAHIITFVF  375

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLPLT+L+PEV+VPKWG+IY+PCI+T+LNSVGTPRS+HLLF+W+LFENVM+ HR+KA
Sbjct  376  YCIVLPLTVLIPEVEVPKWGSIYMPCIITLLNSVGTPRSVHLLFFWVLFENVMALHRSKA  435

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TI GLL  K+AN WVVTEKLG    N+    KP             R+R+   EL F +F
Sbjct  436  TIAGLLGAKKANVWVVTEKLGSKTTNSKAPKKPRFR---------IRERLHLTELAFGLF  486

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L     YDF+YGKN+Y+I+L LQ ITF I G GY+GTI+PS
Sbjct  487  LALVSCYDFVYGKNNYFIFLSLQAITFFIVGFGYVGTIIPS  527



>ref|XP_003571119.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1 [Brachypodium 
distachyon]
Length=518

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 172/223 (77%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIV NK+V +WKK +VIY+FFLVRKI AH+VTF F
Sbjct  302  TFKAFRFQQHRWSCGPANLFRKMLLEIVTNKKVTIWKKFHVIYNFFLVRKIVAHIVTFTF  361

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+++P TI VPEV +PKWG +YIP I+T+LNSVGTPRS HLLF+WILFENVMS HRTKA
Sbjct  362  YCIIIPTTIFVPEVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKA  421

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGLLE  R NEWVVTEKLG+A+       K  +A  A  +KS  R  DR+   ELG  
Sbjct  422  TLIGLLEAGRVNEWVVTEKLGNAM-------KMKSASKASARKSFMRIWDRLNVPELGVG  474

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             FL   G YD  +GK++++IYLF Q + F I GVGY+GTIVP 
Sbjct  475  AFLFSIGWYDVAFGKDNFFIYLFFQSMAFFIVGVGYVGTIVPQ  517



>gb|EAY84833.1| hypothetical protein OsI_06199 [Oryza sativa Indica Group]
Length=517

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 158/221 (71%), Gaps = 9/221 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EI       +      IY+FFL+RKI AH+VTF F
Sbjct  305  TFKAFRFQQHRWSCGPANLFRKMLMEIKVTIWKKIHV----IYNFFLIRKIIAHIVTFTF  360

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+++P TI VPEV +PKWG +YIP I+T+LNSVGTPRS HLLF+WILFENVMS HRTKA
Sbjct  361  YCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKA  420

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVTEKLG+A+   ++                  DR+   ELG A F
Sbjct  421  TLIGLLEAGRANEWVVTEKLGNALKMKSSSKSSAKKSFMRVW-----DRLNVTELGVAAF  475

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  +GK+H++IYLF Q   F I G+GY+GTIVP 
Sbjct  476  LFSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQ  516



>ref|XP_009353016.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Pyrus x bretschneideri]
Length=497

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 174/223 (78%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V  WKKV+VIYSFF VRKI AH+  F F
Sbjct  281  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVTFWKKVHVIYSFFFVRKIIAHINAFVF  340

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T++VPEV+VPKWG IYIP ++TILN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  341  YCIVLPSTVMVPEVEVPKWGGIYIPSMITILNAVGTPRSIHLLVFWILFENVMSLHRTKA  400

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            TIIGLLE  R NEW+VTEKLGDA+       +   A     +KS FR  +R+   EL   
Sbjct  401  TIIGLLEASRVNEWIVTEKLGDAL-------RTLKAATKLPRKSRFRIGERLHVLELAVG  453

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            ++L FCG YDF++GKN+++++L++Q   F I G GY+GT VP+
Sbjct  454  LYLFFCGCYDFVFGKNYFFMFLYIQATAFFIIGFGYVGTFVPN  496



>gb|KCW48370.1| hypothetical protein EUGRSUZ_K02079 [Eucalyptus grandis]
Length=296

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM  +I++NK+V+ WKK+YVIYSFF+VRKI AH+VTF F
Sbjct  81   TLKAYRYQQHRWSCGPANLFRKMVFDIIKNKKVSTWKKLYVIYSFFMVRKIVAHIVTFLF  140

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+L PEV VPKW +IYIP I+T LN++ TPRS+HL+ +WILFENVMS HRTKA
Sbjct  141  YCIVLPATVLTPEVAVPKWASIYIPSIITALNALSTPRSLHLMVFWILFENVMSLHRTKA  200

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEW+VTEKLGDA+ N    +     +        F +R    E+G  V+
Sbjct  201  TIIGLLEGNRVNEWIVTEKLGDALKNKAITSFAERTRLR------FTERFHFLEIGVGVY  254

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKNHY+++L++Q + F I G GY+G  VP 
Sbjct  255  LCFCGCYDVAFGKNHYFLFLYVQAVAFFIMGFGYVGIFVPK  295



>gb|KEH24115.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=531

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V++WKK++VIYSFF VRK+ AH+ TF F
Sbjct  317  TFKAYRYQQHRWSCGPANLFRKMVLEIIRNKKVSLWKKIHVIYSFFFVRKVIAHINTFVF  376

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV VPKWGA+YIP ++T+LN+VGTPRS+HLL +WILFENVMS HR KA
Sbjct  377  YCIVLPATVLVPEVAVPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILFENVMSLHRAKA  436

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  R NEW+VTEKLGDA+            +          DRI   ELG  ++
Sbjct  437  TVIGLLEASRVNEWIVTEKLGDALKAKAGTKALKKPRFR------IEDRIHLLELGVGMY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L F G YD ++GKNH++I+LF+Q I F I   GY+GT VP+
Sbjct  491  LFFIGCYDVMFGKNHFFIFLFIQAIAFFIMAFGYVGTFVPN  531



>ref|XP_008456578.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=518

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 170/223 (76%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM  EI+RNK+V++WKK+Y+IYSFF VRKI AH+VTF F
Sbjct  303  TFKAYRYQQHRWSCGPANLFKKMVTEIMRNKKVSLWKKLYLIYSFFFVRKIVAHIVTFVF  362

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP  +T+LN+VGTPRS HL+ +WILFENVMS HRTKA
Sbjct  363  YCVILPATVLVPEVSVPKWGAVYIPSTITLLNAVGTPRSFHLIIFWILFENVMSLHRTKA  422

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T IGLLE  R NEWVVTEKLGDA+        P   +        FR  +R+   EL   
Sbjct  423  TFIGLLEAGRVNEWVVTEKLGDALKTKLGSKAPRKPR--------FRLGERLHILELCVG  474

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG YD  +GKN Y+IYLFLQ   F IAGVGY+GT+VP+
Sbjct  475  AYLFFCGWYDLNFGKNQYFIYLFLQSFAFFIAGVGYVGTMVPN  517



>ref|XP_009361452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=483

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 170/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V+  KK +VIYSFF VRKI AH+VTF F
Sbjct  268  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSPMKKFHVIYSFFFVRKIVAHIVTFVF  327

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T+LVPEV VP WGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  328  YCIILPATVLVPEVQVPIWGAVYIPSIITLLNAVGTPRSLHLMIFWILFENVMSLHRTKA  387

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL E  R NEWVVTEKLGDA+         +  K A + +S   +R+   EL    +
Sbjct  388  TFIGLFEAGRVNEWVVTEKLGDAL------KTKSGGKAARRPRSRIGERLHMLELIVGFY  441

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKN Y+I+LF+Q I F IAGVGY+GT VP+
Sbjct  442  LFFCGCYDLAFGKNGYFIFLFIQSIAFFIAGVGYVGTFVPN  482



>ref|XP_009335111.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
 ref|XP_009335114.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=517

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 171/221 (77%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V+  KK++VIYSFF VRKI AH+VTF F
Sbjct  302  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSPMKKLHVIYSFFFVRKIVAHIVTFVF  361

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T+LVPEV VP WGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  362  YCIILPATVLVPEVQVPIWGAVYIPSIITLLNAVGTPRSLHLMIFWILFENVMSLHRTKA  421

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL E  R NEWVVTEKLGDA+         +  K A + +S   +R+   EL    +
Sbjct  422  TFIGLFEAGRVNEWVVTEKLGDAL------KTKSGGKAARRPRSRIGERLHMLELIVGFY  475

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKN Y+I+LF+Q I F IAGVGY+GT VP+
Sbjct  476  LFFCGCYDLAFGKNGYFIFLFIQSIAFFIAGVGYVGTFVPN  516



>ref|XP_009365313.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=534

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 173/223 (78%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V  WKKV+VIYSFF VRKI AH+  F F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVTCWKKVHVIYSFFFVRKIIAHINAFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV VPKWG IYIP ++T+LN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  378  YCIVLPATVLVPEVVVPKWGGIYIPSLITLLNAVGTPRSIHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            TIIGLLE  R NEW+VTEKLGDA+       K         +KS FR  +R+   EL   
Sbjct  438  TIIGLLEASRVNEWIVTEKLGDAL-------KTLKVATKLPRKSRFRIGERLHLLELAVG  490

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            ++L+FCG YDF++GKN++Y++L++Q   F I G GY+GT VP+
Sbjct  491  LYLIFCGCYDFIFGKNYFYLFLYIQATAFFIIGFGYVGTFVPN  533



>ref|XP_010325940.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Solanum lycopersicum]
Length=496

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI+RNK+V++WKKV+VIYSFF VRK+ AH+VTF F
Sbjct  281  TLKAYRYQQHRWSCGPANLFRKMCMEIIRNKKVSLWKKVHVIYSFFFVRKVVAHIVTFVF  340

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            Y VVLP T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  341  YVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  400

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+   +        +          DRI   E     +
Sbjct  401  TFIGLLEAGRVNEWIVTEKLGDALKLKSATKAFKKHRMR------LGDRIHLLEFAAGAY  454

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +G NHY++YLF+Q   F I G GY+GT VP+
Sbjct  455  LFFCGCYDIAFGTNHYFLYLFIQAFAFLIVGFGYVGTFVPN  495



>gb|EYU41550.1| hypothetical protein MIMGU_mgv1a004346mg [Erythranthe guttata]
Length=532

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 167/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V +WKKV+VIYSFF +RKI AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVVEIIRNKKVTLWKKVHVIYSFFFIRKIVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV +PKWGAIYIP I+TILN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVYIPKWGAIYIPSIITILNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA    +        +          +R+   E+    +
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDAFKLKSALKAFKKPRFK------IGERVHFLEVATGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD ++GKNHYYI L++Q I F I G  Y+GT VPS
Sbjct  492  LFFCGCYDVVFGKNHYYICLYVQAIAFFIMGFSYIGTFVPS  532



>ref|XP_009353014.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Pyrus x bretschneideri]
Length=534

 Score =   263 bits (673),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 174/223 (78%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V  WKKV+VIYSFF VRKI AH+  F F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVTFWKKVHVIYSFFFVRKIIAHINAFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T++VPEV+VPKWG IYIP ++TILN+VGTPRSIHLL +WILFENVMS HRTKA
Sbjct  378  YCIVLPSTVMVPEVEVPKWGGIYIPSMITILNAVGTPRSIHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            TIIGLLE  R NEW+VTEKLGDA+       +   A     +KS FR  +R+   EL   
Sbjct  438  TIIGLLEASRVNEWIVTEKLGDAL-------RTLKAATKLPRKSRFRIGERLHVLELAVG  490

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            ++L FCG YDF++GKN+++++L++Q   F I G GY+GT VP+
Sbjct  491  LYLFFCGCYDFVFGKNYFFMFLYIQATAFFIIGFGYVGTFVPN  533



>ref|XP_009404378.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 163/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T +A+R+QQHRWSCGPANLFRKM +EI  NK+V++WKKV+VIYSFF VRK+ AH+VTF F
Sbjct  318  TLRAYRYQQHRWSCGPANLFRKMAMEIANNKKVSLWKKVHVIYSFFFVRKVVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P  +LVPEV++P+WGAIYIP I+ +LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCVVIPAAVLVPEVEIPRWGAIYIPSIIALLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  R NEWVVTEKLGD +                       DR+   EL    +
Sbjct  438  TLIGLLEAGRVNEWVVTEKLGDTVKAKMAVKAARKPPIR------IGDRLHLLELWTGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKNHY++YLFLQ I F + G GY+GT VP 
Sbjct  492  LFFCGCYDVAFGKNHYFLYLFLQAIAFFVVGFGYVGTFVPG  532



>ref|XP_004151323.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004165881.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=483

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 170/223 (76%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANL +KM IEI+RNK+V++WKK+Y+IYSFF VRKI AH+VTF F
Sbjct  268  TFKAYRYQQHRWSCGPANLLKKMVIEIMRNKKVSLWKKLYLIYSFFFVRKIVAHIVTFVF  327

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP  +T+LN+VGTPRS HL+ +WILFENVMS HRTKA
Sbjct  328  YCVILPATVLVPEVSVPKWGAVYIPSTITLLNAVGTPRSFHLIIFWILFENVMSLHRTKA  387

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T IGLLE  R NEWVVTEKLGDA+        P   +        FR  +R+   EL   
Sbjct  388  TFIGLLEAGRVNEWVVTEKLGDALKTKLGSKAPRKPR--------FRMGERLHMLELCVG  439

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG YD  +GKN Y+IYLFLQ   F IAGVGY+GT+VP+
Sbjct  440  GYLFFCGWYDLNFGKNGYFIYLFLQSFAFFIAGVGYVGTLVPN  482



>emb|CBI40224.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM IEI RNK+VN+WKKVYVIYSFF VRKI AH+VTF F
Sbjct  234  TFKAYRYQQHRWSCGPANLFKKMAIEIARNKKVNLWKKVYVIYSFFFVRKIVAHIVTFLF  293

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV P T+  PEV+VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  294  YCVVFPATVFFPEVEVPMWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  353

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T +GLLE  R NEWVVTEKLGDA+   ++       +          +R+   ELG   +
Sbjct  354  TFMGLLEVGRVNEWVVTEKLGDALKMKSSTKTSKKPRIRIG------ERMHLLELGVGAY  407

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  YGKN ++IYLF Q + F IAG GY+GT VP+
Sbjct  408  LFFCGCYDVTYGKNGFFIYLFFQSMAFFIAGFGYVGTFVPN  448



>ref|XP_010325939.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Solanum lycopersicum]
Length=533

 Score =   263 bits (671),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI+RNK+V++WKKV+VIYSFF VRK+ AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMCMEIIRNKKVSLWKKVHVIYSFFFVRKVVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            Y VVLP T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+   +        +          DRI   E     +
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDALKLKSATKAFKKHRMR------LGDRIHLLEFAAGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +G NHY++YLF+Q   F I G GY+GT VP+
Sbjct  492  LFFCGCYDIAFGTNHYFLYLFIQAFAFLIVGFGYVGTFVPN  532



>ref|XP_009401015.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401017.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 161/221 (73%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM ++I RNK V +W KV+VIYSFF VRKI AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMAMDIARNKNVTLWTKVHVIYSFFFVRKIVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+LVPEV+VP WG +YIP  +T+LN+VGTPRS+HLL +WILFENVMS HR KA
Sbjct  378  YCVVIPATVLVPEVEVPNWGLVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRAKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  R NEWVVTEKLGD +            +          DR+   EL    +
Sbjct  438  TLIGLLEAGRVNEWVVTEKLGDVMKTKVAAKAARKPRIR------IGDRLHLLELFTGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKNHYY+YLFLQ ITF + G GY+GT VP 
Sbjct  492  LFFCGCYDLSFGKNHYYLYLFLQAITFFVVGFGYVGTFVPQ  532



>gb|AFW87395.1| hypothetical protein ZEAMMB73_638072, partial [Zea mays]
Length=479

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 165/220 (75%), Gaps = 9/220 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRK  +EIVRNK+V +WKK++VIY+FFLVRKI AH VTF F
Sbjct  269  TLKAYRYQQHRWSCGPANLFRKTLVEIVRNKKVTLWKKIHVIYNFFLVRKIVAHAVTFVF  328

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV VPKWG++YIP ++T+L++V TPRS HL+ +W LFENVMS HRTKA
Sbjct  329  YCIVIPTTVLVPEVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLFENVMSLHRTKA  388

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+       KP              DR+   ELG A +
Sbjct  389  TFIGLLEAGRVNEWVVTEKLGDALRTKVPGKKPRMRIG---------DRLHVLELGVAAY  439

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            LLFCG YD  +G N YYI+LFLQ I F I G+GY+GT VP
Sbjct  440  LLFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTFVP  479



>ref|XP_010243535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Nelumbo 
nucifera]
Length=533

 Score =   262 bits (670),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 168/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +E+VRNK+V +WKK +VIYSFF VRKI AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEVVRNKKVTLWKKFHVIYSFFFVRKIVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+PLT+LVPEV+VPKWG++YIP I+TILNSVGT RS+HLL +WILFENVMS HRTKA
Sbjct  378  YCVVMPLTVLVPEVEVPKWGSVYIPSIITILNSVGTLRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+            +          +R+   ELG  +F
Sbjct  438  TFIGLLEAGRVNEWVVTEKLGDALKVKAASKAAKKPRVRIG------ERLHLLELGVGMF  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L F   YD  YGKNHY++YL+LQ + F I G GY+GT VP+
Sbjct  492  LFFIACYDLAYGKNHYFLYLYLQSLAFFIVGFGYVGTFVPN  532



>ref|XP_008659807.1| PREDICTED: probable mannan synthase 9 [Zea mays]
Length=526

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 165/220 (75%), Gaps = 9/220 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRK  +EIVRNK+V +WKK++VIY+FFLVRKI AH VTF F
Sbjct  315  TLKAYRYQQHRWSCGPANLFRKTLVEIVRNKKVTLWKKIHVIYNFFLVRKIVAHAVTFVF  374

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV VPKWG++YIP ++T+L++V TPRS HL+ +W LFENVMS HRTKA
Sbjct  375  YCIVIPTTVLVPEVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLFENVMSLHRTKA  434

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+       KP              DR+   ELG A +
Sbjct  435  TFIGLLEAGRVNEWVVTEKLGDALRTKVPGKKPRMRIG---------DRLHVLELGVAAY  485

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            LLFCG YD  +G N YYI+LFLQ I F I G+GY+GT VP
Sbjct  486  LLFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTFVP  525



>ref|XP_008232025.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Prunus 
mume]
Length=517

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 165/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V+  KK +VIYSFF VRKI AH+VTF F
Sbjct  302  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKIVAHIVTFVF  361

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  362  YCVILPATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKA  421

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL E  R NEWVVTEKLGDA+        P   +          +R+   EL    +
Sbjct  422  TFIGLFEAGRVNEWVVTEKLGDALKKKLGAKAPRKPRLRIG------ERLHMLELIVGFY  475

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKN Y+IYLF+Q + F IAGVGY+GT VP+
Sbjct  476  LFFCGCYDLAFGKNGYFIYLFIQSVAFFIAGVGYVGTFVPN  516



>ref|XP_004951606.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Setaria 
italica]
Length=521

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 164/221 (74%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIV NK+V +WKK++VIY+FFL+RKI AH++TF F
Sbjct  305  TFKAFRFQQHRWSCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSF  364

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+++P TI VPEV +PKWG +YIP  +T+LNSVGTPRS HLLF+W+ FENVMS HRTKA
Sbjct  365  YCLIIPATIFVPEVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAFENVMSLHRTKA  424

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLLE  RANEWVVT KLG A+   +        +          +R+   ELG   F
Sbjct  425  TLIGLLEAGRANEWVVTAKLGSAMKMKSANKGGLKKQFMRIW-----ERLHITELGVGTF  479

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  YG++H+YIYLF Q I F I G GY+GTIVP 
Sbjct  480  LFSCGWYDLAYGRDHFYIYLFFQSIAFFIIGFGYVGTIVPQ  520



>ref|XP_007219015.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
 gb|EMJ20214.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
Length=517

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 165/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V+  KK +VIYSFF VRKI AH+VTF F
Sbjct  302  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKIVAHIVTFVF  361

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  362  YCVILPATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKA  421

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL E  R NEWVVTEKLGDA+        P   +          +R+   EL    +
Sbjct  422  TFIGLFEAGRVNEWVVTEKLGDALKKKLGAKAPRKPRLR------IGERLHVLELIVGFY  475

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKN Y+IYLF+Q + F IAGVGY+GT VP+
Sbjct  476  LFFCGCYDLAFGKNGYFIYLFIQSVAFFIAGVGYVGTFVPN  516



>ref|XP_006341174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI+RNK+V++WKKV+VIYSFF VRK+ AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMCMEIIRNKKVSLWKKVHVIYSFFFVRKVVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            Y VVLP T+LVPEV+VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+   +        +          DRI   E     +
Sbjct  438  TFIGLLEAGRVNEWIVTEKLGDALKLKSATKAFKKHRMR------LGDRIHLLEFAAGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +G NHY++YLF+Q   F I G GY+GT +P+
Sbjct  492  LFFCGCYDIAFGTNHYFLYLFIQSFAFLIVGFGYVGTFIPN  532



>ref|XP_007220072.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
 gb|EMJ21271.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
Length=517

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 165/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V+  KK +VIYSFF VRK+ AH+VTF F
Sbjct  302  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKVVAHIVTFVF  361

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  362  YCVILPATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKA  421

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL E  R NEWVVTEKLGDA+        P   +          +R+   EL    +
Sbjct  422  TFIGLFEAGRVNEWVVTEKLGDALKKKLGAKAPRKPRLRIG------ERLHVLELIVGFY  475

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKN Y+IYLF+Q + F IAGVGY+GT VP+
Sbjct  476  LFFCGCYDLAFGKNGYFIYLFIQSVAFFIAGVGYVGTFVPN  516



>ref|XP_004164074.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            + KA+R+QQHRWSCGPANL RKM +EI+ NK+V  WKKV+VIYSFF VRK+ AH+ TF F
Sbjct  322  SLKAYRYQQHRWSCGPANLLRKMIMEIITNKKVTAWKKVHVIYSFFFVRKVVAHINTFVF  381

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV+VPKWG++YIP I+T+LN+VGTPRSIHLL YWILFENVM+ HRTK 
Sbjct  382  YCIVLPATVLVPEVEVPKWGSVYIPSIITLLNAVGTPRSIHLLVYWILFENVMAMHRTKG  441

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEW+VTEKLGDA         P   +          +R+L  ELG   +
Sbjct  442  TIIGLLEASRVNEWIVTEKLGDASKPKLAAKTPKKPRFW------IGERVLMWELGVGAY  495

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG+YD  +GKN Y+I+LFLQ I F I G G++GT V S
Sbjct  496  LFICGIYDIFFGKNQYFIFLFLQAIAFCIVGFGFVGTHVSS  536



>gb|ABG34548.1| cellulose synthase-like A2 [Pinus taeda]
Length=534

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 166/221 (75%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK+V+ WKK +VIY FF VRKI AH+VTF F
Sbjct  320  TFKAYRYQQHRWSCGPANLFRKMVREIIANKKVSAWKKFHVIYGFFFVRKIVAHIVTFVF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+LVPEV +PKWGA+YIP  +T+LN+V TPRS+HLL +WILFENVMS HRTKA
Sbjct  380  YCVVIPTTVLVPEVQLPKWGAVYIPSTITLLNAVSTPRSLHLLVFWILFENVMSLHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGL E  R NEWVVTEKLGDA+       K   AK   + +S   +RI   E+   V+
Sbjct  440  TIIGLFEAGRVNEWVVTEKLGDAL-------KHKTAKQMKRSQSRIGERIHVLEVLTGVY  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  +GKNH+YIYLFLQ   F I G GY+GT VP+
Sbjct  493  LFFCASYDLAFGKNHFYIYLFLQAGAFFIMGFGYIGTFVPT  533



>gb|ABG34547.1| cellulose synthase-like A1 [Pinus taeda]
Length=530

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 169/221 (76%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNKRV  WKK +VIY+FF VRKI AH+VTF F
Sbjct  316  TFKAYRYQQHRWSCGPANLFRKMVMEILRNKRVTPWKKFHVIYAFFFVRKIVAHIVTFTF  375

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+LVPEV VPKWGA+YIP I+T+LN+V TP+S+HLL +WILFENVMS HRTKA
Sbjct  376  YCVVIPATVLVPEVQVPKWGAVYIPSIITLLNAVSTPKSLHLLVFWILFENVMSLHRTKA  435

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+       K  + K   K +S   +R+   EL   V+
Sbjct  436  TFIGLLEAGRVNEWVVTEKLGDAM-------KHKSGKQIKKSRSRIGERLHVLELFAGVY  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  +G+NH+YIYL+LQ   F + G GY+GT VP+
Sbjct  489  LFFCASYDLAFGRNHFYIYLYLQAAAFFVMGFGYIGTFVPT  529



>dbj|BAF36300.1| hypothetical protein [Ipomoea trifida]
Length=571

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 160/174 (92%), Gaps = 3/174 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKMFIEIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFF
Sbjct  320  TFKAFRFQQHRWSCGPANLFRKMFIEIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFF  379

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV+VPKWGAIYIPCI+TILNSVGTPRSIHLLFYWILFENVMSFHRTKA
Sbjct  380  YCVVLPLTILVPEVEVPKWGAIYIPCIITILNSVGTPRSIHLLFYWILFENVMSFHRTKA  439

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQE  523
            T+IGLLEFKRANEWVVTEKLGDAI   NN NK N+     K KS+FRDR+  + 
Sbjct  440  TLIGLLEFKRANEWVVTEKLGDAI---NNNNKSNSKPAPKKSKSMFRDRVFTEN  490



>ref|XP_008241312.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Prunus mume]
Length=534

 Score =   261 bits (666),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 168/221 (76%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V++WKKV+VIYSFF VRKI AH+  F F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVSLWKKVHVIYSFFFVRKIIAHINAFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV VPKWG IYIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCIVLPATVLVPEVVVPKWGGIYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEW+VTEKLGDA+       K               +R+   EL    +
Sbjct  438  TIIGLLEASRVNEWIVTEKLGDALKTLTVAAKLPRKPRIRIG-----ERLHLLELAVGCY  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YDF +GKN++Y++L++Q + F I G GY+GT VP+
Sbjct  493  LFFCGTYDFAFGKNYFYLFLYIQAMAFYIIGFGYVGTFVPN  533



>ref|XP_002269110.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
 emb|CAN62185.1| hypothetical protein VITISV_019367 [Vitis vinifera]
Length=529

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM IEI RNK+VN+WKKVYVIYSFF VRKI AH+VTF F
Sbjct  314  TFKAYRYQQHRWSCGPANLFKKMAIEIARNKKVNLWKKVYVIYSFFFVRKIVAHIVTFLF  373

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV P T+  PEV+VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  374  YCVVFPATVFFPEVEVPMWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  433

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T +GLLE  R NEWVVTEKLGDA+   ++       +          +R+   ELG   +
Sbjct  434  TFMGLLEVGRVNEWVVTEKLGDALKMKSSTKTSKKPRIRIG------ERMHLLELGVGAY  487

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  YGKN ++IYLF Q + F IAG GY+GT VP+
Sbjct  488  LFFCGCYDVTYGKNGFFIYLFFQSMAFFIAGFGYVGTFVPN  528



>ref|XP_004965827.1| PREDICTED: probable mannan synthase 9-like [Setaria italica]
Length=538

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 166/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EIVRNK+V +WKK++VIY+FFLVRKI AH+VTF F
Sbjct  323  TLKAYRYQQHRWSCGPANLFRKMLMEIVRNKKVTLWKKIHVIYNFFLVRKIIAHIVTFVF  382

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV++P+WG++YIP I+T+LN+VGTPRS+HL+ +WILFENVM+ HR KA
Sbjct  383  YCIVIPATVLVPEVEIPRWGSVYIPTIITLLNAVGTPRSVHLIVFWILFENVMALHRMKA  442

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGDA+            +          DR+   EL    +
Sbjct  443  TFIGLLEAGRVNEWVVTEKLGDALRMKMPGKGFKKPRMRIV------DRLHILELCVGAY  496

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L FCG YD   G NHYYI+LFLQ I F I G+GY+GT VP
Sbjct  497  LFFCGCYDVTVGNNHYYIFLFLQSIAFFIVGLGYVGTFVP  536



>ref|XP_008363207.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Malus domestica]
Length=425

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V+  KK +VIYSFF VRKI AH+VTF F
Sbjct  210  TFKAYRYQQHRWSCGPANLFRKMAMEIVRNKKVSPMKKFHVIYSFFFVRKIVAHVVTFVF  269

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T+ VPE+ VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  270  YCIILPATVFVPEIQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKA  329

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGL E  R NEWVVTEKLGDA+   +        +          +R+   EL    +
Sbjct  330  TLIGLFEAGRVNEWVVTEKLGDALKTKSGAKASRKPRIRIG------ERLHMLELIVGFY  383

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKN Y+I LF+Q I F IAGVGY+GT VP+
Sbjct  384  LFFCGCYDLSFGKNGYFIXLFIQSIAFFIAGVGYVGTFVPN  424



>ref|XP_008462529.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=536

 Score =   260 bits (665),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 165/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            + KA+R+QQHRWSCGPANL RKM +EI+ NK+V+ WKKV+VIYSFF VRK+ AH+ TF F
Sbjct  321  SLKAYRYQQHRWSCGPANLLRKMIMEIITNKKVSAWKKVHVIYSFFFVRKVVAHINTFVF  380

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV+VPKWG++YIP I+T+LN+VGTPRS+HLL YWILFENVM+ HRTK 
Sbjct  381  YCLVLPATVLVPEVEVPKWGSVYIPSIITLLNAVGTPRSLHLLVYWILFENVMAMHRTKG  440

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEW+VTEKLGDA         P   +          +R+L  ELG   +
Sbjct  441  TIIGLLEASRVNEWIVTEKLGDASKPKLAAKTPKKTRFW------IGERVLMWELGVGAY  494

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG+YD  +GKN Y+I+LFLQ I F I G G++GT V S
Sbjct  495  LFICGIYDIFFGKNQYFIFLFLQAIAFCIVGFGFVGTHVSS  535



>ref|XP_004143300.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48231.1| hypothetical protein Csa_6G450360 [Cucumis sativus]
Length=537

 Score =   260 bits (665),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            + KA+R+QQHRWSCGPANL RKM +EI+ NK+V  WKKV+VIYSFF VRK+ AH+ TF F
Sbjct  322  SLKAYRYQQHRWSCGPANLLRKMIMEIITNKKVTAWKKVHVIYSFFFVRKVVAHINTFVF  381

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV+VPKWG++YIP I+T+LN+VGTPRS+HLL YWILFENVM+ HRTK 
Sbjct  382  YCIVLPATVLVPEVEVPKWGSVYIPSIITLLNAVGTPRSLHLLVYWILFENVMAMHRTKG  441

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEW+VTEKLGDA         P   +          +R+L  ELG   +
Sbjct  442  TIIGLLEASRVNEWIVTEKLGDASKPKLAAKTPKKPRFW------IGERVLMWELGVGAY  495

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG+YD  +GKN Y+I+LFLQ I F I G G++GT V S
Sbjct  496  LFICGIYDIFFGKNQYFIFLFLQAIAFCIVGFGFVGTHVSS  536



>ref|XP_008359466.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Malus 
domestica]
Length=534

 Score =   260 bits (665),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 169/223 (76%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V  WKKV+VIYSFF VRKI AH+  F F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVTFWKKVHVIYSFFFVRKIIAHINAFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV VPKWG IYIP ++T+LN+VGTPRSIHLL +WILFEN+MS HRTKA
Sbjct  378  YCIVLPATVLVPEVVVPKWGGIYIPSLITLLNAVGTPRSIHLLVFWILFENIMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            TIIGLLE  R NEW+VTEKLGDA+       K             FR  +R+   EL   
Sbjct  438  TIIGLLEASRVNEWIVTEKLGDALKTLKVATKLPRKPR-------FRIGERLHLLELAVG  490

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            ++L FCG YDF++GKN++Y++L++Q   F I G GY+GT VP+
Sbjct  491  LYLFFCGCYDFIFGKNYFYLFLYIQATAFFIIGFGYVGTFVPN  533



>ref|XP_009379774.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 163/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI  NK+V +WKKV+VIYSFF VRK+ AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIKNNKKVGLWKKVHVIYSFFFVRKVVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV++PKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCIVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD              +          DR+   EL    +
Sbjct  438  TFIGLLEAGRVNEWVVTEKLGDTKKPKMAAKAARKLRIR------IGDRLHLLELWTGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L  CG YD  +G +H++IYLFLQ + F I G GY+GT VPS
Sbjct  492  LFVCGCYDVAFGNSHFFIYLFLQAMAFFIVGFGYVGTFVPS  532



>ref|XP_004303037.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=533

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 168/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFR QQHRWSCGPANLF+KM +EI+ NK+V+VW+KV+VIYSFF VRKI AH+  FFF
Sbjct  318  TFKAFRHQQHRWSCGPANLFKKMVMEIITNKKVSVWQKVHVIYSFFFVRKIIAHIFAFFF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP TILVPEV VPKWG +YIP I+T+LNSVGTPRSIHL+ +WILFENVMS HRTKA
Sbjct  378  YCIVLPATILVPEVTVPKWGGVYIPTIITLLNSVGTPRSIHLVVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIG+LEF R NEW+VTEKLGD + N      P   +          DR+   EL    +
Sbjct  438  TIIGILEFSRVNEWIVTEKLGDFLKNKVGAKAPKKFRLNIG------DRLHFLELAVGCY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YDF++GK++Y+I+ + Q + F I G GY+GTIVP+
Sbjct  492  LFFCACYDFVFGKDNYFIFFYTQSLAFFIMGFGYVGTIVPT  532



>ref|XP_008363208.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Malus domestica]
Length=483

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V+  KK +VIYSFF VRKI AH+VTF F
Sbjct  268  TFKAYRYQQHRWSCGPANLFRKMAMEIVRNKKVSPMKKFHVIYSFFFVRKIVAHVVTFVF  327

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T+ VPE+ VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  328  YCIILPATVFVPEIQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKA  387

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGL E  R NEWVVTEKLGDA+   +        +          +R+   EL    +
Sbjct  388  TLIGLFEAGRVNEWVVTEKLGDALKTKSGAKASRKPRIRIG------ERLHMLELIVGFY  441

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKN Y+I LF+Q I F IAGVGY+GT VP+
Sbjct  442  LFFCGCYDLSFGKNGYFIXLFIQSIAFFIAGVGYVGTFVPN  482



>ref|XP_004137864.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004170538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN59050.1| hypothetical protein Csa_3G748790 [Cucumis sativus]
Length=532

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 166/223 (74%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EI +NKRV +WKKVYVIYSFF VRKI AH+  F F
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVMEIAKNKRVTLWKKVYVIYSFFFVRKIIAHINNFLF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +C+ LP T++VPEV++P WG +YIP   TI+N++GTP+S HL  +WI+FENVMS HR KA
Sbjct  378  FCIALPATVVVPEVEIPTWGGVYIPTATTIINAIGTPKSFHLTIFWIMFENVMSLHRAKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            TIIGLLE  RANEWVVTEKLGD +                 KK IFR  DRI   ELG  
Sbjct  438  TIIGLLEGSRANEWVVTEKLGDIL--------KGKTASKATKKPIFRIGDRIHITELGVG  489

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG Y+ LYG+N+++++L +Q I+F I G GY+GTIVPS
Sbjct  490  AYLFFCGCYNMLYGENYFFVFLLVQAISFFIVGFGYIGTIVPS  532



>ref|XP_010543471.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Tarenaya 
hassleriana]
Length=533

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 165/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLF KM +EI+ NK V++WKK +VIYSFF+VRKI AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFMKMILEIITNKNVSLWKKCHVIYSFFVVRKIVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T++VPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVMVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL+   R NEW+VTEKLGDAI   +    P   +        F +R+   ELG  ++
Sbjct  438  TFIGLIGAGRVNEWIVTEKLGDAIKAKSASKAPRKPRFR------FGERMHVLELGVGMY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            LL  GVYD  +GKNHYY+YLF Q   F + G G +GT VP
Sbjct  492  LLLVGVYDLSFGKNHYYLYLFAQAFAFFVMGFGQVGTFVP  531



>gb|AES60635.2| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 166/223 (74%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KAFR+QQHRWSCGPANLFRKM +EIV NK+V++WKK+YV+YSFF VRKI AH+ TF F
Sbjct  308  TLKAFRYQQHRWSCGPANLFRKMVMEIVTNKKVSLWKKIYVVYSFFFVRKIVAHINTFVF  367

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T++VPEV VPKWGA+YIP I+T+LN+VGTPRS HLL +WILFEN MS HRTKA
Sbjct  368  YCIVLPATVMVPEVVVPKWGAVYIPSIITLLNAVGTPRSFHLLVFWILFENTMSLHRTKA  427

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            TIIGLLE  R NEW+VTEKLGDA     +       +        FR  DRI   EL   
Sbjct  428  TIIGLLEASRVNEWIVTEKLGDAFKGKASGKGLKKLR--------FRIGDRIHMLELVVG  479

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +LL CG YD +YGKNH++I+L++Q   F I   GY+GT VP+
Sbjct  480  FYLLLCGCYDLMYGKNHFFIFLYIQAFAFFIMAFGYVGTFVPN  522



>ref|XP_007203625.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
 gb|EMJ04824.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
Length=534

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 167/221 (76%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI+RNK+V++WKK++VIYSFF VRKI AH+  F F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVSLWKKIHVIYSFFFVRKIIAHINAFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+LVPEV VPKWG IYIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCIVLPATVLVPEVVVPKWGGIYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEW+VTEKLGDA+       K               +R+   EL    +
Sbjct  438  TIIGLLEASRVNEWIVTEKLGDALKTLTVAAKLPRKPRIRIG-----ERLHLLELAVGCY  492

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YDF +GKN+ +++L++Q + F I G GY+GT VP+
Sbjct  493  LFFCGTYDFAFGKNYVFLFLYIQAMAFYIIGFGYVGTFVPN  533



>ref|XP_009403735.1| PREDICTED: probable mannan synthase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=528

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 161/221 (73%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFR QQHRWSCGPANLFRKM +EI +NK+V++W KVYVIYSFF +RKI  H+VTF F
Sbjct  313  TFKAFRHQQHRWSCGPANLFRKMVVEISKNKKVSLWTKVYVIYSFFFIRKIVGHIVTFIF  372

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+ VPEV++P WG +Y+P ++T+LNSVGTPRS+HLL +W+LFENVMS HRTKA
Sbjct  373  YCLVIPATVFVPEVEIPMWGLVYLPSVITMLNSVGTPRSLHLLVFWVLFENVMSLHRTKA  432

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+ GLL+  R NEWVVTEKLGD +            +          DR+   EL    +
Sbjct  433  TLSGLLDLGRVNEWVVTEKLGDIMKTKLPTKAAKKPRVRIG------DRLHKMELFTGAY  486

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FC  YD  YGKNHY++YLFLQ ITF I G GY+GT +P 
Sbjct  487  LFFCACYDLKYGKNHYFLYLFLQSITFFIVGFGYVGTYIPQ  527



>emb|CDY10358.1| BnaCnng02590D [Brassica napus]
Length=532

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 166/221 (75%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V +WKKV+VIYSFF+VRKI AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKIVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP I+T+LN+VGTPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVVLPATVLVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGD    +  K               F DRI   ELG  ++
Sbjct  438  TFIGLLEGGRVNEWIVTEKLGDLKAKSATKAPKKLRFR-------FGDRIHVLELGVGMY  490

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L   G YD L+GKNHYY+YLF Q   F IAG G +GT+VP+
Sbjct  491  LFSIGCYDALFGKNHYYLYLFAQAFAFFIAGCGQIGTVVPN  531



>ref|XP_010038980.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
Length=533

 Score =   257 bits (657),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 166/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM  +I++NK+V+ WKK+YVIYSFF+VRKI AH+VTF F
Sbjct  318  TLKAYRYQQHRWSCGPANLFRKMVFDIIKNKKVSTWKKLYVIYSFFMVRKIVAHIVTFLF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+L PEV VPKW +IYIP I+T LN++ TPRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCIVLPATVLTPEVAVPKWASIYIPSIITALNALSTPRSLHLMVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEW+VTEKLGDA+ N    +     +        F +R    E+G  V+
Sbjct  438  TIIGLLEGNRVNEWIVTEKLGDALKNKAITSFAERTRLR------FTERFHFLEIGVGVY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L FCG YD  +GKNHY+++L++Q + F I G GY+G  VP 
Sbjct  492  LCFCGCYDVAFGKNHYFLFLYVQAVAFFIMGFGYVGIFVPK  532



>ref|XP_009603325.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   257 bits (656),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI  NK+V++WKK Y+IYSFF VRKI AH+VTF F
Sbjct  313  TFKAYRYQQHRWSCGPANLFRKMALEIAANKKVSMWKKCYLIYSFFFVRKIVAHIVTFVF  372

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P TIL+PEV VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRT+A
Sbjct  373  YCVVMPATILIPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRTRA  432

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL E  R NEWVVTEKLGDA+    +       +    +    R ++   E+   ++
Sbjct  433  TFIGLFEAGRVNEWVVTEKLGDALKTKMSSKASKKDRFRIGE----RYKLHFMEIFVGLY  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LLFCG YD+ +GKN +YIYLFLQ + F + G GY+G  VP+
Sbjct  489  LLFCGWYDYSFGKNRFYIYLFLQSMAFFVGGFGYIGVFVPN  529



>emb|CDO99850.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   255 bits (651),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 164/223 (74%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R QQHRWSCGPANLFRKM +EIVR K+V+ WKK Y+IYSFFLVRKI AHMVTF F
Sbjct  234  TFKAYRHQQHRWSCGPANLFRKMAMEIVRCKKVSPWKKFYLIYSFFLVRKIVAHMVTFIF  293

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP TI++PEV VP WGA+YIP ++T+LN+VGTPRS HL+ +WILFENVMS HRTKA
Sbjct  294  YCVVLPATIVIPEVQVPVWGAVYIPSVITLLNAVGTPRSFHLVIFWILFENVMSLHRTKA  353

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T IGLLE  R NEW+VTEKLG  +        P   +        FR  DR+   EL   
Sbjct  354  TFIGLLEAGRVNEWIVTEKLGHVLQTKLGSKVPKKPR--------FRMGDRLHLLELFVG  405

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG YD  +GK+H++IYLFLQ   F  AG GY+GT VPS
Sbjct  406  FYLFFCGCYDVAFGKSHFFIYLFLQSTAFFTAGFGYVGTFVPS  448



>ref|XP_006851749.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
 gb|ERN13216.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
Length=533

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 166/224 (74%), Gaps = 14/224 (6%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI RNKRV++WKK++VIY+FF VRKI AH+VTF F
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMAMEIFRNKRVSLWKKIHVIYNFFFVRKIVAHIVTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+LVPEV++PKWGA+YIP  +TILN++ +PRS+HL+ +WILFENVMS HRTKA
Sbjct  378  YCVVIPATVLVPEVEIPKWGAVYIPSTITILNALSSPRSLHLVVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQ----ELG  529
            T IGL E +R NEWVVTEKLGDA+                     F  RI  +    ELG
Sbjct  438  TFIGLAEARRVNEWVVTEKLGDALKGKAGGKSVKK----------FWIRIGGKLHLLELG  487

Query  530  FAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
               +L FC  YD  +GKNHY+IYL+LQ + F I G GY+GT VP
Sbjct  488  VGAYLFFCACYDLAFGKNHYFIYLYLQAMAFFIMGFGYIGTFVP  531



>ref|XP_009421122.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 161/220 (73%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T  A+R+QQHRWSCGPANLFRKM +EI +NK+V +W KV+VIYSFF VRKI AH+VTF F
Sbjct  318  TLTAYRYQQHRWSCGPANLFRKMVLEIAKNKKVTLWTKVHVIYSFFFVRKIVAHIVTFIF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+LVPEV VPKWG +YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCVVIPATVLVPEVQVPKWGLVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD +            +          +R+   EL    +
Sbjct  438  TFIGLLEAGRVNEWVVTEKLGDGMKTKAGAKAAKIPRIR------IGERLHLLELLTGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L+FCG YD  +GKN+YY+YLF Q + F I G GY+GT VP
Sbjct  492  LVFCGCYDLAFGKNYYYLYLFFQAVAFFIVGFGYVGTFVP  531



>ref|XP_008442792.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=532

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 166/223 (74%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EI +NK+V +WKKVYVIYSFF VRKI AH+  F F
Sbjct  318  TFKAFRFQQHRWSCGPANLFRKMVLEIAKNKKVTLWKKVYVIYSFFFVRKIIAHINNFLF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            +C+ LP T++VPEV +P+WG +YIP   TI+N++GTP+S HL  +WI+FENVMS HR KA
Sbjct  378  FCIALPATVVVPEVAIPRWGGVYIPTATTIINAIGTPKSFHLTIFWIMFENVMSLHRAKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGLLE  RANEWVVTEKLGD +                 KK +FR  +RI   ELG  
Sbjct  438  TLIGLLEGSRANEWVVTEKLGDIL--------KGKTASKATKKPMFRIGERIHITELGVG  489

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG Y+ LYG+N+++++L +Q I+F I G GY+GTIVPS
Sbjct  490  AYLFFCGCYNMLYGENYFFVFLLVQAISFFIVGFGYVGTIVPS  532



>ref|XP_009760346.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=530

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EI  NK+V++WKK Y+IYSFF VRKI AH+VTF F
Sbjct  313  TFKAYRYQQHRWSCGPANLFRKMALEIAANKKVSLWKKCYLIYSFFFVRKIVAHIVTFIF  372

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+L+PEV VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRT+A
Sbjct  373  YCVVMPATVLIPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRTRA  432

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL E  R NEW+VTEKLGDA+    +       +    +    R ++   E+   ++
Sbjct  433  TFIGLFEVGRVNEWIVTEKLGDALKTKMSSKASKKDRFRIGE----RYKLHFMEIFVGLY  488

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LL CG YD+ +GKN +YIYLFLQ + F +AG  Y+G  VP+
Sbjct  489  LLLCGWYDYSFGKNRFYIYLFLQSMAFFVAGFSYIGVFVPN  529



>gb|KGN63048.1| hypothetical protein Csa_2G386160 [Cucumis sativus]
Length=706

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 167/220 (76%), Gaps = 10/220 (5%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANL +KM IEI+RNK+V++WKK+Y+IYSFF VRKI AH+VTF F
Sbjct  268  TFKAYRYQQHRWSCGPANLLKKMVIEIMRNKKVSLWKKLYLIYSFFFVRKIVAHIVTFVF  327

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP T+LVPEV VPKWGA+YIP  +T+LN+VGTPRS HL+ +WILFENVMS HRTKA
Sbjct  328  YCVILPATVLVPEVSVPKWGAVYIPSTITLLNAVGTPRSFHLIIFWILFENVMSLHRTKA  387

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T IGLLE  R NEWVVTEKLGDA+        P   +        FR  +R+   EL   
Sbjct  388  TFIGLLEAGRVNEWVVTEKLGDALKTKLGSKAPRKPR--------FRMGERLHMLELCVG  439

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTI  655
             +L FCG YD  +GKN Y+IYLFLQ   F IAGVGY+GT+
Sbjct  440  GYLFFCGWYDLNFGKNGYFIYLFLQSFAFFIAGVGYVGTL  479



>ref|XP_010558212.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Tarenaya 
hassleriana]
Length=526

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 164/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI+ NK V+VWKKV+VIYSFF+VRKI AH+VTF F
Sbjct  311  TFKAYRYQQHRWSCGPANLFRKMLFEIITNKNVSVWKKVHVIYSFFVVRKIVAHIVTFIF  370

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+LVPEV VPKWGA+YIP I+T+LN++GTPRS+HLL +WI+FENVMS HRTKA
Sbjct  371  YCVVLPATVLVPEVTVPKWGAVYIPSIITLLNAIGTPRSLHLLVFWIMFENVMSLHRTKA  430

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLGDA+ +      P   +        F +RI   E+G  ++
Sbjct  431  TFIGLLEAGRVNEWIVTEKLGDALKSKVKSPHPKKPRFR------FGERIHVLEVGVGMY  484

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L   G  D + GKN YY+YLF Q   F + G G +GT VP
Sbjct  485  LFIVGCCDVMLGKNRYYLYLFGQSFAFFVMGFGLVGTFVP  524



>ref|XP_010911245.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Elaeis 
guineensis]
Length=294

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 167/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRW+CGPA LFRKMF EIV+ K+V++WKK++VIY+FFL R+I +H VTF F
Sbjct  78   TFKAYRYQQHRWACGPAVLFRKMFWEIVKAKKVSIWKKLHVIYNFFLARRIISHFVTFSF  137

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+PL++  PEV++PKWG IY+P  +T+LNSVGTP S HL+ +W+LFENVMS HR KA
Sbjct  138  YCVVIPLSVFFPEVEIPKWGMIYVPTTITLLNSVGTPSSFHLIIFWVLFENVMSLHRCKA  197

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
             +IGLLE  RANEW+VTEKLGD +   +N +     +        F DR    ELG AVF
Sbjct  198  VLIGLLEAGRANEWIVTEKLGDMLKTKSNISVTQKIRFK------FWDRFHLLELGLAVF  251

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L+ C  YD +Y +++++IY+F Q ITF I G GY+GTI+PS
Sbjct  252  LMICACYDCIYRQDYFFIYIFPQSITFFIMGFGYVGTIIPS  292



>ref|XP_010937165.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Elaeis 
guineensis]
Length=541

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 168/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLFRKM  +IV+ K+V++WKK YVIYSFFL R++ ++ VTFFF
Sbjct  325  TFKAYRFQQHRWSCGPANLFRKMLCDIVKAKKVSIWKKFYVIYSFFLARRVLSNFVTFFF  384

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+PL++  PEV +P+WG +YIP  +TILN+VGTP S HL+ +WILFENVMS HR KA
Sbjct  385  YCVVIPLSVFFPEVKIPRWGMVYIPSTITILNAVGTPSSFHLIIFWILFENVMSLHRCKA  444

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
             IIGLLE  RANEWVVTEKLGD +         +  K A K +S F +R+   ELG AV+
Sbjct  445  VIIGLLEAGRANEWVVTEKLGDLL------KTKSNIKVAKKYRSKFWERLHFLELGLAVY  498

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            L+ C  YD+ + K++Y++ LF Q + F I GVGY+GTI+PS
Sbjct  499  LMICACYDYYFRKDYYFVILFPQAMAFVIMGVGYIGTIIPS  539



>ref|XP_007145259.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
 gb|ESW17253.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
Length=523

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 169/223 (76%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKM +EI+RNK+V++WKK+YV+YSFF VRK+ AH+ TF F
Sbjct  308  TLKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVSLWKKIYVVYSFFFVRKVVAHLNTFVF  367

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T++VPEV VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFEN MS HRTKA
Sbjct  368  YCIVLPATVVVPEVAVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENTMSLHRTKA  427

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            TIIGLLE  R NEW+VTEKLGDA+            +        FR  DRI   EL   
Sbjct  428  TIIGLLEASRVNEWIVTEKLGDALKGKGGGKAAKKIR--------FRIGDRIHMLELLVG  479

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +L FCG YD ++GKN +YI+L++Q I F I   GY+GTIVP+
Sbjct  480  FYLFFCGCYDVMFGKNRFYIFLYIQSIAFFIMAFGYVGTIVPN  522



>ref|XP_008800552.1| PREDICTED: mannan synthase 1-like [Phoenix dactylifera]
Length=530

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 162/221 (73%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKMF EI   +RV++WKK +V+Y+FF VRKI AH VTFFF
Sbjct  315  TFKAYRYQQHRWSCGPANLFRKMFKEIANCERVSIWKKFHVLYAFFFVRKIVAHFVTFFF  374

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P  +LV ++ +PK+ A+YIP  +TILN++ TPRSIHLL +WILFENVMS HR KA
Sbjct  375  YCVVIPACVLVQDIPLPKFVAVYIPATITILNAISTPRSIHLLIFWILFENVMSMHRAKA  434

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  R NEWVVT+KLG A+    N  K    K          DRI   E+    F
Sbjct  435  TIIGLLEANRVNEWVVTDKLGSALKQKANTTKSKTKKRPQIG-----DRIHLLEIFMGSF  489

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LL+C +YD+ +G +H+YIYLFLQ   F IAG GY+GT VPS
Sbjct  490  LLYCAIYDYTFGHDHFYIYLFLQASAFFIAGFGYVGTFVPS  530



>ref|XP_002890585.1| hypothetical protein ARALYDRAFT_889889 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66844.1| hypothetical protein ARALYDRAFT_889889 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   250 bits (638),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 164/221 (74%), Gaps = 8/221 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANL+RKM +EI++NK+V+ WKK+Y+IY+FF +RKI  H+ TF F
Sbjct  341  TFKAYRFQQHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVF  400

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T+L PE+ VPKW  +Y P  +TILN++ TPRS+HLL +WILFENVMS HRTKA
Sbjct  401  YCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRSLHLLVFWILFENVMSMHRTKA  460

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD +         +      K  + F  RI  +EL   ++
Sbjct  461  TFIGLLEAGRVNEWVVTEKLGDTL--------KSKLIATTKLYTRFGQRINWRELVVGLY  512

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            + FCG YDF YG +++Y+YLFLQ   F +AGVGY+GT VPS
Sbjct  513  IFFCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVPS  553



>ref|XP_010521855.1| PREDICTED: probable mannan synthase 3 [Tarenaya hassleriana]
Length=564

 Score =   250 bits (639),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 167/221 (76%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLF+KM +EI+ NKRV++WKK+Y+IYSFF VRKI  H  TFFF
Sbjct  349  TFKAYRFQQHRWSCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIIVHTFTFFF  408

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV+LP ++L PE++VPKW  +Y+P  +T+LN+  TPRS+HLL  WILFENVM+ HRTKA
Sbjct  409  YCVILPTSVLFPEIEVPKWATVYVPATITLLNAAATPRSLHLLVCWILFENVMAMHRTKA  468

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL +  R NEWVVTEKLGD +     K K        K++S F +R+  +EL   ++
Sbjct  469  TFIGLFDAGRVNEWVVTEKLGDTL-----KAKLICDASPTKRRSRFGERMNWRELVAGLY  523

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            +  CG YD  +GK ++Y+YLFLQ I F +AGVGY+GTIVPS
Sbjct  524  IFLCGCYDVAFGKTYFYVYLFLQSIAFFVAGVGYVGTIVPS  564



>ref|NP_001031084.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AEE30393.1| putative mannan synthase 3 [Arabidopsis thaliana]
Length=484

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANL+RKM +EI++NK+V+ WKK+Y+IY+FF +RKI  H+ TF F
Sbjct  269  TFKAYRFQQHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVF  328

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T+L PE+ VPKW  +Y P  +TILN++ TPRS+HLL +WILFENVMS HRTKA
Sbjct  329  YCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRSLHLLVFWILFENVMSMHRTKA  388

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD +            K   K  + F  R+  +EL   ++
Sbjct  389  TFIGLLEAGRVNEWVVTEKLGDTL------KSKLIGKATTKLYTRFGQRLNWRELVVGLY  442

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            + FCG YDF YG +++Y+YLFLQ   F +AGVGY+GT VP+
Sbjct  443  IFFCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVPT  483



>ref|XP_010525611.1| PREDICTED: probable mannan synthase 3 isoform X3 [Tarenaya hassleriana]
Length=396

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 167/221 (76%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLF+KM +EI+ NKRV++WKK+Y+IYSFF VRKI  H+ TF F
Sbjct  182  TFKAYRFQQHRWSCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIVVHIFTFVF  241

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP ++   E+++PKW ++YIP  +T+LN+V TPRS+HLL +WILFENVMS HRTKA
Sbjct  242  YCLILPTSVFFSEIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILFENVMSMHRTKA  301

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLL+  R NEWVVTEKLGD +           +K   K++S F +RI  +EL   ++
Sbjct  302  TLIGLLDAGRVNEWVVTEKLGDTL------KMKLISKVPTKRRSEFGERIHWRELVAGLY  355

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            +  CG YDF +GK  +Y+YLFLQ + F +AG GY+GT VP 
Sbjct  356  IFLCGCYDFAFGKTFFYVYLFLQSVAFFVAGFGYVGTFVPG  396



>ref|XP_004239715.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
lycopersicum]
Length=526

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 165/226 (73%), Gaps = 13/226 (6%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM  EI  NK+V++WK+ Y+IYSFF VRKI AHMVTF F
Sbjct  308  TFKAYRYQQHRWSCGPANLFKKMVGEIASNKKVSIWKRFYLIYSFFFVRKIIAHMVTFIF  367

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P T+L+PEV VP WGA+YIP  +T+LN+VGTPRS +LL +WILFENVMS HRT+A
Sbjct  368  YCVIIPTTVLIPEVQVPIWGAVYIPSTITLLNAVGTPRSFYLLIFWILFENVMSLHRTRA  427

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR-----DRILPQEL  526
            T IGL E  R NEWVVTEKLGD I                 ++S FR     +++   E+
Sbjct  428  TFIGLFEVGRVNEWVVTEKLGDGI--------KAKTSTKGSRRSRFRIGEWYNKVHFVEV  479

Query  527  GFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
               ++L+ CG YD+ +GKN +YIYLFLQ + F +AG GY+G  VP+
Sbjct  480  FVGLYLMLCGWYDYSFGKNRFYIYLFLQGVAFLVAGFGYIGVFVPN  525



>ref|XP_006345855.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=486

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 165/226 (73%), Gaps = 13/226 (6%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLF+KM  EI  NK+V++WKK Y+IYSFF VRKI AH+VTF F
Sbjct  268  TFKAYRYQQHRWSCGPANLFKKMVGEIASNKKVSIWKKFYLIYSFFFVRKIIAHIVTFIF  327

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCV++P T+L+PEV VP WGA+YIP  +T+LN+VGTPRS +LL +WILFENVMS HRT+A
Sbjct  328  YCVIMPTTVLIPEVQVPIWGAVYIPSTITLLNAVGTPRSFYLLIFWILFENVMSLHRTRA  387

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR-----DRILPQEL  526
            T IGL E  + NEWVVTEKLGD I                 KKS FR     +++   E+
Sbjct  388  TFIGLFEVGKVNEWVVTEKLGDGI--------KAKTSMKVSKKSRFRIGEWYNKVHFAEV  439

Query  527  GFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
               ++L+ CG YD+ +GKN +YIYLFLQ + F +AG GY+G  VP+
Sbjct  440  FVGLYLMLCGWYDYSFGKNRFYIYLFLQGMAFLVAGFGYIGVFVPN  485



>ref|XP_008232088.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Prunus 
mume]
Length=477

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 162/221 (73%), Gaps = 11/221 (5%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R QQHRWSCGPANLFRKM +EIVRNK+V+  KK +VIYSFF VRKI AH+VTF F
Sbjct  267  TFKAYRSQQHRWSCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKIVAHIVTFVF  326

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            Y V+LP T+LVPEV VP WGA+YIP  +T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  327  YSVILPATVLVPEVHVPMWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKA  386

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGL E  R NEWVVTEKLGD++  +  K +               +R+   EL    +
Sbjct  387  TFIGLFEAGRVNEWVVTEKLGDSLKKDPRKPRLRIG-----------ERLHMLELIVGFY  435

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            + FCG YD  + KN Y+IYLF+Q + F IAG GY+GT VP+
Sbjct  436  VFFCGCYDLAFVKNGYFIYLFIQSVAFFIAGFGYVGTFVPN  476



>emb|CDY04707.1| BnaC05g18820D [Brassica napus]
Length=555

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 165/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANL+RKM IEI++NK+V+ WKK+Y+IY+FF +RKI  H+ TF F
Sbjct  340  TFKAYRFQQHRWSCGPANLWRKMTIEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVF  399

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T++ PE+ VPKW  +Y+P  +T+LN++ TPRS+HLL +WILFENVMS HRTKA
Sbjct  400  YCLILPATVMFPELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILFENVMSMHRTKA  459

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD +           AK   K  + F  RI  +EL   ++
Sbjct  460  TFIGLLEAGRVNEWVVTEKLGDTL------KSKLIAKATTKLYTRFGQRINWRELVVGLY  513

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            +  CG YDF YG +++Y+YLFLQ   F +AGVGY+GTIVP
Sbjct  514  IFICGCYDFAYGGSYFYVYLFLQACAFFVAGVGYIGTIVP  553



>emb|CDY44151.1| BnaA09g31010D [Brassica napus]
Length=555

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 165/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANL+RKM +EI++NK+V+ WKK+Y+IY+FF +RKI  H+ TF F
Sbjct  340  TFKAYRFQQHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVF  399

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T+L PE+ VPKW  +Y+P  +T+LN++ TPRS+HLL +WILFENVMS HRTKA
Sbjct  400  YCLILPATVLFPELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILFENVMSMHRTKA  459

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD +           AK   K  + F  RI  +EL   ++
Sbjct  460  TFIGLLEAGRVNEWVVTEKLGDTL------KSKLIAKATTKLYTRFGQRINWRELVVGLY  513

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            +  CG YDF YG +++Y+YLFLQ   F +AGVGY+GTIVP
Sbjct  514  IFICGCYDFAYGGSYFYVYLFLQACAFFVAGVGYIGTIVP  553



>ref|XP_009115523.1| PREDICTED: probable mannan synthase 3 [Brassica rapa]
 ref|XP_009115524.1| PREDICTED: probable mannan synthase 3 [Brassica rapa]
Length=555

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 164/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANL+RKM +EI++NK+V+ WKK+Y+IY+FF +RKI  H+ TF F
Sbjct  340  TFKAYRFQQHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVF  399

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T+L PE+ VPKW  +Y+P  +T+LN++ TPRS+HLL +WILFENVMS HRTKA
Sbjct  400  YCLILPATVLFPELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILFENVMSMHRTKA  459

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD +            K   K  + F  RI  +EL   ++
Sbjct  460  TFIGLLEAGRVNEWVVTEKLGDTL------KSKLITKATTKLYTRFGQRINWRELVVGLY  513

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            +  CG YDF YG +++Y+YLFLQ   F +AGVGY+GTIVP
Sbjct  514  IFICGCYDFAYGGSYFYVYLFLQACAFFVAGVGYIGTIVP  553



>ref|XP_006430317.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
 gb|ESR43557.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
Length=533

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 165/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V++WKKV+VIYSFF VRKI AH++TF  
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSLWKKVHVIYSFFFVRKIIAHIITFVL  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+++PEV VPKW A+YIP ++TILN+VGTPRSIHLL +WILFENVMS HRT A
Sbjct  378  YCVVLPATVVIPEVQVPKWAAVYIPTVITILNAVGTPRSIHLLVFWILFENVMSLHRTMA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLG A+        P   +        F DRI   ELG   F
Sbjct  438  TFIGLLEGVRVNEWIVTEKLGGALKAKAAAKAPRLRRF------FFGDRIYLLELGVGAF  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L  CG YD L+G NHY+IYLF+Q + F + G GY+G  VP
Sbjct  492  LFSCGCYDVLFGNNHYFIYLFVQALAFFVMGFGYVGIYVP  531



>ref|XP_006416081.1| hypothetical protein EUTSA_v10007266mg [Eutrema salsugineum]
 gb|ESQ34434.1| hypothetical protein EUTSA_v10007266mg [Eutrema salsugineum]
Length=555

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 165/221 (75%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANL+RKM +EI++NK+V+ WKK+Y+IY+FF +RKI  H+ TF F
Sbjct  340  TFKAYRFQQHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVF  399

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP  +L PE+ VPKW  +Y+P  +TILN++ TPRS+HLL +WILFENVMS HRTKA
Sbjct  400  YCLILPTIVLFPELQVPKWATVYVPTTITILNALATPRSLHLLVFWILFENVMSMHRTKA  459

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD +           AK   K  + F  RI  +EL   ++
Sbjct  460  TFIGLLEAGRVNEWVVTEKLGDTL------RSKLIAKATTKLYTRFGQRINWRELVVGLY  513

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            +  CG YDF YG +++Y+YLFLQ   F +AGVGY+GTIVP+
Sbjct  514  IFLCGCYDFAYGGSYFYVYLFLQACAFFVAGVGYIGTIVPT  554



>ref|XP_009793132.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X3 [Nicotiana sylvestris]
Length=494

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 162/223 (73%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI  NK+V+VWKK Y+IYSFF VRKI AH+VTF  
Sbjct  279  TFKAYRYQQHRWSCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFFFVRKIIAHIVTFVL  338

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+ VPEV VPKWGAIYIP  +TILN +G+PRS++L+ YWILFENVMS HRTKA
Sbjct  339  YCVVMPATVFVPEVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYWILFENVMSLHRTKA  398

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T +GL E  R NEW+VTEKLGDA+    +       +        FR  +R+   EL   
Sbjct  399  TFVGLFESGRVNEWIVTEKLGDALKTKVSSKTSRKLR--------FRVGERVHLLELFVG  450

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            ++L FCG YDF +GK+ +++YLFLQ   F + G GY+G  VP+
Sbjct  451  LYLWFCGWYDFSFGKSRFHVYLFLQAAAFFVVGFGYVGVFVPN  493



>gb|EMS67675.1| hypothetical protein TRIUR3_27071 [Triticum urartu]
Length=522

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 159/219 (73%), Gaps = 6/219 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFR+QQHRWSCGPANLFRKM +EI+ NK+V +WKK++V+Y+FF +RK+ AH+VTF F
Sbjct  308  TFKAFRYQQHRWSCGPANLFRKMVMEIITNKKVTLWKKIHVVYNFFFLRKVVAHIVTFVF  367

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P T+LVPEV+VPKWG +YIP I+T+L+ VGTPRS+HL+ +W LFENVMS HR KA
Sbjct  368  YCLVIPATVLVPEVEVPKWGCVYIPAIITLLSVVGTPRSVHLVIFWALFENVMSLHRAKA  427

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE    NEWVVTEKLGD +            +          +R+   ELG A +
Sbjct  428  TFIGLLEAHTVNEWVVTEKLGDTVKTKMPSKALKKLRMG------IGERLHLWELGVAAY  481

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIV  658
            L  CG Y   +G NHY+I+L +Q I F I GVGY+GT V
Sbjct  482  LFICGCYSISFGNNHYFIFLLMQSIAFFIVGVGYVGTFV  520



>ref|XP_010935702.1| PREDICTED: mannan synthase 1-like isoform X1 [Elaeis guineensis]
Length=528

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 164/220 (75%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLFRKMF EI   +RV++WKK++V+Y+FF VRKI AH VTFFF
Sbjct  313  TFKAYRFQQHRWSCGPANLFRKMFKEIAYCERVSIWKKIHVLYAFFFVRKIVAHFVTFFF  372

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P  +LV ++ +PK+ A+YIP I+T+LN V TPRS+HLL +WILFENVMS HR KA
Sbjct  373  YCIVIPACVLVQDIPLPKFVAVYIPAIITVLNCVTTPRSMHLLIFWILFENVMSMHRVKA  432

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            TIIGLLE  RANEWVVT+KLG+A+    N +K    K        F DRI   E+    F
Sbjct  433  TIIGLLEANRANEWVVTDKLGNALKQKANTSKSRTKKRFQ-----FGDRIHLMEIFMGSF  487

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            LL+CG+YD+ +G + +Y+YL  Q   F IAG GY+GT VP
Sbjct  488  LLYCGIYDYTFGNDLFYVYLLFQASAFFIAGFGYVGTFVP  527



>ref|NP_850952.1| putative mannan synthase 3 [Arabidopsis thaliana]
 ref|NP_173762.4| putative mannan synthase 3 [Arabidopsis thaliana]
 sp|Q9LQC9.1|CSLA3_ARATH RecName: Full=Probable mannan synthase 3; AltName: Full=Cellulose 
synthase-like protein A3; Short=AtCslA3 [Arabidopsis thaliana]
 gb|AAF79586.1|AC007945_6 F28C11.11 [Arabidopsis thaliana]
 gb|AAM20620.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15522.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30391.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AEE30392.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AHL38929.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=556

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANL+RKM +EI++NK+V+ WKK+Y+IY+FF +RKI  H+ TF F
Sbjct  341  TFKAYRFQQHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVF  400

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T+L PE+ VPKW  +Y P  +TILN++ TPRS+HLL +WILFENVMS HRTKA
Sbjct  401  YCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRSLHLLVFWILFENVMSMHRTKA  460

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD +            K   K  + F  R+  +EL   ++
Sbjct  461  TFIGLLEAGRVNEWVVTEKLGDTL------KSKLIGKATTKLYTRFGQRLNWRELVVGLY  514

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            + FCG YDF YG +++Y+YLFLQ   F +AGVGY+GT VP+
Sbjct  515  IFFCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVPT  555



>ref|XP_009793131.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Nicotiana sylvestris]
Length=531

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 162/223 (73%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI  NK+V+VWKK Y+IYSFF VRKI AH+VTF  
Sbjct  316  TFKAYRYQQHRWSCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFFFVRKIIAHIVTFVL  375

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+ VPEV VPKWGAIYIP  +TILN +G+PRS++L+ YWILFENVMS HRTKA
Sbjct  376  YCVVMPATVFVPEVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYWILFENVMSLHRTKA  435

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T +GL E  R NEW+VTEKLGDA+    +       +        FR  +R+   EL   
Sbjct  436  TFVGLFESGRVNEWIVTEKLGDALKTKVSSKTSRKLR--------FRVGERVHLLELFVG  487

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            ++L FCG YDF +GK+ +++YLFLQ   F + G GY+G  VP+
Sbjct  488  LYLWFCGWYDFSFGKSRFHVYLFLQAAAFFVVGFGYVGVFVPN  530



>ref|XP_006481909.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=533

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 165/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM +EIVRNK+V++WKKV+VIYSFF VRKI AH++TF  
Sbjct  318  TFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSLWKKVHVIYSFFFVRKIIAHIITFVL  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLP T+++PEV VPKW A+YIP ++T+LN+VGTPRSIHLL +WILFENVMS HRT A
Sbjct  378  YCVVLPATVVIPEVQVPKWAAVYIPTVITMLNAVGTPRSIHLLVFWILFENVMSLHRTMA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEW+VTEKLG A+        P   +        F DRI   ELG   F
Sbjct  438  TFIGLLEGVRVNEWIVTEKLGGALKAKAAAKAPRIRRF------FFGDRIYLLELGVGAF  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            L  CG YD L+G NHY+IYLF+Q + F + G GY+G  VP
Sbjct  492  LFSCGCYDVLFGNNHYFIYLFVQALAFFVMGFGYVGIYVP  531



>emb|CDX88785.1| BnaA03g08640D [Brassica napus]
Length=510

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 164/227 (72%), Gaps = 40/227 (18%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRK+ AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKVIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TII----GLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQE  523
            T+I    GL +F R                                  IF+  DR+   E
Sbjct  438  TLIGNTKGLKKFPR----------------------------------IFKLPDRLNTLE  463

Query  524  LGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LGFA FL  CG YDF++GKN+Y+IYLFLQ ++F I+G+G++GT VPS
Sbjct  464  LGFAAFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  510



>emb|CDX71011.1| BnaC03g10950D [Brassica napus]
Length=510

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 164/227 (72%), Gaps = 40/227 (18%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EIVRNK+V  WKKVYVIYSFF VRK+ AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKVIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+TILNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TII----GLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQE  523
            T+I    GL +F R                                  IF+  DR+   E
Sbjct  438  TLIGNTKGLKKFPR----------------------------------IFKLPDRLNTLE  463

Query  524  LGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LGFA FL  CG YDF++GKN+Y+IYLFLQ ++F I+G+G++GT VPS
Sbjct  464  LGFAAFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  510



>ref|XP_001764061.1| cellulose synthase-like A1, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
 gb|ABD79099.1| cellulose synthase-like A1 [Physcomitrella patens]
 gb|EDQ71200.1| cellulose synthase-like A1, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
Length=538

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 165/226 (73%), Gaps = 6/226 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRK+   I++N+ + +WK++++IY+FF VRKI AH+VTF F
Sbjct  310  TFKAFRFQQHRWSCGPANLFRKVLFTILKNQNLRLWKRLHMIYAFFFVRKIVAHIVTFTF  369

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P ++LVPEVD+P WGA+Y+P I+T+LN++ TP+S+HLL +WILFENVMS HRTKA
Sbjct  370  YCVVIPASVLVPEVDLPFWGAVYVPSIITLLNAITTPKSLHLLVFWILFENVMSLHRTKA  429

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR-----DRILPQEL  526
            TIIGL +    NEWVVTEKLG+ +   + K              + R     +R+   EL
Sbjct  430  TIIGLFDIGNVNEWVVTEKLGNLMKYRSAKYGKKYTLQRMASNMLARGWKMSERLHILEL  489

Query  527  GFAVFLLFCGVYDFLY-GKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
                FL+FC VYDF + GKNH+Y+YLFLQ   F I G GY+GT VP
Sbjct  490  WTGGFLMFCAVYDFYFQGKNHFYVYLFLQSCAFLIMGFGYVGTFVP  535



>ref|XP_004497598.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=523

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 168/223 (75%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            T KA+R+QQHRWSCGPANLFRKMF EIV NK+V+ WKK+YV+YSFF VRKI AH+ TF F
Sbjct  308  TLKAYRYQQHRWSCGPANLFRKMFREIVTNKKVSFWKKIYVVYSFFFVRKIVAHINTFVF  367

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T++VPEV VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFEN MS HRTKA
Sbjct  368  YCIVLPATVVVPEVVVPKWGAVYIPSIITLLNAVGTPRSLHLLLFWILFENTMSLHRTKA  427

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            TIIGLLE  R NEWVVTEKLGDA+            +        FR  DRI   EL   
Sbjct  428  TIIGLLEASRVNEWVVTEKLGDALKGKVGGKGLKTFR--------FRIVDRIHMLELLVG  479

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             +LLFCG YD +YGKNH++I+L++Q + F I   GY+GT +P+
Sbjct  480  FYLLFCGCYDLMYGKNHFFIFLYIQALAFFIMAFGYVGTFIPN  522



>ref|XP_009603536.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Nicotiana tomentosiformis]
Length=494

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 160/223 (72%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI  NK+V+VWKK Y+IYSFF VRKI AH+VTF  
Sbjct  279  TFKAYRYQQHRWSCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFFFVRKIIAHVVTFVL  338

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+ VPEV VPKWGAIYIP  +T+LN +G+ RS++L+ YWILFENVMS HRTKA
Sbjct  339  YCVVMPATVFVPEVQVPKWGAIYIPSAITLLNVLGSTRSMYLVVYWILFENVMSLHRTKA  398

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T +GL E  R NEW+VTEKLGDA+            +        FR  +R+   EL   
Sbjct  399  TFVGLFESGRVNEWIVTEKLGDALKTKMGSKASRKLR--------FRVGERVHVLELFVG  450

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            + LLFCG YDF +GK+ +Y+YLFLQ   F + G GY+G  VP+
Sbjct  451  LHLLFCGWYDFSFGKSRFYVYLFLQAAAFFVVGFGYIGVFVPN  493



>ref|XP_010683891.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Beta vulgaris 
subsp. vulgaris]
Length=533

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 158/200 (79%), Gaps = 6/200 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLFRKM  EI+RN++V++WKKV+VIYSFF +RK+ AH+VTF F
Sbjct  318  TFKAYRFQQHRWSCGPANLFRKMVSEIIRNEKVSLWKKVHVIYSFFTIRKVIAHVVTFAF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+VLP T+L PEV VPKWGA+YIP I+T+LN+VGTPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCIVLPATVLAPEVVVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGL+E  R NEWVVTEKLGDA+   +        +        F +R+   ELG   +
Sbjct  438  TLIGLMEGVRVNEWVVTEKLGDALKFKSAAKGSKKPRFR------FGERLHILELGVGAY  491

Query  542  LLFCGVYDFLYGKNHYYIYL  601
            LLFCG Y+ L+GKNH++IYL
Sbjct  492  LLFCGWYNLLFGKNHFFIYL  511



>ref|XP_009793130.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana sylvestris]
Length=553

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 162/223 (73%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI  NK+V+VWKK Y+IYSFF VRKI AH+VTF  
Sbjct  338  TFKAYRYQQHRWSCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFFFVRKIIAHIVTFVL  397

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+ VPEV VPKWGAIYIP  +TILN +G+PRS++L+ YWILFENVMS HRTKA
Sbjct  398  YCVVMPATVFVPEVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYWILFENVMSLHRTKA  457

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T +GL E  R NEW+VTEKLGDA+    +       +        FR  +R+   EL   
Sbjct  458  TFVGLFESGRVNEWIVTEKLGDALKTKVSSKTSRKLR--------FRVGERVHLLELFVG  509

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            ++L FCG YDF +GK+ +++YLFLQ   F + G GY+G  VP+
Sbjct  510  LYLWFCGWYDFSFGKSRFHVYLFLQAAAFFVVGFGYVGVFVPN  552



>ref|XP_010525610.1| PREDICTED: probable mannan synthase 3 isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 167/220 (76%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLF+KM +EI+ NKRV++WKK+Y+IYSFF VRKI  H+ TF F
Sbjct  318  TFKAYRFQQHRWSCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIVVHIFTFVF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP ++   E+++PKW ++YIP  +T+LN+V TPRS+HLL +WILFENVMS HRTKA
Sbjct  378  YCLILPTSVFFSEIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILFENVMSMHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLL+  R NEWVVTEKLGD +           +K   K++S F +RI  +EL   ++
Sbjct  438  TLIGLLDAGRVNEWVVTEKLGDTL------KMKLISKVPTKRRSEFGERIHWRELVAGLY  491

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            +  CG YDF +GK  +Y+YLFLQ + F +AG GY+GT VP
Sbjct  492  IFLCGCYDFAFGKTFFYVYLFLQSVAFFVAGFGYVGTFVP  531



>gb|EMT23763.1| hypothetical protein F775_17087 [Aegilops tauschii]
Length=819

 Score =   251 bits (641),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 164/213 (77%), Gaps = 9/213 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRKM +EIV NK+V +WKK +VIY+FFLVRKI AH+VTF F
Sbjct  365  TFKAFRFQQHRWSCGPANLFRKMLVEIVTNKKVTIWKKFHVIYNFFLVRKIVAHIVTFTF  424

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+++P TI VPEV +PKWG +YIP I+T+LNSVGTPRS HLLF+WILFENVMS HRTKA
Sbjct  425  YCIIIPTTIFVPEVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKA  484

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGLLE  RANEWVVTEKLG A+       K  +A  A  +KS  R  +R+   ELG  
Sbjct  485  TLIGLLEAGRANEWVVTEKLGSAM-------KMKSANKASARKSFMRMWERLNVPELGVG  537

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAG  634
             FL  CG YD  +GK++++IYLF Q + F + G
Sbjct  538  AFLFSCGWYDVAFGKDNFFIYLFFQSMAFFVVG  570



>ref|XP_009603535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana tomentosiformis]
Length=531

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 160/223 (72%), Gaps = 10/223 (4%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+R+QQHRWSCGPANLFRKM  EI  NK+V+VWKK Y+IYSFF VRKI AH+VTF  
Sbjct  316  TFKAYRYQQHRWSCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFFFVRKIIAHVVTFVL  375

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVV+P T+ VPEV VPKWGAIYIP  +T+LN +G+ RS++L+ YWILFENVMS HRTKA
Sbjct  376  YCVVMPATVFVPEVQVPKWGAIYIPSAITLLNVLGSTRSMYLVVYWILFENVMSLHRTKA  435

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T +GL E  R NEW+VTEKLGDA+            +        FR  +R+   EL   
Sbjct  436  TFVGLFESGRVNEWIVTEKLGDALKTKMGSKASRKLR--------FRVGERVHVLELFVG  487

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            + LLFCG YDF +GK+ +Y+YLFLQ   F + G GY+G  VP+
Sbjct  488  LHLLFCGWYDFSFGKSRFYVYLFLQAAAFFVVGFGYIGVFVPN  530



>ref|XP_010525608.1| PREDICTED: probable mannan synthase 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010525609.1| PREDICTED: probable mannan synthase 3 isoform X1 [Tarenaya hassleriana]
Length=546

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 167/220 (76%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANLF+KM +EI+ NKRV++WKK+Y+IYSFF VRKI  H+ TF F
Sbjct  332  TFKAYRFQQHRWSCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIVVHIFTFVF  391

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP ++   E+++PKW ++YIP  +T+LN+V TPRS+HLL +WILFENVMS HRTKA
Sbjct  392  YCLILPTSVFFSEIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILFENVMSMHRTKA  451

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T+IGLL+  R NEWVVTEKLGD +           +K   K++S F +RI  +EL   ++
Sbjct  452  TLIGLLDAGRVNEWVVTEKLGDTL------KMKLISKVPTKRRSEFGERIHWRELVAGLY  505

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVP  661
            +  CG YDF +GK  +Y+YLFLQ + F +AG GY+GT VP
Sbjct  506  IFLCGCYDFAFGKTFFYVYLFLQSVAFFVAGFGYVGTFVP  545



>emb|CDY35710.1| BnaC02g09760D [Brassica napus]
Length=511

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 163/223 (73%), Gaps = 31/223 (14%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRK+ AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKVIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+T+LNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGSVYIPSIITVLNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQELGFA  535
            T+IGL                               K   K   IF+  DR+   ELGFA
Sbjct  438  TLIGL-----------------------------NTKGLKKFPRIFKLPDRLNTLELGFA  468

Query  536  VFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
             FL  CG YD+++GKN+Y+IYLFLQ ++F I+G+G++GT VPS
Sbjct  469  AFLFVCGCYDYVHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  511



>ref|XP_006307154.1| hypothetical protein CARUB_v10008745mg [Capsella rubella]
 gb|EOA40052.1| hypothetical protein CARUB_v10008745mg [Capsella rubella]
Length=555

 Score =   245 bits (625),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 163/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKA+RFQQHRWSCGPANL+RKM +EI++NK+V+ WKK+Y+IY+FF +RKI  H+ TF F
Sbjct  340  TFKAYRFQQHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVF  399

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC++LP T+L PE+ VPKW  +Y P  +TILN++ TPRS HLL +WILFENVMS HRTKA
Sbjct  400  YCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRSFHLLVFWILFENVMSMHRTKA  459

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFRDRILPQELGFAVF  541
            T IGLLE  R NEWVVTEKLGD +           AK   K  + F  R+  +EL   ++
Sbjct  460  TFIGLLEAGRVNEWVVTEKLGDTL------KSKLIAKATTKLYTRFGQRLNWRELVVGLY  513

Query  542  LLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            +  CG YDF YG +++Y+YLFLQ   F +AGVGY+GT VP+
Sbjct  514  IFLCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVPT  554



>ref|XP_001759209.1| cellulose synthase-like A3, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
 gb|EDQ75893.1| cellulose synthase-like A3, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
Length=538

 Score =   244 bits (624),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 166/227 (73%), Gaps = 6/227 (3%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TFKAFRFQQHRWSCGPANLFRK+   I++N+++ +WK++++IY+FF VRKI AH+VTF F
Sbjct  310  TFKAFRFQQHRWSCGPANLFRKVLPSILKNQKLKLWKRLHMIYAFFFVRKIVAHIVTFTF  369

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YC+V+P ++LVPEVD+P WGA+Y+P I+T+LN++ TP+S+HLL +WILFENVMS HRTKA
Sbjct  370  YCLVIPASVLVPEVDLPFWGAVYVPSIITLLNAITTPKSLHLLVFWILFENVMSLHRTKA  429

Query  362  TIIGLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR-----DRILPQEL  526
            TIIGL +    NEWVVTEKLG+ +   + K              + R     +R+   EL
Sbjct  430  TIIGLFDIGNVNEWVVTEKLGNLMKYRSAKYGKKYTLQRMASNVLARGWRMSERMHILEL  489

Query  527  GFAVFLLFCGVYDFLY-GKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
                FL+FC  YDF + GKNH+Y+YLFLQ   F I G+GY+GT VP 
Sbjct  490  WTGGFLMFCAAYDFYFQGKNHFYVYLFLQSFAFIIMGLGYVGTFVPQ  536



>emb|CDY09164.1| BnaA02g05900D [Brassica napus]
Length=510

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 163/227 (72%), Gaps = 40/227 (18%)
 Frame = +2

Query  2    TFKAFRFQQHRWSCGPANLFRKMFIEIvrnkrvnvwkkvyvIYSFFLVRKITAHMVTFFF  181
            TF+AFRFQQHRWSCGPANLFRKM +EI+RNK+V  WKKVYVIYSFF VRK+ AH VTF F
Sbjct  318  TFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKVIAHWVTFCF  377

Query  182  YCVVLPLTILVPEVDVPKWGAIYIPCIVTILNSVGTPRSIHLLFYWILFENVMSFHRTKA  361
            YCVVLPLTILVPEV VP WG++YIP I+T+LNSVGTPRSIHLLFYWILFENVMS HRTKA
Sbjct  378  YCVVLPLTILVPEVKVPIWGSVYIPSIITVLNSVGTPRSIHLLFYWILFENVMSLHRTKA  437

Query  362  TII----GLLEFKRANEWVVTEKLGDAInnnnnknkpnaakpapkkkSIFR--DRILPQE  523
            T+I    GL +F R                                  IF+  DR+   E
Sbjct  438  TLIGNTKGLKKFPR----------------------------------IFKLPDRLNTLE  463

Query  524  LGFAVFLLFCGVYDFLYGKNHYYIYLFLQVITFTIAGVGYLGTIVPS  664
            LGFA FL  CG YD+ +GKN+Y+IYLFLQ ++F I+G+G++GT VPS
Sbjct  464  LGFAAFLFVCGCYDYAHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  510



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1725262341894