BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8209_g2_i1 len=364 path=[2587:0-2 419:3-26 443:27-363]

Length=364
                                                                      Score     E

gb|AAB07724.1|  Pn47p                                                   174   6e-50   Ipomoea nil [qian niu]
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           124   4e-31   
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              124   5e-31   
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           123   7e-31   
emb|CDO96757.1|  unnamed protein product                                123   8e-31   
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           123   9e-31   
emb|CDO96758.1|  unnamed protein product                                123   1e-30   
gb|ABQ95989.1|  phospholipase A1                                        122   3e-30   Capsicum annuum
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    121   3e-30   
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           121   3e-30   
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           121   3e-30   
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           121   4e-30   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             121   5e-30   
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                120   7e-30   
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           120   7e-30   
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           120   9e-30   
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           120   1e-29   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           120   1e-29   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           119   2e-29   
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           119   3e-29   
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           119   3e-29   
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           119   3e-29   
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           118   4e-29   
gb|AFK35349.1|  unknown                                                 116   4e-29   
gb|KHN18919.1|  Phospholipase A1-IIgamma                                118   5e-29   
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           118   5e-29   
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   118   5e-29   
gb|KHN08451.1|  Phospholipase A1-IIgamma                                118   5e-29   
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             118   8e-29   
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           118   8e-29   
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              117   1e-28   
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           117   1e-28   
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           116   2e-28   
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           116   2e-28   
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              116   3e-28   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              116   3e-28   
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg                115   5e-28   
ref|XP_002316835.2|  lipase class 3 family protein                      115   5e-28   Populus trichocarpa [western balsam poplar]
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              115   6e-28   
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           114   1e-27   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           114   1e-27   
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           114   1e-27   
ref|XP_002305750.2|  lipase class 3 family protein                      114   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              114   1e-27   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           114   2e-27   
ref|XP_002522554.1|  triacylglycerol lipase, putative                   114   2e-27   Ricinus communis
gb|EPS68357.1|  hypothetical protein M569_06414                         110   3e-27   
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     113   3e-27   
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           113   3e-27   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           112   4e-27   
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like           112   5e-27   
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   112   8e-27   
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           112   1e-26   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           111   2e-26   
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           111   2e-26   
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           111   2e-26   
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                111   2e-26   
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              111   2e-26   
gb|EPS70940.1|  hypothetical protein M569_03817                         110   2e-26   
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              110   3e-26   
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    110   3e-26   
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    110   3e-26   
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    110   3e-26   
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                110   5e-26   
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         110   5e-26   
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    109   6e-26   
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           109   7e-26   
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    109   7e-26   
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           109   8e-26   
emb|CBI21954.3|  unnamed protein product                                108   1e-25   
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like           108   1e-25   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           108   1e-25   
emb|CDP11819.1|  unnamed protein product                                108   1e-25   
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            108   2e-25   
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420          108   2e-25   Sorghum bicolor [broomcorn]
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     108   2e-25   Vitis vinifera
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           108   2e-25   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                108   3e-25   
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like              108   3e-25   
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor     107   3e-25   Zea mays [maize]
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810          107   3e-25   Sorghum bicolor [broomcorn]
ref|XP_011100290.1|  PREDICTED: phospholipase A1-IIgamma-like           107   3e-25   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   107   4e-25   
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like              107   5e-25   
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like              107   6e-25   
gb|EMT21704.1|  Putative lipase                                         107   6e-25   
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           107   6e-25   
ref|XP_006362439.1|  PREDICTED: phospholipase A1-IIgamma-like           107   7e-25   
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202              107   7e-25   
ref|XP_003593747.1|  Lipase                                             106   9e-25   
gb|EMT05578.1|  hypothetical protein F775_13080                         106   1e-24   
ref|XP_004232958.1|  PREDICTED: phospholipase A1-II 1-like              106   1e-24   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   105   1e-24   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like           105   1e-24   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          105   2e-24   
ref|XP_006655614.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    105   2e-24   
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma                105   3e-24   
ref|XP_002525127.1|  triacylglycerol lipase, putative                   104   4e-24   Ricinus communis
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...    104   4e-24   
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                104   5e-24   
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like           104   5e-24   
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma                104   8e-24   
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640          103   1e-23   Sorghum bicolor [broomcorn]
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg             103   1e-23   
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             103   1e-23   
ref|XP_004232955.1|  PREDICTED: phospholipase A1-II 1-like isofor...    103   2e-23   
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like              103   2e-23   
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like              103   2e-23   
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       103   2e-23   
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    102   2e-23   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           103   2e-23   
ref|NP_001151242.1|  triacylglycerol lipase                             102   2e-23   Zea mays [maize]
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1       102   2e-23   
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like              102   2e-23   
dbj|BAJ90094.1|  predicted protein                                      102   2e-23   
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   102   3e-23   
gb|EYU17473.1|  hypothetical protein MIMGU_mgv1a008748mg                101   4e-23   
dbj|BAJ95995.1|  predicted protein                                      102   4e-23   
ref|XP_010316799.1|  PREDICTED: phospholipase A1-II 1-like isofor...    102   4e-23   
gb|EMS51987.1|  Phospholipase A1-II 3                                   102   4e-23   
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              101   6e-23   
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              101   7e-23   
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              101   7e-23   
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like              101   8e-23   
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2             101   8e-23   Oryza sativa Indica Group [Indian rice]
gb|EMS63790.1|  Phospholipase A1-II 7                                   102   1e-22   
ref|NP_001043730.2|  Os01g0651200                                       100   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ACG40994.1|  triacylglycerol lipase                                98.2    2e-22   Zea mays [maize]
gb|EMT11182.1|  hypothetical protein F775_27795                         100   2e-22   
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like            99.8    2e-22   
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like            99.8    3e-22   
ref|XP_003608120.1|  Lipase                                           99.4    3e-22   
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4           99.4    3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AFW83434.1|  hypothetical protein ZEAMMB73_348788                  97.8    3e-22   
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680        99.8    3e-22   Sorghum bicolor [broomcorn]
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like            99.8    4e-22   
ref|XP_010108435.1|  Phospholipase A1-IIgamma                         99.0    4e-22   
ref|NP_001056387.1|  Os05g0574100                                     99.4    4e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                  99.0    4e-22   
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g           99.0    5e-22   
dbj|BAD68802.1|  lipase-like protein                                  99.0    5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137120.1|  PREDICTED: phospholipase A1-IIgamma-like         98.6    5e-22   
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like         98.6    5e-22   
gb|EAY75192.1|  hypothetical protein OsI_03084                        99.0    6e-22   Oryza sativa Indica Group [Indian rice]
gb|AFK39140.1|  unknown                                               96.3    6e-22   
gb|EMT15520.1|  Feruloyl esterase A                                     100   6e-22   
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like         99.0    6e-22   
gb|AFK47098.1|  unknown                                               98.2    7e-22   
ref|XP_003608142.1|  Lipase                                           97.8    1e-21   
ref|XP_002867985.1|  lipase class 3 family protein                    98.2    1e-21   
gb|EMT04701.1|  Lipase                                                97.8    1e-21   
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630        97.8    1e-21   Sorghum bicolor [broomcorn]
ref|XP_003608122.1|  Lipase                                           97.4    1e-21   
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                 97.4    1e-21   
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like         97.8    1e-21   
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       100   2e-21   
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  97.8    2e-21   
ref|NP_001152663.1|  triacylglycerol lipase precursor                 97.4    2e-21   Zea mays [maize]
emb|CBI30665.3|  unnamed protein product                              97.1    2e-21   
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma              97.4    2e-21   
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  97.8    2e-21   
emb|CDY01554.1|  BnaC07g35440D                                        97.1    3e-21   
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like            96.3    3e-21   
ref|XP_010058983.1|  PREDICTED: phospholipase A1-IIgamma-like         95.9    4e-21   
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like         96.7    4e-21   
gb|KCW74056.1|  hypothetical protein EUGRSUZ_E02682                   95.9    5e-21   
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...  96.7    6e-21   
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like         95.9    8e-21   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg           95.9    8e-21   
emb|CDM85400.1|  unnamed protein product                              95.5    9e-21   
emb|CDY53993.1|  BnaA03g58180D                                        95.1    9e-21   
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1            95.5    9e-21   
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like            95.5    1e-20   
gb|EEE64775.1|  hypothetical protein OsJ_19631                        95.1    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg           95.1    1e-20   
ref|XP_002437113.1|  hypothetical protein SORBIDRAFT_10g021260        95.1    1e-20   Sorghum bicolor [broomcorn]
ref|NP_193590.1|  phospholipase A1-IIgamma                            95.1    1e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDM83551.1|  unnamed protein product                              94.7    2e-20   
ref|XP_007014120.1|  Alpha/beta-Hydrolases superfamily protein        95.1    2e-20   
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  97.1    2e-20   
ref|XP_010655496.1|  PREDICTED: phospholipase A1-IIgamma isoform X2   93.6    2e-20   
ref|XP_002525129.1|  triacylglycerol lipase, putative                 94.4    2e-20   Ricinus communis
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6           94.0    3e-20   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ96485.1|  predicted protein                                    93.6    4e-20   
ref|XP_003565876.1|  PREDICTED: phospholipase A1-II 6-like            93.6    7e-20   
gb|EMT15519.1|  Lipase                                                92.4    1e-19   
gb|EMS63185.1|  Phospholipase A1-II 1                                 94.7    1e-19   
ref|XP_006374295.1|  hypothetical protein POPTR_0015s05760g           92.4    1e-19   
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg              92.4    1e-19   
dbj|BAJ85084.1|  predicted protein                                    92.8    1e-19   
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                 92.4    1e-19   
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...  92.0    1e-19   
gb|EMS50696.1|  Phospholipase A1-II 7                                 90.9    2e-19   
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like          91.7    2e-19   
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta               91.7    2e-19   
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like          91.7    3e-19   
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470        91.3    3e-19   
ref|XP_010557126.1|  PREDICTED: phospholipase A1-IIbeta isoform X2    90.5    3e-19   
gb|EMS48809.1|  Phospholipase A1-II 6                                 91.7    3e-19   
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...  90.9    3e-19   
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta        90.5    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1    90.1    7e-19   
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                  90.1    8e-19   
ref|XP_007025431.1|  Alpha/beta-Hydrolases superfamily protein        89.7    9e-19   
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1           89.7    9e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like         89.7    1e-18   
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like         89.7    1e-18   
gb|KCW74061.1|  hypothetical protein EUGRSUZ_E02689                   88.6    2e-18   
ref|XP_010058981.1|  PREDICTED: phospholipase A1-IIgamma-like         88.6    3e-18   
gb|KDP31780.1|  hypothetical protein JCGZ_12241                       87.8    3e-18   
gb|KDO38625.1|  hypothetical protein CISIN_1g0208022mg                87.0    5e-18   
ref|XP_003528483.1|  PREDICTED: phospholipase A1-IIgamma-like         87.4    6e-18   
ref|XP_011047741.1|  PREDICTED: phospholipase A1-IIgamma-like         87.4    9e-18   
ref|XP_011005461.1|  PREDICTED: phospholipase A1-IIgamma-like         87.0    1e-17   
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha              87.4    1e-17   
ref|XP_002438517.1|  hypothetical protein SORBIDRAFT_10g021250        86.7    1e-17   Sorghum bicolor [broomcorn]
ref|XP_011047800.1|  PREDICTED: phospholipase A1-II 4-like            87.4    1e-17   
ref|XP_002488949.1|  hypothetical protein SORBIDRAFT_1306s002010      86.3    2e-17   Sorghum bicolor [broomcorn]
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                  86.3    2e-17   
gb|KDP46901.1|  hypothetical protein JCGZ_24110                       86.3    2e-17   
gb|EMS52156.1|  Phospholipase A1-II 2                                 86.3    2e-17   
ref|NP_001149813.1|  triacylglycerol lipase                           86.3    2e-17   Zea mays [maize]
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like         86.3    2e-17   
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like         85.9    3e-17   
ref|XP_010058987.1|  PREDICTED: uncharacterized protein LOC104446890  88.2    3e-17   
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg           85.9    3e-17   
ref|XP_002522552.1|  triacylglycerol lipase, putative                 85.9    3e-17   Ricinus communis
emb|CDY23963.1|  BnaC03g17280D                                        85.9    4e-17   
ref|XP_011005460.1|  PREDICTED: phospholipase A1-II 4-like            85.5    4e-17   
ref|XP_002440294.1|  hypothetical protein SORBIDRAFT_09g029220        85.1    6e-17   Sorghum bicolor [broomcorn]
emb|CDX84801.1|  BnaA03g14290D                                        85.1    6e-17   
gb|KDP46905.1|  hypothetical protein JCGZ_24114                       85.1    6e-17   
emb|CDY24728.1|  BnaC04g13330D                                        84.7    7e-17   
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg           85.1    8e-17   
ref|XP_006374296.1|  hypothetical protein POPTR_0015s05770g           84.7    8e-17   
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg           84.7    8e-17   
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like          84.7    9e-17   
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg           84.7    1e-16   
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                  84.3    1e-16   
gb|KDP21071.1|  hypothetical protein JCGZ_21542                       84.3    1e-16   
gb|ABK96341.1|  unknown                                               84.0    1e-16   Populus trichocarpa x Populus deltoides
ref|XP_011027708.1|  PREDICTED: phospholipase A1-IIgamma-like         83.6    2e-16   
gb|ABR16123.1|  unknown                                               84.7    2e-16   Picea sitchensis
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  84.3    2e-16   
ref|XP_007208931.1|  hypothetical protein PRUPE_ppb012141mg           81.3    2e-16   
ref|XP_009144598.1|  PREDICTED: phospholipase A1-IIbeta-like          83.2    3e-16   
ref|XP_001779106.1|  predicted protein                                83.6    3e-16   
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like         83.6    3e-16   
gb|KCW89613.1|  hypothetical protein EUGRSUZ_A01896                   82.0    3e-16   
ref|XP_002305084.2|  hypothetical protein POPTR_0004s05380g           82.8    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010446304.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  81.6    4e-16   
ref|XP_006469038.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  82.8    4e-16   
ref|XP_002892328.1|  predicted protein                                82.0    4e-16   
gb|KDO40783.1|  hypothetical protein CISIN_1g046292mg                 80.5    5e-16   
gb|KDP46903.1|  hypothetical protein JCGZ_24112                       82.4    5e-16   
ref|XP_006428645.1|  hypothetical protein CICLE_v10011864mg           82.4    6e-16   
emb|CDY49813.1|  BnaC06g04560D                                        82.8    7e-16   
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  82.8    9e-16   
emb|CDY22842.1|  BnaA06g02350D                                        82.8    9e-16   
gb|AAM61647.1|  lipase-like protein                                   82.0    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172115.1|  phospholipase A1-IIalpha                            82.0    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like            81.6    1e-15   
ref|XP_007210039.1|  hypothetical protein PRUPE_ppa017270mg           81.3    1e-15   
emb|CDY57813.1|  BnaA10g28020D                                        82.4    1e-15   
gb|KCW74059.1|  hypothetical protein EUGRSUZ_E02687                   80.9    2e-15   
ref|XP_010246745.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  82.0    2e-15   
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                  81.6    2e-15   
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  81.6    2e-15   
gb|KDP21072.1|  hypothetical protein JCGZ_21543                       80.9    2e-15   
ref|XP_009333706.1|  PREDICTED: phospholipase A1-IIgamma-like         80.1    3e-15   
ref|XP_008238421.1|  PREDICTED: phospholipase A1-IIgamma-like         80.1    3e-15   
ref|XP_001779107.1|  predicted protein                                80.9    3e-15   
ref|XP_008238422.1|  PREDICTED: phospholipase A1-IIgamma-like         80.1    3e-15   
ref|XP_002891639.1|  lipase class 3 family protein                    80.9    4e-15   
ref|XP_004301748.1|  PREDICTED: phospholipase A1-IIgamma-like         80.1    4e-15   
emb|CDX86530.1|  BnaC08g01730D                                        80.1    4e-15   
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like         80.1    4e-15   
gb|EMT30117.1|  Mono- and diacylglycerol lipase                       80.1    5e-15   
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha              79.7    6e-15   
ref|XP_009389474.1|  PREDICTED: phospholipase A1-II 5-like            79.0    7e-15   
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                  79.3    8e-15   
gb|EEE64776.1|  hypothetical protein OsJ_19632                        77.8    8e-15   
ref|NP_564590.1|  DAD1-like lipase 2                                  79.7    9e-15   
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  79.7    9e-15   
emb|CBI16352.3|  unnamed protein product                              79.7    1e-14   
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  79.7    1e-14   
ref|XP_007025428.1|  Alpha/beta-Hydrolases superfamily protein        78.6    1e-14   
emb|CAN83233.1|  hypothetical protein VITISV_005768                   79.3    1e-14   
ref|XP_002441554.1|  hypothetical protein SORBIDRAFT_09g029230        78.2    1e-14   
emb|CDY10187.1|  BnaC05g04300D                                        78.6    1e-14   
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg           79.3    1e-14   
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  79.0    1e-14   
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg           79.0    2e-14   
ref|XP_001781080.1|  predicted protein                                78.2    2e-14   
ref|XP_008369474.1|  PREDICTED: phospholipase A1-II 2-like            76.3    2e-14   
ref|XP_010269807.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  78.6    2e-14   
ref|XP_002522553.1|  triacylglycerol lipase, putative                 78.2    2e-14   
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  78.6    2e-14   
ref|XP_008345355.1|  PREDICTED: phospholipase A1-IIgamma-like         77.8    2e-14   
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  78.6    2e-14   
gb|ABK24664.1|  unknown                                               78.2    3e-14   
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                 78.2    3e-14   
ref|XP_006644445.1|  PREDICTED: phospholipase A1-II 3-like            77.8    3e-14   
ref|XP_010102366.1|  Phospholipase A1-Igamma3                         78.2    4e-14   
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  78.2    4e-14   
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg           78.2    4e-14   
gb|KGN44761.1|  hypothetical protein Csa_7G378500                     77.4    5e-14   
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  77.4    6e-14   
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  77.4    6e-14   
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  77.4    6e-14   
ref|XP_004301746.1|  PREDICTED: phospholipase A1-IIgamma-like         76.3    8e-14   
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg           77.0    9e-14   
gb|EYU31376.1|  hypothetical protein MIMGU_mgv1a004679mg              76.6    1e-13   
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                 76.3    1e-13   
ref|XP_010938722.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  76.3    1e-13   
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  76.3    1e-13   
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  75.9    1e-13   
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                   76.3    2e-13   
ref|XP_010925002.1|  PREDICTED: phospholipase A1-II 5-like            75.9    2e-13   
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  76.3    2e-13   
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  75.9    2e-13   
ref|XP_010087133.1|  Phospholipase A1-Igamma1                         75.9    2e-13   
ref|NP_001043734.1|  Os01g0651800                                     75.5    2e-13   
sp|A2WTA0.1|PLA3_ORYSI  RecName: Full=Phospholipase A1-II 3; Flag...  75.5    2e-13   
ref|XP_011042425.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  75.5    2e-13   
gb|KDO63322.1|  hypothetical protein CISIN_1g0475241mg                72.0    2e-13   
gb|KGN66495.1|  hypothetical protein Csa_1G614650                     75.9    2e-13   
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  75.5    2e-13   
gb|KHG20660.1|  Phospholipase A1-IIgamma -like protein                74.7    3e-13   
gb|KDP22109.1|  hypothetical protein JCGZ_25940                       75.1    4e-13   
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g           74.7    5e-13   
ref|XP_011080360.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  74.7    5e-13   
ref|XP_010925003.1|  PREDICTED: phospholipase A1-II 5-like            74.3    5e-13   
gb|KDP21366.1|  hypothetical protein JCGZ_21837                       74.3    7e-13   
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  74.3    7e-13   
ref|XP_003607369.1|  Lipase                                           74.3    8e-13   
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  73.9    9e-13   
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                 73.6    9e-13   
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg              73.9    1e-12   
gb|EAY99121.1|  hypothetical protein OsI_21080                        73.2    1e-12   
ref|XP_002513514.1|  triacylglycerol lipase, putative                 73.6    1e-12   
ref|XP_007025427.1|  Alpha/beta-Hydrolases superfamily protein        73.2    1e-12   
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g           73.6    1e-12   
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  73.6    2e-12   
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  73.2    2e-12   
ref|XP_010941431.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  72.0    2e-12   
gb|EEC79153.1|  hypothetical protein OsI_19824                        73.2    2e-12   
ref|NP_001055438.1|  Os05g0390000                                     72.8    2e-12   
ref|XP_008444745.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  73.2    2e-12   
ref|XP_008451277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  72.8    2e-12   
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  72.8    2e-12   
ref|XP_008451276.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  72.8    2e-12   
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  72.8    2e-12   
ref|XP_001754450.1|  predicted protein                                72.0    3e-12   
ref|XP_004969721.1|  PREDICTED: phospholipase A1-II 5-like            72.0    4e-12   
ref|XP_009801144.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  72.0    4e-12   
ref|XP_011079989.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  71.6    5e-12   
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg           71.6    5e-12   
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  71.6    5e-12   
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  72.0    6e-12   
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                   71.2    6e-12   
gb|KFK37118.1|  hypothetical protein AALP_AA4G215200                  70.5    6e-12   
emb|CDP03693.1|  unnamed protein product                              71.2    6e-12   
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  70.9    6e-12   
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  71.2    7e-12   
ref|XP_006489506.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  71.2    7e-12   
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  71.6    7e-12   
gb|ABK23399.1|  unknown                                               70.9    7e-12   
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  71.2    7e-12   
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  71.2    9e-12   
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein        71.2    9e-12   
ref|XP_008801803.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  70.1    9e-12   
ref|XP_004167249.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  70.9    1e-11   
ref|XP_004135535.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  70.9    1e-11   
ref|XP_011028727.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  70.5    1e-11   
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  70.9    1e-11   
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g           70.9    1e-11   
ref|XP_010413021.1|  PREDICTED: phospholipase A1-IIdelta-like         70.5    1e-11   
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  70.9    1e-11   
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  70.9    1e-11   
ref|XP_010274200.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  70.5    1e-11   
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                   70.5    1e-11   
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  70.5    1e-11   
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  70.5    2e-11   
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  70.5    2e-11   
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g           70.5    2e-11   
ref|XP_009142882.1|  PREDICTED: phospholipase A1-IIdelta-like         69.3    2e-11   
gb|ABR18391.1|  unknown                                               70.1    2e-11   
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  70.1    2e-11   
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  70.1    2e-11   
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  70.1    2e-11   
emb|CAN74039.1|  hypothetical protein VITISV_012945                   70.1    2e-11   
ref|XP_006411539.1|  hypothetical protein EUTSA_v10017651mg           69.3    2e-11   
ref|XP_002881868.1|  hypothetical protein ARALYDRAFT_903642           69.3    3e-11   
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  69.7    3e-11   
emb|CDP09265.1|  unnamed protein product                              69.7    3e-11   
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  69.7    3e-11   
emb|CDY50817.1|  BnaC04g52540D                                        68.9    3e-11   
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  69.3    3e-11   
ref|XP_010507708.1|  PREDICTED: phospholipase A1-IIdelta-like         68.9    3e-11   
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  69.3    4e-11   
gb|KHN18833.1|  Phospholipase A1-Igamma2, chloroplastic               68.6    4e-11   
ref|NP_001141332.1|  uncharacterized protein LOC100273423             68.9    4e-11   
ref|XP_010107463.1|  Phospholipase A1-IIdelta                         68.6    5e-11   
ref|XP_003518893.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  68.9    5e-11   
ref|XP_006853087.1|  hypothetical protein AMTR_s00038p00110060        68.9    5e-11   
dbj|BAJ85518.1|  predicted protein                                    68.9    6e-11   
emb|CDY47985.1|  BnaA04g24630D                                        68.2    6e-11   
ref|XP_010512889.1|  PREDICTED: phospholipase A1-IIdelta-like         68.2    7e-11   
ref|XP_002272558.2|  PREDICTED: phospholipase A1-Igamma1, chlorop...  68.6    7e-11   
gb|ABK23028.1|  unknown                                               66.2    8e-11   
emb|CDO99150.1|  unnamed protein product                              68.2    8e-11   
emb|CDM86669.1|  unnamed protein product                              68.2    9e-11   
emb|CBI21996.3|  unnamed protein product                              68.2    1e-10   
gb|KDP38020.1|  hypothetical protein JCGZ_04663                       68.2    1e-10   
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  68.2    1e-10   
emb|CDX97819.1|  BnaC04g41200D                                        67.8    1e-10   
emb|CDY14851.1|  BnaC04g48480D                                        67.4    1e-10   
ref|NP_565701.1|  phospholipase A1-Igamma2                            67.8    1e-10   
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  67.8    2e-10   
gb|KDP21364.1|  hypothetical protein JCGZ_21835                       67.4    2e-10   
ref|NP_850148.1|  phospholipase A1-Igamma2                            67.4    2e-10   
ref|XP_002458388.1|  hypothetical protein SORBIDRAFT_03g032660        67.4    2e-10   
gb|KCW74063.1|  hypothetical protein EUGRSUZ_E02691                   66.6    2e-10   
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  67.4    2e-10   
ref|XP_010414253.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  67.4    2e-10   
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg           67.4    2e-10   
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  67.4    2e-10   
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg           67.4    2e-10   
ref|NP_001044041.1|  Os01g0710700                                     67.0    2e-10   
sp|B8A8C9.1|PLA5_ORYSI  RecName: Full=Phospholipase A1-II 5           67.0    2e-10   
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  67.4    2e-10   
ref|XP_010414254.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  67.0    2e-10   
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  67.4    2e-10   
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  67.0    2e-10   
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  67.4    2e-10   
emb|CDX79431.1|  BnaC03g17670D                                        67.0    2e-10   
ref|XP_010104409.1|  Phospholipase A1-IIdelta                         67.0    2e-10   
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  67.0    2e-10   
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg           67.0    2e-10   
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  67.0    2e-10   
gb|EEE55280.1|  hypothetical protein OsJ_03214                        67.0    3e-10   
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  67.0    3e-10   
ref|XP_009614944.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  66.6    3e-10   
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  67.0    3e-10   
ref|XP_010486696.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  66.6    3e-10   
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like         66.2    3e-10   
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein        66.6    3e-10   
ref|XP_008675114.1|  PREDICTED: phospholipase A1-II 5                 66.6    3e-10   
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg           66.6    4e-10   
ref|XP_002879267.1|  lipase class 3 family protein                    66.6    4e-10   
ref|XP_006294314.1|  hypothetical protein CARUB_v10023322mg           65.9    4e-10   
ref|XP_010486634.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  66.2    4e-10   
ref|XP_004298041.1|  PREDICTED: galactolipase DONGLE, chloroplast...  66.2    4e-10   
gb|EMS68153.1|  Phospholipase A1-II 7                                 65.9    4e-10   
ref|XP_010486640.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  65.9    4e-10   
ref|XP_010486704.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  65.9    4e-10   
ref|XP_003518892.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  65.9    5e-10   
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  65.9    5e-10   
emb|CDX84763.1|  BnaA03g14670D                                        65.9    5e-10   
ref|XP_002531054.1|  triacylglycerol lipase, putative                 66.2    5e-10   
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg           65.9    5e-10   
ref|XP_006852124.1|  hypothetical protein AMTR_s00049p00044160        65.5    6e-10   
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like         65.9    6e-10   
ref|XP_007208858.1|  hypothetical protein PRUPE_ppa025833mg           65.5    6e-10   
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  65.9    6e-10   
ref|XP_004962194.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  65.9    6e-10   
emb|CDY29665.1|  BnaA04g17620D                                        65.9    7e-10   
gb|KHN32323.1|  Phospholipase A1-Igamma1, chloroplastic               64.3    7e-10   
ref|XP_002437873.1|  hypothetical protein SORBIDRAFT_10g004170        65.9    7e-10   
ref|XP_010934644.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  65.1    7e-10   
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  65.5    7e-10   
gb|EPS65213.1|  hypothetical protein M569_09566                       65.1    7e-10   
ref|XP_006576920.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  65.1    8e-10   
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  65.5    8e-10   
ref|XP_002511565.1|  hypothetical protein RCOM_1514850                62.8    8e-10   
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  65.5    8e-10   
emb|CAN64309.1|  hypothetical protein VITISV_037470                   65.5    9e-10   
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                   65.1    9e-10   
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  65.1    9e-10   
ref|XP_010685025.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  65.1    1e-09   
ref|XP_010069172.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  65.1    1e-09   
ref|XP_004968489.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  65.1    1e-09   
ref|XP_008238420.1|  PREDICTED: phospholipase A1-IIgamma-like         64.3    1e-09   
ref|XP_006348881.1|  PREDICTED: phospholipase A1-IIdelta-like         65.1    1e-09   
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  64.7    1e-09   
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...  65.1    1e-09   
ref|XP_008362525.1|  PREDICTED: phospholipase A1-IIdelta-like         64.7    1e-09   
ref|XP_002272780.2|  PREDICTED: phospholipase A1-Igamma1, chlorop...  65.1    1e-09   
ref|XP_006644603.1|  PREDICTED: phospholipase A1-II 5-like            64.7    1e-09   
ref|XP_007024951.1|  Alpha/beta-Hydrolases superfamily protein        64.7    1e-09   
ref|XP_006853086.1|  hypothetical protein AMTR_s00038p00106840        64.7    1e-09   
ref|XP_010655698.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  64.3    2e-09   
gb|KEH23856.1|  phospholipase A1                                      64.3    2e-09   
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  64.3    2e-09   
emb|CDM86668.1|  unnamed protein product                              64.3    2e-09   
ref|XP_009144055.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  63.9    2e-09   
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  64.3    3e-09   
ref|XP_002268142.1|  PREDICTED: galactolipase DONGLE, chloroplastic   63.9    3e-09   
ref|XP_008382954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  63.5    3e-09   



>gb|AAB07724.1| Pn47p [Ipomoea nil]
Length=402

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 94/121 (78%), Gaps = 1/121 (1%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KYEVTKYFYA S  P+    GY V   R DAVL+ESNWNGY+AVATDEGKVALGRRDIL+
Sbjct  78   KYEVTKYFYAPSTIPL-PDEGYNVRATRADAVLKESNWNGYVAVATDEGKVALGRRDILI  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            VWRGT R  E   ++T  FV APL FGQNS PLVHKG+YDMYTT  QDSQLN  SARDQI
Sbjct  137  VWRGTIRKSEWNENLTFWFVKAPLFFGQNSDPLVHKGWYDMYTTINQDSQLNEKSARDQI  196

Query  361  R  363
            R
Sbjct  197  R  197



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 84/122 (69%), Gaps = 3/122 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYAT+  P+     +  S +R +A  +ESN+ GYIAVATDEGKV+LGRRDI++
Sbjct  75   KYRVTKYFYATASIPLPDGVFFVKSLSR-EAWSKESNFMGYIAVATDEGKVSLGRRDIVI  133

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS--HPLVHKGFYDMYTTTIQDSQLNRMSARD  354
             WRG+ + LE + D+  V V AP +FG      PLVH+GFY++YT +   SQ N  SARD
Sbjct  134  NWRGSMQTLEWVNDLQFVLVPAPEVFGDGGLLQPLVHQGFYNVYTASSSRSQFNVTSARD  193

Query  355  QI  360
            Q+
Sbjct  194  QV  195



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 81/122 (66%), Gaps = 4/122 (3%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYATS  P+     +       +A  +ESN+ GYIAVATDEGKV+LGRRDI++
Sbjct  73   KYRVTKYFYATSSIPL--PDAFITKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVI  130

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS--HPLVHKGFYDMYTTTIQDSQLNRMSARD  354
             WRGT++ LE I D+  + V AP +FG      PLVH GFY++YT+    SQ N  SARD
Sbjct  131  NWRGTQQKLEFINDLQFLLVPAPKVFGDGGLLQPLVHNGFYNVYTSASSRSQFNLTSARD  190

Query  355  QI  360
            Q+
Sbjct  191  QV  192



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 82/125 (66%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYAT+  P+    G+ V     +A  +ESN+ GYIAVATDEGKV+LGRRDI++
Sbjct  72   KYRVTKFFYATASIPL--PDGFIVKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVI  129

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + V AP +FG         PLVH GFY+ YT++   SQ N  S
Sbjct  130  AWRGTMQKLEWVNDLQFLLVPAPQVFGDGGLLPLFQPLVHHGFYNAYTSSSSRSQFNLTS  189

Query  346  ARDQI  360
            ARDQ+
Sbjct  190  ARDQV  194



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   123 bits (308),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +1

Query  82   RVDAVLRESNWNGYIAVATDEGKVALGRRDILVVWRGTRRFLEAITDITLVFVNAPLIFG  261
            RV   L+ESNW GY+AVATDEGKVALGRRDI++ WRGT R LE + D+  V V+AP IFG
Sbjct  80   RVTKYLKESNWMGYVAVATDEGKVALGRRDIVIAWRGTVRSLEWVNDLEFVLVSAPKIFG  139

Query  262  QNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            +N  P VH+G+Y +YTT    S  N+ SARDQ+
Sbjct  140  ENDDPKVHQGWYSIYTTDDSRSPFNKTSARDQV  172



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   123 bits (308),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 84/125 (67%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYATS  P+     +       +A  +ESN+ GYIAVATDEGKV+LGRRDI++
Sbjct  75   KYRVTKYFYATSSIPL--PDAFITKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQN-----SHPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + + AP +FG+      + PLVH GFY++YT+  + S+ N+ S
Sbjct  133  AWRGTIQTLEWVNDLQFLLIPAPEVFGKGGLLPLTQPLVHHGFYNIYTSESERSKFNKTS  192

Query  346  ARDQI  360
            ARDQ+
Sbjct  193  ARDQV  197



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS   I     + V     +A  +ESNW GY+AVATDEGKVALGRRDI++
Sbjct  78   KYRVTKYLYATSS--IQLPDAFIVKSFSREAWSKESNWMGYVAVATDEGKVALGRRDIVI  135

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQN-SHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRGT R LE + D+  V V+AP IF +N   P VH+G+Y +YTT    S  N++SARDQ
Sbjct  136  AWRGTVRSLEWVNDLEFVSVSAPKIFTENDDDPKVHQGWYSIYTTDDSRSPFNKISARDQ  195

Query  358  I  360
            +
Sbjct  196  V  196



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score =   122 bits (305),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FY TS  P+     +       +A  +ESN+ GYIAVATDEGKVALGRRDI++
Sbjct  75   KYHVTKFFYGTSSIPL--PDAFMTRSLSREAWSKESNFMGYIAVATDEGKVALGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + V AP +FG        HPLVH GF+++YTT    SQ N+  
Sbjct  133  NWRGTLQVLEWVNDLQFLLVPAPKVFGDGGLLPLFHPLVHHGFHNIYTTENPRSQFNKTC  192

Query  346  ARDQI  360
             RDQ+
Sbjct  193  VRDQV  197



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 82/125 (66%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYAT+  P+     + V     +A  +ESN+ GYIAVATDEGKVALGRRDI+V
Sbjct  75   KYRVTKFFYATASIPL--PDAFIVKSLSREAWSKESNFMGYIAVATDEGKVALGRRDIVV  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + V  P +FG         PLVH GFY++YTT    SQ N++S
Sbjct  133  NWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLSLLQPLVHHGFYNIYTTEDPRSQFNQVS  192

Query  346  ARDQI  360
            ARDQ+
Sbjct  193  ARDQV  197



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTKYFYATS  P+   + + V     +A  +ESN+ GYIAVATDEGKVALGRRDI++
Sbjct  75   KYKVTKYFYATSSIPL--PSAFLVKSLSREAWNKESNFMGYIAVATDEGKVALGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + +  P +FG         PLVH GFY++YT+    S  N+ S
Sbjct  133  AWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQPLVHHGFYNIYTSEDPRSMFNQAS  192

Query  346  ARDQI  360
            ARDQ+
Sbjct  193  ARDQV  197



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   121 bits (304),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYATS  P+     +       +A  +ESN+ GYIAVATDEGK +LGRRDI++
Sbjct  76   KYCVTKYFYATSSMPL--PDAFITKSLSREAWSKESNFMGYIAVATDEGKASLGRRDIVI  133

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + V AP +FG        HPLVH GF+++YTT    SQ N+  
Sbjct  134  NWRGTLQVLEWVNDLQFLLVPAPQVFGDGGLLPLFHPLVHHGFHNIYTTENPRSQFNKTC  193

Query  346  ARDQI  360
             RDQ+
Sbjct  194  VRDQV  198



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   121 bits (304),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYATS  P+     +       +A  +ESN+ GYIAVATDEGK +LGRRDI++
Sbjct  76   KYCVTKYFYATSSMPL--PDAFITKSFSREAWSKESNFMGYIAVATDEGKASLGRRDIVI  133

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + V AP +FG        HPLVH GF+++YTT    SQ N+  
Sbjct  134  NWRGTLQVLEWVNDLQFLLVPAPKVFGDGGLLPLFHPLVHHGFHNIYTTENPRSQFNKTC  193

Query  346  ARDQI  360
             RDQ+
Sbjct  194  VRDQV  198



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score =   121 bits (303),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 59/119 (50%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+ YATS   I     + +     +A  RESNW GY+AVATDEGK ALGRRDI++ 
Sbjct  108  YSVTKFLYATSS--IDLPEAFIIKSFSREAWSRESNWIGYVAVATDEGKAALGRRDIVIA  165

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRGT + LE + D+  V V+AP +FG+N+ P VH+G+Y +YT+    S  N+ SAR Q+
Sbjct  166  WRGTVQTLEWVNDLEFVLVSAPKVFGKNTDPKVHQGWYSIYTSEDPLSPFNKSSARSQV  224



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYATS   +     + +     +A  RESNW GY+AVATDEGK ALGRRDIL+
Sbjct  102  KYRVTKYFYATSSTKVP--DAFILKSWSREAWSRESNWIGYVAVATDEGKSALGRRDILI  159

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT R LE + D     V+AP IFG N  P VH G+Y +YT+    S  N+ SAR+Q+
Sbjct  160  AWRGTIRTLEWMNDFEFATVSAPEIFGGNDEPNVHLGWYSIYTSDDPRSPFNKTSARNQV  219



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KYEVTKY YATS   I     + +     +A  +ESNW G++AVATDEG+VALGRRDI++
Sbjct  82   KYEVTKYVYATSS--IQVPEAFIIKSLSGEAWSKESNWIGFVAVATDEGEVALGRRDIVI  139

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WR T   +E   D   + V+AP IFG+NS P VH G+Y MYT+    S  N+ SARDQ+
Sbjct  140  AWRSTVVPMEWFNDFEFIRVSAPTIFGENSDPKVHHGWYSMYTSNDPRSLFNKASARDQV  199



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 82/124 (66%), Gaps = 7/124 (6%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y+VTKYFYATS  P+   + + V     +A  +ESN+ GYIAVATDEGKVALGRRDI++ 
Sbjct  76   YKVTKYFYATSSIPL--PSAFLVKSLSREAWSKESNFMGYIAVATDEGKVALGRRDIVIA  133

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMSA  348
            WRGT + LE + D+  + +  P +FG         PLVH GFY++YT+    S+ N+ SA
Sbjct  134  WRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFKPLVHHGFYNIYTSEDPRSKFNQASA  193

Query  349  RDQI  360
            RDQ+
Sbjct  194  RDQV  197



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS  P+    G+ V     +A  +ESN+ GYIAVATDEGK +LGRRDI+V
Sbjct  75   KYRVTKFFYATSSIPL--PDGFIVKSFSREAWSKESNFMGYIAVATDEGKASLGRRDIVV  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + +E + D+  + + AP IFG         PLVH GFY++YT+    SQ N+ S
Sbjct  133  NWRGTIQKMEWVNDLQFLLIPAPKIFGAGGLLPLFKPLVHHGFYNVYTSASSRSQFNKTS  192

Query  346  ARDQI  360
             RDQ+
Sbjct  193  VRDQV  197



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+ YATS   I     + +     +A  RESNW GY+AVATDEGK ALGRRDI++V
Sbjct  105  YSVTKFLYATS--EIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAALGRRDIVIV  162

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRGT + LE + D+  + V AP +FG+N+ P VH+G+Y +YT+    S  N+ SAR Q+
Sbjct  163  WRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSEDPRSPFNQTSARSQV  221



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS  P+     + V     +A  +ESN+ GYIAVATDEGKV+LGRRDI++
Sbjct  75   KYRVTKFFYATSSIPL--PDAFVVKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D   + V AP +FG         PLVH GFY++YT+    SQ N+  
Sbjct  133  NWRGTMQNLEWVNDFQFLLVPAPKVFGDGGLLPLFQPLVHHGFYNIYTSESSRSQFNKTC  192

Query  346  ARDQI  360
             RDQ+
Sbjct  193  VRDQV  197



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 80/125 (64%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS  P+   + + V     +A  +ESN+ GYIAVATDEGKVALGRRDI++
Sbjct  75   KYRVTKFFYATSSIPL--PSAFLVKSLSREAWNKESNFMGYIAVATDEGKVALGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + +  P +FG         PLVH GFY +YTT    S+ N+ S
Sbjct  133  AWRGTIQTLEWVNDLEFLLIPGPKVFGNGGLVPLFKPLVHHGFYSIYTTENPRSKFNQYS  192

Query  346  ARDQI  360
             RDQ+
Sbjct  193  VRDQV  197



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 78/125 (62%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS  P+    G  V    ++A  +ESN+ GY+AVATDEGKV LGRRDI++
Sbjct  75   KYRVTKFFYATSSIPL--PDGLFVRSLSLEAWSKESNFMGYVAVATDEGKVELGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT   LE + +     V AP +FG         PLVH GFY++YTT    SQ N  S
Sbjct  133  AWRGTMEKLEWVNNFQFAAVPAPKVFGDRGLLHLLQPLVHHGFYNIYTTNNPRSQFNHTS  192

Query  346  ARDQI  360
            ARDQ+
Sbjct  193  ARDQV  197



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS  P+     + V     +A  +ESN+ GY+AVATDEGKV+LGRRDI++
Sbjct  75   KYRVTKFFYATSSIPL--PDAFVVKSLSREAWSKESNFMGYVAVATDEGKVSLGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D   + V AP +FG         PLVH GFY++YT+    SQ N+  
Sbjct  133  NWRGTMQNLEWVNDFQFLLVPAPKVFGDGGLLPLFQPLVHHGFYNIYTSESSRSQFNKTC  192

Query  346  ARDQI  360
             RDQ+
Sbjct  193  VRDQV  197



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYAT+  P+     +       +A  +ESN+ GY+AVATDEGKV+LGRRDI+V
Sbjct  75   KYGVTKFFYATASIPL--PDAFITRSFSREAWSKESNFMGYVAVATDEGKVSLGRRDIVV  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT++ LE + D+  + V AP +FG         PLVH GFY++YT+    SQ N+ S
Sbjct  133  AWRGTKQALEWVNDLQFLLVPAPNVFGNGGLLPLFQPLVHHGFYNIYTSESARSQFNQTS  192

Query  346  ARDQI  360
             RDQ+
Sbjct  193  VRDQV  197



>gb|AFK35349.1| unknown [Lotus japonicus]
Length=246

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + V     +A  RESNW GY+AVATDEGK  LGRRDI+V
Sbjct  112  KYSVTKFLYATS--KIDLPEAFIVKSLSREAWSRESNWIGYVAVATDEGKAVLGRRDIVV  169

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-HPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRGT + LE + D   + V AP +FG NS +P VH+G+Y +YT+    S  N  SARDQ
Sbjct  170  AWRGTVQTLEWVDDFQFILVPAPKVFGNNSKNPKVHQGWYSIYTSDDPRSPFNITSARDQ  229

Query  358  I  360
            +
Sbjct  230  V  230



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+ YATS   I     + +     +A  RESNW GY+AVATDEGK ALGRRDI++ 
Sbjct  80   YSVTKFLYATS--EIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAALGRRDIVIA  137

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRGT + LE + D+  + V AP +FG+N+ P VH+G+Y +YT+    S  N+ SAR Q+
Sbjct  138  WRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSEDPRSPFNKTSARTQV  196



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+ YATS   I     + +     +A  RESNW GY+AVATDEGK ALGRRDI++ 
Sbjct  107  YSVTKFLYATS--EIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAALGRRDIVIA  164

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRGT + LE + D+  + V AP +FG+N+ P VH+G+Y +YT+    S  N+ SAR Q+
Sbjct  165  WRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSEDPRSPFNKTSARTQV  223



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYATS  P+     +       +A  +ESN+ GYIAVATDEGKV+LGRRDI++
Sbjct  75   KYRVTKYFYATSSIPL--PDAFITKSLSREAWSKESNFMGYIAVATDEGKVSLGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + +  P +FG         PLVH GFY++YT+    S  N+ S
Sbjct  133  AWRGTIQTLEWVNDLQFLLIPGPKVFGDGGLLPLFKPLVHHGFYNVYTSESARSNFNKKS  192

Query  346  ARDQI  360
            ARDQ+
Sbjct  193  ARDQV  197



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+ YATS   I     + +     +A  RESNW GY+AVATDEGK ALGRRDI++ 
Sbjct  80   YSVTKFLYATS--EIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAALGRRDIVIA  137

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRGT + LE + D+  + V AP +FG+N+ P VH+G+Y +YT+    S  N+ SAR Q+
Sbjct  138  WRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSEDPRSPFNQTSARSQV  196



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 4/122 (3%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS   I     + + P   +A  +ESNW GY+AVATDEGK  LGRRDI++
Sbjct  97   KYNVTKFFYATS--QIHVPEAFIIVPLSREAWSKESNWMGYVAVATDEGKAVLGRRDIVI  154

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFG--QNSHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
             WRG+ + LE + D+   FV+A  IFG  +   P VH+G+Y +YT+  Q S  N+ SARD
Sbjct  155  AWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVHQGWYSIYTSDDQRSPFNKTSARD  214

Query  355  QI  360
            Q+
Sbjct  215  QV  216



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 4/122 (3%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS   I     + + P   +A  +ESNW GY+AVATDEGK  LGRRDI++
Sbjct  97   KYNVTKFFYATS--QIHVPEAFIIVPLSREAWSKESNWMGYVAVATDEGKAVLGRRDIVI  154

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFG--QNSHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
             WRG+ + LE + D+   FV+A  IFG  +   P VH+G+Y +YT+  Q S  N+ SARD
Sbjct  155  AWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVHQGWYSIYTSDDQRSPFNKTSARD  214

Query  355  QI  360
            Q+
Sbjct  215  QV  216



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YEVTKY YATS   +     +  S +R +A  +ESNW G++AVATDEGK+ALGRRDI++ 
Sbjct  105  YEVTKYIYATSSVQV-PEALFIKSLSR-EAWSKESNWVGFVAVATDEGKMALGRRDIVIA  162

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRG+ + +E   D   + V+AP IFGQ S P VH G+Y +YT++   S  N+ SARDQ+
Sbjct  163  WRGSVQTMEWFNDFDFIQVSAPEIFGQKSIPKVHHGWYSVYTSSDSRSPFNKASARDQV  221



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYATS  P+     +       +A  +ESN+ GYIAVATDEGK +LGRRDIL+
Sbjct  75   KYRVTKYFYATSSIPL--PDAFITKSLSREAWSKESNFMGYIAVATDEGKASLGRRDILI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + +  P +FG         PLVH GFY++YT+    S+ N+ S
Sbjct  133  AWRGTIQTLEWVNDLQFLLIPGPKVFGDGGLLPLFKPLVHHGFYNVYTSESARSKYNQAS  192

Query  346  ARDQI  360
            ARDQ+
Sbjct  193  ARDQV  197



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 80/125 (64%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYATS  P+     +       +A  +ESN+ GY+AVATDEGKV+LGRRDI++
Sbjct  72   KYRVTKYFYATSSMPL--PDAFITKSLSREAWSKESNFMGYVAVATDEGKVSLGRRDIVI  129

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + +  P +FG         PLVH GFY++YT+    S+ N+ S
Sbjct  130  AWRGTIQTLEWVNDLQFLPIPGPKVFGDGGLLPLFKPLVHHGFYNVYTSESARSKFNKTS  189

Query  346  ARDQI  360
            ARDQ+
Sbjct  190  ARDQV  194



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYAT+  P+     + V     +A  +ESN+ GYIAVATDEGKV+LGRRDI++
Sbjct  72   KYRVTKFFYATASIPL--PDAFIVKSFSREAWSKESNFMGYIAVATDEGKVSLGRRDIVI  129

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + +E + D+  + V AP +FG         PLVH GFY++YT+    SQ N  S
Sbjct  130  NWRGTLQKMEWVNDLQFLPVPAPKVFGDGGLLPLFKPLVHHGFYNVYTSASSRSQFNLTS  189

Query  346  ARDQI  360
            ARDQ+
Sbjct  190  ARDQV  194



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KYEVTKY YATS   +     +  S +R +A  +ESNW G++AVATD+GK+ALGRRDI++
Sbjct  121  KYEVTKYIYATSSVQV-PDALFIKSLSR-EAWSKESNWVGFVAVATDKGKIALGRRDIVI  178

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            VWRG+ + +E   D   + V++P IFG+ S P VH G+Y +YT+    S  N+ SARDQ+
Sbjct  179  VWRGSVQTMEWFNDFDFIQVSSPKIFGEKSDPKVHHGWYSIYTSDDSRSPFNKGSARDQV  238



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KYEVTKY YATS   +     +  S +R +A  +ESNW G++AVATD+GK+ALGRRDI++
Sbjct  119  KYEVTKYIYATSAVQV-PEALFIKSLSR-EAWSKESNWAGFVAVATDKGKIALGRRDIVI  176

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            VWRG+ + LE   D   + V+A  IFG+ S P VH G+Y +YT+    S  N+ SARDQ+
Sbjct  177  VWRGSVQTLEWFNDFDFIQVSATKIFGEKSDPKVHHGWYSIYTSDDSRSLFNKESARDQV  236



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 77/124 (62%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS         + +     +A  +ESNW GY+AVATDEGK+ALGRRDIL+
Sbjct  100  KYRVTKYVYATSSL-TEVPDAFILRSWSREAWTKESNWIGYVAVATDEGKLALGRRDILI  158

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ----NSHPLVHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT R LE I D     V+APLIFG     +  P VH G+Y +YT+    S  N+ SA
Sbjct  159  AWRGTVRTLEWINDFEFSLVDAPLIFGAANDGDDQPRVHLGWYSIYTSDDPRSPFNKTSA  218

Query  349  RDQI  360
            R+Q+
Sbjct  219  RNQV  222



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   +     + V     +A  +ESNW G++AVATDEGK  LGRRDI++
Sbjct  96   KYRVTKFLYATS--QVQLPEAFIVKSLSREAWSKESNWIGFVAVATDEGKTTLGRRDIVI  153

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT R LE + D    FV+A  I G++  P VH+G+Y +YT+    SQ N+ SARDQ+
Sbjct  154  AWRGTIRTLEWVNDFEFNFVSASKILGESGDPKVHQGWYSIYTSDDSRSQYNKNSARDQV  213



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYATS   +     + V     +A  +ESNW GY+AVATDEGK ALGRRDIL+
Sbjct  95   KYRVTKYFYATSSAQV--PDAFIVPSWSREAWSKESNWMGYVAVATDEGKSALGRRDILI  152

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT R LE + D     V AP IFG N  P VH G++ +YT+    S  ++ SAR Q+
Sbjct  153  AWRGTIRNLEWVNDFEFGLVPAPEIFGGNDDPKVHFGWHSIYTSDDPKSPFSKNSARHQV  212



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 80/125 (64%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYAT+  P+     + V     +A  +ESN+ GYIAV+TDEGK +LGRRDI++
Sbjct  75   KYRVTKFFYATASIPL--PDAFIVKSFSREAWSKESNFMGYIAVSTDEGKASLGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + +E + D+  + + AP IFG         PLVH GFY++YT+    SQ N+ S
Sbjct  133  NWRGTIQKMEWVNDLQFLLIPAPKIFGDGGLLHLFKPLVHHGFYNVYTSASSRSQFNQTS  192

Query  346  ARDQI  360
             RDQ+
Sbjct  193  VRDQV  197



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + + P   +A  +ESNW GY+AVATDEGK ALGRRDI+V
Sbjct  91   KYSVTKFLYATS--EIHVPDAFLIKPLSREAWRKESNWIGYVAVATDEGKTALGRRDIVV  148

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT++ LE I D     V+A  + G+ + P VH+G+Y +Y ++   S  N+ SAR Q+
Sbjct  149  AWRGTKQTLEWIDDFEFNLVSASKVLGEANDPKVHQGWYSIYNSSDPRSPFNKKSARHQV  208



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS  P+     + V     +A  +ESN+ GYIAVATDEGKVALGRRDI+V
Sbjct  75   KYRVTKFFYATSSIPL--PDAFIVKSLSREAWSKESNFMGYIAVATDEGKVALGRRDIVV  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-----NSHPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT + LE + D+  + V  P +FG         PLVH GFY++YTT    SQ N+ S
Sbjct  133  NWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLPLLKPLVHHGFYNIYTTEDLRSQFNQAS  192

Query  346  ARDQI  360
            ARDQ+
Sbjct  193  ARDQV  197



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + +     +A  +ESNW G++AV+TDEGKVALGRRDI++
Sbjct  79   KYRVTKFLYATSQVHIS--EAFIIKSLSREAWSKESNWMGFVAVSTDEGKVALGRRDIVI  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D     V+A  I G++ +P VH+G+Y +YT+    S  N+ SARDQ+
Sbjct  137  AWRGTIQILEWVNDFEFNLVSASKILGESGNPKVHQGWYSIYTSDDSRSPYNKNSARDQV  196



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 59/125 (47%), Positives = 79/125 (63%), Gaps = 8/125 (6%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTKYFYATS FP+     + V     +A  +ESN+ GY+AVATD+GK  LGRRDI++ 
Sbjct  76   YHVTKYFYATSSFPL--PEAFMVKSWSREAWSKESNFMGYVAVATDKGKAVLGRRDIVIA  133

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNS------HPLVHKGFYDMYTTTIQDSQLNRMS  345
            WRGT R LE + D+  + V AP +FG  +       PLVH+G+  +YT+    S  N+ S
Sbjct  134  WRGTIRTLEWVNDLQFLLVPAPKVFGGGNSILPLFKPLVHQGWKSIYTSDDPKSPFNKAS  193

Query  346  ARDQI  360
            ARDQ+
Sbjct  194  ARDQV  198



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + + P   +A  +ESNW GY+AVATDEGK ALGRRD++V
Sbjct  91   KYSVTKFLYATS--EIHVPDAFLIKPLSREAWRKESNWIGYVAVATDEGKAALGRRDVVV  148

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT++ LE + D   + V+A  + G+ + P V KG+Y +Y ++   S  N+ SAR Q+
Sbjct  149  AWRGTKQTLEWVDDFEFILVSASKVLGKANDPKVQKGWYSIYNSSDPRSPFNKKSARHQV  208



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + +     +A  +ESNW GY+AVATDEGK  LGRRDI++
Sbjct  102  KYQVTKFLYATS--QIQLPEAFIIKSLSREAWSKESNWMGYVAVATDEGKAVLGRRDIVI  159

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D     V AP IFG+++   VH+G+Y +YT+    S  N+ SARDQ+
Sbjct  160  AWRGTVQTLEWVNDFQFTLVPAPKIFGESNDRKVHQGWYSVYTSDDPRSPYNKSSARDQV  219



>gb|EPS68357.1| hypothetical protein M569_06414, partial [Genlisea aurea]
Length=191

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y VT+Y YATS   +     + V     +A  +ESNW GY+AVATDEG   LGRRDIL+
Sbjct  74   RYRVTRYLYATSNGAMP--DAFLVRSWSREAWSKESNWMGYVAVATDEGVGVLGRRDILI  131

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT R LE + D     V+AP IFG N    VH G+Y +YT++   S  +++SARDQ+
Sbjct  132  AWRGTVRSLEWVNDFQFGLVSAPEIFGGNDEAKVHFGWYSIYTSSDSQSPFSKISARDQV  191



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   +     + V     +A  +ESNW GY+AVATDEGK  LGRRDI++
Sbjct  95   KYSVTKFLYATS--QVQVPDAFIVKSLSREAWSKESNWIGYVAVATDEGKAVLGRRDIVI  152

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D     V+A  I G+   P VH+G+Y +YT+    S  NR+SARDQ+
Sbjct  153  AWRGTVQTLEWVNDFEFDLVSASKILGEKGDPRVHQGWYSIYTSDDSRSPFNRISARDQV  212



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   +     + V     +A  +ESNW GY+AVATDEGK  LGRRDI++
Sbjct  135  KYSVTKFLYATS--QVQVPDAFIVKSLSREAWSKESNWIGYVAVATDEGKAVLGRRDIVI  192

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D     V+A  I G+   P VH+G+Y +YT+    S  NR+SARDQ+
Sbjct  193  AWRGTVQTLEWVNDFEFDLVSASKILGEKGDPRVHQGWYSIYTSDDSRSPFNRISARDQV  252



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   +     + +     +A  RESNW GY+AVATDEGK ALGRRDI++
Sbjct  78   KYNVTKFLYATSRMDVP--EAFIIKSLSREAWSRESNWMGYVAVATDEGKAALGRRDIVI  135

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRG+ + LE I D + + V+A  I G+   P VH+G+  +YT+    +  NR SARDQ+
Sbjct  136  AWRGSLQALEWIDDFSFIMVSASQILGRTIDPFVHQGWLSIYTSDDPRAPFNRTSARDQV  195



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + +     +A  +ESNW G++AV+TDEGKVALGRRDI++
Sbjct  79   KYRVTKFVYATSQVHIS--EAFIIKSLSREAWSKESNWMGFVAVSTDEGKVALGRRDIVI  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D     V+A  I G++ +P VH+G+Y +YT+    S  N+ SARDQ+
Sbjct  137  AWRGTVQTLEWVNDFEFNLVSASKILGESGNPKVHQGWYSIYTSDDSRSPYNKNSARDQV  196



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score =   112 bits (280),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS   I     + V     ++  +ESNW G+IAV TDEGK+ALGRR+IL+
Sbjct  96   KYRVTKYLYATSS--IQVPEAFIVKSLSRESWSKESNWIGFIAVCTDEGKIALGRREILI  153

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + L+ + D+    V+AP IF  N+ P +H+G+Y +YT+    S  N  S RDQ+
Sbjct  154  SWRGTVQTLDWVNDLDFFQVSAPEIFRGNTEPQIHRGWYSIYTSDDPRSPFNNTSVRDQV  213



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS  PI     + +     ++  +ESNW  YIAVATDEGK  LGRRDI++
Sbjct  110  KYNVTKFVYATSQIPIP--EAFLIKSLSRESWCKESNWMAYIAVATDEGKAVLGRRDIVI  167

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D+    V+A  I G+   P VH+G+Y +YT+    S  N+ SAR Q+
Sbjct  168  AWRGTVQSLEWVNDLQFNLVSASNILGEEGDPKVHQGWYSIYTSDDSRSPFNKTSARHQV  227



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS   I     + V     ++  +ESNW G+IAV TDEGK+ALGRR+IL+
Sbjct  87   KYRVTKYLYATSS--IQVPEAFIVKSLSRESWSKESNWIGFIAVCTDEGKIALGRREILI  144

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + L+ + D+    V+AP IF  N+ P +H+G+Y +YT+    S  N  S RDQ+
Sbjct  145  SWRGTVQTLDWVNDLDFFQVSAPEIFRGNTDPQIHRGWYSIYTSEDPRSPFNNTSVRDQV  204



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score =   111 bits (278),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 58/121 (48%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   +     + V     +A  +ESNW GY+AVATDEGK  LGRRDI++
Sbjct  109  KYSVTKFLYATS--QVDVPDAFIVKSLSREAWSKESNWMGYVAVATDEGKAELGRRDIVI  166

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-HPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRGT R LE I D     V+A  I G  +  P VH+G+Y +YT+  Q S+ N+ SAR Q
Sbjct  167  AWRGTVRTLEWINDFEFRLVSASKILGDKAGDPKVHQGWYSIYTSEDQRSRFNKTSARQQ  226

Query  358  I  360
            +
Sbjct  227  V  227



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (64%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS   +     + +     +A  +ESNW GY+ V++DEGK  LGRRDI++
Sbjct  97   KYNVTKYIYATSEMDVPE--AFIIKSFSREAWSKESNWIGYVGVSSDEGKDVLGRRDIVI  154

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQN-SHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRGT R LE + D+  V V+AP +FG N   P VH+G+Y +YT+    S  N+ SAR+Q
Sbjct  155  AWRGTIRSLEWVNDLNFVLVSAPKLFGNNIIDPKVHQGWYSIYTSEDPRSPFNKTSARNQ  214

Query  358  I  360
            +
Sbjct  215  V  215



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   +     + V     +A  +ESNW G++AVATDEGK  LGRRDI++
Sbjct  96   KYRVTKFLYATS--QVQLPEAFIVKSLSREAWSKESNWIGFVAVATDEGKTTLGRRDIVI  153

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D    FV+A  I G++  P VH+G+Y +YT+    S  N+ SARDQ+
Sbjct  154  AWRGTIQTLEWVNDFEFNFVSASKILGESGDPKVHQGWYSIYTSDDSRSPYNKNSARDQV  213



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KYEVTKY YATS   +       +     +A  +ESNW G++AVATDEGKVALGRRDI++
Sbjct  115  KYEVTKYIYATSSVQV--PEALIIKSLSREAWSKESNWVGFVAVATDEGKVALGRRDIVI  172

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFG-QNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + +E   D   + V+AP IFG Q S P VH G+Y +YT+    S  ++ SAR+Q
Sbjct  173  SWRGSVQTMEWFNDFDFIQVSAPEIFGHQKSIPKVHHGWYSVYTSNDSRSPFSKASARNQ  232

Query  358  I  360
            +
Sbjct  233  V  233



>gb|EPS70940.1| hypothetical protein M569_03817 [Genlisea aurea]
Length=397

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS   I     +        A  +ESNW GY+AVATDEGKVALGRRD++V
Sbjct  82   KYRVTKYIYATSS--IALPLSFLCKSLSEKAWSKESNWIGYVAVATDEGKVALGRRDVVV  139

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT   +E + D+    V A  +FG++    VH+GF  +YT+T +   ++R SARDQ+
Sbjct  140  AWRGTIMPMEWVNDLEFPLVPASELFGESGVANVHQGFLSLYTSTNESVSVSRTSARDQV  199



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 79/125 (63%), Gaps = 8/125 (6%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y +TKYFYATS FP+     + +     +A  +ESN+ G++AVATD+GK  LGRRDI++ 
Sbjct  76   YHITKYFYATSSFPL--PEAFMIRSWSREAWSKESNFMGFVAVATDKGKAVLGRRDIVIA  133

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNS------HPLVHKGFYDMYTTTIQDSQLNRMS  345
            WRGT R LE + D+  + V AP +FG  +       PLVH+G+  +YT+    S  N+ S
Sbjct  134  WRGTIRTLEWVNDLQFLLVPAPKVFGAGNSILPLLKPLVHQGWNSVYTSDDPRSPFNKAS  193

Query  346  ARDQI  360
            ARDQ+
Sbjct  194  ARDQV  198



>ref|XP_009777407.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 76/119 (64%), Gaps = 7/119 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYAT+  P+     + V     +A  +ESN+ GYIAVATDEGKVALGRRDI+V
Sbjct  75   KYRVTKFFYATASIPL--PDAFIVKSLSREAWSKESNFMGYIAVATDEGKVALGRRDIVV  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRM  342
             WRGT + LE + D+  + V  P +FG         PLVH GFY++YTT    SQ N++
Sbjct  133  NWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLSLLQPLVHHGFYNIYTTEDPRSQFNQV  191



>ref|XP_009757709.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS  P+    G+ V    ++A  ++SN+ GY+AVATDEGKV LGRRDI++
Sbjct  75   KYRVTKFFYATSSIPL--PDGFFVRSLSLEAWSKDSNFMGYVAVATDEGKVELGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-----NSHPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT   LE + +     V AP +FG         PLVH GFY++YTT    SQ N+ S
Sbjct  133  AWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQPLVHHGFYNIYTTDNPRSQFNQTS  192

Query  346  ARDQI  360
             RDQ+
Sbjct  193  VRDQV  197



>ref|XP_009757707.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=394

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS  P+    G+ V    ++A  ++SN+ GY+AVATDEGKV LGRRDI++
Sbjct  75   KYRVTKFFYATSSIPL--PDGFFVRSLSLEAWSKDSNFMGYVAVATDEGKVELGRRDIVI  132

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-----NSHPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRGT   LE + +     V AP +FG         PLVH GFY++YTT    SQ N+ S
Sbjct  133  AWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQPLVHHGFYNIYTTDNPRSQFNQTS  192

Query  346  ARDQI  360
             RDQ+
Sbjct  193  VRDQV  197



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + +     ++  +ESNW GY+AVATDEGK ALGRRDI++
Sbjct  110  KYNVTKFVYATS--QIQVPEAFLIKSLSRESWCKESNWMGYVAVATDEGKAALGRRDIVI  167

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D+    V+A  + G++  P VH+G+Y +YT+    S  N+ SAR Q+
Sbjct  168  AWRGTVQSLEWVNDLQFNLVSASKLLGEDGDPKVHEGWYSIYTSDDSRSPFNKTSARYQV  227



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score =   110 bits (274),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS   I     + V     +A  +ESNW GYIAVATDEG   LGRRDI++
Sbjct  80   KYTVTKFFYATS--QIQLPEAFIVKSLSREAWSKESNWMGYIAVATDEGTAVLGRRDIVI  137

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSH-PLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRGT R LE + D+  V V+A  + G++ + P VH+G++ +YT+    S  N+ SARDQ
Sbjct  138  AWRGTVRTLEWVDDLEFVLVSASDLLGESGNDPKVHQGWHSVYTSDDPLSPFNKSSARDQ  197

Query  358  I  360
            +
Sbjct  198  V  198



>ref|XP_010518796.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + V P   +   +ESNW GY+AV TDEG   LGRRDI+V
Sbjct  80   KYQVTKFLYATS--QIEVPDSFLVFPVSREGRTKESNWMGYVAVTTDEGTELLGRRDIVV  137

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPL-VHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE I D   V V+A  IFG+ S  + VH+G+Y +YT++ + S  N+ SARDQ
Sbjct  138  AWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGVQVHQGWYSIYTSSDERSPFNKSSARDQ  197

Query  358  I  360
            +
Sbjct  198  V  198



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 77/121 (64%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ Y+TS   I     + V P   +   +ESNW GY+AVATD+GK  LGRRDI+V
Sbjct  102  KYQVTKFLYSTS--QISVPDSFLVFPVSREGWTKESNWIGYVAVATDQGKQVLGRRDIVV  159

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPL-VHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRGT + LE I D     +NA  IFG N   + VH+G+Y +YT+  + S  N+ SARDQ
Sbjct  160  AWRGTIQTLEWINDFDFGTINAKKIFGDNGDGVGVHQGWYSIYTSEDERSPFNKASARDQ  219

Query  358  I  360
            +
Sbjct  220  V  220



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + V P   +   +ESNW GY+AV TDEG   LGRRDI+V
Sbjct  80   KYQVTKFLYATS--QIEVPDSFLVFPVSREGRTKESNWMGYVAVTTDEGTELLGRRDIVV  137

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPL-VHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE I D   V V+A  IFG+ S  + VH+G+Y +YT++ + S  N+ SARDQ
Sbjct  138  AWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGVQVHQGWYSIYTSSDERSPFNKSSARDQ  197

Query  358  I  360
            +
Sbjct  198  V  198



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + +     +A  RESNW GY+AVATDEGK  LGRRDI+V
Sbjct  79   KYQVTKFLYATS--RIEVPEAFIIKSLSREAWSRESNWMGYVAVATDEGKAVLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT   LE + D +   V+A  I G  + P VH+G+  +YT+    S  N+ SARDQ+
Sbjct  137  AWRGTVEDLEWVDDFSFNLVSASEILGGTNDPKVHQGWLSIYTSDDPRSPFNKASARDQV  196



>emb|CBI21954.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y  TKY YATS   I   T + + P  +DA  ++SNW G++AVATDEGK ALGRRDI+V 
Sbjct  80   YTPTKYLYATSE--IKVPTAFILKPIPIDAWSKQSNWIGFVAVATDEGKTALGRRDIVVA  137

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRG+ + +E + D      +A +I G+  +P  H+ +  +YT+    S+ N+ SARDQ+
Sbjct  138  WRGSVQIVEWLKDFDFPLASASMIVGEKGNPYAHRCWVSIYTSHDPKSRFNKQSARDQV  196



>ref|XP_010657149.1| PREDICTED: phospholipase A1-IIgamma-like [Vitis vinifera]
Length=407

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y  TKY YATS   I   T + + P  +DA  ++SNW G++AVATDEGK ALGRRDI+V 
Sbjct  80   YTPTKYLYATS--EIKVPTAFILKPIPIDAWSKQSNWIGFVAVATDEGKTALGRRDIVVA  137

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRG+ + +E + D      +A +I G+  +P  H+ +  +YT+    S+ N+ SARDQ+
Sbjct  138  WRGSVQIVEWLKDFDFPLASASMIVGEKGNPYAHRCWVSIYTSHDPKSRFNKQSARDQV  196



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   108 bits (271),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/120 (46%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y VTK+ YATS   I     + V     +A  +ESNW GY+AVATDEGK  LGRRDI++
Sbjct  115  RYNVTKFLYATS--QIQVPEAFIVKSLSREAWSKESNWIGYVAVATDEGKALLGRRDIVI  172

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT R LE + D+    V+A  I G+ +   VH+G+Y +YT+    S  N+ SAR+Q+
Sbjct  173  AWRGTVRSLEWVNDLHFSMVSASNILGEEADAKVHQGWYSIYTSDDSHSPFNKTSARNQV  232



>emb|CDP11819.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 57/120 (48%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+V KY YATS   I     +       D+V +ESN+ GY+AVATDEGK+ALGRRDILV
Sbjct  79   KYKVVKYLYATS--KISVPDAFIEKSLSKDSVCKESNFMGYVAVATDEGKIALGRRDILV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT R +E   D     V A +I G++ +  VHKG   +YT++   S  N+ SAR Q+
Sbjct  137  AWRGTIRNIELAKDFDFPLVPASMILGKDINAKVHKGVLSIYTSSDPQSTYNKQSARVQV  196



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + +     ++  +ESNW GY+AVATDEGK ALGRRDI++
Sbjct  81   KYNVTKFVYATS--QIQVPEAFLIKSLSRESWCKESNWMGYVAVATDEGKAALGRRDIVI  138

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D+    V+   + G++  P VH+G+Y +YT+    S  N+ SAR Q+
Sbjct  139  AWRGTVQSLEWVNDLQFNLVSVSKLLGEDGDPKVHEGWYSIYTSDDSRSPFNKTSARYQV  198



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 79/125 (63%), Gaps = 8/125 (6%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSP--ARVDAVLRESNWNGYIAVATDEGKVALGRRDIL  177
            YEVT++ YATSG P+     + V P  A  D   RESN+ GY+AVATDEG  ALGRRDI+
Sbjct  86   YEVTRFIYATSGQPL--PDAFLVRPLAALKDVWSRESNFMGYVAVATDEGAAALGRRDIV  143

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQ----NSHPLVHKGFYDMYTTTIQDSQLNRMS  345
            V WRGT + LE + D+T   V A  + G+    N   +VH GF  +YT++   S+ N+ S
Sbjct  144  VAWRGTVQSLEWVNDLTFTPVPAAPVLGKKAAANPLAMVHMGFLSLYTSSHAGSKFNKTS  203

Query  346  ARDQI  360
            ARDQ+
Sbjct  204  ARDQV  208



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS   I    G+ +     +A  +ESNW GY+AVATDEGK  LGRRDI++
Sbjct  93   KYYVTKYLYATS--EIQVPDGFILKSLSREAWSKESNWMGYVAVATDEGKAVLGRRDIVI  150

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRGT + LE + D     V+A  I G+    P VH+G+Y +YT+    S  ++ SARDQ
Sbjct  151  AWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQGWYSIYTSDDPLSSFSKTSARDQ  210

Query  358  I  360
            +
Sbjct  211  V  211



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + +     ++  +ESNW  Y+AVATDEGK ALGRRDI++
Sbjct  119  KYNVTKFVYATS--QIQVPEAFLIKSLSRESWCKESNWMAYVAVATDEGKAALGRRDIVI  176

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE ++D+    V+A  I  +   P VH+G+Y +YT+    S  N+ SAR Q+
Sbjct  177  AWRGTVQSLEWVSDLQFNLVSASNILSEEGDPKVHQGWYSIYTSNDSHSPFNKTSARHQV  236



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score =   108 bits (269),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 54/120 (45%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + +     ++  +ESNW  YIAVATDEGK  LGRRDI++
Sbjct  110  KYNVTKFVYATS--QIQVPEAFLIKSLSRESWCKESNWMAYIAVATDEGKAVLGRRDIVI  167

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D+    V+A  I G+   P VH+G+Y +YT+    S  N+ SAR Q+
Sbjct  168  AWRGTVQSLEWVNDLQFNLVSASNILGEEGDPKVHQGWYSIYTSDDSRSPFNKTSARHQV  227



>ref|XP_008655897.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=424

 Score =   108 bits (269),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 78/126 (62%), Gaps = 6/126 (5%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPA--RVDAVLRESNWNGYIAVATDEGKVALGRRDI  174
            +Y VTK+ YATSG  +         PA  + +   RESNW GY+AVATDEG  ALGRRD+
Sbjct  83   RYRVTKFVYATSGLHVPDAFLLLPQPALGQQEPWCRESNWMGYVAVATDEGAAALGRRDV  142

Query  175  LVVWRGTRRFLEAITDITLVFVNAPLIFGQ--NSHP--LVHKGFYDMYTTTIQDSQLNRM  342
            +V WRGT R LE + D+    V A  + G    +HP  +VH GF  +YT++   S+ N++
Sbjct  143  VVAWRGTVRSLEWVNDLDFTPVPAAPVLGSAAAAHPRAMVHGGFLSLYTSSNASSKYNKL  202

Query  343  SARDQI  360
            SARDQ+
Sbjct  203  SARDQV  208



>ref|NP_001132361.1| uncharacterized protein LOC100193806 precursor [Zea mays]
 gb|ACF81176.1| unknown [Zea mays]
 gb|AFW74937.1| hypothetical protein ZEAMMB73_515693 [Zea mays]
Length=427

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 77/125 (62%), Gaps = 5/125 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPI-GARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDIL  177
            +Y VT++ YATS  P+ G+       P   +A  RESNW GY+AVATDEG   LGRRD++
Sbjct  101  RYAVTRFVYATSALPVPGSDFPLLPLPETREAWTRESNWIGYVAVATDEGAAELGRRDVV  160

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQ----NSHPLVHKGFYDMYTTTIQDSQLNRMS  345
            V WRGT + LE   D T   V+A  + G     N   +VH+GF  +YT++  DS+ N+ S
Sbjct  161  VAWRGTVKDLEWANDFTFTPVSAAPVLGSAAAANPLAVVHQGFLSVYTSSNADSRFNKAS  220

Query  346  ARDQI  360
            ARDQ+
Sbjct  221  ARDQV  225



>ref|XP_002465238.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
 gb|EER92236.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
Length=423

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 78/127 (61%), Gaps = 7/127 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPA---RVDAVLRESNWNGYIAVATDEGKVALGRRD  171
            +Y VTK+ YATSG  +         P    +  A  RESNW GY+AVATDEG   LGRRD
Sbjct  84   RYRVTKFVYATSGLQVPDAFLLLPQPGLQGQEPAWCRESNWMGYVAVATDEGAAELGRRD  143

Query  172  ILVVWRGTRRFLEAITDITLVFVNAPLIFG--QNSHP--LVHKGFYDMYTTTIQDSQLNR  339
            ++V WRGT R LE + D+    V A  + G   ++HP  +VH+GF  +YT++   S+ N+
Sbjct  144  VVVAWRGTVRSLEWVNDLDFTPVPAAPVLGAAADTHPRAMVHRGFLSLYTSSNASSKYNK  203

Query  340  MSARDQI  360
            +SARDQ+
Sbjct  204  LSARDQV  210



>ref|XP_011100290.1| PREDICTED: phospholipase A1-IIgamma-like [Sesamum indicum]
Length=395

 Score =   107 bits (268),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 58/124 (47%), Positives = 73/124 (59%), Gaps = 6/124 (5%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y+  KY YATSG  I     + + P       +ESNW GYIAVATDEGK ALGRRDIL+
Sbjct  79   RYKAVKYIYATSGPGISLPESFILKPLSEKTWYKESNWMGYIAVATDEGKAALGRRDILI  138

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ----NSHPLVHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT   +E   D     V A  I G+    N+H  VH+GF  +YT T   S+ ++ SA
Sbjct  139  AWRGTIMPIEWEKDFEFPLVPASKILGKCGGSNAH--VHQGFLSIYTATNPRSKYSKTSA  196

Query  349  RDQI  360
            RDQ+
Sbjct  197  RDQV  200



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 76/121 (63%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+FYATS   I     + +     +A  +ESNW GY+AVATDEGK  LGRRD++V 
Sbjct  80   YRVTKFFYATSS--IDVPEAFLIKSLSREAWSKESNWMGYVAVATDEGKKVLGRRDVVVA  137

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNS--HPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT + LE I D+    V+A  I G+ S  +P VH+G+  +YT+    S  N+ SARDQ
Sbjct  138  WRGTVQALEWINDLDFTLVSASAILGKGSSGNPQVHRGWLSIYTSNDPRSPYNKDSARDQ  197

Query  358  I  360
            +
Sbjct  198  V  198



>ref|XP_004960509.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=420

 Score =   107 bits (267),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 5/124 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAV-LRESNWNGYIAVATDEGKVALGRRDILV  180
            Y VTK+FYATS  P+         P   DA   RESNW GY+AVATDEG   LGRRDI+V
Sbjct  101  YAVTKFFYATSAVPVPESVLLLPLPELGDAAWCRESNWIGYVAVATDEGVAELGRRDIVV  160

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQN--SHPL--VHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT   LE   D +   V+A  + G +  ++PL  VH+GF  +YT++  +S+ N+ SA
Sbjct  161  AWRGTVTDLEWANDFSFTPVSAAPVLGSSAAANPLAMVHQGFLSVYTSSNANSKYNKASA  220

Query  349  RDQI  360
            RDQ+
Sbjct  221  RDQV  224



>ref|XP_003574515.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=438

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 78/123 (63%), Gaps = 4/123 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y+VT++ YATS  P+         P+  DA  R+SNW GY+AVATDEG  ALGRRDI+V 
Sbjct  116  YKVTRFIYATSSIPLPESFLCLPLPSLPDAWSRDSNWIGYVAVATDEGAEALGRRDIVVA  175

Query  184  WRGTRRFLEAITDITLVFVNAPLIF----GQNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            WRGT + LE + D+    V+A  +     G+N   +VH+GF  +YT++ + S+  + SAR
Sbjct  176  WRGTVKNLEWVNDLDFTPVSAAPVLGSAAGKNRLAVVHRGFLSVYTSSNKSSKFTKTSAR  235

Query  352  DQI  360
            DQ+
Sbjct  236  DQV  238



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 76/123 (62%), Gaps = 4/123 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y+VTK+ YATS  P+         P+  D   RESNW GY+AVATDEG  ALGRRDI+V 
Sbjct  114  YQVTKFVYATSSLPLPESFLLLPLPSLPDVWSRESNWMGYVAVATDEGAAALGRRDIVVA  173

Query  184  WRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            WRGT + LE + D+    V A  + G    QN   +VH+GF  +YT++ + S+  + SA+
Sbjct  174  WRGTIKNLEWVNDLDFTPVPAAPVLGSAASQNRFAVVHRGFLSVYTSSNKSSEFTKTSAK  233

Query  352  DQI  360
            +Q+
Sbjct  234  EQV  236



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + +     +A  RESNW GY+AVATDEGK  LGRRDIL+
Sbjct  79   KYNVTKFLYATS--RIDVPDAFIIKSLSREAWSRESNWMGYVAVATDEGKAVLGRRDILI  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRG+ + LE I D   + V+A  I G  + P VH+G+  +YT+    S  N  SAR Q+
Sbjct  137  AWRGSVQALEWINDFNFILVSASGILGTKNDPNVHQGWLSIYTSDDPRSAYNTTSARQQV  196



>ref|XP_006362439.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=419

 Score =   107 bits (266),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 73/122 (60%), Gaps = 14/122 (11%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KYEVTKY Y  S  P                 ++ SNW G++AVATD+GKVALGRRDIL+
Sbjct  106  KYEVTKYIYGASDVPSKTEK------------IKSSNWIGFVAVATDDGKVALGRRDILI  153

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHP-LVHKGFYDMYTTTIQDSQLNR-MSARD  354
             WRGT    E   D   V V    IFG+N+H  LVH+GFY +YT+  + S+ NR  SARD
Sbjct  154  AWRGTMSPAEWNDDYDWVLVPPTKIFGENTHDILVHRGFYSVYTSLNEASKFNRTTSARD  213

Query  355  QI  360
            Q+
Sbjct  214  QV  215



>tpg|DAA45463.1| TPA: hypothetical protein ZEAMMB73_472202 [Zea mays]
Length=448

 Score =   107 bits (266),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 58/125 (46%), Positives = 77/125 (62%), Gaps = 6/125 (5%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPA--RVDAVLRESNWNGYIAVATDEGKVALGRRDI  174
            +Y VTK+ YATSG  +         PA  + +   RESNW GY+AVATDEG  ALGRRD+
Sbjct  83   RYRVTKFVYATSGLHVPDAFLLLPQPALGQQEPWCRESNWMGYVAVATDEGAAALGRRDV  142

Query  175  LVVWRGTRRFLEAITDITLVFVNAPLIFGQ--NSHP--LVHKGFYDMYTTTIQDSQLNRM  342
            +V WRGT R LE + D+    V A  + G    +HP  +VH GF  +YT++   S+ N++
Sbjct  143  VVAWRGTVRSLEWVNDLDFTPVPAAPVLGSAAAAHPRAMVHGGFLSLYTSSNASSKYNKL  202

Query  343  SARDQ  357
            SARDQ
Sbjct  203  SARDQ  207



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 5/123 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   I     + +     +A  +ESNW G++AVA DEGK  LGRRDI++
Sbjct  94   KYSVTKFIYATS--EINVPEAFIIKSLSREAWSKESNWIGFVAVANDEGKDVLGRRDIVI  151

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSH---PLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT + LE + D+  + V+AP +FG +++   P VH+G+Y +YT+    S  ++ SAR
Sbjct  152  AWRGTIQTLEWVNDLQFLLVSAPKVFGNSNNINDPKVHQGWYSIYTSEDPRSPFSKTSAR  211

Query  352  DQI  360
            +Q+
Sbjct  212  NQV  214



>gb|EMT05578.1| hypothetical protein F775_13080 [Aegilops tauschii]
Length=414

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 80/132 (61%), Gaps = 13/132 (10%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVS--------PARVDAV-LRESNWNGYIAVATDEGKVA  156
            Y VTK+ YATSGF +   TG +V         P+ ++    RES+W GY+AVATDEG  A
Sbjct  82   YSVTKFIYATSGFFLAPTTGTSVPDAFFVLPLPSLLEEPWCRESHWMGYVAVATDEGVAA  141

Query  157  LGRRDILVVWRGTRRFLEAITDITLVFVNAPLIFGQNS----HPLVHKGFYDMYTTTIQD  324
            LGRRDI+V WRGT   LE + D+     +A  + G  +      +VH GF  +YT++ +D
Sbjct  142  LGRRDIVVAWRGTVESLEWVNDLDFTPASAEPVLGPAAGDFDSAVVHHGFLSVYTSSDED  201

Query  325  SQLNRMSARDQI  360
            S+ N+ SARDQ+
Sbjct  202  SKFNQQSARDQV  213



>ref|XP_004232958.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=419

 Score =   106 bits (264),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 72/122 (59%), Gaps = 14/122 (11%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KYEVTKY Y  S  P                 ++ SNW G++AVATDEGKVALGRRDIL+
Sbjct  106  KYEVTKYIYGASDVPSKTEK------------IKSSNWIGFVAVATDEGKVALGRRDILI  153

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSH-PLVHKGFYDMYTTTIQDSQLNRM-SARD  354
             WRGT    E   D   V V    IFG+N+H  LVH+GFY +YT+    S+ NR  SARD
Sbjct  154  AWRGTMCPAEWNDDSDWVLVPPTKIFGENTHDTLVHRGFYSVYTSLNDASKFNRTASARD  213

Query  355  QI  360
            Q+
Sbjct  214  QV  215



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 3/119 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+FYATSG  +     + +      A  ++SNW GY+AVATDEG   LGRRD+LV 
Sbjct  80   YRVTKFFYATSGVQV--PDAFIIKSLSRQAWSKDSNWMGYVAVATDEGAAQLGRRDVLVA  137

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRGT   LE I D+    V AP + G +S PLVH+G+  +YT+    S  ++ SAR+Q+
Sbjct  138  WRGTLLPLEWINDLDFTMVPAPEVLGSSS-PLVHRGWLSIYTSEDPKSPYSKSSARNQV  195



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY +TK+ YATSG  +     + +     +A  +ESNW GYIAVATDEGK ALGRRDI++
Sbjct  79   KYNITKFLYATSGIEVS--EAFLLRSLSREAWNKESNWIGYIAVATDEGKAALGRRDIVI  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D     V A  +FG ++   VHKG+  +YT+    S  N  SAR Q+
Sbjct  137  AWRGTIQALEWVNDFEFPLVPADKLFGASNDSKVHKGWLSIYTSQDARSPFNTNSARQQV  196



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y+VTK+ YATS   I     + V  +  +A  +ESNW GY+AVATDEGK  LGRRDI++
Sbjct  96   RYQVTKFLYATS--QIQLPEAFIVKSSSREAWSKESNWIGYVAVATDEGKDVLGRRDIVI  153

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPL-VHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRGT + LE I DI    V+   IFG     + VH+G+Y +YT+    S  N+ SARDQ
Sbjct  154  AWRGTVQTLEWINDIEFNLVSPEKIFGHERRDIKVHEGWYSIYTSEDSRSPYNKSSARDQ  213

Query  358  I  360
            +
Sbjct  214  V  214



>ref|XP_006655614.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-II 7-like [Oryza 
brachyantha]
Length=416

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 57/124 (46%), Positives = 75/124 (60%), Gaps = 5/124 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPI-GARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            Y VTK+ YATSG P+  A     +      A  + SNW GY+AVATDEG  ALGRRDI+V
Sbjct  90   YRVTKFVYATSGLPVPEAFLVLPLPSLLPPAWSKVSNWMGYVAVATDEGVAALGRRDIVV  149

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT   LE + D+    V A  + G     N   +VH+GF  +YT++ +DS+ N+ SA
Sbjct  150  AWRGTMESLEWVNDLDFTPVPAAPVLGPAAAANPLAIVHRGFLSVYTSSNKDSKYNQSSA  209

Query  349  RDQI  360
            RDQ+
Sbjct  210  RDQV  213



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 55/120 (46%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY +TK+ YATSG  +     + +     +A  +ESNW GYIAVATDEGK ALGRRDI++
Sbjct  160  KYNITKFLYATSGIEVSE--AFLLRSLSREAWNKESNWIGYIAVATDEGKAALGRRDIVI  217

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + LE + D     V A  +FG  +   VHKG+  +YT+    S  N  SAR Q+
Sbjct  218  AWRGTVQALEWVNDFEFPLVPADKLFGAANDSKVHKGWLSIYTSQDARSPFNINSARQQV  277



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y+  KY YATS   I     + + P   DA  RESNW GYIAVATD+GK ALGRRDI + 
Sbjct  81   YQPVKYLYATSK--IDVPESFILKPLSRDAWNRESNWIGYIAVATDQGKQALGRRDITIA  138

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRGT + LE I D      +A  I G      VH+GF  +YT+    SQ N+ S R+QI
Sbjct  139  WRGTIQPLEWIKDFDFPLTSASDIVGVEKDAQVHQGFLSIYTSDNPQSQFNKTSVREQI  197



>ref|XP_007025432.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY28054.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=406

 Score =   104 bits (260),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 58/121 (48%), Positives = 70/121 (58%), Gaps = 13/121 (11%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLR-ESNWNGYIAVATDEGKVALGRRDIL  177
            KY+VTK+FYA S   I            +D     ESNW GY+AV TDEGK  LGRRDIL
Sbjct  88   KYKVTKFFYARSEIQI------------LDWFAAVESNWIGYVAVTTDEGKAVLGRRDIL  135

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            + WRGT R LE I DI    V+A  I G N  P VH G++ +YT     S  N+ SAR+Q
Sbjct  136  ICWRGTMRNLEVINDIKADLVSAADILGDNGDPKVHHGWHSIYTAKDSKSVYNQASAREQ  195

Query  358  I  360
            +
Sbjct  196  V  196



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   +     + V     +A  +ESNW GY+AV+TDEG   LGRRD+++
Sbjct  122  KYRVTKFLYATS--QVQVPDAFIVRSLSREAWSKESNWIGYVAVSTDEGAAELGRRDVVI  179

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT R LE I D     V+AP IFG++S   +H+G+Y +YT+  + S     S R+Q+
Sbjct  180  AWRGTVRSLEWIDDFEFGLVSAPQIFGESSDVKIHQGWYSIYTSDDRRSPFTNNSVRNQV  239



>ref|XP_003528482.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31003.1| Phospholipase A1-IIgamma [Glycine soja]
Length=408

 Score =   104 bits (259),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 56/120 (47%), Positives = 71/120 (59%), Gaps = 3/120 (3%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YAT     GA   + +     DA  +ESNW GY+AVATDEGK ALGRRDI+V
Sbjct  78   KYVVTKFLYATC--KAGASESFILKSFNKDAWSQESNWIGYVAVATDEGKAALGRRDIVV  135

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT    E + D+     +APLIF  ++   VH GFY +YT+    S+ N    R Q+
Sbjct  136  AWRGTINAAEWVQDLHFHLDSAPLIF-DDARAKVHHGFYSVYTSNKPGSEFNDTCVRHQV  194



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ +ATS   I     + + P   +   +ESNW GY+AV  D+G  ALGRRDI+V
Sbjct  109  KYKVTKFLFATS--QIHVPESFLLFPVSREGCTKESNWIGYVAVTDDQGTAALGRRDIVV  166

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D    FVNA  IFG+ N    +H+G+Y +Y +  + S  N+ +ARDQ
Sbjct  167  AWRGSVQPLEWVNDFEFGFVNAKKIFGEKNDQVQIHQGWYSIYMSKDERSPFNKANARDQ  226

Query  358  I  360
            +
Sbjct  227  V  227



>ref|XP_002456058.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
 gb|EES01178.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
Length=436

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 73/123 (59%), Gaps = 6/123 (5%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YE T+Y YAT+   +  R    + P       RE NW GY+AVATD+G  ALGRRDI+V 
Sbjct  80   YEATRYLYATASAEV--RGKVLLRPLCRQGRARECNWMGYVAVATDQGAAALGRRDIVVA  137

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN----SHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            WRGT+R LE + D+ L   +A  I G      S P VH+G+  +YT+  + S L++ SAR
Sbjct  138  WRGTQRALEWVADLKLALASAAGILGPEGAGGSDPSVHRGYLSLYTSADEGSNLSKQSAR  197

Query  352  DQI  360
             Q+
Sbjct  198  MQV  200



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  111  KYKVTKFLYATS--QIHVPESFLLFPMSREGWTKESNWMGYVAVTDDQGTAILGRRDIVV  168

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-HPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE ++D     VNA  IFG N+ H  +H+G+Y +Y +  + S  N+ +ARDQ
Sbjct  169  AWRGSVQPLEWVSDFDFSLVNANKIFGDNNDHVQIHQGWYSIYMSQDERSHFNKANARDQ  228

Query  358  I  360
            +
Sbjct  229  V  229



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KYEVT++ YATS     A   + +     D    ESNW GY+AVATDEGK ALGRRDI+V
Sbjct  80   KYEVTEFLYATS--KATASKQFALKLFSKDEWGMESNWIGYVAVATDEGKAALGRRDIVV  137

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT +  E + D+ +    APLIF +++   +H GFY +YT+   DS + + SAR+Q+
Sbjct  138  AWRGTVQGSEWVQDLHIPLDPAPLIF-RDARAELHNGFYSVYTSNNPDSHITQTSARNQV  196



>ref|XP_004232955.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Solanum lycopersicum]
Length=408

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 60/121 (50%), Positives = 73/121 (60%), Gaps = 17/121 (14%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YE+TKY YA S     ++T  T          +ESNW G++AVATDEGKVALGRRDIL+ 
Sbjct  104  YEITKYVYAAS-----SKTEET----------KESNWIGFVAVATDEGKVALGRRDILIA  148

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN-SHPLVHKGFYDMYTTTIQDSQLNR-MSARDQ  357
            WRGT+   E   D     V    IFG+N  + LVHKGFY +YT   + S  NR  SARDQ
Sbjct  149  WRGTKTKSEMNEDDKWSLVQPSKIFGENRDNILVHKGFYSVYTCLNEASNFNRTTSARDQ  208

Query  358  I  360
            +
Sbjct  209  V  209



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 74/127 (58%), Gaps = 10/127 (8%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YE T+Y YAT+   +  R    + P   +   RE NW GY+AVATDEG  ALGRRDI+V 
Sbjct  80   YEATRYLYATASAEV--RGKVLLRPLCRERCARECNWMGYVAVATDEGAAALGRRDIVVA  137

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN--------SHPLVHKGFYDMYTTTIQDSQLNR  339
            WRGT+R LE + D+ L   +A  I G          S P VH+G+  +YT+  + S L++
Sbjct  138  WRGTQRALEWVADLKLALASAAGILGPEGGGGGSGGSDPSVHRGYLSLYTSDYEGSNLSK  197

Query  340  MSARDQI  360
             SAR Q+
Sbjct  198  QSARMQV  204



>ref|XP_004969328.1| PREDICTED: phospholipase A1-II 2-like [Setaria italica]
Length=425

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/123 (45%), Positives = 74/123 (60%), Gaps = 6/123 (5%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y  T+Y YAT+   +  R    +SP       RE NW GY+AVATDEG  ALGRRDI+V 
Sbjct  97   YAATRYIYATASAEV--RGEALLSPLCRHGRARECNWMGYVAVATDEGAAALGRRDIVVA  154

Query  184  WRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            WRGT+R LE + D+ L   +A  I G      S P VH+G+  +YT+  + S+L++ SAR
Sbjct  155  WRGTQRALEWVADLKLALASAAGILGPEGADGSDPSVHRGYLSLYTSADEGSKLSKKSAR  214

Query  352  DQI  360
             Q+
Sbjct  215  MQV  217



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   +     + V     +A  +ESNW GY+AV TDEG   LGRRD+++
Sbjct  122  KYRVTKFLYATS--QVQVPDAFIVRSLSREAWSKESNWIGYVAVGTDEGAAELGRRDVVI  179

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT R LE + D     V+AP IFG++S   +H+G+Y +YT+  + S     S R+Q+
Sbjct  180  AWRGTVRSLEWMDDFEFGLVSAPKIFGESSDVKIHQGWYSIYTSDDRRSPFTNNSVRNQV  239



>ref|XP_004505132.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Cicer arietinum]
Length=401

 Score =   102 bits (255),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 72/120 (60%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY +TK+ YATS     + +    S    DA   ESNW GY+AVATDEGKV+LGRRDI+V
Sbjct  78   KYSITKFIYATSKAS-DSESFLLRSILSKDAWSMESNWIGYVAVATDEGKVSLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT +  E I D      +APLIFG  S   +H GFY +YT+     Q    SAR+Q+
Sbjct  137  AWRGTIQGSEWIKDFHFHLDSAPLIFGLQSPVQIHNGFYSLYTSDNPGFQSANSSARNQV  196



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS   +     + V     +A  +ESNW GY+AV TDEG   LGRRD+++
Sbjct  116  KYRVTKFLYATS--QVQVPDAFIVRSLSREAWSKESNWIGYVAVGTDEGAAELGRRDVVI  173

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT R LE + D     V+AP IFG++S   +H+G+Y +YT+  + S     S R+Q+
Sbjct  174  AWRGTVRSLEWMDDFEFGLVSAPKIFGESSDVKIHQGWYSIYTSDDRRSPFTNNSVRNQV  233



>ref|NP_001151242.1| triacylglycerol lipase [Zea mays]
 gb|ACG42106.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 6/123 (5%)
 Frame = +1

Query  10   VTKYFYATSGFP--IGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            VT++ YATS  P    A     +     ++  RESNW GY+AVATD+G  ALGRRDILV 
Sbjct  81   VTRFIYATSALPGVPEAFLLLPLPDLLPESWSRESNWMGYVAVATDDGVAALGRRDILVA  140

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQ----NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            WRGT R LE + D     V+A  + G     N   LVH+GF  +YT++  DS+ N+ SAR
Sbjct  141  WRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFALVHRGFLSVYTSSNPDSKYNQTSAR  200

Query  352  DQI  360
            DQ+
Sbjct  201  DQV  203



>ref|XP_008647947.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
 gb|ACN26514.1| unknown [Zea mays]
 gb|AFW79274.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 6/123 (5%)
 Frame = +1

Query  10   VTKYFYATSGFP--IGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            VT++ YATS  P    A     +     ++  RESNW GY+AVATD+G  ALGRRDILV 
Sbjct  81   VTRFIYATSALPGVPEAFLLLPLPDLLPESWSRESNWMGYVAVATDDGVAALGRRDILVA  140

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQ----NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            WRGT R LE + D     V+A  + G     N   LVH+GF  +YT++  DS+ N+ SAR
Sbjct  141  WRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFALVHRGFLSVYTSSNPDSKYNQTSAR  200

Query  352  DQI  360
            DQ+
Sbjct  201  DQV  203



>ref|XP_004961147.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=406

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 74/124 (60%), Gaps = 5/124 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIG-ARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            Y VTK+ YATS  P+  A     +     ++  RESNW GY+AVATD G  ALGRRDILV
Sbjct  85   YSVTKFIYATSALPVPEAFLVLPLPDLLPESWSRESNWMGYVAVATDAGVAALGRRDILV  144

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ----NSHPLVHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT R LE + D     V+A  + G     N   LVH+GF  +Y ++  DS+ N+ SA
Sbjct  145  AWRGTMRNLEWVNDFDFTPVSAAPVLGSAAAANPAALVHRGFLSVYRSSNPDSKYNQSSA  204

Query  349  RDQI  360
            RDQ+
Sbjct  205  RDQV  208



>dbj|BAJ90094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 76/124 (61%), Gaps = 4/124 (3%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
             Y+VTK+ YATS  P+ +       P+  D   RESNW GY+AVATDEG   LGRRDI+V
Sbjct  39   NYQVTKFIYATSSLPLPSSFLLLPLPSLPDVWSRESNWMGYVAVATDEGAAKLGRRDIVV  98

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT + +E + D+  V V A  + G    QN   +VH GF  MYT++ + S+  + SA
Sbjct  99   AWRGTVQNMEWVNDLDFVPVPAAPVLGSAASQNRLAVVHHGFLSMYTSSNKSSEFTKTSA  158

Query  349  RDQI  360
            RDQ+
Sbjct  159  RDQV  162



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 75/121 (62%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+FYATS   I     + +     +A  +ESNW GY+AVATDEGK  LGRRD++V 
Sbjct  80   YRVTKFFYATSS--IDVPDAFLIRSLSREAWSKESNWMGYVAVATDEGKKVLGRRDVVVA  137

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQ--NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT + LE I D+    V+A  I G+  +  P VH+G+  +YT+    S  N+ SAR+Q
Sbjct  138  WRGTVQALEWINDLDFTLVSASGILGKGYSGDPQVHRGWLSIYTSDDPRSPYNKDSARNQ  197

Query  358  I  360
            +
Sbjct  198  V  198



>gb|EYU17473.1| hypothetical protein MIMGU_mgv1a008748mg [Erythranthe guttata]
Length=363

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 76/124 (61%), Gaps = 6/124 (5%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKYFYA S           V     +A  +ESNW G++AVATDEG++ALGRRDIL+
Sbjct  42   KYRVTKYFYAASS--SLVLGSLLVVSLSREAWSKESNWMGFVAVATDEGRLALGRRDILI  99

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSH----PLVHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT + LE + D+    V+AP IFG+ ++    P VH G+  +YT+    S  N+ SA
Sbjct  100  SWRGTIQNLEWVNDLQFELVSAPEIFGETNNEGDEPKVHLGWRSIYTSDDPKSPFNKTSA  159

Query  349  RDQI  360
            R Q+
Sbjct  160  RHQV  163



>dbj|BAJ95995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 76/124 (61%), Gaps = 4/124 (3%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
             Y+VTK+ YATS  P+ +       P+  D   RESNW GY+AVATDEG   LGRRDI+V
Sbjct  114  NYQVTKFIYATSSLPLPSSFLLLPLPSLPDVWSRESNWMGYVAVATDEGAAKLGRRDIVV  173

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT + +E + D+  V V A  + G    QN   +VH GF  MYT++ + S+  + SA
Sbjct  174  AWRGTVQNMEWVNDLDFVPVPAAPVLGSAASQNRLAVVHHGFLSMYTSSNKSSEFTKTSA  233

Query  349  RDQI  360
            RDQ+
Sbjct  234  RDQV  237



>ref|XP_010316799.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Solanum lycopersicum]
Length=410

 Score =   102 bits (253),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 60/120 (50%), Positives = 72/120 (60%), Gaps = 17/120 (14%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YE+TKY YA S     ++T  T          +ESNW G++AVATDEGKVALGRRDIL+ 
Sbjct  104  YEITKYVYAAS-----SKTEET----------KESNWIGFVAVATDEGKVALGRRDILIA  148

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN-SHPLVHKGFYDMYTTTIQDSQLNR-MSARDQ  357
            WRGT+   E   D     V    IFG+N  + LVHKGFY +YT   + S  NR  SARDQ
Sbjct  149  WRGTKTKSEMNEDDKWSLVQPSKIFGENRDNILVHKGFYSVYTCLNEASNFNRTTSARDQ  208



>gb|EMS51987.1| Phospholipase A1-II 3 [Triticum urartu]
Length=423

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +    G+   P  V A   ESNW GY+AVATD G  ALGRRDI+V 
Sbjct  72   YRVTRFIYATSSARL--PEGFMARPLPVGAWSTESNWMGYVAVATDRGAAALGRRDIVVA  129

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN---SHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WR T+R  E  +D+    V A  I G     S P VH+GF  +YT+    S+ NR SAR+
Sbjct  130  WRATKRATEWASDLDFALVPAAGIVGPGRGWSQPYVHRGFLSVYTSKNSTSRFNRRSARE  189

Query  355  QI  360
            Q+
Sbjct  190  QV  191



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 73/122 (60%), Gaps = 5/122 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATSG  +    G  + PA   A   ESNW GY+AVATD G   LGRRD++V 
Sbjct  100  YRVTRFLYATSGARV--PDGIIMRPAPPGAWSLESNWMGYVAVATDAGAARLGRRDVVVA  157

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN---SHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WRGT+R +E   D+ +  V A  + G     S P VH+GF  +Y ++   S+ N+ SAR+
Sbjct  158  WRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYASSNSTSRFNKQSARE  217

Query  355  QI  360
            Q+
Sbjct  218  QV  219



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 76/122 (62%), Gaps = 7/122 (6%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+ YATS   +     + +    +    RESNW GY+AVATD+GK ALGRRDI+V 
Sbjct  82   YRVTKFLYATSS--VAVPEPFILRSVSLGRRCRESNWIGYVAVATDDGKTALGRRDIVVA  139

Query  184  WRGTRRFLEAITDITLVFVNAP---LIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WRGT + LE I D+   FV AP   L+  + S   VH+G+  MYT++  +S  N+ SARD
Sbjct  140  WRGTTQALEWINDME--FVMAPPRSLLGDEASEATVHRGWLSMYTSSDPESSHNKDSARD  197

Query  355  QI  360
            Q+
Sbjct  198  QV  199



>ref|XP_003569464.1| PREDICTED: phospholipase A1-II 3-like [Brachypodium distachyon]
Length=418

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +  R  +   P    A   ESNW GY+AVATD    ALGRRD++V 
Sbjct  94   YRVTRFLYATSSARL--RDAFMTRPVPAGAWSTESNWMGYVAVATDGAARALGRRDVVVA  151

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRGT+R +E  +D+ +V V A  + G      VH+GF  +YT+    S+ N+ SAR+Q+
Sbjct  152  WRGTKRMVEWASDLDIVLVPAAGVVGPGGRGSVHRGFLSLYTSKNSTSRFNKQSAREQV  210



>ref|XP_003566945.1| PREDICTED: phospholipase A1-II 2-like [Brachypodium distachyon]
Length=410

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 74/124 (60%), Gaps = 7/124 (6%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTV-SPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            Y VT+Y YAT+   +    G T+  P   D   RE NW GY+A ATDEG   LGRRDI+V
Sbjct  80   YAVTRYVYATACADV--LHGETLLRPLCRDGRARECNWMGYVAAATDEGAARLGRRDIVV  137

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT+R LE + D+ L F +A  I G      S P VH+G+  +YT+    S+L++ SA
Sbjct  138  AWRGTQRALEWVADLKLAFASAAGILGPEGADGSDPSVHRGYLSLYTSADPGSELSKQSA  197

Query  349  RDQI  360
            R Q+
Sbjct  198  RMQV  201



>sp|A2WT96.2|PLA2_ORYSI RecName: Full=Phospholipase A1-II 2 [Oryza sativa Indica Group]
Length=403

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 6/123 (5%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y  T+Y YAT+   +  +    + P   +    E NW GY+AVATDEG  ALGRRDI+V 
Sbjct  74   YAATRYIYATANADVHGKV--LLRPLCREGRATECNWMGYVAVATDEGAAALGRRDIVVA  131

Query  184  WRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            WRGT+R LE + D+ L   +A  I G      + P VH+G+  +YT+  Q S+LN+ SAR
Sbjct  132  WRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLYTSEDQCSELNKQSAR  191

Query  352  DQI  360
             Q+
Sbjct  192  MQV  194



>gb|EMS63790.1| Phospholipase A1-II 7 [Triticum urartu]
Length=515

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 76/124 (61%), Gaps = 4/124 (3%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
             YEVTK+ YATS  P+ +       P+  D   RESNW GY+AVATDEG  ALGRRDI+V
Sbjct  114  NYEVTKFIYATSSLPLPSSFLLLPLPSLPDVWSRESNWMGYVAVATDEGAAALGRRDIVV  173

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT + +E + D+    V A  + G    Q+   +VH GF  MYT++ + S+  + SA
Sbjct  174  AWRGTVQNMEWVNDLDFAPVPAAPVLGSAASQHRLAVVHHGFLSMYTSSNKSSEFTKTSA  233

Query  349  RDQI  360
            RDQ+
Sbjct  234  RDQV  237



>ref|NP_001043730.2| Os01g0651200 [Oryza sativa Japonica Group]
 sp|Q0JKT4.1|PLA2_ORYSJ RecName: Full=Phospholipase A1-II 2 [Oryza sativa Japonica Group]
 dbj|BAF05644.2| Os01g0651200 [Oryza sativa Japonica Group]
Length=408

 Score =   100 bits (248),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 6/123 (5%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y  T+Y YAT+   +  +    + P   +    E NW GY+AVATDEG  ALGRRDI+V 
Sbjct  79   YAATRYIYATANADVHGKV--LLRPLCREGRATECNWMGYVAVATDEGAAALGRRDIVVA  136

Query  184  WRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            WRGT+R LE + D+ L   +A  I G      + P VH+G+  +YT+  Q S+LN+ SAR
Sbjct  137  WRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLYTSEDQCSELNKQSAR  196

Query  352  DQI  360
             Q+
Sbjct  197  MQV  199



>gb|ACG40994.1| triacylglycerol lipase [Zea mays]
Length=223

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +  +  +   PA   A   ESNW GY+AVATD G   LGRRDI+V 
Sbjct  102  YNVTRFLYATSSARVPGQ--FITRPAPPGAWSAESNWMGYVAVATDAGVARLGRRDIVVA  159

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN---SHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WRGT+R +E   D+ +  V A  + G     S P VH+GF  +Y +    S+ N+ SAR+
Sbjct  160  WRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYASRNSTSRFNKQSARE  219

Query  355  QI  360
            Q+
Sbjct  220  QV  221



>gb|EMT11182.1| hypothetical protein F775_27795 [Aegilops tauschii]
Length=474

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
             YEVTK+ YATS  P+ +       P+  D   RESNW GY+AVATDEG  ALGRRDI+V
Sbjct  114  NYEVTKFIYATSSLPLPSSFLLLPLPSLPDVWSRESNWMGYVAVATDEGAAALGRRDIVV  173

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSA  348
             WRGT + +E + D+    V A  + G    Q+   +VH GF  MYT++ + S+  + SA
Sbjct  174  AWRGTVQNMEWVNDLDFAPVPAGPVLGSAASQHRLAVVHHGFLSMYTSSNKSSEFTKTSA  233

Query  349  RDQ  357
            RDQ
Sbjct  234  RDQ  236



>ref|XP_004961148.1| PREDICTED: phospholipase A1-II 6-like [Setaria italica]
Length=409

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 71/120 (59%), Gaps = 4/120 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS  P+     + +  A      RESNW GY+AVATDEGK ALGRRD++V 
Sbjct  84   YRVTRFLYATSSLPVPG--AFILRSASGAGRCRESNWIGYVAVATDEGKAALGRRDVVVA  141

Query  184  WRGTRRFLEAITDITLVFVNAPLIFG--QNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT + LE + D+    V    + G  +    +VH+G+  MYT+    S  N+ SARDQ
Sbjct  142  WRGTVQALEWVEDLEFAMVPPRGLLGDREACDAMVHRGWLSMYTSADPVSSHNQDSARDQ  201



>ref|XP_004232956.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=410

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 73/122 (60%), Gaps = 17/122 (14%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KYE+TKYFY  S              ++ + V + SNW G++AVATDEGKVALGRRDIL+
Sbjct  103  KYEITKYFYGAS--------------SKTEKV-KVSNWIGFVAVATDEGKVALGRRDILI  147

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-HPLVHKGFYDMYTTTIQDSQLNR-MSARD  354
            VWRGT    E   D     V    IF +N+ + LVHKGFY +YT+    S  NR  SARD
Sbjct  148  VWRGTITVSEWNDDFESSMVQPIEIFRENTDNILVHKGFYSIYTSLNHASNFNRTTSARD  207

Query  355  QI  360
            Q+
Sbjct  208  QV  209



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 59/120 (49%), Positives = 70/120 (58%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS     A    T S    DA   ESNW GY+AVATDE K ALGRRDI+V
Sbjct  87   KYSVTKYLYATSKASDSAAFLLT-SIFSKDAWSLESNWIGYVAVATDEAKEALGRRDIVV  145

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            VWRGT +  E + +  +    APLIFG  S+  +H GFY +YT+          SAR Q+
Sbjct  146  VWRGTIQGSEWVQNFNIDLDPAPLIFGPKSNVQIHNGFYSLYTSENSGLPSADSSARKQV  205



>sp|B9EYD3.2|PLA4_ORYSJ RecName: Full=Phospholipase A1-II 4 [Oryza sativa Japonica Group]
Length=396

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 11/122 (9%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YEVT +FYAT+G       G   +P  V    RESNW GY+AVATD G  ALGRRD++V 
Sbjct  84   YEVTAFFYATAG------AGGVPAPFMVRN--RESNWMGYVAVATDAGVAALGRRDVVVA  135

Query  184  WRGTRRFLEAITDITLVFVNAPLIF---GQNSHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WRGT R +E + D+    V+A  +    G++  P VH+G+  +YT +   S+ +++SAR+
Sbjct  136  WRGTVRPMEWLNDLDFTLVSAAGVLGAGGRSPAPRVHRGWLSIYTASDPASKYSKLSARE  195

Query  355  QI  360
            QI
Sbjct  196  QI  197



>gb|AFW83434.1| hypothetical protein ZEAMMB73_348788 [Zea mays]
Length=226

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +  +  +   PA   A   ESNW GY+AVATD G   LGRRDI+V 
Sbjct  106  YNVTRFLYATSSARVPGQ--FITRPAPPGAWSAESNWMGYVAVATDAGVARLGRRDIVVA  163

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN---SHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WRGT+R +E   D+ +  V A  + G     S P VH+GF  +Y +    S+ N+ SAR+
Sbjct  164  WRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYASRNSTSRFNKQSARE  223

Query  355  QI  360
            Q+
Sbjct  224  QV  225



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 70/122 (57%), Gaps = 3/122 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +     +   PA   A   ESNW GY+AVATD G   LGRRDI+V 
Sbjct  108  YAVTRFLYATSSARVPVPDTFITRPAPPGAWSAESNWMGYVAVATDAGAARLGRRDIVVA  167

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN---SHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WRGT+R +E   D+ +  V A  + G     S P VH+GF  +Y +    S+ N+ SAR+
Sbjct  168  WRGTKRAVEWADDLDITLVPATGVVGPGPGWSQPAVHRGFLSVYASRNSTSRFNKQSARE  227

Query  355  QI  360
            Q+
Sbjct  228  QV  229



>ref|XP_008648636.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=446

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 57/133 (43%), Positives = 76/133 (57%), Gaps = 13/133 (10%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPI-GARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDIL  177
            +Y VT++ YATS  P+ G+       P   +A  RESNW GY+AVATDEG   LGRRD++
Sbjct  112  RYAVTRFVYATSALPVPGSDFPLLPLPETREAWSRESNWIGYVAVATDEGAAELGRRDVV  171

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQ----NSHPLVHKGFYDMY--------TTTIQ  321
            V WRGT + LE   D T   V+A  + G     N   +VH+GF  +Y        T+   
Sbjct  172  VAWRGTVKDLEWANDFTFTPVSAVPVLGSAAAANPLAVVHQGFLSVYQLSSLTLTTSCNA  231

Query  322  DSQLNRMSARDQI  360
            DS+ N+ SARDQ+
Sbjct  232  DSRFNKASARDQV  244



>ref|XP_010108435.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19463.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=394

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 71/123 (58%), Gaps = 13/123 (11%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDA---VLRESNWNGYIAVATDEGKVALGRRD  171
            KYEVT + YA             + P  + A   V+++SN   Y+AVATD+GK ALGRRD
Sbjct  79   KYEVTNFIYA----------ALELKPPSLTATWKVIKQSNLMAYVAVATDDGKAALGRRD  128

Query  172  ILVVWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            ILV WRGT    E I D+    V+A  I G  + P VH G+Y +YT T  DS L  +SAR
Sbjct  129  ILVSWRGTMLDPEWIKDLDFASVSASKILGTANDPKVHNGWYSLYTGTNPDSPLTSISAR  188

Query  352  DQI  360
            DQI
Sbjct  189  DQI  191



>ref|NP_001056387.1| Os05g0574100 [Oryza sativa Japonica Group]
 sp|Q6F357.1|PLA7_ORYSJ RecName: Full=Phospholipase A1-II 7 [Oryza sativa Japonica Group]
 sp|A2Y7R2.1|PLA7_ORYSI RecName: Full=Phospholipase A1-II 7 [Oryza sativa Indica Group]
 gb|AAT69581.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44111.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF18301.1| Os05g0574100 [Oryza sativa Japonica Group]
 gb|EAY99122.1| hypothetical protein OsI_21081 [Oryza sativa Indica Group]
Length=407

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +1

Query  10   VTKYFYATSGFPIG-ARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVVW  186
            VTK+ YATSG P+  A     +      A  RESNW GY+AVATDEG  ALGRRDI+V W
Sbjct  85   VTKFVYATSGLPVPEAFLLLPLPSLLPPAWSRESNWMGYVAVATDEGVAALGRRDIVVAW  144

Query  187  RGTRRFLEAITDITLVFV----NAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            RGT   LE + D     V            N   +VH+GF  +YT++ +DS+ N+ SARD
Sbjct  145  RGTVESLEWVNDFDFTPVPAAPVLGAAAAANPRAIVHRGFLSVYTSSNKDSKYNKASARD  204

Query  355  QI  360
            Q+
Sbjct  205  QV  206



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  92   KYKVTKFLYATS--QIHVPDSFLLFPVSREGWTKESNWMGYVAVTDDQGTAVLGRRDIVV  149

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D     V+A  IFG+ N    +H+G+Y +Y +  Q S  N+ +ARDQ
Sbjct  150  SWRGSVQPLEWVNDFEFGLVDAKKIFGEKNDKVQIHQGWYSIYMSDDQRSPFNKANARDQ  209

Query  358  I  360
            +
Sbjct  210  V  210



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 54/120 (45%), Positives = 70/120 (58%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS      +  + +     DA   +SNW GY+AVATDEGK ALGRRDI+V
Sbjct  78   KYLVTKFLYATSKASDSEK--FLLRSFSKDAWSLQSNWIGYVAVATDEGKEALGRRDIVV  135

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT +  E + D       AP IFG  +   +H GFY +YT+    S+    SAR+Q+
Sbjct  136  AWRGTIQAAEWVKDFHFHLDPAPEIFGDAASAELHHGFYSLYTSKNPGSKFTNTSARNQV  195



>dbj|BAD68802.1| lipase-like protein [Oryza sativa Japonica Group]
Length=418

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 72/122 (59%), Gaps = 6/122 (5%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y  T+Y YAT+   +  +    + P   +    E NW GY+AVATDEG  ALGRRDI+V 
Sbjct  74   YAATRYIYATANADVHGKV--LLRPLCREGRATECNWMGYVAVATDEGAAALGRRDIVVA  131

Query  184  WRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            WRGT+R LE + D+ L   +A  I G      + P VH+G+  +YT+  Q S+LN+ SAR
Sbjct  132  WRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLYTSEDQCSELNKQSAR  191

Query  352  DQ  357
             Q
Sbjct  192  MQ  193



>ref|XP_009137120.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=349

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  108  KYKVTKFLYATS--QIHVPESFLLFPLSREGCTKESNWMGYVAVTDDQGTAVLGRRDIVV  165

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D     VNA  IFG+ N    +H+G+Y +Y +  + S  ++ +ARDQ
Sbjct  166  AWRGSVQPLEWVNDFEFGLVNAKNIFGEKNDQVQIHQGWYSIYMSEDERSPFSKANARDQ  225



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 71/120 (59%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y+V K+ YATS         + +     D+  ++SNW GY+AVATD GK ALGRRDI+V
Sbjct  79   RYDVKKFLYATS--KASDAEAFLLKSFSKDSWSKQSNWIGYVAVATDAGKEALGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT +  E + D       AP IFG +S   VH GFY +YT++   S+    SAR+Q+
Sbjct  137  AWRGTIQAAEWVKDFHFHLDLAPEIFGGDSSAQVHHGFYSLYTSSNPGSKFTDTSARNQV  196



>gb|EAY75192.1| hypothetical protein OsI_03084 [Oryza sativa Indica Group]
Length=418

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 72/122 (59%), Gaps = 6/122 (5%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y  T+Y YAT+   +  +    + P   +    E NW GY+AVATDEG  ALGRRDI+V 
Sbjct  74   YAATRYIYATANADVHGKV--LLRPLCREGRATECNWMGYVAVATDEGAAALGRRDIVVA  131

Query  184  WRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            WRGT+R LE + D+ L   +A  I G      + P VH+G+  +YT+  Q S+LN+ SAR
Sbjct  132  WRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLYTSEDQCSELNKQSAR  191

Query  352  DQ  357
             Q
Sbjct  192  MQ  193



>gb|AFK39140.1| unknown [Medicago truncatula]
Length=196

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 68/119 (57%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS     A    T S    DA   E+NW GY+AVATDE K ALGRRDI+V
Sbjct  78   KYSVTKYLYATSKARDSAAFLLT-SIFSKDAWSLETNWMGYVAVATDEAKEALGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRGT +  E + +  +    APLIFG  S   +H GFY +YT+      L   SAR Q
Sbjct  137  AWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNGFYSLYTSDNSSLPLADSSARKQ  195



>gb|EMT15520.1| Feruloyl esterase A [Aegilops tauschii]
Length=663

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 6/121 (5%)
 Frame = +1

Query  10   VTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVVWR  189
            V +Y YA +   +  +    + P   +   RE NW GY+AVATDEG  ALGRRDI+V WR
Sbjct  285  VPRYIYAAASADVHGKV--LLRPLCRNGRARECNWMGYVAVATDEGAAALGRRDIVVAWR  342

Query  190  GTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            GT+R LE + D+ L F +A  I G      S P VH+G+  +YT+  + S++++ SAR Q
Sbjct  343  GTQRALEWVADLKLAFASAAGILGAEGADGSEPSVHRGYLSLYTSADEGSEISKQSARMQ  402

Query  358  I  360
            +
Sbjct  403  V  403



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + + P   +   +ESNW GY+AV  D+G   LGRRDI++
Sbjct  110  KYKVTKFLYATS--EIHVPEAFLLFPVSREGWSKESNWMGYVAVTDDQGTAVLGRRDIVI  167

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPL-VHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE ++D     VNA  IFG+  + + +H+G++ +Y +  + S  N+ +ARDQ
Sbjct  168  AWRGSVQPLEWVSDFDFSLVNAKKIFGEKYNQVQIHQGWHSIYMSEDERSHFNKANARDQ  227

Query  358  I  360
            +
Sbjct  228  V  228



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 69/120 (58%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS     A    T S    DA   E+NW GY+AVATDE K ALGRRDI+V
Sbjct  78   KYSVTKYLYATSKARDSAAFLLT-SIFSKDAWSLETNWMGYVAVATDEAKEALGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT +  E + +  +    APLIFG  S   +H GFY +YT+      L   SAR Q+
Sbjct  137  AWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNGFYSLYTSDNSSLPLADSSARKQV  196



>ref|XP_003608142.1| Lipase [Medicago truncatula]
Length=349

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 69/120 (58%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS     A    T S    DA   E+NW GY+AVATDE K ALGRRDI+V
Sbjct  28   KYSVTKYLYATSKARDSAAFLLT-SIFSKDAWSLETNWMGYVAVATDEAKEALGRRDIVV  86

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT +  E + +  +    APLIFG  S   +H GFY +YT+      L   SAR Q+
Sbjct  87   AWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNGFYSLYTSDNSSLPLADSSARKQV  146



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  93   KYKVTKFLYATS--EIHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTALLGRRDIVV  150

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D     VNA  IFG+ N    +H+G+Y +Y +  + S   + +ARDQ
Sbjct  151  AWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIYMSQDERSPFTKANARDQ  210

Query  358  I  360
            +
Sbjct  211  V  211



>gb|EMT04701.1| Lipase [Aegilops tauschii]
Length=373

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y +T++ YAT   P      + V      +  +ESNW GY+AVATD GK  LGRRD++VV
Sbjct  90   YRITRFLYATCSAPAAPAATF-VRSCHPQSRSKESNWIGYVAVATDAGKATLGRRDVVVV  148

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQ--NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT + LE I D+    V+   I G+   +  +V +G++ +YT+T Q S  N++SAR Q
Sbjct  149  WRGTIQALEWIKDLEFAMVHPKGILGEVTGAEAMVDRGWFSIYTSTDQASTHNKVSARKQ  208

Query  358  I  360
            +
Sbjct  209  V  209



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YE+TK+ YA     +    G+ V      A  R+SNW G++AVATDEGK  LGRRD++V 
Sbjct  83   YEITKFIYAMC--TVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGKEVLGRRDVVVA  140

Query  184  WRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R +E + D+ +  V A  I   G  ++P VH G+  +YT+    SQ N+ SAR Q
Sbjct  141  WRGTIRMVEWMDDLDISLVPASEIVLPGSATNPCVHGGWLSVYTSADPGSQYNKESARHQ  200

Query  358  I  360
            +
Sbjct  201  V  201



>ref|XP_003608122.1| Lipase [Medicago truncatula]
Length=387

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 69/120 (58%), Gaps = 1/120 (1%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATS     A    T S    DA   E+NW GY+AVATDE K ALGRRDI+V
Sbjct  78   KYSVTKYLYATSKARDSAAFLLT-SIFSKDAWSLETNWMGYVAVATDEAKEALGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT +  E + +  +    APLIFG  S   +H GFY +YT+      L   SAR Q+
Sbjct  137  AWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNGFYSLYTSDNSSLPLADSSARKQV  196



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 54/123 (44%), Positives = 73/123 (59%), Gaps = 8/123 (7%)
 Frame = +1

Query  4    YEVTKYFYA--TSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDIL  177
            YE+TK+ YA  T   P     G+ V      A  R+SNW G++AVATDEGK  LGRRD++
Sbjct  83   YEITKFIYAMCTVSLP----DGFMVKSLSKAAWSRQSNWMGFVAVATDEGKELLGRRDVV  138

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            V WRGT R +E + D+ +  V A  I   G  ++P VH G+  +YT+    SQ N+ SAR
Sbjct  139  VAWRGTIRMVEWVDDLDISLVPASEIVLPGSAANPCVHGGWLSVYTSADPGSQYNKESAR  198

Query  352  DQI  360
             Q+
Sbjct  199  HQV  201



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 54/123 (44%), Positives = 75/123 (61%), Gaps = 5/123 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATSG  I   + +       +A  +ESN+ GY+AVA DE   ALGRRDI++
Sbjct  83   KYRVTKFLYATSG--IDLPSAFMFKSLSREAWSKESNFIGYVAVAEDESVAALGRRDIVI  140

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ---NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT + LE + D+  + V+A  I G+   N  P VH+G+Y +YT+    S  N+ SAR
Sbjct  141  SWRGTIQSLEWVNDLQFLQVSASSIVGKSDGNDDPKVHQGWYSVYTSDDPKSPFNKTSAR  200

Query  352  DQI  360
             Q+
Sbjct  201  YQV  203



>ref|XP_008655140.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
Length=1067

 Score =   100 bits (248),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 52/122 (43%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +  +  +   PA   A   ESNW GY+AVATD G   LGRRDI+V 
Sbjct  743  YNVTRFLYATSSARVPGQ--FITRPAPPGAWSAESNWMGYVAVATDAGVARLGRRDIVVA  800

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN---SHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WRGT+R +E   D+ +  V A  + G     S P VH+GF  +Y +    S+ N+ SAR+
Sbjct  801  WRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYASRNSTSRFNKQSARE  860

Query  355  QI  360
            Q+
Sbjct  861  QV  862



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   +     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  110  KYKVTKFLYATS--QVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTALLGRRDIVV  167

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D     VNA  IFG+ N    +H+G+Y +Y +  + S   +++ARDQ
Sbjct  168  AWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIYMSQDERSPFTKVNARDQ  227

Query  358  I  360
            +
Sbjct  228  V  228



>ref|NP_001152663.1| triacylglycerol lipase precursor [Zea mays]
 gb|ACF88339.1| unknown [Zea mays]
 gb|ACG48810.1| triacylglycerol lipase [Zea mays]
 gb|AFW83435.1| Triacylglycerol lipase [Zea mays]
Length=430

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +  +  +   PA   A   ESNW GY+AVATD G   LGRRDI+V 
Sbjct  106  YNVTRFLYATSSARVPGQ--FITRPAPPGAWSAESNWMGYVAVATDAGVARLGRRDIVVA  163

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN---SHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WRGT+R +E   D+ +  V A  + G     S P VH+GF  +Y +    S+ N+ SAR+
Sbjct  164  WRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYASRNSTSRFNKQSARE  223

Query  355  QI  360
            Q+
Sbjct  224  QV  225



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 69/116 (59%), Gaps = 6/116 (5%)
 Frame = +1

Query  16   KYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVVWRGT  195
            K F++  G  IG    Y V+        +ESNW GY+AVATDEGK  LGRRDI++ WRGT
Sbjct  63   KDFFSKVGIDIGNPFKYYVTK-----YFKESNWMGYVAVATDEGKAVLGRRDIVIAWRGT  117

Query  196  RRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             + LE + D     V+A  I G+    P VH+G+Y +YT+    S  ++ SARDQ+
Sbjct  118  VKTLEWVNDFEFNLVSASKILGEAGGEPKVHQGWYSIYTSDDPLSSFSKTSARDQV  173



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   +     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  110  KYKVTKFLYATS--QVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTALLGRRDIVV  167

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D     VNA  IFG+ N    +H+G+Y +Y +  + S   + +ARDQ
Sbjct  168  AWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIYMSQDERSPFTKANARDQ  227

Query  358  I  360
            +
Sbjct  228  V  228



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 69/120 (58%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY +TK+ YATS   I     + +     +A  RESNW GY+AVATDEGK  LGRRDIL+
Sbjct  79   KYNITKFLYATSR--IDVPDAFIIKSLSREAWSRESNWMGYVAVATDEGKAVLGRRDILI  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRG+ + LE I D     V+A  I    +   VH+G+  +YT+    S  N  SAR Q+
Sbjct  137  AWRGSVQALEWIDDFEFNLVSASEILRAKTDAKVHQGWLSIYTSDDPRSPYNTTSARQQV  196



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VT++ YATS   I     + + P   +   +ESNW GY+AV  ++G   LGRRDI+V
Sbjct  108  KYKVTRFLYATS--QIHVPESFLLFPLSREGWTKESNWMGYVAVTDNQGTAVLGRRDIVV  165

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D     VNA  IFG+ N    +H+G+Y +Y +  + S  N+ +ARDQ
Sbjct  166  AWRGSVQPLEWVNDFEFGLVNAKNIFGEKNDQVQIHQGWYSIYMSEDERSPFNKANARDQ  225

Query  358  I  360
            +
Sbjct  226  V  226



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 71/121 (59%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YE+TK+ YA     +    G+ V      A  R+SNW G++AVATDEGK  LGRRD++V 
Sbjct  83   YEITKFVYAMC--TVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGKEVLGRRDVVVA  140

Query  184  WRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R +E + D+ +  V A  I   G   +P VH G+  +YTT    SQ N+ SAR Q
Sbjct  141  WRGTIRMVEWMDDLDISLVPASEIVLPGSAINPCVHGGWLSVYTTADPGSQYNQESARHQ  200

Query  358  I  360
            +
Sbjct  201  V  201



>ref|XP_010058983.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=341

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 68/120 (57%), Gaps = 14/120 (12%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVT+YFY  S         +   P R        +W GY+AV+TDEG  ALGRRDILV
Sbjct  23   RYEVTRYFYVPS------HATFLEQPDR--------SWAGYVAVSTDEGTQALGRRDILV  68

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT  FLE++ DI      A  IF  ++H  +H GF D+YT     +   R+SARDQ+
Sbjct  69   TWRGTANFLESMEDIRDDLAPANNIFKDDTHTKIHAGFLDLYTKWDLVNPYTRLSARDQV  128



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   +     + V PA      ++SNW GY+AVAT++G   LGRRDI+V
Sbjct  116  KYQVTKFLYATSEARMPG--AFMVFPASGQGWTKQSNWIGYVAVATNDGTAVLGRRDIVV  173

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPL-VHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRGT    E I D     V+   IF   S P+ VH+G+  +YT+    S+ N++ ARDQ
Sbjct  174  AWRGTIETTEWIDDFDFGLVDGSKIFAGKSKPIKVHRGWLSIYTSYDTRSKFNKICARDQ  233

Query  358  I  360
            +
Sbjct  234  L  234



>gb|KCW74056.1| hypothetical protein EUGRSUZ_E02682 [Eucalyptus grandis]
Length=387

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 68/120 (57%), Gaps = 14/120 (12%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVT+YFY  S         +   P R        +W GY+AV+TDEG  ALGRRDILV
Sbjct  69   RYEVTRYFYVPS------HATFLEQPDR--------SWAGYVAVSTDEGTQALGRRDILV  114

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT  FLE++ DI      A  IF  ++H  +H GF D+YT     +   R+SARDQ+
Sbjct  115  TWRGTANFLESMEDIRDDLAPANNIFKDDTHTKIHAGFLDLYTKWDLVNPYTRLSARDQV  174



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY +TK+ YATS   I     + +     +A  RESNW GY+AVATDEGK  LGRRDIL+
Sbjct  79   KYNITKFLYATSR--IDVPDAFIIKSLSREAWSRESNWMGYVAVATDEGKAVLGRRDILI  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE I D     V+A  I    +   VH+G+  +YT+    S  N  SAR Q
Sbjct  137  AWRGSVQALEWIDDFEFNLVSASEILRAKTDAKVHQGWLSIYTSDDPRSPYNTTSARQQ  195



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   +     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  110  KYKVTKFLYATS--QVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTALLGRRDIVV  167

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D     VNA  IFG+ N    +H+G+Y +Y +  + S   + +ARDQ
Sbjct  168  AWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYLIYMSQDERSPFTKANARDQ  227

Query  358  I  360
            +
Sbjct  228  V  228



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   +     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  115  KYKVTKFLYATS--EVHVPESFLLFPISREGWTKESNWMGYVAVTDDQGTALLGRRDIVV  172

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            VWRG+ + LE + D     VNA  IFG+ N    +H+G+Y +Y +    S   + +AR+Q
Sbjct  173  VWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIYMSQDDRSPFTKANAREQ  232

Query  358  I  360
            +
Sbjct  233  V  233



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 69/122 (57%), Gaps = 5/122 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +    G+   P    A   +SNW GY+AVATD G  ALGRRDI+V 
Sbjct  93   YRVTRFIYATSSARL--PDGFMARPLPAGAWSTDSNWMGYVAVATDRGAAALGRRDIVVA  150

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN---SHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WR T+R  E  +D+    V A  I G     S P VH+GF  +YT+    S+ NR SAR+
Sbjct  151  WRATKRATEWASDLDFALVPAAGIVGPGRGWSQPYVHRGFLSVYTSKNSTSRFNRRSARE  210

Query  355  QI  360
             +
Sbjct  211  LV  212



>emb|CDY53993.1| BnaA03g58180D [Brassica napus]
Length=351

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  26   KYKVTKFLYATSH--IHVPESFLLFPLSREGWTKESNWMGYVAVTDDQGTAVLGRRDIVV  83

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D     VNA  IFG+ N    +H+ +Y +Y +  + S  ++ +ARDQ
Sbjct  84   AWRGSVQPLEWVNDFEFGLVNAQNIFGEKNDQVQIHQDWYSIYMSEDERSPFSKANARDQ  143

Query  358  I  360
            +
Sbjct  144  V  144



>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1
 pdb|2YIJ|B Chain B, Crystal Structure Of Phospholipase A1
Length=419

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  94   KYKVTKFIYATSD--IHVPESFLLFPISREGWSKESNWXGYVAVTDDQGTALLGRRDIVV  151

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D     VNA  IFG+ N    +H+G+Y +Y +  + S   + +ARDQ
Sbjct  152  SWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIYXSQDERSPFTKTNARDQ  211

Query  358  I  360
            +
Sbjct  212  V  212



>ref|XP_003567848.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=425

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 54/140 (39%), Positives = 76/140 (54%), Gaps = 21/140 (15%)
 Frame = +1

Query  4    YEVTKYFYATSGFP--------------IGARTGYTVSPA---RVDAVLRESNWNGYIAV  132
            Y VTK+ YAT G                      + V P    + +   RESNW GY+AV
Sbjct  81   YAVTKFLYATCGITQLASTSTTRESTSASRLAKAFLVLPVPELKEEPWCRESNWMGYVAV  140

Query  133  ATDEGKVALGRRDILVVWRGTRRFLEAITDITLVFVNAPLIFG----QNSHPLVHKGFYD  300
            ATD+G  ALGRRDI+V WRGT   LE + D+  +  +A  + G    ++ + +VH GF  
Sbjct  141  ATDDGVAALGRRDIVVAWRGTLESLEWVNDLDFLPASAAPVLGPAAEEHGNAVVHHGFLT  200

Query  301  MYTTTIQDSQLNRMSARDQI  360
            +YT + +DS+ N+ SARDQ+
Sbjct  201  VYTASDEDSKYNKTSARDQV  220



>gb|EEE64775.1| hypothetical protein OsJ_19631 [Oryza sativa Japonica Group]
Length=387

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 62/91 (68%), Gaps = 1/91 (1%)
 Frame = +1

Query  91   AVLRESNWNGYIAVATDEGKVALGRRDILVVWRGTRRFLEAITDITLVFVNAP-LIFGQN  267
            A  RESNW GY+AVATDEGK ALGRRDI+V WRGT + LE I D+  V V    L+  + 
Sbjct  88   ARCRESNWIGYVAVATDEGKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRDKA  147

Query  268  SHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            S  +VH+G+  MYT+   +S  N+ SARDQ+
Sbjct  148  SDAMVHRGWLSMYTSRDSESSHNKDSARDQV  178



>ref|XP_006295721.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
 gb|EOA28619.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
Length=411

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YE TK+ Y TS   I     + +     +A+ +ESNW GY+AVATDEGK  LGRRDI+V
Sbjct  79   RYEATKFIYGTSS--IRLPECFIIKSLSREALYKESNWLGYVAVATDEGKRLLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ---NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D       A  +F Q   N  P +  G+  +YT+T Q S+ ++ SAR
Sbjct  137  AWRGTIQLYEWANDFDFPLETAETVFPQANPNDTPRIANGWLSLYTSTDQRSRFDKTSAR  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>ref|XP_002437113.1| hypothetical protein SORBIDRAFT_10g021260 [Sorghum bicolor]
 ref|XP_002438518.1| hypothetical protein SORBIDRAFT_10g021270 [Sorghum bicolor]
 gb|EER88480.1| hypothetical protein SORBIDRAFT_10g021260 [Sorghum bicolor]
 gb|EER89885.1| hypothetical protein SORBIDRAFT_10g021270 [Sorghum bicolor]
Length=401

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 59/126 (47%), Positives = 75/126 (60%), Gaps = 15/126 (12%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLR-----ESNWNGYIAVATDEGKVALGRR  168
            Y VTK+ YAT+  P   R  + V P   +A LR     ESNW GY+AVATD+G  ALGRR
Sbjct  86   YRVTKFIYATAAEP-ALRDAFLVLP---NAALRDPWSTESNWIGYVAVATDDGVAALGRR  141

Query  169  DILVVWRGTRRFLEAITDITLVFVNAPLIFGQNSHPL--VHKGFYDMYTTTIQDSQLNRM  342
            DILV WRGT   LE++ D+    V      GQ   PL  VH GF  +YT++   S+ N++
Sbjct  142  DILVAWRGTLA-LESLKDVGDALVPTAPALGQ---PLGSVHGGFLSLYTSSDAGSEFNKI  197

Query  343  SARDQI  360
            SAR Q+
Sbjct  198  SARAQV  203



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTK+ YATS   I     + + P   +   +ESNW GY+AV  D+G   LGRRDI+V
Sbjct  94   KYKVTKFIYATSD--IHVPESFLLFPISREGWSKESNWMGYVAVTDDQGTALLGRRDIVV  151

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ-NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
             WRG+ + LE + D     VNA  IFG+ N    +H+G+Y +Y +  + S   + +ARDQ
Sbjct  152  SWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIYMSQDERSPFTKTNARDQ  211

Query  358  I  360
            +
Sbjct  212  V  212



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YE+TK+ YA     +     + + P    A  ++SNW G++AVATDEGK  LGRRD++V 
Sbjct  83   YEITKFIYAMC--TVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVA  140

Query  184  WRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R LE + D+ +  V A  I   G  + P VH G+  +YT+T   S+ N+ SAR Q
Sbjct  141  WRGTIRVLEWMDDLDISLVPASEIVRPGSANDPRVHGGWLSVYTSTDPGSRYNKQSARYQ  200

Query  358  I  360
            +
Sbjct  201  V  201



>ref|XP_007014120.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY31739.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=428

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 71/117 (61%), Gaps = 5/117 (4%)
 Frame = +1

Query  22   FYATSGFPIGARTGYTVSP---ARVDAVLRESNWNGYIAVATDEGKVALGRRDILVVWRG  192
            F++ +G  IG    Y+V+    A  D V  +S W GY+AV TD+GK  LGRRDILV WRG
Sbjct  111  FFSRAGLEIGNPFKYSVTNFFYAASDIV--QSAWFGYVAVTTDDGKAVLGRRDILVAWRG  168

Query  193  TRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQIR  363
            T    E+I D+     +A  +FG+++ P VH GF  +YT    +S  ++ SARDQ+R
Sbjct  169  TMTDSESINDVQFFPTSASELFGEDNDPQVHSGFLSLYTGRSSNSPYSQTSARDQVR  225



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 72/123 (59%), Gaps = 8/123 (7%)
 Frame = +1

Query  4    YEVTKYFYA--TSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDIL  177
            YE+TK+ YA  T   P     G+ +      A  ++SNW G++AVATDEGK  LGRRD++
Sbjct  680  YEITKFIYAMCTVSLP----DGFMIKSLSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVV  735

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            V WRGT R LE + D+ +  V A  I   G    P VH G+  +YT+T   S+ N+ SAR
Sbjct  736  VAWRGTIRILEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSVYTSTDPGSRYNKQSAR  795

Query  352  DQI  360
             Q+
Sbjct  796  YQV  798



>ref|XP_010655496.1| PREDICTED: phospholipase A1-IIgamma isoform X2 [Vitis vinifera]
Length=321

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +1

Query  88   DAVLRESNWNGYIAVATDEGKVALGRRDILVVWRGTRRFLEAITDITLVFVNAPLIFGQ-  264
            +A  +ESNW GY+AVATDEGK  LGRRDI++ WRGT + LE + D     V+A  I G+ 
Sbjct  35   EAWSKESNWMGYVAVATDEGKAVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEA  94

Query  265  NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
               P VH+G+Y +YT+    S  ++ SARDQ+
Sbjct  95   GGEPKVHQGWYSIYTSDDPLSSFSKTSARDQV  126



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 70/121 (58%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLR--ESNWNGYIAVATDEGKVALGRRDIL  177
            Y+  KY YATS   +     + +SPA     +   ESNW GYIAVATD+ K  LGRRDI 
Sbjct  82   YKPVKYLYATS--KVDVPQSFIMSPASTSRAVPNGESNWIGYIAVATDQAKEKLGRRDIA  139

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            V WRGT + LE I D      +A  + G ++   VH+GF+ +YT+    SQ ++ SAR Q
Sbjct  140  VAWRGTLQPLEWIKDFDFPLTSASDVLGGHNDAQVHQGFHSVYTSDNPQSQTSKTSARQQ  199

Query  358  I  360
            +
Sbjct  200  V  200



>sp|Q6F358.1|PLA6_ORYSJ RecName: Full=Phospholipase A1-II 6 [Oryza sativa Japonica Group]
 gb|AAT69580.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44110.1| putative lipase [Oryza sativa Japonica Group]
Length=411

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y V ++ YATS   +       +  A      RESNW GY+AVATDEGK ALGRRDI+V 
Sbjct  85   YRVARFVYATSC--VAVPEPLILRSASRARRCRESNWIGYVAVATDEGKAALGRRDIVVA  142

Query  184  WRGTRRFLEAITDITLVFVNAP-LIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRGT + LE I D+  V V    L+  + S  +VH+G+  MYT+   +S  N+ SARDQ+
Sbjct  143  WRGTVQSLEWIKDMDFVMVPPKGLLRDKASDAMVHRGWLSMYTSRDSESSHNKDSARDQV  202



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 70/121 (58%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YE+TK+ YA     +     + + P    A  ++SNW G++AVATDEGK  LGRRD++V 
Sbjct  83   YEITKFIYAMC--TVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVMVA  140

Query  184  WRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R LE + D+ +    A  I   G    P VH G+  +YT+T   S+ N+ SAR Q
Sbjct  141  WRGTIRVLEWMDDLDISLAPASEIVRPGSADDPRVHGGWLSVYTSTDPGSRYNKQSARYQ  200

Query  358  I  360
            +
Sbjct  201  V  201



>ref|XP_003565876.1| PREDICTED: phospholipase A1-II 6-like [Brachypodium distachyon]
Length=446

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 75/133 (56%), Gaps = 15/133 (11%)
 Frame = +1

Query  4    YEVTKYFYATSGFP-------IGARTGYTVSPARVDAVL-----RESNWNGYIAVATDEG  147
            Y+VT++ YATS  P       +  R G+    A     +     RESNW GY+AVAT+ G
Sbjct  93   YKVTRFLYATSSAPGHAAAFMVRGRGGHVSWRAAAGGHVSGGGCRESNWIGYVAVATEAG  152

Query  148  KVALGRRDILVVWRGTRRFLEAITDITLVFVNAP--LIFGQNSHPLVHKGFYDMYTTTIQ  321
            K ALGRRDI+V WRGT   LE + D+    V AP  ++       LVH+G+  MYT+T  
Sbjct  153  KAALGRRDIVVAWRGTVESLEWVDDLEFAMV-APRGIVKDGCEDALVHRGWLSMYTSTHP  211

Query  322  DSQLNRMSARDQI  360
             S  N+ SARDQ+
Sbjct  212  ASSHNKDSARDQV  224



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 70/121 (58%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YE+TK+ YA     +     + + P    A  ++SNW G++AVATDEGK  LGRRD++V 
Sbjct  83   YEITKFIYAMC--TVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVA  140

Query  184  WRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R LE + D+ +    A  I   G  + P VH G+  +YT+T   S+ N  SAR Q
Sbjct  141  WRGTIRVLEWMDDLDISLAPASEIVRPGSANDPRVHGGWLSVYTSTDPGSRYNEQSARYQ  200

Query  358  I  360
            +
Sbjct  201  V  201



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YE+TK+ YA     +     + + P    A  ++SNW G++AVATDEGK  LGRRD++V 
Sbjct  486  YEITKFIYAMC--TVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVA  543

Query  184  WRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R LE + D+ +  V A  I   G    P VH G+  +YT+T   S+ N+ SAR Q
Sbjct  544  WRGTIRVLEWMDDLDISLVPASEIVRPGSAHDPRVHGGWLSVYTSTDPGSRYNKQSARYQ  603

Query  358  I  360
            +
Sbjct  604  V  604



>ref|XP_006374295.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
 gb|ERP52092.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
Length=412

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 67/120 (56%), Gaps = 10/120 (8%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTKYFY  S                ++  L  S W GY+AV TDEG+  LGRRDILV
Sbjct  94   KYQVTKYFYLKS----------EDIAEVLELDLEGSAWIGYVAVTTDEGQRVLGRRDILV  143

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT    E + D   V + A  IFG  ++P VH GF+++Y      S+ N+ SAR+Q+
Sbjct  144  CWRGTILPAEWLKDFLFVLIPASDIFGATNNPKVHSGFHNVYVAKSSKSKYNKTSAREQV  203



>gb|EYU24809.1| hypothetical protein MIMGU_mgv1a007765mg [Erythranthe guttata]
Length=396

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 69/122 (57%), Gaps = 3/122 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y+  KY YAT+    G   G+ V     +  + ESNW GY+AV+T+EG  ALGRRDILV
Sbjct  79   RYDAVKYIYATASIG-GLPQGFMVKSMADNPWMDESNWMGYVAVSTNEGSKALGRRDILV  137

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQN--SHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
             WRGT   +E + D     + A  I G    S   +H+GF+ +YT     S  N+ SARD
Sbjct  138  AWRGTVLPVEWMKDADAQLIPATDIMGGGGASGAKLHQGFHSIYTAKSASSSFNKTSARD  197

Query  355  QI  360
            Q+
Sbjct  198  QV  199



>dbj|BAJ85084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 16/134 (12%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRE----------SNWNGYIAVATDEGKV  153
            Y+VTK+ YAT G    +R   +V P    A+  +          SNW GY+AVAT+EG  
Sbjct  103  YKVTKFLYATCGGSTVSRLATSV-PTVTSALFVQPLGKAEGTPTSNWMGYVAVATEEGVA  161

Query  154  ALGRRDILVVWRGTRRFLEAITDITLVFVNAPLIFGQNSH-----PLVHKGFYDMYTTTI  318
            ALGRRDI+VVWRGT   LE   D     V+A  + G+ +H       VH+GF  +YT++ 
Sbjct  162  ALGRRDIVVVWRGTENDLEWEQDKDCRQVSAAPVLGRYAHDEYRNAEVHRGFLSVYTSSD  221

Query  319  QDSQLNRMSARDQI  360
             +S  N+ SAR+Q+
Sbjct  222  NNSMYNKTSAREQV  235



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 71/139 (51%), Gaps = 21/139 (15%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y  TKYFYATS   +     + +     +A  +ESNW GY+AVATD+GK ALGRRDIL+
Sbjct  79   EYTATKYFYATSSVKLPG--CFLLRSLSREAWNKESNWIGYVAVATDKGKAALGRRDILI  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSH-------------------PLVHKGFYDM  303
             WRGT + LE  +D       A  I G                       P VH GF  +
Sbjct  137  AWRGTIQVLEWASDFNFPLTPATKILGGTDPDADADTAADAAADDVDDIIPKVHSGFLSV  196

Query  304  YTTTIQDSQLNRMSARDQI  360
            YT+    S+ N+ SAR+Q+
Sbjct  197  YTSDDPRSEFNKSSAREQV  215



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (58%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y +TK+ YA     +    G+ +      A  ++SNW G++AVATDEGK  LGRRD++V 
Sbjct  86   YVITKFIYAMC--TVNLPDGFMIKSWSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVA  143

Query  184  WRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R +E + D+ +  V A  I   G    P VH G+  +YT+   +SQ N+ SAR Q
Sbjct  144  WRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSVYTSADPESQYNKQSARYQ  203

Query  358  I  360
            +
Sbjct  204  V  204



>gb|EMS50696.1| Phospholipase A1-II 7 [Triticum urartu]
Length=311

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 77/136 (57%), Gaps = 20/136 (15%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGY--TVSPARVDAVLRE----------SNWNGYIAVATDEG  147
            Y+VTK+ YAT G   G+   +  T  P   +A+  +          SNW GY+AVATDEG
Sbjct  7    YKVTKFLYATCG---GSTASWLATSMPTVTNALFVQPLGKAEGTPTSNWMGYVAVATDEG  63

Query  148  KVALGRRDILVVWRGTRRFLEAITDITLVFVNAPLIF-----GQNSHPLVHKGFYDMYTT  312
              ALGRRDI+VVWRGT   LE   D   + V A  +      G++ +  VH+GF  +YT+
Sbjct  64   VAALGRRDIVVVWRGTENELEWEKDKHFLQVPAAPVLGRYADGEHKNSKVHRGFLSVYTS  123

Query  313  TIQDSQLNRMSARDQI  360
            +  +S  N+ SAR+Q+
Sbjct  124  SDNNSMYNKTSAREQV  139



>ref|XP_010469763.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=411

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTK+ Y TS   I     + +     +A  +ESNW GYIAVATDEGK  LGRRDI+V
Sbjct  79   RYEVTKFIYGTSS--IRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKRLLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ---NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A  +F +   N  P V  G+  +YT+T   S+ ++ SAR
Sbjct  137  AWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRVANGWLSLYTSTDPRSRFDKTSAR  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>ref|XP_010510242.1| PREDICTED: phospholipase A1-IIbeta [Camelina sativa]
Length=415

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTK+ Y TS   I     + +     +A  +ESNW GYIAVATDEGK  LGRRDI+V
Sbjct  79   RYEVTKFIYGTSS--IRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKRLLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ---NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A  +F +   N  P V  G+  +YT+T   S+ ++ SAR
Sbjct  137  AWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRVANGWLSLYTSTDPRSRFDKTSAR  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>ref|XP_010414181.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=423

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTK+ Y TS   I     + +     +A  +ESNW GYIAVATDEGK  LGRRDI+V
Sbjct  88   RYEVTKFIYGTSS--IRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKRLLGRRDIVV  145

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ---NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A  +F +   N  P V  G+  +YT+T   S+ ++ SAR
Sbjct  146  AWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRVANGWLSLYTSTDPRSRFDKTSAR  205

Query  352  DQIR  363
            +Q++
Sbjct  206  EQVQ  209



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 70/120 (58%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y +TK+ YATS   +     + +     +A  +ESNW G++AVATD GK  LGRRD+++
Sbjct  80   EYTITKFIYATSSVQV--PEAFLIRSLSREAWSKESNWMGFVAVATDNGKKQLGRRDVVI  137

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT   LE + D  +  V+A  I G      VH+G++ +YT+    S  N  SAR+Q+
Sbjct  138  AWRGTIEALEWVEDFDIGQVSAAPISGGGDDAKVHRGWFSIYTSDDSKSPYNNTSAREQV  197



>ref|XP_010557126.1| PREDICTED: phospholipase A1-IIbeta isoform X2 [Tarenaya hassleriana]
Length=327

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 70/123 (57%), Gaps = 5/123 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y+VTK+FYATS   +     + V     +A  +ESNW GYIAVATDEGK  LGRRDI+V
Sbjct  79   RYKVTKFFYATSSVKLPG--SFIVKSLSREAWSKESNWMGYIAVATDEGKEKLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIF--GQNSH-PLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D       A  +F   +  H P +  G+  +YTT    S  N+ SAR
Sbjct  137  AWRGTIQPYEWANDFDFPLDPASELFPGAETGHKPQIASGWLALYTTDDPRSPFNKTSAR  196

Query  352  DQI  360
            +Q+
Sbjct  197  EQV  199



>gb|EMS48809.1| Phospholipase A1-II 6 [Triticum urartu]
Length=454

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 70/122 (57%), Gaps = 3/122 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS         + V      +  RESNW GY+AVATD GK ALGRRD++V 
Sbjct  90   YRVTRFLYATSSAHAAKAVAF-VKGGHPRSRCRESNWIGYVAVATDAGKSALGRRDVVVA  148

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQ--NSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT + L+   D+    V+   I G    +  +VH+G+  +YT+T   S  N+ SAR Q
Sbjct  149  WRGTIQALQWTNDLEFAMVHPTGIIGDATGADVMVHRGWLSIYTSTDPASTHNKESARGQ  208

Query  358  IR  363
            +R
Sbjct  209  VR  210



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 69/120 (58%), Gaps = 4/120 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y +TK+ YA     +    G+ +      A  ++SNW G++AVATDEGK  LGRRD++V 
Sbjct  86   YVITKFIYAMC--TVNLPDGFMIKSWSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVA  143

Query  184  WRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R +E + D+ +  V A  I   G    P VH G+  +YT+   +SQ N+ SAR Q
Sbjct  144  WRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSVYTSADPESQYNKQSARYQ  203



>sp|O82274.2|PLA19_ARATH RecName: Full=Phospholipase A1-IIbeta [Arabidopsis thaliana]
Length=414

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 71/124 (57%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTKY Y TS   I     + +     +A  +ESNW GYIAVATDEGK  LGRR I+V
Sbjct  79   RYEVTKYIYGTSS--IRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKKLLGRRGIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIF---GQNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A ++F     N  P V  G+  +YT+T   S+ ++ SA+
Sbjct  137  AWRGTIQLYEWANDFDFPLESAVMVFPGANPNDEPRVANGWLSLYTSTDPRSRFDKTSAQ  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 70/123 (57%), Gaps = 5/123 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y+VTK+FYATS   +     + V     +A  +ESNW GYIAVATDEGK  LGRRDI+V
Sbjct  79   RYKVTKFFYATSSVKLPG--SFIVKSLSREAWSKESNWMGYIAVATDEGKEKLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIF--GQNSH-PLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D       A  +F   +  H P +  G+  +YTT    S  N+ SAR
Sbjct  137  AWRGTIQPYEWANDFDFPLDPASELFPGAETGHKPQIASGWLALYTTDDPRSPFNKTSAR  196

Query  352  DQI  360
            +Q+
Sbjct  197  EQV  199



>gb|KFK31237.1| hypothetical protein AALP_AA6G086300 [Arabis alpina]
Length=414

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 72/127 (57%), Gaps = 8/127 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTK+ Y TS   I     + V+    +A  RESNW GYIAVATDEGK  LGRRDI+V
Sbjct  79   RYEVTKFIYGTSS--IRLPECFIVNSWSREAWNRESNWLGYIAVATDEGKKLLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ------NSHPLVHKGFYDMYTTTIQDSQLNRM  342
             WRGT +  E   D       A  +F +      N  P V  G+  +YT+T   S+ ++ 
Sbjct  137  AWRGTIQLYEWANDFDFPLELAVSVFPRIDPNDPNDPPRVANGWLSLYTSTDPRSRFDKT  196

Query  343  SARDQIR  363
            SAR+Q++
Sbjct  197  SAREQVQ  203



>ref|XP_007025431.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28053.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=383

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 63/119 (53%), Gaps = 20/119 (17%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            YEVT +FY                     A   +SNW GY+AVATDEGK ALGRRDILV 
Sbjct  80   YEVTNFFYGA-------------------ADSNDSNWFGYVAVATDEGKTALGRRDILVS  120

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            WRGT    E I D       A  +FG + H  VH GF  +YT  + +S  N+ SARDQ+
Sbjct  121  WRGTGTEPEWIDDARFFTTPAKELFGTD-HAKVHSGFLAIYTGKVSNSPYNQTSARDQV  178



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 69/121 (57%), Gaps = 4/121 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y +TK+ YA     +     + +      A  ++SNW G++AVATDEGK  LGRRD++V 
Sbjct  83   YVITKFIYAMC--TVSLPDAFMIKSWSKAAWSKQSNWMGFVAVATDEGKEVLGRRDVVVA  140

Query  184  WRGTRRFLEAITDITLVFVNAPLIF--GQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R +E + D+ +  V A  I   G    P VH G+  +YT+   +SQ N+ SAR Q
Sbjct  141  WRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSVYTSADPESQYNKQSARYQ  200

Query  358  I  360
            +
Sbjct  201  V  201



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 49/127 (39%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTKY YATSG  I     + +  +  +A  +ESN+ GY+AVA D    +LGRRDI++
Sbjct  101  KYRVTKYLYATSG--IDVPDAFILKSSSREAWSKESNFIGYVAVAEDTAVASLGRRDIVI  158

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFG-------QNSHPLVHKGFYDMYTTTIQDSQLNR  339
             WRG+ + LE + ++  + V+A  + G         +   VH+G+Y +YT+    S  N+
Sbjct  159  AWRGSIQSLEWVNNLQFLQVSASDVVGDGDVADHDKAKAKVHQGWYSIYTSDDPRSPFNK  218

Query  340  MSARDQI  360
             SARDQ+
Sbjct  219  TSARDQV  225



>ref|XP_010501341.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=424

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 69/124 (56%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTKY YAT+   I     + V P   DA   ++NW GYIAVATD+GK  LGRRDI+V
Sbjct  79   RYEVTKYIYATAS--INLPICFIVKPLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIF---GQNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A  +F        P +  G+ D+YT +   S   + SAR
Sbjct  137  AWRGTLQPYEWANDFDFPLESAISVFPVKDPKDSPRIGSGWLDIYTASDSRSPYAKTSAR  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>gb|KCW74061.1| hypothetical protein EUGRSUZ_E02689 [Eucalyptus grandis]
Length=372

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 65/120 (54%), Gaps = 14/120 (12%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVT+YFY  S           V P R        +W GY+AV+TDEG  ALGRRDILV
Sbjct  66   RYEVTRYFYLRS------HAFLLVQPDR--------SWAGYVAVSTDEGTEALGRRDILV  111

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT   LE+  D+      A  IF  ++   +H GF D+YT +   +   R SARDQ+
Sbjct  112  TWRGTANLLESFEDVQDDLKPATDIFKDDTDTKIHAGFLDLYTKSNFLNDYTRHSARDQV  171



>ref|XP_010058981.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW74055.1| hypothetical protein EUGRSUZ_E02678 [Eucalyptus grandis]
Length=396

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 66/120 (55%), Gaps = 17/120 (14%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVT+YFY                P+ +D   R  +W GY+AV+TDEG  ALGRRDILV
Sbjct  81   RYEVTRYFYV---------------PSVLDPPDR--SWAGYVAVSTDEGTEALGRRDILV  123

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT   LE+  DI      A  IF  ++   +H GF D+YT +   +   R SARDQ+
Sbjct  124  TWRGTANLLESFEDIQDDLKPATDIFKDDTDTKIHAGFLDLYTKSDFLNDYTRHSARDQV  183



>gb|KDP31780.1| hypothetical protein JCGZ_12241 [Jatropha curcas]
Length=372

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 65/120 (54%), Gaps = 2/120 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY   KY YATS   +     + V          + NW GY+AVATDEGK  LGRRDI++
Sbjct  53   KYRAVKYVYATSKVELP--QSFMVKSLAKQPWSSQCNWIGYVAVATDEGKAMLGRRDIVI  110

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT + +E + D     ++A  I   +  P VH+GF  +Y T    S  ++ SAR+Q+
Sbjct  111  AWRGTIQPIEWVKDFQAPLISASNILKWDKDPRVHQGFLSLYNTADFVSAYSKTSAREQV  170



>gb|KDO38625.1| hypothetical protein CISIN_1g0208022mg, partial [Citrus sinensis]
Length=288

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 15/124 (12%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVL-RESNWNGYIAVATDEGKVALGRRDIL  177
            KY VT Y Y  S   +             D VL  +S W GY+AVATDEGK  LGRRDIL
Sbjct  80   KYTVTNYLYGRSDTDLS------------DWVLPDQSAWIGYVAVATDEGKTLLGRRDIL  127

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQ--NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            + WRGT+   E   D       A  +FG   +  P+VH GF+ +Y  +  DS   + SA+
Sbjct  128  ISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVHLGFHSLYVQSNPDSTYCKFSAK  187

Query  352  DQIR  363
            DQ+R
Sbjct  188  DQVR  191



>ref|XP_003528483.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31004.1| Phospholipase A1-IIgamma [Glycine soja]
Length=366

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 69/122 (57%), Gaps = 3/122 (2%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+ YATS     A     ++          +NW GY+AVATDEGK ALGRRDI+V
Sbjct  73   KYVVTKFLYATS--QTSAPRACILNLFSKKEWNTRTNWIGYVAVATDEGKEALGRRDIVV  130

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTT-TIQDSQLNRMSARDQ  357
             WRGT +  E + ++      AP +F  +S   VH GFY MYT+   +D Q    S R+Q
Sbjct  131  TWRGTIQASEWVDNLNFDLDPAPEMFAVDSPFQVHDGFYSMYTSNNPEDVQFGLTSVRNQ  190

Query  358  IR  363
            ++
Sbjct  191  VQ  192



>ref|XP_011047741.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 65/121 (54%), Gaps = 12/121 (10%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARV-DAVLRESNWNGYIAVATDEGKVALGRRDIL  177
            KY+VTKYFY  S              A V +  L  S W GY+AV TDEG+  LGRRDIL
Sbjct  79   KYQVTKYFYLKSD-----------DIAEVLELDLEGSAWVGYVAVTTDEGQRVLGRRDIL  127

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            V WRGT    E   D       A  IFG  ++P VH GF+++Y      S+ N+ SAR+Q
Sbjct  128  VCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHGFHNVYVAKSSKSKYNKTSAREQ  187

Query  358  I  360
            +
Sbjct  188  V  188



>ref|XP_011005461.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 65/121 (54%), Gaps = 12/121 (10%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARV-DAVLRESNWNGYIAVATDEGKVALGRRDIL  177
            KY+VTKYFY  S              A V +  L  S W GY+AV TDEG+  LGRRDIL
Sbjct  79   KYQVTKYFYLKSD-----------DIAEVLELDLEGSAWIGYVAVTTDEGQRVLGRRDIL  127

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            V WRGT    E   D       A  IFG  ++P VH GF+++Y      S+ N+ SAR+Q
Sbjct  128  VCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHGFHNVYVAKSSKSKYNKTSAREQ  187

Query  358  I  360
            +
Sbjct  188  V  188



>ref|XP_010457749.1| PREDICTED: phospholipase A1-IIalpha [Camelina sativa]
Length=423

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 70/124 (56%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTKY YAT+   I     + V     DA   ++NW GYIAVATD+GK  LGRRDI+V
Sbjct  79   RYEVTKYIYATAS--IKLPICFIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIF---GQNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A  +F       +P +  G+ D+YT +   S  ++ SAR
Sbjct  137  AWRGTLQPYEWANDFDFPLESAISVFPVKDPKDNPRIGSGWLDIYTASDPRSPYDKTSAR  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>ref|XP_002438517.1| hypothetical protein SORBIDRAFT_10g021250 [Sorghum bicolor]
 gb|EER89884.1| hypothetical protein SORBIDRAFT_10g021250 [Sorghum bicolor]
Length=396

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 52/125 (42%), Positives = 68/125 (54%), Gaps = 21/125 (17%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+ YAT+    G              + +++ W GY+AVATDEG  ALGRRDI+V 
Sbjct  93   YRVTKFVYATAELLFG--------------LYKQTTWMGYVAVATDEGVAALGRRDIVVA  138

Query  184  WRGTRRFLEAITDITLVFVNAPL--IFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMS  345
            WRG+    E   DI + FV AP   + G          VH GF  +YTT+  DS+L + S
Sbjct  139  WRGSATDAEWAKDI-IEFVPAPAESVLGSAAAAYPSAYVHSGFLSLYTTSNADSELGKTS  197

Query  346  ARDQI  360
            ARDQ+
Sbjct  198  ARDQV  202



>ref|XP_011047800.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=448

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 65/121 (54%), Gaps = 12/121 (10%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARV-DAVLRESNWNGYIAVATDEGKVALGRRDIL  177
            KY+VTKYFY  S              A V +  L  S W GY+AV TDEG+  LGRRDIL
Sbjct  116  KYQVTKYFYLKSD-----------DIAEVLELDLEGSAWIGYVAVTTDEGQRVLGRRDIL  164

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            V WRGT    E   D       A  IFG  ++P VH GF+++Y      S+ N+ SAR+Q
Sbjct  165  VCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHGFHNVYVAKSSKSKYNKTSAREQ  224

Query  358  I  360
            +
Sbjct  225  V  225



>ref|XP_002488949.1| hypothetical protein SORBIDRAFT_1306s002010 [Sorghum bicolor]
 gb|EES20262.1| hypothetical protein SORBIDRAFT_1306s002010 [Sorghum bicolor]
Length=396

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 52/125 (42%), Positives = 67/125 (54%), Gaps = 21/125 (17%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VTK+ YAT+    G              + +++ W GY+AVATDEG  ALGRRDI+V 
Sbjct  93   YRVTKFVYATAELLFG--------------LYKQTTWMGYVAVATDEGVAALGRRDIVVA  138

Query  184  WRGTRRFLEAITDITLVFVNAPL--IFG----QNSHPLVHKGFYDMYTTTIQDSQLNRMS  345
            WRG+    E   DI   FV AP   + G          VH GF  +YTT+  DS+L + S
Sbjct  139  WRGSATRAEWAKDI-FEFVPAPAESVLGSAAAAYPSAYVHSGFLSLYTTSNADSELGKTS  197

Query  346  ARDQI  360
            ARDQ+
Sbjct  198  ARDQV  202



>gb|AFW79273.1| hypothetical protein ZEAMMB73_515320 [Zea mays]
Length=400

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 68/118 (58%), Gaps = 3/118 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +     + +         RESNW GY+AVATDEGK ALGRRD++V 
Sbjct  84   YRVTRFLYATS--SVAVPDAFILRSVSRSRRCRESNWIGYVAVATDEGKAALGRRDVVVA  141

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R LE   D+    V    + G +   +VH+G+  MYT++   S  N+ SAR Q
Sbjct  142  WRGTMRALEWADDLEFPMVPTGGLLG-DGDAMVHRGWLSMYTSSDPASSHNQDSARHQ  198



>gb|KDP46901.1| hypothetical protein JCGZ_24110 [Jatropha curcas]
Length=403

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +1

Query  103  ESNWNGYIAVATDEGKVALGRRDILVVWRGTRRFLEAITDITLVFVNAPLIFGQNSH-PL  279
            ES W  Y+AVATD+GK  LGRRDI+V WRGT    E + D+  + + A  +F  N++ PL
Sbjct  109  ESTWCAYVAVATDDGKKKLGRRDIVVSWRGTILPGEKLEDVEFIPIPASDMFPNNNNDPL  168

Query  280  VHKGFYDMYTTTIQDSQLNRMSARDQI  360
            +H GF+ +YTT   +S  N+ SARDQ+
Sbjct  169  IHSGFHQIYTTEKDNSIYNKKSARDQV  195



>gb|EMS52156.1| Phospholipase A1-II 2 [Triticum urartu]
Length=386

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/91 (46%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT+Y YAT+   +  +    + P   +   RE NW GY+AVATDEG  ALGRRDI+V 
Sbjct  74   YAVTRYIYATASADVHGKV--LLRPLCRNGRARECNWMGYVAVATDEGAAALGRRDIVVA  131

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHP  276
            WRGT+R LE + D+ L F +A  + G  + P
Sbjct  132  WRGTQRALEWVADLKLAFASAARVLGAATGP  162



>ref|NP_001149813.1| triacylglycerol lipase [Zea mays]
 gb|ACG36877.1| triacylglycerol lipase [Zea mays]
Length=400

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 68/118 (58%), Gaps = 3/118 (3%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +     + +         RESNW GY+AVATDEGK ALGRRD++V 
Sbjct  84   YRVTRFLYATS--SVAVPDAFILRSVSRSRRCRESNWIGYVAVATDEGKAALGRRDVVVA  141

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQ  357
            WRGT R LE   D+    V    + G +   +VH+G+  MYT++   S  N+ SAR Q
Sbjct  142  WRGTMRALEWADDLEFPMVPTGGLLG-DGDAMVHRGWLSMYTSSDPASSHNQDSARHQ  198



>ref|XP_010475356.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
 ref|XP_010475357.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=423

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 69/124 (56%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTKY YAT+   +     + V     DA   ++NW GYIAVATD+GK  LGRRDI+V
Sbjct  79   RYEVTKYIYATASLNLP--ICFIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIF---GQNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A  +F        P +  G+ D+YT +   S  ++ SAR
Sbjct  137  AWRGTLQPYEWANDFDFPLESAISVFPVKDPKDSPRIGSGWLDIYTASDSRSPYDKTSAR  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>ref|XP_006491814.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
Length=407

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 15/124 (12%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVL-RESNWNGYIAVATDEGKVALGRRDIL  177
            KY VT Y Y  S   +             D VL  +S W GY+AVATDEGK  LGRRDIL
Sbjct  80   KYTVTNYLYGRSDTDL------------WDWVLPDQSAWIGYVAVATDEGKTLLGRRDIL  127

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQ--NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            + WRGT+   E   D       A  +FG   +  P+VH GF+ +Y  +  DS   + SA+
Sbjct  128  ISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVHLGFHSLYVQSNPDSTYCKFSAK  187

Query  352  DQIR  363
            DQ+R
Sbjct  188  DQVR  191



>ref|XP_010058987.1| PREDICTED: uncharacterized protein LOC104446890 [Eucalyptus grandis]
Length=1378

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 66/120 (55%), Gaps = 14/120 (12%)
 Frame = +1

Query  1     KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
             +YEVT+YFY      + +     V P R        +W GY+AV+TDEG  ALGRRDILV
Sbjct  1060  RYEVTRYFY------LRSHAFLLVQPDR--------SWAGYVAVSTDEGTEALGRRDILV  1105

Query  181   VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
              WRGT   LE+  D+      A  IF  ++   +H GF D+YT +   +   R SARDQ+
Sbjct  1106  TWRGTANLLESFEDVQDDLKPATDIFKDDTDTKIHAGFLDLYTKSNFLNDYTRHSARDQV  1165



>ref|XP_006428509.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
 gb|ESR41749.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
Length=407

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 15/124 (12%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVL-RESNWNGYIAVATDEGKVALGRRDIL  177
            KY VT Y Y  S   +             D VL  +S W GY+AVATDEGK  LGRRDIL
Sbjct  80   KYTVTNYLYGRSDTDL------------WDWVLPDQSAWIGYVAVATDEGKTLLGRRDIL  127

Query  178  VVWRGTRRFLEAITDITLVFVNAPLIFGQ--NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            + WRGT+   E   D       A  +FG   +  P+VH GF+ +Y  +  DS   + SA+
Sbjct  128  ISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVHLGFHSLYVQSNPDSTYCKFSAK  187

Query  352  DQIR  363
            DQ+R
Sbjct  188  DQVR  191



>ref|XP_002522552.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39852.1| triacylglycerol lipase, putative [Ricinus communis]
Length=403

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 68/120 (57%), Gaps = 12/120 (10%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VT YFYA S            + A  + +   S + G++AV+TDEGK+ LGRRDI+V
Sbjct  78   KYLVTDYFYARSE-----------ADAFREYLPATSTFVGFVAVSTDEGKLVLGRRDIIV  126

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT   +E   DI    V A  IF  +S  LVH GFY+MYT     S  N+MS R+Q+
Sbjct  127  CWRGTTLPIEWFQDILCDQVPATDIF-PDSEALVHNGFYNMYTAKDSTSTYNKMSVREQV  185



>emb|CDY23963.1| BnaC03g17280D [Brassica napus]
Length=414

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 70/127 (55%), Gaps = 8/127 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTKY Y TS   I     + ++    +A  ++SNW GY AVATDEGK  LGRRDI+V
Sbjct  79   RYEVTKYIYGTSS--IRLPECFLINSLSREAWNKDSNWLGYTAVATDEGKELLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ------NSHPLVHKGFYDMYTTTIQDSQLNRM  342
             WRGT +  E   D       A  +F        N  P +  G+  +YTT+   S+ ++ 
Sbjct  137  AWRGTMQLYEWANDFDFPLELATSVFPSTDPNDPNDPPRIANGWLSLYTTSNTHSRFDKT  196

Query  343  SARDQIR  363
            SA++Q++
Sbjct  197  SAQEQVQ  203



>ref|XP_011005460.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=412

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 10/120 (8%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTKYFY      +     Y      ++  ++ES W GY+AV TDEG   LGRRDILV
Sbjct  79   KYQVTKYFY----LKLDDFADY------MEFDIKESAWIGYVAVTTDEGNTVLGRRDILV  128

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT    E   ++    V+A  I G   +P +H GF+ +Y      S+ N+ SAR+Q+
Sbjct  129  CWRGTILGSEWAKNLQFDLVSAAEILGGAHNPKMHHGFHSVYLAKSSSSKYNKTSAREQV  188



>ref|XP_002440294.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
 gb|EES18724.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
Length=408

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 68/121 (56%), Gaps = 5/121 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILVV  183
            Y VT++ YATS   +     + +         RESNW GY+AVATDEGK ALGRRD++VV
Sbjct  89   YRVTRFLYATSSVAL--PDAFMLRSVSRSRRCRESNWIGYVAVATDEGKAALGRRDVVVV  146

Query  184  WRGTRRFLEAITDITLVFVNAPLIFGQN---SHPLVHKGFYDMYTTTIQDSQLNRMSARD  354
            WRGT + LE   D+    V+   + G        +VH+G+  MYT+    S  N+ SAR 
Sbjct  147  WRGTMQKLEWADDLEFPMVSTKGLLGDGQAACDAMVHRGWLSMYTSIDPASSHNQDSARH  206

Query  355  Q  357
            Q
Sbjct  207  Q  207



>emb|CDX84801.1| BnaA03g14290D [Brassica napus]
Length=414

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 8/127 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTKY Y TS   I     + ++    +A  ++SNW GY AV+TDEGK  LGRRDI+V
Sbjct  79   RYEVTKYIYGTSS--IRLPECFLINSLSREAWNKDSNWLGYTAVSTDEGKELLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIF------GQNSHPLVHKGFYDMYTTTIQDSQLNRM  342
             WRGT +  E   D       A  +F        N  P +  G+  +YTT+   S+ ++ 
Sbjct  137  AWRGTMQLYEWANDFDFPLELATSVFPPTDPNDPNDPPRIANGWLSLYTTSNTHSRFDKT  196

Query  343  SARDQIR  363
            SA++Q++
Sbjct  197  SAKEQVQ  203



>gb|KDP46905.1| hypothetical protein JCGZ_24114 [Jatropha curcas]
Length=403

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +1

Query  88   DAVLRESNWNGYIAVATDEGKVALGRRDILVVWRGTRRFLEAITDITLVFVNAPLIFGQN  267
            D V+ ES W  Y+AVATD+GK  LGRRDI+V WR T    E + D   + V+A  IF  N
Sbjct  104  DNVINESTWCAYVAVATDDGKKKLGRRDIVVSWRETALDGEKLEDYEFIPVSASDIFPNN  163

Query  268  SH-PLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
            ++ PL+H GF  +YTT    S  N+ SARDQ+
Sbjct  164  NNDPLIHFGFRSIYTTKDDKSIYNKKSARDQV  195



>emb|CDY24728.1| BnaC04g13330D [Brassica napus]
Length=408

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 48/124 (39%), Positives = 71/124 (57%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTK+ Y TS   I     + ++    +A  +ESNW GY+AVATDE K  LGRRDI+V
Sbjct  79   RYEVTKFIYGTSS--IKLPECFMINSWSREAWNKESNWLGYVAVATDECKELLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ---NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A  +F +   +  P +  G+  +YTT    S+ ++ SAR
Sbjct  137  AWRGTIQLYEWANDFDFPLESAISVFPRADPSDPPRIASGWLSLYTTADPRSRFDKTSAR  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>ref|XP_006306316.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
 gb|EOA39214.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
Length=423

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 69/124 (56%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y VTKY YAT+   I     + V     DA   ++NW GYIAVATD+GK  LGRRDI+V
Sbjct  79   RYNVTKYIYATAS--IKLPICFIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIF---GQNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D       A  +F      ++P +  G+ D+YT +   S  ++ SAR
Sbjct  137  AWRGTLQPYEWANDFDFPLEPAISVFPVKDAKANPRIGSGWLDIYTASDSRSPYDKTSAR  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>ref|XP_006374296.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
 gb|ERP52093.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
Length=412

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 64/120 (53%), Gaps = 10/120 (8%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VTKYFY                   ++  ++ES W GY+AV TDEG   LGRRDILV
Sbjct  79   KYQVTKYFYLKQ----------DDFADYMEFDIKESAWIGYVAVTTDEGNTVLGRRDILV  128

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT    E   ++    V+A  I G   +P +H GF+ +Y      S+ N+ SAR+Q+
Sbjct  129  CWRGTILASEWAKNLQFDLVSAAEILGGAHNPKMHHGFHSVYLAKSSSSKYNKTSAREQV  188



>ref|XP_006410236.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
 gb|ESQ51689.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
Length=414

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 71/127 (56%), Gaps = 8/127 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTKY Y TS   I     + ++    +A  +ESNW GYIAVATD+GK  LGRRDI+V
Sbjct  79   RYEVTKYIYGTSS--IRLPECFIINSLSREAWNKESNWLGYIAVATDQGKELLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ------NSHPLVHKGFYDMYTTTIQDSQLNRM  342
             WRGT +  E   D       A  +F +      +  P +  G+  +YTT    S+ ++ 
Sbjct  137  AWRGTIQLYEWANDFDFPLEPAISVFPKTDPNDPSDPPRIANGWLSLYTTADPRSRFDKT  196

Query  343  SARDQIR  363
            SA++Q++
Sbjct  197  SAQEQVQ  203



>ref|XP_009132769.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=414

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 8/127 (6%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTKY Y TS   I     + ++    +A  ++SNW GY AV+TDEGK  LGRRDI+V
Sbjct  79   RYEVTKYIYGTSS--IRLPECFLINSLSREAWNKDSNWLGYTAVSTDEGKELLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIF------GQNSHPLVHKGFYDMYTTTIQDSQLNRM  342
             WRGT +  E   D       A  +F        N  P +  G+  +YTT+   S+ ++ 
Sbjct  137  AWRGTMQLYEWANDFDFPLELATSVFPPTDPNDPNDPPRIANGWLSLYTTSNTHSRFDKT  196

Query  343  SARDQIR  363
            SA++Q++
Sbjct  197  SAQEQVQ  203



>ref|XP_006417941.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
 gb|ESQ36294.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
Length=411

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 68/124 (55%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y VTKY YAT+   +     + V     DA   ++NW GYIAVATDEGK  LGRRDI+V
Sbjct  79   RYNVTKYIYATASLKLP--ICFIVKSLSKDASRVQTNWMGYIAVATDEGKAMLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSH---PLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A  +F        P V  G+ D+YT +  +S  +  SAR
Sbjct  137  AWRGTLQPYEWANDFDFPLESAISVFPVTDPKVVPRVGSGWLDVYTASDSNSPYDTTSAR  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>gb|KFK42950.1| hypothetical protein AALP_AA1G060100 [Arabis alpina]
Length=412

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 68/124 (55%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +Y VTKY YAT+   I     + V     DA   ++NW GYIAVATDEGK  LGRRDI+V
Sbjct  79   RYNVTKYIYATAS--IKLPICFIVKSLSKDATRVQTNWMGYIAVATDEGKAMLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIF---GQNSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A  +F        P +  G+ D+YT +  +S  +  SA+
Sbjct  137  AWRGTLQPYEWANDFDFPLESAASVFPVTDPKDVPRIGSGWLDIYTASDSNSPYDTTSAQ  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>gb|KDP21071.1| hypothetical protein JCGZ_21542 [Jatropha curcas]
Length=407

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (56%), Gaps = 12/120 (10%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY+VT +FY  S F  G  T           +   S + G++AV TDEGK+  GRRDI+V
Sbjct  78   KYQVTDFFYGRSEFDFGDWT-----------IAGLSAYFGFVAVTTDEGKIVTGRRDIVV  126

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT   +E   D   +F +   +F  ++   VH GF+ +YTT+  DS  N+ SAR+Q+
Sbjct  127  CWRGTSFTIEWFKDFDHIFTSGSDLF-PDTDAKVHNGFHSVYTTSKSDSTYNKRSAREQV  185



>gb|ABK96341.1| unknown [Populus trichocarpa x Populus deltoides]
Length=396

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 66/124 (53%), Gaps = 23/124 (19%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVL-----RESNWNGYIAVATDEGKVALGR  165
            KY+VT + Y                  +VDA +      ES W+ Y+AVAT+EGK  LGR
Sbjct  88   KYQVTDFIYG-----------------KVDAKVLLLDDSESTWSAYVAVATNEGKALLGR  130

Query  166  RDILVVWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMS  345
            RDI+V WRGT   +E + D     ++ P IFG N    +HKGF+ +YT     S  ++ S
Sbjct  131  RDIVVSWRGTSLSVEWLKDFDAELISVPEIFG-NDVAKMHKGFHSLYTAKDDKSTYSKTS  189

Query  346  ARDQ  357
            ARDQ
Sbjct  190  ARDQ  193



>ref|XP_011027708.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
 ref|XP_011015585.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=396

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 67/125 (54%), Gaps = 23/125 (18%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVL-----RESNWNGYIAVATDEGKVALGR  165
            KY+VT + Y                   VDA +      ES W+ Y+AVAT+EGK  LGR
Sbjct  88   KYQVTDFIYG-----------------EVDAKILILDDSESTWSAYVAVATNEGKALLGR  130

Query  166  RDILVVWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMS  345
            RDI+V WRGT   +E + D     ++AP IF +N    +HKGF+ +YT     S  ++ S
Sbjct  131  RDIVVSWRGTLLSVEWLKDFDAELISAPEIF-RNDVAKMHKGFHSLYTAKDDKSTYSKTS  189

Query  346  ARDQI  360
            ARDQ+
Sbjct  190  ARDQV  194



>gb|ABR16123.1| unknown [Picea sitchensis]
Length=554

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 52/122 (43%), Positives = 68/122 (56%), Gaps = 7/122 (6%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVA-LGRRDILV  180
            YEVTKY YATS   +   TG    P         +NW G+IAVATDE ++  LGRRDI++
Sbjct  182  YEVTKYLYATSNINL---TGLFQKPRVQKMWSTHANWMGFIAVATDEEEIKRLGRRDIVI  238

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLV--HKGFYDMYTTTIQDSQLNRMSARD  354
             WRGT  +LE I D+      A L +  + HP V    GF  +YT   +D +  + SARD
Sbjct  239  AWRGTVTYLEWIADLMDYLRPAELNY-VHPHPDVKIESGFLSLYTARERDCRFCKSSARD  297

Query  355  QI  360
            Q+
Sbjct  298  QV  299



>ref|XP_010673678.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=514

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 67/120 (56%), Gaps = 5/120 (4%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVA-LGRRDILV  180
            Y++ +Y YATS   I     +  S +        +NW GY+AV +DE ++  LGRRDIL+
Sbjct  153  YDICRYLYATSN--INLEKFFQKSSSIRSIWSPHANWMGYVAVTSDEEEIKRLGRRDILI  210

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
             WRGT  +LE I D+  +    P  F  N H  +  GFYD+YTT  ++ +    SAR+Q+
Sbjct  211  TWRGTVTYLEWIHDLKNIL--RPAHFRDNPHIQIESGFYDLYTTKEENCKYCSFSAREQV  268



>ref|XP_007208931.1| hypothetical protein PRUPE_ppb012141mg [Prunus persica]
 gb|EMJ10130.1| hypothetical protein PRUPE_ppb012141mg [Prunus persica]
Length=185

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 65/121 (54%), Gaps = 18/121 (15%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KYEV KY YA + F  G                 +S+  G++AV+TDEG   LGRRDIL+
Sbjct  81   KYEVKKYLYAATRFAPG-----------------KSSLLGFVAVSTDEGSKVLGRRDILI  123

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNR-MSARDQ  357
             WRGT    E   D T++F +A  I G+  +P VH G++  YT    +S  N+  S RDQ
Sbjct  124  SWRGTMLDQELEVDATILFFSASDILGKEHNPQVHLGWHGYYTNLDSESAHNKTASCRDQ  183

Query  358  I  360
            +
Sbjct  184  L  184



>ref|XP_009144598.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=408

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 47/124 (38%), Positives = 70/124 (56%), Gaps = 5/124 (4%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            +YEVTK+ Y TS   I     + ++    +A  +ESNW GY+AVATDE K  LGRRDI+V
Sbjct  79   RYEVTKFIYGTSS--IKLPECFMINSWSREAWNKESNWLGYVAVATDECKELLGRRDIVV  136

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQ---NSHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
             WRGT +  E   D      +A  +  +   +  P +  G+  +YTT    S+ ++ SAR
Sbjct  137  AWRGTIQLYEWANDFDFPLESAISVLPRADPSDPPRIASGWLSLYTTADPRSRFDKTSAR  196

Query  352  DQIR  363
            +Q++
Sbjct  197  EQVQ  200



>ref|XP_001779106.1| predicted protein [Physcomitrella patens]
 gb|EDQ56052.1| predicted protein [Physcomitrella patens]
Length=469

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 51/121 (42%), Positives = 67/121 (55%), Gaps = 7/121 (6%)
 Frame = +1

Query  4    YEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKV-ALGRRDILV  180
            Y VT Y YAT+   + +   +     R DA  ++SNW GY+AV TDE ++  LGRRDILV
Sbjct  113  YTVTWYIYATANVRVWS---FLRRSEREDAWSKKSNWIGYVAVCTDEKEINRLGRRDILV  169

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQN---SHPLVHKGFYDMYTTTIQDSQLNRMSAR  351
            VWRGT   LE   +     V    I G N   S P V  GF  +YT+    S+ N++SAR
Sbjct  170  VWRGTVTGLEWAANAQYFLVPCAFIDGGNDNESTPKVEAGFLSLYTSADDSSRFNKISAR  229

Query  352  D  354
            +
Sbjct  230  E  230



>ref|XP_010686321.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 71/125 (57%), Gaps = 6/125 (5%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVLRESNWNGYIAVATDEGKVALGRRDILV  180
            KY VTK+FYATS   +     +  S + ++   +++N+ GYIAVA D+    LGRR+I+V
Sbjct  112  KYRVTKFFYATSAIDVPDAFIFK-SLSSIEQSSKDTNFMGYIAVAEDDAVELLGRREIVV  170

Query  181  VWRGTRRFLEAITDITLVFVNAPLIFGQNS-----HPLVHKGFYDMYTTTIQDSQLNRMS  345
             WRG+  F+E + D+  + V+A  I           P VH+G++ +YTT    S   + S
Sbjct  171  AWRGSVEFMEWLNDLKFLQVSASDILAHEGDDGEPEPEVHQGWHSIYTTDNLSSPFEKTS  230

Query  346  ARDQI  360
            AR Q+
Sbjct  231  ARQQV  235



>gb|KCW89613.1| hypothetical protein EUGRSUZ_A01896, partial [Eucalyptus grandis]
Length=330

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 19/106 (18%)
 Frame = +1

Query  100  RESNWNGYIAVATDEGKVALGRRDILVVWRGTRRFLEAITDITLVFVNAPLIFGQNSH--  273
            +ESNW GY+AVATD+GK ALGRRDIL+ WRGT + LE  +D       A  I G      
Sbjct  18   KESNWIGYVAVATDKGKAALGRRDILIAWRGTIQVLEWASDFNFPLTPATKILGGTDPDA  77

Query  274  -----------------PLVHKGFYDMYTTTIQDSQLNRMSARDQI  360
                             P VH GF  +YT+    S+ N+ SAR+Q+
Sbjct  78   DADTAADAAADDVDDIIPKVHSGFLSVYTSDDPRSEFNKSSAREQV  123



>ref|XP_002305084.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
 gb|EEE85595.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
Length=396

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 65/124 (52%), Gaps = 23/124 (19%)
 Frame = +1

Query  1    KYEVTKYFYATSGFPIGARTGYTVSPARVDAVL-----RESNWNGYIAVATDEGKVALGR  165
            KY+VT + Y                   VDA +      ES W+ Y+AVAT+EGK  LGR
Sbjct  88   KYQVTDFIYG-----------------EVDAKILLLDDSESTWSAYVAVATNEGKALLGR  130

Query  166  RDILVVWRGTRRFLEAITDITLVFVNAPLIFGQNSHPLVHKGFYDMYTTTIQDSQLNRMS  345
            RDI+V WRGT   +E + D     ++ P IFG N    +HKGF+ +YT     S  ++ S
Sbjct  131  RDIVVSWRGTSLSVEWLKDFDAELISVPGIFG-NDVAKMHKGFHSLYTAKDDKSTYSKTS  189

Query  346  ARDQ  357
            ARDQ
Sbjct  190  ARDQ  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516420797772