BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8209_g1_i1 len=1513 path=[1:0-417 419:418-441 2613:442-1512]

Length=1513
                                                                      Score     E

gb|AAB07724.1|  Pn47p                                                   487   1e-165   Ipomoea nil [qian niu]
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           423   1e-140   
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              419   9e-139   
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              412   3e-136   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              412   7e-136   
emb|CDO96758.1|  unnamed protein product                                409   2e-135   
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              404   8e-133   
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           403   1e-132   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           403   1e-132   
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                402   4e-132   
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     402   5e-132   
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           403   6e-132   
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           401   1e-131   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             400   2e-131   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                400   2e-131   
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   399   3e-131   
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     399   4e-131   Vitis vinifera
gb|KHN18919.1|  Phospholipase A1-IIgamma                                398   5e-131   
emb|CDO96757.1|  unnamed protein product                                397   8e-131   
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           398   1e-130   
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           398   2e-130   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           397   2e-130   
ref|XP_006362439.1|  PREDICTED: phospholipase A1-IIgamma-like           397   2e-130   
gb|KHN08451.1|  Phospholipase A1-IIgamma                                395   8e-130   
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              395   1e-129   
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            394   2e-129   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           395   2e-129   
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             395   2e-129   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           394   6e-129   
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                394   7e-129   
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           393   1e-128   
ref|XP_004232958.1|  PREDICTED: phospholipase A1-II 1-like              392   3e-128   
ref|XP_003593747.1|  Lipase                                             390   1e-127   
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             389   2e-127   
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         388   4e-127   
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           388   5e-127   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           388   7e-127   
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           385   6e-126   
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg                386   7e-126   
ref|XP_002522554.1|  triacylglycerol lipase, putative                   385   1e-125   Ricinus communis
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           384   1e-125   
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   384   2e-125   
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           384   4e-125   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           383   5e-125   
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           382   8e-125   
emb|CBI30665.3|  unnamed protein product                                381   9e-125   
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           380   6e-124   
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           379   2e-123   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           379   2e-123   
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           377   5e-123   
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like              378   8e-123   
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           376   2e-122   
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           376   2e-122   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          377   3e-122   
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             375   4e-122   
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    375   4e-122   
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           375   4e-122   
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              375   9e-122   
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           374   1e-121   
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           374   1e-121   
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                375   2e-121   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           375   2e-121   
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    373   2e-121   
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       375   3e-121   
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           372   9e-121   
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              372   1e-120   
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           371   1e-120   
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           371   1e-120   
gb|ABQ95989.1|  phospholipase A1                                        370   3e-120   Capsicum annuum
ref|XP_002305750.2|  lipase class 3 family protein                      369   1e-119   Populus trichocarpa [western balsam poplar]
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           369   2e-119   
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           368   2e-119   
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           367   4e-119   
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           367   6e-119   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like           367   7e-119   
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           367   1e-118   
ref|XP_002316835.2|  lipase class 3 family protein                      366   2e-118   Populus trichocarpa [western balsam poplar]
emb|CDP11819.1|  unnamed protein product                                365   4e-118   
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like           364   1e-117   
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              363   1e-117   
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma                367   1e-117   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   363   2e-117   
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           363   2e-117   
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like           363   2e-117   
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    362   8e-117   
ref|XP_004232955.1|  PREDICTED: phospholipase A1-II 1-like isofor...    362   1e-116   
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like           362   1e-116   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   361   1e-116   
emb|CBI21954.3|  unnamed protein product                                360   2e-116   
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    361   3e-116   
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    359   8e-116   
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like           359   9e-116   
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                359   1e-115   
ref|XP_010316799.1|  PREDICTED: phospholipase A1-II 1-like isofor...    357   9e-115   
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...    355   3e-114   
gb|EPS70940.1|  hypothetical protein M569_03817                         354   7e-114   
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like           355   1e-113   
gb|AFK47098.1|  unknown                                                 353   1e-113   
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           354   2e-113   
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like           352   2e-112   
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    351   3e-112   
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4             349   7e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002525127.1|  triacylglycerol lipase, putative                   349   8e-112   Ricinus communis
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma                349   2e-111   
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                   349   2e-111   
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    347   4e-111   
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                    346   1e-110   
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like           347   1e-110   
ref|XP_002867985.1|  lipase class 3 family protein                      346   2e-110   
emb|CDY01554.1|  BnaC07g35440D                                          346   3e-110   
ref|XP_003608120.1|  Lipase                                             344   9e-110   
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg             343   3e-109   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg             343   4e-109   
ref|XP_002525129.1|  triacylglycerol lipase, putative                   342   5e-109   Ricinus communis
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          340   1e-108   
gb|EYU17473.1|  hypothetical protein MIMGU_mgv1a008748mg                339   2e-108   
ref|XP_011047741.1|  PREDICTED: phospholipase A1-IIgamma-like           340   3e-108   
ref|NP_193590.1|  phospholipase A1-IIgamma                              340   5e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   339   6e-108   
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like              338   6e-108   
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    340   2e-107   
ref|XP_009333706.1|  PREDICTED: phospholipase A1-IIgamma-like           336   3e-107   
ref|XP_003608122.1|  Lipase                                             336   5e-107   
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1      336   9e-107   
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                   335   2e-106   
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630          335   2e-106   Sorghum bicolor [broomcorn]
ref|XP_010108435.1|  Phospholipase A1-IIgamma                           333   6e-106   
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640          335   7e-106   Sorghum bicolor [broomcorn]
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like              333   2e-105   
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma                333   3e-105   
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1             332   3e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like           332   4e-105   
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...    333   8e-105   
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg             330   2e-104   
ref|XP_008345355.1|  PREDICTED: phospholipase A1-IIgamma-like           330   2e-104   
emb|CDM83551.1|  unnamed protein product                                329   3e-104   
dbj|BAJ96485.1|  predicted protein                                      329   4e-104   
gb|EMT15519.1|  Lipase                                                  329   4e-104   
ref|XP_006428645.1|  hypothetical protein CICLE_v10011864mg             329   6e-104   
ref|XP_004301748.1|  PREDICTED: phospholipase A1-IIgamma-like           328   9e-104   
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1       328   1e-103   
ref|XP_011005461.1|  PREDICTED: phospholipase A1-IIgamma-like           328   1e-103   
ref|XP_006374295.1|  hypothetical protein POPTR_0015s05760g             327   5e-103   
ref|NP_001151242.1|  triacylglycerol lipase                             326   5e-103   Zea mays [maize]
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...    326   7e-103   
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1              327   8e-103   
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like              326   1e-102   
ref|XP_006374296.1|  hypothetical protein POPTR_0015s05770g             325   4e-102   
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like              324   4e-102   
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like           325   7e-102   
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like              324   1e-101   
ref|XP_011100290.1|  PREDICTED: phospholipase A1-IIgamma-like           323   1e-101   
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...    322   1e-101   
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    323   2e-101   
ref|XP_011005460.1|  PREDICTED: phospholipase A1-II 4-like              323   2e-101   
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    322   2e-101   
ref|XP_011027708.1|  PREDICTED: phospholipase A1-IIgamma-like           322   3e-101   
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                321   9e-101   
ref|XP_002305084.2|  hypothetical protein POPTR_0004s05380g             320   1e-100   Populus trichocarpa [western balsam poplar]
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              321   1e-100   
ref|NP_001152663.1|  triacylglycerol lipase precursor                   321   1e-100   Zea mays [maize]
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor     321   1e-100   Zea mays [maize]
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like              320   2e-100   
gb|EMT21704.1|  Putative lipase                                         321   2e-100   
gb|EMS63185.1|  Phospholipase A1-II 1                                   331   3e-100   
ref|NP_172115.1|  phospholipase A1-IIalpha                              320   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    335   3e-100   
gb|ABK96341.1|  unknown                                                 318   5e-100   Populus trichocarpa x Populus deltoides
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2             318   6e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          319   7e-100   Sorghum bicolor [broomcorn]
gb|AAM61647.1|  lipase-like protein                                     318   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg             318   1e-99    
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             318   2e-99    
emb|CDX86530.1|  BnaC08g01730D                                          317   3e-99    
emb|CDM85400.1|  unnamed protein product                                317   3e-99    
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           317   3e-99    
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like           317   4e-99    
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420          316   5e-99    Sorghum bicolor [broomcorn]
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              317   6e-99    
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           317   6e-99    
ref|NP_001043730.2|  Os01g0651200                                       316   6e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008238422.1|  PREDICTED: phospholipase A1-IIgamma-like           315   6e-99    
ref|XP_008238421.1|  PREDICTED: phospholipase A1-IIgamma-like           315   9e-99    
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             315   2e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like              312   2e-97    
dbj|BAJ95995.1|  predicted protein                                      313   2e-97    
ref|NP_001149813.1|  triacylglycerol lipase                             310   6e-97    Zea mays [maize]
gb|KDP46903.1|  hypothetical protein JCGZ_24112                         310   9e-97    
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    310   1e-96    
ref|XP_007014120.1|  Alpha/beta-Hydrolases superfamily protein          310   1e-96    
gb|EMT05578.1|  hypothetical protein F775_13080                         309   4e-96    
ref|XP_004301746.1|  PREDICTED: phospholipase A1-IIgamma-like           308   4e-96    
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha                309   5e-96    
gb|KDP46901.1|  hypothetical protein JCGZ_24110                         308   6e-96    
gb|KDP31780.1|  hypothetical protein JCGZ_12241                         307   6e-96    
gb|EAY75192.1|  hypothetical protein OsI_03084                          308   7e-96    Oryza sativa Indica Group [Indian rice]
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta          308   9e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like              309   1e-95    
emb|CDY10187.1|  BnaC05g04300D                                          307   2e-95    
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like            307   2e-95    
gb|ABK23399.1|  unknown                                                 307   2e-95    Picea sitchensis
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       323   3e-95    
gb|ABR18391.1|  unknown                                                 306   4e-95    Picea sitchensis
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    305   4e-95    
dbj|BAD68802.1|  lipase-like protein                                    306   6e-95    Oryza sativa Japonica Group [Japonica rice]
emb|CDY57813.1|  BnaA10g28020D                                          310   6e-95    
ref|XP_007210039.1|  hypothetical protein PRUPE_ppa017270mg             304   9e-95    
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like            305   1e-94    
ref|XP_003528483.1|  PREDICTED: phospholipase A1-IIgamma-like           303   2e-94    
gb|KDP46905.1|  hypothetical protein JCGZ_24114                         303   3e-94    
ref|XP_002522552.1|  triacylglycerol lipase, putative                   303   4e-94    Ricinus communis
emb|CDX76515.1|  BnaA08g08850D                                          303   7e-94    
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like              303   7e-94    
gb|EMS52156.1|  Phospholipase A1-II 2                                   301   2e-93    
ref|XP_008238420.1|  PREDICTED: phospholipase A1-IIgamma-like           301   2e-93    
gb|EMT15520.1|  Feruloyl esterase A                                     309   2e-93    
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              301   4e-93    
gb|EEE64775.1|  hypothetical protein OsJ_19631                          300   4e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta                 301   5e-93    
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like              301   8e-93    
ref|XP_007208858.1|  hypothetical protein PRUPE_ppa025833mg             299   1e-92    
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg             298   3e-92    
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg             298   4e-92    
ref|XP_010655496.1|  PREDICTED: phospholipase A1-IIgamma isoform X2     295   7e-92    
ref|XP_003565876.1|  PREDICTED: phospholipase A1-II 6-like              298   2e-91    
ref|XP_007025431.1|  Alpha/beta-Hydrolases superfamily protein          295   3e-91    
gb|EAY99121.1|  hypothetical protein OsI_21080                          296   3e-91    Oryza sativa Indica Group [Indian rice]
gb|EMS63790.1|  Phospholipase A1-II 7                                   299   5e-91    
emb|CDY23963.1|  BnaC03g17280D                                          295   8e-91    
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810          295   8e-91    Sorghum bicolor [broomcorn]
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like              295   9e-91    
gb|EMT11182.1|  hypothetical protein F775_27795                         296   2e-90    
emb|CDX84801.1|  BnaA03g14290D                                          294   3e-90    
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like            293   3e-90    
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                    292   1e-89    
emb|CDX99456.1|  BnaC01g10960D                                          291   1e-89    
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg                291   2e-89    
ref|XP_003608142.1|  Lipase                                             288   5e-89    
ref|NP_001056387.1|  Os05g0574100                                       288   6e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644445.1|  PREDICTED: phospholipase A1-II 3-like              288   6e-88    
gb|KDP21072.1|  hypothetical protein JCGZ_21543                         286   2e-87    
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202              287   2e-87    
ref|XP_002438517.1|  hypothetical protein SORBIDRAFT_10g021250          285   3e-87    Sorghum bicolor [broomcorn]
dbj|BAJ85084.1|  predicted protein                                      286   8e-87    
ref|NP_001043734.1|  Os01g0651800                                       285   8e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011047800.1|  PREDICTED: phospholipase A1-II 4-like              286   8e-87    
emb|CDY34061.1|  BnaC03g62710D                                          284   1e-86    
gb|ABK24664.1|  unknown                                                 285   1e-86    Picea sitchensis
gb|EMS51987.1|  Phospholipase A1-II 3                                   285   1e-86    
sp|A2WTA0.1|PLA3_ORYSI  RecName: Full=Phospholipase A1-II 3; Flag...    284   1e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_002488949.1|  hypothetical protein SORBIDRAFT_1306s002010        283   2e-86    Sorghum bicolor [broomcorn]
emb|CDY53993.1|  BnaA03g58180D                                          281   2e-86    
ref|XP_006469038.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    283   3e-86    
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like              283   3e-86    
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                    281   1e-85    
gb|KDP21071.1|  hypothetical protein JCGZ_21542                         281   2e-85    
ref|XP_002440294.1|  hypothetical protein SORBIDRAFT_09g029220          280   3e-85    Sorghum bicolor [broomcorn]
gb|KDO38625.1|  hypothetical protein CISIN_1g0208022mg                  275   8e-85    
ref|XP_002437113.1|  hypothetical protein SORBIDRAFT_10g021260          279   1e-84    Sorghum bicolor [broomcorn]
ref|XP_002892328.1|  predicted protein                                  276   2e-84    
ref|XP_002441554.1|  hypothetical protein SORBIDRAFT_09g029230          277   2e-84    Sorghum bicolor [broomcorn]
gb|EAY75191.1|  hypothetical protein OsI_03083                          276   2e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_006655614.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    278   2e-84    
ref|XP_010058981.1|  PREDICTED: phospholipase A1-IIgamma-like           278   3e-84    
ref|XP_006646158.1|  PREDICTED: phospholipase A1-II 4-like              275   1e-83    
ref|XP_010557126.1|  PREDICTED: phospholipase A1-IIbeta isoform X2      273   2e-83    
gb|EMS48809.1|  Phospholipase A1-II 6                                   277   2e-83    
gb|EMT04701.1|  Lipase                                                  273   6e-83    
dbj|BAJ90094.1|  predicted protein                                      271   2e-82    
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          275   5e-82    
ref|XP_007025428.1|  Alpha/beta-Hydrolases superfamily protein          271   7e-82    
gb|EMT30117.1|  Mono- and diacylglycerol lipase                         272   8e-82    
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           276   8e-82    
gb|KCW89613.1|  hypothetical protein EUGRSUZ_A01896                     269   9e-82    
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    275   1e-81    
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    274   3e-81    
gb|KHG20660.1|  Phospholipase A1-IIgamma -like protein                  270   3e-81    
gb|EMS68153.1|  Phospholipase A1-II 7                                   269   6e-81    
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    272   6e-81    
ref|NP_001168256.1|  hypothetical protein                               268   7e-81    
ref|XP_003518892.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    271   8e-81    
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    273   8e-81    
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             272   1e-80    
ref|XP_009144598.1|  PREDICTED: phospholipase A1-IIbeta-like            268   1e-80    
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             271   1e-80    
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    271   1e-80    
emb|CDY24728.1|  BnaC04g13330D                                          268   2e-80    
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    271   3e-80    
ref|XP_010689863.1|  PREDICTED: phospholipase A1-IIdelta-like           268   4e-80    
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    270   6e-80    
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    270   7e-80    
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940          270   7e-80    
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    270   9e-80    
ref|XP_010087133.1|  Phospholipase A1-Igamma1                           269   1e-79    
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    269   2e-79    
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like           265   3e-79    
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    268   3e-79    
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    267   5e-79    
gb|EPS65213.1|  hypothetical protein M569_09566                         264   6e-79    
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     267   7e-79    
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    266   1e-78    
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    267   1e-78    
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         266   1e-78    
gb|ABR16123.1|  unknown                                                 267   2e-78    
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    266   2e-78    
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                     266   3e-78    
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                   263   3e-78    
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    265   4e-78    
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    265   4e-78    
ref|XP_006646154.1|  PREDICTED: phospholipase A1-II 2-like              260   4e-78    
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    265   6e-78    
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    265   7e-78    
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    265   8e-78    
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    264   1e-77    
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    263   2e-77    
ref|XP_007025427.1|  Alpha/beta-Hydrolases superfamily protein          259   3e-77    
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                   261   3e-77    
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg             261   4e-77    
emb|CAN74039.1|  hypothetical protein VITISV_012945                     262   4e-77    
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    262   4e-77    
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg             261   5e-77    
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    262   6e-77    
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                   259   1e-76    
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    259   4e-76    
ref|XP_003518893.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    258   6e-76    
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g             259   7e-76    
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    259   9e-76    
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    258   1e-75    
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    258   1e-75    
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    258   1e-75    
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    257   2e-75    
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         258   2e-75    
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             258   2e-75    
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    258   2e-75    
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    258   2e-75    
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    258   3e-75    
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             258   4e-75    
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    256   5e-75    
ref|XP_002891639.1|  lipase class 3 family protein                      256   9e-75    
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg             256   9e-75    
ref|XP_007024951.1|  Alpha/beta-Hydrolases superfamily protein          256   1e-74    
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    256   1e-74    
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    255   1e-74    
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    256   2e-74    
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                254   2e-74    
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         255   2e-74    
ref|XP_011028053.1|  PREDICTED: phospholipase A1-IIdelta                252   2e-74    
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             254   3e-74    
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                256   3e-74    
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    253   3e-74    
ref|XP_002303465.1|  lipase family protein                              251   4e-74    
emb|CDP15943.1|  unnamed protein product                                251   1e-73    
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    253   1e-73    
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    252   1e-73    
emb|CDP03693.1|  unnamed protein product                                250   1e-73    
gb|KGN44761.1|  hypothetical protein Csa_7G378500                       253   1e-73    
ref|XP_006853087.1|  hypothetical protein AMTR_s00038p00110060          253   2e-73    
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    253   2e-73    
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    253   2e-73    
ref|NP_564590.1|  DAD1-like lipase 2                                    253   2e-73    
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    252   2e-73    
emb|CDY49813.1|  BnaC06g04560D                                          252   3e-73    
ref|XP_006411539.1|  hypothetical protein EUTSA_v10017651mg             249   3e-73    
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    251   3e-73    
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    252   4e-73    
emb|CDY22842.1|  BnaA06g02350D                                          251   6e-73    
ref|XP_001781080.1|  predicted protein                                  248   6e-73    
ref|XP_010276983.1|  PREDICTED: phospholipase A1-IIdelta                249   7e-73    
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    251   7e-73    
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    251   7e-73    
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein          251   7e-73    
gb|EEE64776.1|  hypothetical protein OsJ_19632                          244   8e-73    
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             251   8e-73    
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    249   9e-73    
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    251   9e-73    
ref|XP_006294314.1|  hypothetical protein CARUB_v10023322mg             248   1e-72    
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                     248   2e-72    
ref|XP_010525149.1|  PREDICTED: phospholipase A1-IIdelta-like           247   2e-72    
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    251   2e-72    
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             251   2e-72    
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    250   2e-72    
gb|KDP38020.1|  hypothetical protein JCGZ_04663                         249   3e-72    
ref|XP_010246745.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    249   3e-72    
gb|KCW74056.1|  hypothetical protein EUGRSUZ_E02682                     246   3e-72    
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like           248   3e-72    
ref|XP_002522553.1|  triacylglycerol lipase, putative                   248   3e-72    
gb|EYU19151.1|  hypothetical protein MIMGU_mgv1a006227mg                248   3e-72    
ref|XP_007132834.1|  hypothetical protein PHAVU_011G128500g             246   3e-72    
gb|EYU31376.1|  hypothetical protein MIMGU_mgv1a004679mg                249   3e-72    
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...    249   3e-72    
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    249   4e-72    
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg             249   4e-72    
ref|XP_006853086.1|  hypothetical protein AMTR_s00038p00106840          250   7e-72    
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    249   7e-72    
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                    248   9e-72    
gb|KGN66495.1|  hypothetical protein Csa_1G614650                       249   9e-72    
ref|XP_003607369.1|  Lipase                                             248   1e-71    
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    248   1e-71    
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    247   2e-71    
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    247   2e-71    
ref|XP_008228927.1|  PREDICTED: phospholipase A1-IIdelta                246   2e-71    
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    247   2e-71    
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    247   2e-71    
ref|XP_010655698.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    247   3e-71    
ref|XP_006411537.1|  hypothetical protein EUTSA_v10016724mg             244   4e-71    
ref|XP_007217233.1|  hypothetical protein PRUPE_ppa005547mg             245   4e-71    
ref|XP_002892359.1|  lipase class 3 family protein                      246   4e-71    
emb|CDY10228.1|  BnaC05g04710D                                          246   5e-71    
ref|XP_008371801.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    246   5e-71    
ref|XP_008343100.1|  PREDICTED: phospholipase A1-IIdelta-like           243   5e-71    
ref|NP_849603.1|  phospholipase A1-Igamma1                              246   6e-71    
gb|KCW74059.1|  hypothetical protein EUGRSUZ_E02687                     242   6e-71    
gb|EPS65211.1|  hypothetical protein M569_09564                         243   6e-71    
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    246   1e-70    
ref|XP_011082995.1|  PREDICTED: phospholipase A1-IIdelta                242   2e-70    
ref|XP_004135535.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    245   2e-70    
gb|ACJ76846.1|  chloroplast lipase protein                              245   2e-70    
ref|XP_004167249.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    245   2e-70    
ref|XP_010685025.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    244   2e-70    
ref|XP_008353849.1|  PREDICTED: phospholipase A1-IIdelta-like           242   2e-70    
ref|XP_010104406.1|  Phospholipase A1-IIdelta                           241   2e-70    
emb|CBI21996.3|  unnamed protein product                                244   2e-70    
ref|XP_008371806.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    244   2e-70    
ref|XP_009362274.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    244   2e-70    
ref|XP_001779106.1|  predicted protein                                  243   3e-70    
ref|XP_010925002.1|  PREDICTED: phospholipase A1-II 5-like              242   4e-70    
gb|EYU41122.1|  hypothetical protein MIMGU_mgv1a021036mg                241   4e-70    
ref|XP_009362273.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    244   5e-70    
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    244   6e-70    
ref|NP_181797.1|  phospholipase A1-IIdelta                              241   6e-70    
ref|XP_002281095.2|  PREDICTED: phospholipase A1-IIdelta                242   6e-70    
gb|KEH23856.1|  phospholipase A1                                        243   7e-70    
ref|XP_006417878.1|  hypothetical protein EUTSA_v10007393mg             243   7e-70    
ref|XP_010540608.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    243   9e-70    
ref|XP_010925003.1|  PREDICTED: phospholipase A1-II 5-like              241   9e-70    
gb|EYU41119.1|  hypothetical protein MIMGU_mgv1a025698mg                240   9e-70    
emb|CDY50817.1|  BnaC04g52540D                                          239   1e-69    
ref|XP_010512889.1|  PREDICTED: phospholipase A1-IIdelta-like           239   1e-69    
ref|XP_011096641.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    243   1e-69    
ref|XP_008371821.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    243   1e-69    
ref|XP_010522024.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    243   1e-69    
ref|XP_010506105.1|  PREDICTED: phospholipase A1-IIdelta-like           239   1e-69    
ref|XP_007048712.1|  Alpha/beta-Hydrolases superfamily protein          239   1e-69    
gb|AAD01804.1|  lipase                                                  239   3e-69    
emb|CDM86669.1|  unnamed protein product                                242   4e-69    
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    243   4e-69    
ref|XP_002881867.1|  hypothetical protein ARALYDRAFT_483364             238   4e-69    
ref|XP_006448978.1|  hypothetical protein CICLE_v10014927mg             241   4e-69    
ref|XP_003607601.1|  Feruloyl esterase A                                239   4e-69    
ref|XP_010655697.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    241   5e-69    
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g             241   5e-69    
ref|XP_009115161.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    241   5e-69    
ref|XP_009792730.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    241   6e-69    
ref|XP_003532708.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    240   6e-69    
ref|XP_008444745.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    241   6e-69    
ref|XP_010413021.1|  PREDICTED: phospholipase A1-IIdelta-like           238   6e-69    
ref|XP_010274200.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    239   7e-69    
ref|XP_011042425.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    238   9e-69    
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                     239   1e-68    
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg             241   1e-68    
gb|ACJ85535.1|  unknown                                                 238   1e-68    
ref|XP_009142078.1|  PREDICTED: phospholipase A1-IIdelta                237   2e-68    
ref|XP_010507708.1|  PREDICTED: phospholipase A1-IIdelta-like           236   2e-68    
ref|XP_010069172.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    239   2e-68    
ref|XP_007212825.1|  hypothetical protein PRUPE_ppa020655mg             239   3e-68    
ref|XP_009801144.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    239   3e-68    
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    241   3e-68    
ref|XP_011080360.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    239   3e-68    
ref|XP_010508539.1|  PREDICTED: phospholipase A1-IIdelta isoform X1     236   4e-68    
ref|XP_009102705.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    239   4e-68    
emb|CDP09265.1|  unnamed protein product                                238   6e-68    
emb|CDX97819.1|  BnaC04g41200D                                          238   6e-68    
ref|XP_010938722.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    238   7e-68    
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    236   7e-68    
ref|XP_002513514.1|  triacylglycerol lipase, putative                   237   7e-68    
dbj|BAJ99811.1|  predicted protein                                      238   8e-68    
ref|XP_008225538.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    238   9e-68    
ref|XP_009605461.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    237   1e-67    
gb|ABR17156.1|  unknown                                                 237   1e-67    
emb|CDM86668.1|  unnamed protein product                                238   1e-67    
emb|CDY02287.1|  BnaA09g26150D                                          237   1e-67    
gb|KDO75376.1|  hypothetical protein CISIN_1g037474mg                   237   1e-67    
ref|XP_006468077.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    237   1e-67    
gb|EAZ12914.1|  hypothetical protein OsJ_02837                          233   2e-67    
ref|XP_006415481.1|  hypothetical protein EUTSA_v10007346mg             237   2e-67    
ref|XP_010269807.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    236   2e-67    
emb|CDP21091.1|  unnamed protein product                                236   3e-67    
ref|XP_007144693.1|  hypothetical protein PHAVU_007G177100g             236   3e-67    
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    237   4e-67    
emb|CDY09593.1|  BnaC05g23260D                                          236   4e-67    
emb|CDX77597.1|  BnaA07g07350D                                          233   5e-67    
emb|CDY29665.1|  BnaA04g17620D                                          236   5e-67    
ref|XP_006364888.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    235   5e-67    
gb|KDP47123.1|  hypothetical protein JCGZ_22119                         233   6e-67    
ref|XP_006446810.1|  hypothetical protein CICLE_v10015386mg             233   7e-67    
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    235   8e-67    
ref|XP_010517807.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    232   1e-66    
gb|KFK37117.1|  hypothetical protein AALP_AA4G215100                    232   1e-66    
ref|XP_004505480.1|  PREDICTED: phospholipase A1-IIdelta-like           234   1e-66    
tpg|DAA53109.1|  TPA: hypothetical protein ZEAMMB73_566262              234   1e-66    



>gb|AAB07724.1| Pn47p [Ipomoea nil]
Length=402

 Score =   487 bits (1253),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 250/398 (63%), Positives = 296/398 (74%), Gaps = 7/398 (2%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSGS NWEGLL+PLDSDLRRYLIHYG+MVS   DSFINE  SKNVGL RYAR+NL
Sbjct  6     KRWKVLSGSDNWEGLLEPLDSDLRRYLIHYGTMVSPATDSFINEAASKNVGLPRYARRNL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTA-TNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
             L   G   GNPFKYEVTKYFY+PSTI      Y +++ R D VLK+SNW GYVAVATD+G
Sbjct  66    LANCGLVKGNPFKYEVTKYFYAPSTIPLPDEGYNVRATRADAVLKESNWNGYVAVATDEG  125

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDP  736
             K ALGRRDIL+ WRGT+R +EW +N  F FVKAPL FGQ+S+PLVHKG+YDMYT +N D 
Sbjct  126   KVALGRRDILIVWRGTIRKSEWNENLTFWFVKAPLFFGQNSDPLVHKGWYDMYTTINQDS  185

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
              L   SARDQIREEV RLVE YKDE++SIT+ GHSLGSS+ATLNAVDL  NPIN +  I 
Sbjct  186   QLNEKSARDQIREEVARLVELYKDEDISITVTGHSLGSSMATLNAVDLAANPINNNKNIL  245

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             VTAFL+ASPKVG+ NFKN +S    NL+ LR++D  DIV  +PPFG K      I+ Y  
Sbjct  246   VTAFLYASPKVGDENFKNVISN-QQNLRALRISDVNDIVTAVPPFGWKEGDNTAIL-YGD  303

Query  1097  VGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
             VG+    D+ KS+YL  D    S H L+ Y+H +DG+QGSQGGF+   DFD+A +NK  D
Sbjct  304   VGVGLVIDSKKSHYLKPDFPNLSTHDLMLYMHAIDGYQGSQGGFERQEDFDLAKVNKYGD  363

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
              LK  Y +  P  W+ +K+ GMVQQDDG +ILDDHEVD
Sbjct  364   YLKAEYPI--PIGWFNIKDKGMVQQDDGNYILDDHEVD  399



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   423 bits (1087),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/398 (53%), Positives = 277/398 (70%), Gaps = 17/398 (4%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW+ LSG+ NWEGLLDPLD+DLRRYLIHYG MV A+ D+F N+  SK  G  RY++KNL
Sbjct  10    ERWRVLSGNNNWEGLLDPLDNDLRRYLIHYGEMVQAIRDAFNNDETSKYAGCSRYSKKNL  69

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G +  NPFKYEVTKY Y+ S+I+    ++I+S   +   K+SNW+G+VAVATD+G+
Sbjct  70    FSKVGIEISNPFKYEVTKYVYATSSIQVPEAFIIKSLSGEAWSKESNWIGFVAVATDEGE  129

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              ALGRRDI++AWR TV   EW  +F+F+ V AP IFG++S+P VH G+Y MYT+ +P  +
Sbjct  130   VALGRRDIVIAWRSTVVPMEWFNDFEFIRVSAPTIFGENSDPKVHHGWYSMYTSNDPRSL  189

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIPV  919
                 SARDQ+  EV RL+EQYK EE+SIT+ GHS+G+S+ATLNAVD+V N INK    PV
Sbjct  190   FNKASARDQVLGEVERLMEQYKTEEVSITVTGHSMGASIATLNAVDMVFNGINKG--FPV  247

Query  920   TAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEHV  1099
             TAFLFASP+VG+ NF    S+L + L+ LR+ +  DI+P             P I Y  V
Sbjct  248   TAFLFASPRVGDENFNKTFSELENQLRALRVRNIPDIIPH-----------YPFIGYSDV  296

Query  1100  GMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQ  1273
             G+E   D  KS+YL   G   +WH L  YLHGV G QGS+ GFKL  + D++L+NK++D 
Sbjct  297   GVELIMDTRKSDYLKSGGDYWTWHNLECYLHGVAGTQGSKEGFKLEVERDISLVNKHMDT  356

Query  1274  LKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             LK  Y +  P  W+VV+N GMVQQ +G+WIL DHE +D
Sbjct  357   LKDEYGV--PVSWWVVENKGMVQQQNGSWILMDHEDED  392



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score =   419 bits (1076),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 211/399 (53%), Positives = 275/399 (69%), Gaps = 18/399 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW+ LSG+ +WEGLL+PLD DLRRYLIHYG M  A  D+F    +SK  G CRY++KNL
Sbjct  32    ERWRFLSGNNSWEGLLNPLDDDLRRYLIHYGEMAQATRDAFNTNKLSKYAGSCRYSKKNL  91

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L  +G +  NPF YEVTKY Y+ S+++      I+S   +   K+SNW+G+VAVATD+GK
Sbjct  92    LSRAGIEMPNPFNYEVTKYIYATSSVQVPEALFIKSLSREAWSKESNWVGFVAVATDEGK  151

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              ALGRRDI++AWRG+V+  EW  +F F+ V AP IFGQ S P VH G+Y +YT+ +    
Sbjct  152   MALGRRDIVIAWRGSVQTMEWFNDFDFIQVSAPEIFGQKSIPKVHHGWYSVYTSSDSRSP  211

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIPV  919
                 SARDQ+  EV+RLVEQYK+EE++IT+ GHS+G+++ATLNAVD+V N  NK    PV
Sbjct  212   FNKASARDQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVDIVFNEFNKG--FPV  269

Query  920   TAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEHV  1099
             TAFLFASP+VG+ NFK   SKL  NL+ LR+ +A DIVP             P++ Y  V
Sbjct  270   TAFLFASPRVGDENFKKTFSKLV-NLRALRVRNAPDIVP-----------NYPLLGYSDV  317

Query  1100  GMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQ  1273
             G++   D +KS YL   G ++SWH +  YLHGV G QGS+GGFKL    D++++NK +D 
Sbjct  318   GVQLDIDTTKSTYLKSPGDESSWHNMDCYLHGVAGTQGSKGGFKLEVQHDISVVNKYLDA  377

Query  1274  LKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             LK  Y +  PA W+V KN GMVQQ DG+WIL DHE DD+
Sbjct  378   LKDEYGV--PASWWVEKNKGMVQQQDGSWILMDHEDDDL  414



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   412 bits (1060),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 210/400 (53%), Positives = 276/400 (69%), Gaps = 19/400 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW+ LSG+ +WEGLLDPLD+DLRRY+IHYG M  A  D+F    ISK  G CRY++KNL
Sbjct  43    ERWRFLSGNNSWEGLLDPLDNDLRRYIIHYGGMAQATRDAFNTNKISKYAGSCRYSKKNL  102

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L + G +  NPFKYEVTKY Y+ S+++     +I+S   +   K+SNW+G+VAVATD+GK
Sbjct  103   LSQVGIEMSNPFKYEVTKYIYATSSVQVPEALIIKSLSREAWSKESNWVGFVAVATDEGK  162

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG-QDSNPLVHKGFYDMYTAVNPDP  736
              ALGRRDI+++WRG+V+  EW  +F F+ V AP IFG Q S P VH G+Y +YT+ +   
Sbjct  163   VALGRRDIVISWRGSVQTMEWFNDFDFIQVSAPEIFGHQKSIPKVHHGWYSVYTSNDSRS  222

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  SAR+Q+  EV+RLVEQYK+EE++IT+ GHS+G+++ATLNAVD+V N  NK    P
Sbjct  223   PFSKASARNQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVDMVFNGFNKG--FP  280

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             VTAFLFASP+VG+ N K   SKL +NL+ LR+ +A DIVP  P  G           Y  
Sbjct  281   VTAFLFASPRVGDENLKKTFSKL-ENLRTLRVRNAPDIVPNYPLLG-----------YSD  328

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
             VG++   D +KS YL   G ++SWH +  YLHGV G QGS+GGFKL    D++++NK + 
Sbjct  329   VGVQLDIDTTKSAYLKSPGDESSWHNMDCYLHGVAGTQGSKGGFKLQVQHDISVVNKYLG  388

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
              LK  Y +  PA W+V KN GMVQQ DG+WIL DHE DD+
Sbjct  389   ALKDEYGV--PASWWVEKNKGMVQQQDGSWILMDHEDDDL  426



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score =   412 bits (1058),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 210/399 (53%), Positives = 269/399 (67%), Gaps = 18/399 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW+ LSG+ NWEGLLDPLD+DLRRYLI YG M  A  D+F    ISK  G CRY++KN 
Sbjct  47    ERWRILSGNSNWEGLLDPLDNDLRRYLIRYGEMTQAARDAFNTNKISKYAGTCRYSKKNF  106

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G +  NPFKYEVTKY Y+ S ++      I+S   +   K+SNW G+VAVATD GK
Sbjct  107   FSRTGIEISNPFKYEVTKYIYATSAVQVPEALFIKSLSREAWSKESNWAGFVAVATDKGK  166

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              ALGRRDI++ WRG+V+  EW  +F F+ V A  IFG+ S+P VH G+Y +YT+ +   +
Sbjct  167   IALGRRDIVIVWRGSVQTLEWFNDFDFIQVSATKIFGEKSDPKVHHGWYSIYTSDDSRSL  226

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIPV  919
                 SARDQ+  EV+RL+EQYK EE+SIT+ GHS+G+S+ATLNA D+V N INK    PV
Sbjct  227   FNKESARDQVLGEVKRLMEQYKTEEVSITVTGHSMGASMATLNAGDIVFNGINKG--FPV  284

Query  920   TAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEHV  1099
             TAFLFASP+VG+ NFK   SKL +NL+ LR+ +A D+VP  P FG           Y  V
Sbjct  285   TAFLFASPRVGDENFKRTFSKL-ENLRALRIRNAPDLVPSYPLFG-----------YSDV  332

Query  1100  GMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQ  1273
             G+E   D  KS YL   G ++S+H    YLHG+ G QGS+GGFKL  + D++L+NK +D 
Sbjct  333   GVELAIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSKGGFKLEVERDISLINKYLDA  392

Query  1274  LKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             LK  Y +  P  W+V KN+GMVQQ +GTWIL DHE DD 
Sbjct  393   LKDEYGV--PTSWWVEKNNGMVQQQNGTWILVDHEDDDF  429



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   409 bits (1051),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/405 (50%), Positives = 277/405 (68%), Gaps = 22/405 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG+ +W+GLLDPLD DLRRY+IHYG M  A YDSF  E  S+  G C YA+K+L
Sbjct  6     KRWKVLSGNYDWDGLLDPLDYDLRRYIIHYGEMAQATYDSFNAEKASRYAGSCLYAKKDL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G  NGNPFKY VTKY Y+ S+I+    ++++S   +   K+SNWMGYVAVATD+GK
Sbjct  66    FAKVGLQNGNPFKYRVTKYLYATSSIQLPDAFIVKSFSREAWSKESNWMGYVAVATDEGK  125

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ-DSNPLVHKGFYDMYTAVNPDP  736
              ALGRRDI++AWRGTVR+ EW+ + +F+ V AP IF + D +P VH+G+Y +YT  +   
Sbjct  126   VALGRRDIVIAWRGTVRSLEWVNDLEFVSVSAPKIFTENDDDPKVHQGWYSIYTTDDSRS  185

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD----  904
                 +SARDQ+ +E+RRLVE++K EE+SIT+ GHSLG+++ATLNAVD+V N  NK     
Sbjct  186   PFNKISARDQVLDEIRRLVEEFKGEEISITVTGHSLGAAVATLNAVDIVANGFNKSVQNP  245

Query  905   -SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                 PVTAF++ASP+VG++ F+   S+   NLK+LR+ ++ D+VP  P  G         
Sbjct  246   GKACPVTAFVYASPRVGDQGFEKVFSQ-QQNLKVLRIRNSLDVVPNYPLLG---------  295

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
               Y  VG +   D +KS YL   G  +SWH+L  Y+HG+ G QG QGGFKL  + DVAL+
Sbjct  296   --YADVGEQLGIDTTKSKYLKSPGNLSSWHSLECYMHGIAGTQGLQGGFKLVANRDVALV  353

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             NK++D LK  + +  P  W+ ++N GMVQQ DG+W L+DHE DD 
Sbjct  354   NKHMDALKDEHCV--PVSWWCIQNKGMVQQSDGSWKLEDHEDDDF  396



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score =   404 bits (1038),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 209/400 (52%), Positives = 273/400 (68%), Gaps = 20/400 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW+ LSG+ NWEGLLDPLD+DLRRYLI YG M  A  D+F    +SK  G CRY++KNL
Sbjct  49    ERWRLLSGNNNWEGLLDPLDNDLRRYLIRYGEMAQAARDAFNTNKMSKYAGSCRYSKKNL  108

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G +  NPFKYEVTKY Y+ S+++      I+S   +   K+SNW+G+VAVATD GK
Sbjct  109   FSRTGIEISNPFKYEVTKYIYATSSVQVPDALFIKSLSREAWSKESNWVGFVAVATDKGK  168

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNP-DP  736
              ALGRRDI++ WRG+V+  EW  +F F+ V +P IFG+ S+P VH G+Y +YT+ +   P
Sbjct  169   IALGRRDIVIVWRGSVQTMEWFNDFDFIQVSSPKIFGEKSDPKVHHGWYSIYTSDDSRSP  228

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
               KG SARDQ+  EV+RL+EQYK +E++IT+ GHS+G+++ATLNA D+V N INK    P
Sbjct  229   FNKG-SARDQVLGEVQRLLEQYKKDEVTITVTGHSMGAAMATLNAGDIVFNGINKG--FP  285

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             VTAFLFASP+VG+ NFK   SKL +NL+ LR+ +  DIVP  P FG           Y  
Sbjct  286   VTAFLFASPRVGDENFKKTFSKL-ENLRALRIRNDPDIVPNYPLFG-----------YSD  333

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
             VG+E   D  KS YL   G ++S+H    YLHG+ G QGS+GGFKL  + D++L+NK +D
Sbjct  334   VGVELVIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSKGGFKLEVERDISLINKYLD  393

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
              LK  Y +  P  W+V KN GMVQQ +G+WIL DHE DD 
Sbjct  394   ALKDEYGV--PTSWWVEKNKGMVQQQNGSWILVDHEDDDF  431



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score =   403 bits (1036),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 209/404 (52%), Positives = 266/404 (66%), Gaps = 22/404 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+WK LSG KNWEGLLDPL+ DLRRY+IH G M  A YD+F  E  SK  G  RY RK+L
Sbjct  37    EKWKYLSGEKNWEGLLDPLNIDLRRYIIHNGEMAQATYDAFNGEKASKYAGSSRYGRKDL  96

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               +   +NGNPFKY VTK+ Y+ S +     ++++S   +   K+SNWMGYVAVATD+GK
Sbjct  97    FAKVSLENGNPFKYSVTKFLYATSQVDVPDAFIVKSLSREAWSKESNWMGYVAVATDEGK  156

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-NPLVHKGFYDMYTAVNPDP  736
             A LGRRDI++AWRGTVR  EWI +F+F  V A  I G  + +P VH+G+Y +YT+ +   
Sbjct  157   AELGRRDIVIAWRGTVRTLEWINDFEFRLVSASKILGDKAGDPKVHQGWYSIYTSEDQRS  216

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----  901
                  SAR Q+  E+ RLVEQYKDEE+SIT+ GHSLG+++ATLNAVD+V+N  NK     
Sbjct  217   RFNKTSARQQVLSEIERLVEQYKDEEISITITGHSLGAAIATLNAVDIVSNRYNKPKHHP  276

Query  902   DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
               P PVTA +FASP+VG+ +F+N  S   D L+ LR+ +A DIVP             PI
Sbjct  277   HKPCPVTAIIFASPRVGDSDFRNLFSSYKD-LRALRVRNALDIVP-----------NYPI  324

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
             I Y  VG E + D SKS+YL   G  +SWH L  YLHG+ G QGS+GGFKL    D+AL+
Sbjct  325   IEYSDVGEELKIDTSKSSYLKSPGNISSWHNLEGYLHGLAGTQGSKGGFKLEVHRDIALV  384

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             NK +D LK  Y  + P  W   KN GMVQ +DG+W L DHE D+
Sbjct  385   NKTMDGLKDEY--LVPESWRCEKNKGMVQLEDGSWKLIDHEEDN  426



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score =   403 bits (1035),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 206/403 (51%), Positives = 267/403 (66%), Gaps = 21/403 (5%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ LSG  NWEGLLDPLD DLRR +IHYG M  A YD+F  E  S+  G  RYA+++  
Sbjct  20    RWRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYAKRDFF  79

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G DNGNPFKY VTK+ Y+ S I     +LI+    +   K+SNW+GYVAVATD+GKA
Sbjct  80    SKVGLDNGNPFKYSVTKFLYATSEIHVPDAFLIKPLSREAWRKESNWIGYVAVATDEGKA  139

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRD++VAWRGT +  EW+ +F+F+ V A  + G+ ++P V KG+Y +Y + +P    
Sbjct  140   ALGRRDVVVAWRGTKQTLEWVDDFEFILVSASKVLGKANDPKVQKGWYSIYNSSDPRSPF  199

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----DS  907
                SAR Q+ EE+RRLV+ YK+EE+SIT+ GHSLG+++ATLNAVD+V N  NK      +
Sbjct  200   NKKSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDIVANAFNKPIGHQTN  259

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
               PVTAF FASP+VG+ NF+   S+LAD L++LR+ +A DIVP  P  G           
Sbjct  260   GCPVTAFAFASPRVGDSNFRKLFSELAD-LRVLRVRNALDIVPNYPLLG-----------  307

Query  1088  YEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNK  1261
             Y  VG E   D+ KS YL   G  +SWH L  YLH   G QG+ GGF+L  D DVAL+NK
Sbjct  308   YSDVGEELAVDSRKSKYLKSPGNVSSWHGLEVYLHCAAGTQGTNGGFELMVDRDVALINK  367

Query  1262  NIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             ++D LK  Y  + PA W+  KN GMVQQ DG+W L DHE DD+
Sbjct  368   SLDALKVEY--LVPASWWCPKNKGMVQQADGSWKLMDHEADDL  408



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score =   402 bits (1032),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 211/404 (52%), Positives = 277/404 (69%), Gaps = 21/404 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG+  WEGLLDPLD DLRRY+IHYG M  A YD+F +E  SK  G  RYA++NL
Sbjct  30    KRWKLLSGTNQWEGLLDPLDLDLRRYIIHYGEMAQAAYDTFNSEKASKYAGSSRYAKENL  89

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G +  NPFKY VTKYFY+ S+ +    ++++S   +   ++SNW+GYVAVATD+GK
Sbjct  90    FSKVGIEQANPFKYRVTKYFYATSSTKVPDAFILKSWSREAWSRESNWIGYVAVATDEGK  149

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             +ALGRRDIL+AWRGT+R  EW+ +F+F  V AP IFG +  P VH G+Y +YT+ +P   
Sbjct  150   SALGRRDILIAWRGTIRTLEWMNDFEFATVSAPEIFGGNDEPNVHLGWYSIYTSDDPRSP  209

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----D  904
                 SAR+Q+  EVRRLVE+YK+EE+S+T+ GHSLG++++TLNA+D+V N  N+     D
Sbjct  210   FNKTSARNQVLTEVRRLVEEYKNEEISMTVTGHSLGAAVSTLNAIDIVVNGYNRPRDMPD  269

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTAFLFASP+VG+  F+  +S L  NL ILR+T+A+DIVP           T P +
Sbjct  270   KACPVTAFLFASPRVGDYKFRKFLSTL-QNLHILRVTNARDIVP-----------TYPFV  317

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
             +Y  VG E   D  KSNYL   G   SWH L  YLHGV G QGS+GGFKL  + D+AL+N
Sbjct  318   NYAEVGQELPIDTDKSNYLKSPGNLNSWHNLEAYLHGVAGTQGSRGGFKLEVNRDIALVN  377

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             K++D LK  Y +  P  W+  K+ GMVQQ+DG+W L DHE DD 
Sbjct  378   KHLDGLKDEYCV--PVSWWCEKHKGMVQQEDGSWKLMDHEDDDF  419



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score =   402 bits (1032),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 201/403 (50%), Positives = 272/403 (67%), Gaps = 21/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  +WE LLDPL+ DLRRY++HYG M  A YD+FI E  SK  G CRYAR++ 
Sbjct  23    KKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFAGGCRYARRDF  82

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G + GNP+KY VTK+ Y+ S ++    ++++S   +   K+SNW+GYVAVATD+GK
Sbjct  83    FSKVGLELGNPYKYSVTKFLYATSQVQVPDAFIVKSLSREAWSKESNWIGYVAVATDEGK  142

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRDI++AWRGTV+  EW+ +F+F  V A  I G+  +P VH+G+Y +YT+ +    
Sbjct  143   AVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKILGEKGDPRVHQGWYSIYTSDDSRSP  202

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN-----KD  904
                +SARDQ+ +EV+RLVE YK+EE+SIT+ GHSLG+++ATLNAVD+V N +N     + 
Sbjct  203   FNRISARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATLNAVDIVANGLNQPKDRRG  262

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
              P PVTA +FASPKVG+ NF  A S+  D L+ LR+ +A DIVP           + PI+
Sbjct  263   RPCPVTAIVFASPKVGDSNFGEAFSEYQD-LRALRIRNAFDIVP-----------SYPIL  310

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG+E   +  KS YL   G  +SWH L  YLHGV G QGS+GGFKL  + DV+L+N
Sbjct  311   DYTEVGVELGINTRKSQYLKSPGSTSSWHNLECYLHGVAGTQGSKGGFKLEINRDVSLVN  370

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K +D LK  Y  + P  W   KN GMVQQ+DG+W L DHE D+
Sbjct  371   KRLDGLKDEY--LVPVSWRCEKNKGMVQQEDGSWKLMDHEEDN  411



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score =   403 bits (1035),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 201/403 (50%), Positives = 272/403 (67%), Gaps = 21/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  +WE LLDPL+ DLRRY++HYG M  A YD+FI E  SK  G CRYAR++ 
Sbjct  63    KKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFAGGCRYARRDF  122

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G + GNP+KY VTK+ Y+ S ++    ++++S   +   K+SNW+GYVAVATD+GK
Sbjct  123   FSKVGLELGNPYKYSVTKFLYATSQVQVPDAFIVKSLSREAWSKESNWIGYVAVATDEGK  182

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRDI++AWRGTV+  EW+ +F+F  V A  I G+  +P VH+G+Y +YT+ +    
Sbjct  183   AVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKILGEKGDPRVHQGWYSIYTSDDSRSP  242

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN-----KD  904
                +SARDQ+ +EV+RLVE YK+EE+SIT+ GHSLG+++ATLNAVD+V N +N     + 
Sbjct  243   FNRISARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATLNAVDIVANGLNQPKDRRG  302

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
              P PVTA +FASPKVG+ NF  A S+  D L+ LR+ +A DIVP           + PI+
Sbjct  303   RPCPVTAIVFASPKVGDSNFGEAFSEYQD-LRALRIRNAFDIVP-----------SYPIL  350

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG+E   +  KS YL   G  +SWH L  YLHGV G QGS+GGFKL  + DV+L+N
Sbjct  351   DYTEVGVELGINTRKSQYLKSPGSTSSWHNLECYLHGVAGTQGSKGGFKLEINRDVSLVN  410

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K +D LK  Y  + P  W   KN GMVQQ+DG+W L DHE D+
Sbjct  411   KRLDGLKDEY--LVPVSWRCEKNKGMVQQEDGSWKLMDHEEDN  451



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   401 bits (1031),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 208/403 (52%), Positives = 262/403 (65%), Gaps = 20/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++WK LSG  NWEGLLDPLD DLRRY+IHYG M  A YD+F  E  SK  G  RYARKN 
Sbjct  47    KKWKHLSGEHNWEGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKTSKYAGSSRYARKNF  106

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G +  NPFKY VTK+ Y+ S I+    +LI+S   ++  K+SNWM YVAVATD+GK
Sbjct  107   FSKVGLEKANPFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMAYVAVATDEGK  166

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             AALGRRDI++AWRGTV++ EW+ + QF  V A  I  ++ +P VH+G+Y +YT+ +    
Sbjct  167   AALGRRDIVIAWRGTVQSLEWVSDLQFNLVSASNILSEEGDPKVHQGWYSIYTSNDSHSP  226

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP-  910
                 SAR Q+ EEVRRLVEQYKDEE+SIT+ GHSLG+++ATL+A+D+V N +N  KD P 
Sbjct  227   FNKTSARHQVIEEVRRLVEQYKDEEISITITGHSLGAAIATLSAIDIVANGLNRPKDLPN  286

Query  911   --IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTA LFASP+VG  NF+   S   D L+ LR+ +A D+VP  P F           
Sbjct  287   KACPVTAILFASPRVGNSNFEKVFSGYKD-LRALRVRNALDVVPNYPIF----------F  335

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E   D  KS YL   G  ASWH +  YLHGV G QGS+ GFKL    D+AL+N
Sbjct  336   GYSDVGEELTIDTQKSKYLKSPGGVASWHNMEGYLHGVAGTQGSKRGFKLEVKRDIALVN  395

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K+ D LK  Y  + PA W   KN  M Q +DG+W+L DHE  D
Sbjct  396   KSTDALKEEY--LIPASWRCEKNKCMTQLEDGSWVLMDHEDGD  436



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score =   400 bits (1029),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/403 (49%), Positives = 271/403 (67%), Gaps = 21/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W++LSG  +W+GL++PLD DLRRY+IHYG M  A YD+FI+E +SK  G  RYA++N 
Sbjct  35    KKWRELSGQSHWKGLMEPLDIDLRRYIIHYGEMAQAAYDAFISEKVSKYAGCSRYAKRNF  94

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G  NGN F Y VTK+ Y+ S+I     ++I+S   +   ++SNW+GYVAVATD+GK
Sbjct  95    FSKVGLMNGNAFTYSVTKFLYATSSIDLPEAFIIKSFSREAWSRESNWIGYVAVATDEGK  154

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             AALGRRDI++AWRGTV+  EW+ + +F+ V AP +FG++++P VH+G+Y +YT+ +P   
Sbjct  155   AALGRRDIVIAWRGTVQTLEWVNDLEFVLVSAPKVFGKNTDPKVHQGWYSIYTSEDPLSP  214

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS----  907
                 SAR Q+  EV+RLVE YK+EE+SI++ GHSLG+++ATL+AVD+V N  NK S    
Sbjct  215   FNKSSARSQVLSEVKRLVELYKNEEISISITGHSLGAAIATLSAVDIVANGYNKPSDPSL  274

Query  908   -PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTA +FA P+VG+ NF+   S   D LK +R+ +  DIVP             P++
Sbjct  275   KASPVTAIVFACPRVGDTNFRKVFSGYKD-LKTIRIRNELDIVP-----------NYPLV  322

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E + D  KS YL   G   SWH L  YLHGV G QGS+GGFKL  + D+ALLN
Sbjct  323   GYSDVGEELKIDTRKSMYLKSPGNPLSWHNLEGYLHGVAGTQGSKGGFKLEVNRDIALLN  382

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K +D LK    L+ P  W + KN GMVQQ+DG+W L DHE DD
Sbjct  383   KTLDALKDE--LLVPVSWRIEKNKGMVQQNDGSWKLMDHEDDD  423



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score =   400 bits (1028),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/403 (50%), Positives = 266/403 (66%), Gaps = 20/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++WK LSG   W+GLLDPL+ DLRRY+IHYG M  A YD+F +E  SK  G  RYARKN 
Sbjct  38    KKWKHLSGENKWDGLLDPLNIDLRRYIIHYGEMAQATYDAFNSEKTSKYAGSSRYARKNF  97

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G + GNPFKY VTK+ Y+ S I+    +LI+S   ++  K+SNWM Y+AVATD+GK
Sbjct  98    FSKVGLEKGNPFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMAYIAVATDEGK  157

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRDI++AWRGTV++ EW+ + QF  V A  I G++ +P VH+G+Y +YT+ +    
Sbjct  158   AVLGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNILGEEGDPKVHQGWYSIYTSDDSRSP  217

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP-  910
                 SAR Q+ EEV RL+EQYKDEE+SIT+ GHSLG+++ATL+A+D+V N +N  KD P 
Sbjct  218   FNKTSARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDIVANGLNRPKDMPN  277

Query  911   --IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTA +FASP+VG  NF+   S   D L+ LR+ +A D+VP  P           ++
Sbjct  278   KACPVTAIVFASPRVGNSNFEKVFSGYKD-LRALRIRNALDVVPNYP----------ILL  326

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E + D  KS YL   G   SWH +  YLHGV G QGS+GGFKL    D+AL+N
Sbjct  327   GYSDVGEELKIDTQKSKYLKSPGGVVSWHNMEGYLHGVAGTQGSKGGFKLEVKRDIALVN  386

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K++D LK  Y  + PA W   KN  M Q +DG+W+L DHE DD
Sbjct  387   KSVDALKEEY--LIPASWRCEKNKCMTQLEDGSWVLKDHEEDD  427



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score =   399 bits (1026),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 199/400 (50%), Positives = 271/400 (68%), Gaps = 20/400 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW  LSG  NWEGL+DPLD +LRRY+IHYG M  A YD+F +   SKN G  RY+R N 
Sbjct  22    KRWMLLSGKNNWEGLMDPLDYNLRRYIIHYGEMAQASYDNFNSNKASKNAGNNRYSRNNF  81

Query  380   LRESG--HDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDD  553
               + G   D+ NPFKY VTKY Y+ S+I+    ++++S   ++  K+SNW+G++AV TD+
Sbjct  82    FTKVGLDKDHNNPFKYRVTKYLYATSSIQVPEAFIVKSLSRESWSKESNWIGFIAVCTDE  141

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPD  733
             GK ALGRR+IL++WRGTV+  +W+ +  F  V AP IF  ++ P +H+G+Y +YT+ +P 
Sbjct  142   GKIALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTEPQIHRGWYSIYTSDDPR  201

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
                   S RDQ+ EEV+RLVE+YK E+MSIT+ GHS+G+++ TLNA+D+V N  NK    
Sbjct  202   SPFNNTSVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDIVVNGFNKG--C  259

Query  914   PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYE  1093
              VTA LFASP+VG+ NF NA SKL +NL+ILR+T+  DI+P             P+I Y 
Sbjct  260   LVTAILFASPRVGDSNFVNAFSKL-ENLRILRVTNCLDIIP-----------NYPLIDYS  307

Query  1094  HVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
              +G+E   D +KS YL   G   SWH+L  Y+HGV G+QG+ GGFKL    D++LLNK++
Sbjct  308   EIGVELGIDTTKSKYLKVPGDIRSWHSLEAYMHGVAGYQGANGGFKLEVGRDISLLNKHL  367

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             + LK  Y +  P  W+V KN+GMVQQDDG W L DHE DD
Sbjct  368   NALKDEYCV--PTCWWVEKNNGMVQQDDGYWKLMDHEDDD  405



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score =   399 bits (1024),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 267/400 (67%), Gaps = 19/400 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  NWEGLLDPLD DLRRY+IHYG M  A YD+F +E  S+  G  RYA+K+ 
Sbjct  21    KKWRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFAGSSRYAKKDF  80

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D GNPFKY VTKY Y+ S I+    ++++S   +   K+SNWMGYVAVATD+GK
Sbjct  81    FSKVGIDIGNPFKYYVTKYLYATSEIQVPDGFILKSLSREAWSKESNWMGYVAVATDEGK  140

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ-DSNPLVHKGFYDMYTAVNPDP  736
             A LGRRDI++AWRGTV+  EW+ +F+F  V A  I G+    P VH+G+Y +YT+ +P  
Sbjct  141   AVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQGWYSIYTSDDPLS  200

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  SARDQ+  EVRRLVE++K+EE+SI+L GHSLG+++ATLNAVD+V N +N+    P
Sbjct  201   SFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVDIVANGLNQG--CP  258

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             VTA +FASP+VG+ NF    S L  NL++LR+ +A DI+P  P  G           Y  
Sbjct  259   VTAVVFASPRVGDSNFLKLFSAL-KNLRVLRVRNASDIIPNYPLLG-----------YSD  306

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
             VG E   D  KS YL   G  ++WH L  +LHGV G QGS+GGF+L  + D+AL+NK+ID
Sbjct  307   VGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIALVNKSID  366

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
              L   Y  + P  W   KN GMVQQ DG+W L DHE DD+
Sbjct  367   ALNDEY--LVPVSWRCEKNKGMVQQVDGSWKLMDHEEDDL  404



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   398 bits (1023),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 203/403 (50%), Positives = 266/403 (66%), Gaps = 21/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  +W+GL+DPLD DLRRY+IHYG M  A YD+F  E  SK  G  RYA+K+ 
Sbjct  7     KKWRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSRYAKKSF  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G  NGNPF Y VTK+ Y+ S I     ++I+S   +   ++SNW+GYVAVATD+GK
Sbjct  67    FSKVGLVNGNPFTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             AALGRRDI++AWRGTV+  EW+ + QFL V AP +FG++++P VH+G+Y +YT+ +P   
Sbjct  127   AALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSEDPRSP  186

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS----  907
                 SAR Q+  EVRRLVE YK+EE+SIT+ GHSLG+++ATLNAVD+VTN  NK S    
Sbjct  187   FNKTSARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKPSDPSL  246

Query  908   -PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTA +FASP+VG+ NF+   S   D L  +R+ +  DIVP             P++
Sbjct  247   KASPVTAIVFASPRVGDINFQKVFSGYKD-LTTIRIRNELDIVP-----------NYPLV  294

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E + D  KS YL   G  +SWH L  YLHGV G Q S+GGFKL    D+AL+N
Sbjct  295   GYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQRSKGGFKLEVHRDIALVN  354

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K +D LK  +  + P  W   KN GMVQQ+DG+W L DHE DD
Sbjct  355   KTLDALKDEF--LVPVSWRTEKNKGMVQQNDGSWKLMDHEDDD  395



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   397 bits (1019),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 205/404 (51%), Positives = 265/404 (66%), Gaps = 44/404 (11%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ LSG+ NW+GLLDPLD DLR+Y+IHYG M  A YDSF  E  S+  G C YA+K+L
Sbjct  6     KRWEVLSGNNNWDGLLDPLDYDLRQYIIHYGEMAQATYDSFNAEKASRYAGSCLYAKKDL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G  NGNPFKY VTKY                       LK+SNWMGYVAVATD+GK
Sbjct  66    FAKVGLQNGNPFKYRVTKY-----------------------LKESNWMGYVAVATDEGK  102

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              ALGRRDI++AWRGTVR+ EW+ + +F+ V AP IFG++ +P VH+G+Y +YT  +    
Sbjct  103   VALGRRDIVIAWRGTVRSLEWVNDLEFVLVSAPKIFGENDDPKVHQGWYSIYTTDDSRSP  162

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD-----  904
                 SARDQ+ +EVRRLVE++KDEE+SIT+ GHSLG+++ATLNAVD+V N  NK      
Sbjct  163   FNKTSARDQVLDEVRRLVEEFKDEEISITVTGHSLGAAVATLNAVDIVANGFNKSLENPG  222

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTAF++ASP+VG + FK   S+   NL++LR+ ++ D+VP  P  G          
Sbjct  223   KACPVTAFVYASPRVGGQGFKKVFSQ-QQNLRVLRIQNSLDVVPNYPLLG----------  271

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E R D +KS YL   G  +SWH+L  Y+HGV G QG Q GFKL  + DVALLN
Sbjct  272   -YADVGEELRIDTTKSKYLKNPGNLSSWHSLECYMHGVAGKQGLQEGFKLVVNRDVALLN  330

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             K +D LK  + +  P  W+ ++N GMVQQ DG+W L+DHE DD 
Sbjct  331   KYMDVLKDEHCV--PVSWWCIQNKGMVQQADGSWELEDHEDDDF  372



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score =   398 bits (1023),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 203/403 (50%), Positives = 266/403 (66%), Gaps = 21/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  +W+GL+DPLD DLRRY+IHYG M  A YD+F  E  SK  G  RYA+K+ 
Sbjct  34    KKWRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSRYAKKSF  93

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G  NGNPF Y VTK+ Y+ S I     ++I+S   +   ++SNW+GYVAVATD+GK
Sbjct  94    FSKVGLVNGNPFTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGK  153

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             AALGRRDI++AWRGTV+  EW+ + QFL V AP +FG++++P VH+G+Y +YT+ +P   
Sbjct  154   AALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSEDPRSP  213

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS----  907
                 SAR Q+  EVRRLVE YK+EE+SIT+ GHSLG+++ATLNAVD+VTN  NK S    
Sbjct  214   FNKTSARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKPSDPSL  273

Query  908   -PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTA +FASP+VG+ NF+   S   D L  +R+ +  DIVP             P++
Sbjct  274   KASPVTAIVFASPRVGDINFQKVFSGYKD-LTTIRIRNELDIVP-----------NYPLV  321

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E + D  KS YL   G  +SWH L  YLHGV G Q S+GGFKL    D+AL+N
Sbjct  322   GYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQRSKGGFKLEVHRDIALVN  381

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K +D LK  +  + P  W   KN GMVQQ+DG+W L DHE DD
Sbjct  382   KTLDALKDEF--LVPVSWRTEKNKGMVQQNDGSWKLMDHEDDD  422



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score =   398 bits (1022),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 202/403 (50%), Positives = 266/403 (66%), Gaps = 20/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++WK LSG   W+GLLDPL+ DLRRY+IHYG M  A YD+F +E  SK  G  RYARKN 
Sbjct  38    KKWKHLSGENKWDGLLDPLNIDLRRYIIHYGEMAQATYDAFNSEKTSKYAGSSRYARKNF  97

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G + GNPFKY VTK+ Y+ S I     +LI+S   ++  K+SNWM Y+AVATD+GK
Sbjct  98    FSKVGLEKGNPFKYNVTKFVYATSQIPIPEAFLIKSLSRESWCKESNWMAYIAVATDEGK  157

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRDI++AWRGTV++ EW+ + QF  V A  I G++ +P VH+G+Y +YT+ +    
Sbjct  158   AVLGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNILGEEGDPKVHQGWYSIYTSDDSRSP  217

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP-  910
                 SAR Q+ EEV RL+EQYKDEE+SIT+ GHSLG+++ATL+A+D+V N +N  KD P 
Sbjct  218   FNKTSARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDIVANGLNRPKDMPN  277

Query  911   --IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTA +FASP+VG  NF+   S   D L+ LR+ +A D+VP  P           ++
Sbjct  278   KACPVTAIVFASPRVGNSNFEKVFSGYKD-LRALRIRNALDVVPNYP----------ILL  326

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E + D  KS YL   G  ASWH +  YLHGV G QGS+GGFKL    D+AL+N
Sbjct  327   GYSDVGEELKIDTQKSKYLKSPGGVASWHNMEGYLHGVAGTQGSKGGFKLEVKRDIALVN  386

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K++D LK  Y  + PA W   +N  M Q +DG+W+L DHE DD
Sbjct  387   KSVDALKEEY--LIPASWRCEENKCMTQLEDGSWVLKDHEDDD  427



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score =   397 bits (1019),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/399 (49%), Positives = 274/399 (69%), Gaps = 19/399 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW  LSG  NWEGL+DPL+ DLRRY+IHYG M  A YD+F +   SKN G  RY++ NL
Sbjct  14    KRWMLLSGKNNWEGLMDPLNYDLRRYIIHYGEMAQASYDNFNSNKASKNAGNNRYSKNNL  73

Query  380   LRESGHD-NGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G D + NPFKY VTKY Y+ S+I+    ++++S   ++  K+SNW+G++AV TD+G
Sbjct  74    FTKVGLDKDHNPFKYRVTKYLYATSSIQVPEAFIVKSLSRESWSKESNWIGFIAVCTDEG  133

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDP  736
             K ALGRR+IL++WRGTV+  +W+ +  F  V AP IF  +++P +H+G+Y +YT+ +P  
Sbjct  134   KIALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTDPQIHRGWYSIYTSEDPRS  193

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  S RDQ+ EEV+RLVE+YK E+MSIT+ GHS+G+++ TLNA+D+V N  NK     
Sbjct  194   PFNNTSVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDIVVNGFNKG--CL  251

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             VTA LFASP+VG+ +F NA SKL +NL+ILR+T+  DI+P             P+I Y  
Sbjct  252   VTAILFASPRVGDSSFVNAFSKL-ENLRILRVTNCLDIIP-----------NYPLIDYSE  299

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
             +G+E   D +KS YL   G   SWH+L  ++HGV G+QG+ GGFKL    D++L+NK+++
Sbjct  300   IGVELAIDTTKSKYLKVPGDIRSWHSLEAHMHGVAGYQGANGGFKLEVRRDISLVNKHLN  359

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              LK  Y +  P  W+V KN+GMVQQDDG+W L DHE DD
Sbjct  360   ALKDEYCV--PTCWWVEKNNGMVQQDDGSWKLMDHEDDD  396



>ref|XP_006362439.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=419

 Score =   397 bits (1021),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 210/397 (53%), Positives = 269/397 (68%), Gaps = 18/397 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW+ L+G  NWEGLLDPLD DLRRYLIHYG M  A+ DSF +E  SKN+G  RY++KN 
Sbjct  34    ERWEILNGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNSEIASKNLGTNRYSKKNF  93

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
              +  G D  NPFKYEVTKY Y  S + + T            +K SNW+G+VAVATDDGK
Sbjct  94    FKRVGLDKNNPFKYEVTKYIYGASDVPSKTEK----------IKSSNWIGFVAVATDDGK  143

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNP-LVHKGFYDMYTAVN-PD  733
              ALGRRDIL+AWRGT+  AEW  ++ ++ V    IFG++++  LVH+GFY +YT++N   
Sbjct  144   VALGRRDILIAWRGTMSPAEWNDDYDWVLVPPTKIFGENTHDILVHRGFYSVYTSLNEAS  203

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
                +  SARDQ+ EEV+RLVEQYK +++SITL+GHS+GSSLATL AVD+V N INK+   
Sbjct  204   KFNRTTSARDQVIEEVKRLVEQYKGDKVSITLSGHSIGSSLATLCAVDIVVNQINKE--F  261

Query  914   PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYE  1093
             PVTAFL ASP+ GE NFK A   L  NL+ILR+T+A D VP+ P  G    +      YE
Sbjct  262   PVTAFLLASPRTGEANFKKAYQNLK-NLQILRITNALDEVPEKPDRGQVEGSETDWRVYE  320

Query  1094  HVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQ  1273
             HVG E + D +KS YL     + HT+  YLHG+ G  G++G FKL  + D+AL+NK  D 
Sbjct  321   HVGFELKIDTTKSEYLKK-DVNNHTVEVYLHGIAGTHGAEGEFKLEINRDIALVNKEADA  379

Query  1274  LKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             LK  Y +  P  W +V+N GMVQQ+DG+W L+D E D
Sbjct  380   LKNEYGV--PVYWRIVQNKGMVQQEDGSWSLNDREDD  414



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   395 bits (1015),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 200/403 (50%), Positives = 265/403 (66%), Gaps = 21/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  +W+GL+DPLD DLRRY+I YG M  A YD+F  E  SK  G CRYA+K+ 
Sbjct  7     KKWRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCRYAKKSF  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               +    NGNP+ Y VTK+ Y+ S I     ++I+S   +   ++SNW+GYVAVATD+GK
Sbjct  67    FSKVALVNGNPYTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             AALGRRDI++AWRGTV+  EW+ + QFL V AP +FG++++P VH+G+Y +YT+ +P   
Sbjct  127   AALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSEDPRSP  186

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS----  907
                 SAR Q+  EVRRLVE YK+EE+SIT+ GHSLG+++ATLNAVD+VTN  NK +    
Sbjct  187   FNQTSARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKPNDPSL  246

Query  908   -PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTA +FASP+VG+ NF+   S   D L  +R+ +  DIVP             P++
Sbjct  247   KASPVTAIVFASPRVGDINFQKVFSGYKD-LTTIRIRNELDIVP-----------NYPLV  294

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E + D  KS YL   G  +SWH L  YLHGV G QGS+GGF L    D+AL+N
Sbjct  295   GYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSKGGFNLEVHRDIALVN  354

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K +D LK    L+ P  W + KN GM QQ+DG+W L DHE DD
Sbjct  355   KTLDALKD--ELLVPVSWRIEKNKGMFQQNDGSWKLMDHEEDD  395



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score =   395 bits (1015),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 211/403 (52%), Positives = 276/403 (68%), Gaps = 20/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG  NWEGLLDPLD DLRRY+IHYG+M  A YD+F +E  SK  G  RYA+ +L
Sbjct  23    KRWKLLSGKSNWEGLLDPLDLDLRRYVIHYGTMAQATYDTFNSENASKFAGSSRYAKNDL  82

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G D GNPFKY VTKYFY+ S+ +    +++ S   +   K+SNWMGYVAVATD+GK
Sbjct  83    FSNVGMDKGNPFKYRVTKYFYATSSAQVPDAFIVPSWSREAWSKESNWMGYVAVATDEGK  142

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             +ALGRRDIL+AWRGT+R  EW+ +F+F  V AP IFG + +P VH G++ +YT+ +P   
Sbjct  143   SALGRRDILIAWRGTIRNLEWVNDFEFGLVPAPEIFGGNDDPKVHFGWHSIYTSDDPKSP  202

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI--  913
                 SAR Q+  EVRRLVE+YK+EE+SIT+ GHSLG++++T+NAVD+V N  N+   +  
Sbjct  203   FSKNSARHQVLGEVRRLVERYKNEEISITVTGHSLGAAVSTINAVDIVVNGYNRPQGMLH  262

Query  914   ---PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTAF+FA P+VG+ NF++ V  L  NL ILR+ +A+DIVPK            P I
Sbjct  263   KHCPVTAFVFACPRVGDNNFRDFVLNL-QNLHILRVRNARDIVPK-----------YPFI  310

Query  1085  SYEHVGMEFRFDASKSNYL-DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNK  1261
              Y  VG E   D  KS+YL +G  +SWH L  YLHGV G +GS+GGFKL  + D+AL+NK
Sbjct  311   DYVDVGEELAIDTDKSSYLKEGNLSSWHNLEAYLHGVAGTRGSEGGFKLEVNRDIALVNK  370

Query  1262  NIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             ++D LK  + +  P  W+  KN GMVQQ DG+W+L DHE DD 
Sbjct  371   HMDALKDEFCV--PVSWWCEKNKGMVQQADGSWVLMDHEYDDF  411



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score =   394 bits (1013),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 204/397 (51%), Positives = 262/397 (66%), Gaps = 22/397 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  NW+GLLDPLD DLRRY+IHYG M  A YD+F  E  SK  G  RYARKN 
Sbjct  9     KKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKYAGSSRYARKNF  68

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G + GN FKY VTK+ Y+ S I+    +LI+S   ++  K+SNWMGYVAVATD+GK
Sbjct  69    FSRVGLEKGNAFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMGYVAVATDEGK  128

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             AALGRRDI++AWRGTV++ EW+ + QF  V    + G+D +P VH+G+Y +YT+ +    
Sbjct  129   AALGRRDIVIAWRGTVQSLEWVNDLQFNLVSVSKLLGEDGDPKVHEGWYSIYTSDDSRSP  188

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP-  910
                 SAR Q+ EEVRRLVEQ+KDEE+SIT+ GHSLG+++ATLNAVD+V N +N  K+ P 
Sbjct  189   FNKTSARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATLNAVDIVANGVNRPKEQPN  248

Query  911   --IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLP-PFGVKVNTTLPI  1081
                PVTA +FASP+VG+ NF+   S   D ++ LR+ +A D+VP  P P G         
Sbjct  249   KACPVTAIVFASPRVGDSNFEKVFSGHKD-VRTLRVRNALDVVPNYPIPLG---------  298

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
               Y +VG E   D  KS YL   G  ASWH L  YLHGV G QGS+GGFKL    D+AL+
Sbjct  299   --YSNVGEELAIDTRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSKGGFKLEVKRDIALV  356

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWIL  1366
             NK+ D L+  Y  + PA W   KN  M Q DDG+W+L
Sbjct  357   NKSADDLEEEY--LIPASWRCEKNKCMTQLDDGSWVL  391



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 202/406 (50%), Positives = 265/406 (65%), Gaps = 23/406 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG  NWEGLLDPLD DLR+Y+IHYG M  A YD+F  E  SK  G  RYARK+ 
Sbjct  43    KRWKKLSGENNWEGLLDPLDIDLRKYIIHYGEMAQATYDAFNTERASKFAGSSRYARKSF  102

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G +  N F+Y VTK+ Y+ S I+    ++++S   +   K+SNW+GYVAVATD+GK
Sbjct  103   FSRVGLEKANAFRYNVTKFLYATSQIQVPEAFIVKSLSREAWSKESNWIGYVAVATDEGK  162

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRDI++AWRGTVR+ EW+ +  F  V A  I G++++  VH+G+Y +YT+ +    
Sbjct  163   ALLGRRDIVIAWRGTVRSLEWVNDLHFSMVSASNILGEEADAKVHQGWYSIYTSDDSHSP  222

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD-----  904
                 SAR+Q+  EV RLVEQYKDEE+SIT+ GHSLG+++ATL+AVD+V N INK      
Sbjct  223   FNKTSARNQVLAEVSRLVEQYKDEEISITITGHSLGAAIATLSAVDIVANGINKPKDQTA  282

Query  905   ---SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
                S  PVTAF+FA P+VG+ NFK   S   +NL++LR+++A DIVP  P          
Sbjct  283   NKLSSCPVTAFVFACPRVGDSNFKKLFSSY-NNLRVLRVSNALDIVPNYP----------  331

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
              ++ Y  VG E   D+ KS+YL   G   SWH L  YLHGV G QGS+GGFKL    D+A
Sbjct  332   FLVGYSEVGEELGIDSRKSSYLKSPGSVLSWHNLEGYLHGVAGTQGSKGGFKLEVKRDIA  391

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             L+NK+ D LK  Y  + P  W   K+ GMVQ +DG+W L DHE +D
Sbjct  392   LVNKSHDALKEEY--LVPVSWRCEKDKGMVQMEDGSWQLMDHEEED  435



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   395 bits (1014),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/406 (50%), Positives = 264/406 (65%), Gaps = 24/406 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  NWEGLLDPLD DLRRY+IHYG M  A YD+F  E  SK  G   YA+K+ 
Sbjct  25    KKWRSLSGQNNWEGLLDPLDIDLRRYMIHYGEMAQAAYDTFNTEKASKYAGDSIYAKKDF  84

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D GNP+KY VTK+FY+ S I     ++I     +   K+SNWMGYVAVATD+GK
Sbjct  85    FSKVGLDKGNPYKYNVTKFFYATSQIHVPEAFIIVPLSREAWSKESNWMGYVAVATDEGK  144

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD--SNPLVHKGFYDMYTAVNPD  733
             A LGRRDI++AWRG+++  EW+ + +F FV A  IFG D   +P VH+G+Y +YT+ +  
Sbjct  145   AVLGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVHQGWYSIYTSDDQR  204

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   SARDQ+  E+RRLV+QYK+EE+SIT+ GHSLG++LATLNAVD+  N  NK    
Sbjct  205   SPFNKTSARDQVIREIRRLVDQYKNEEISITVTGHSLGAALATLNAVDIAANGFNKPGGQ  264

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              +   PVTA + ASP+VG+  FK  +S   D L++LR+ +  D+VPK            P
Sbjct  265   PNKACPVTAIILASPRVGDSTFKKVLSGYQD-LRVLRIRNELDVVPK-----------YP  312

Query  1079  IISYEHVGMEFRFDASKSNYLDGFKAS---WHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
             +I YE VG E   D +KS YL    A+   WH L  YLHGV G QG +GGF+L  + D++
Sbjct  313   LIGYEDVGKELTIDTTKSKYLKNGTANFSGWHNLEVYLHGVAGTQGRKGGFQLEVNRDIS  372

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             L+NK +D LK  Y  + P  W ++KN GMVQQ DG+W L DHE DD
Sbjct  373   LVNKTMDNLKDQY--LVPVSWRILKNKGMVQQADGSWKLMDHEKDD  416



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score =   394 bits (1011),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 199/403 (49%), Positives = 264/403 (66%), Gaps = 21/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  +W+GL+DPLD DLRRY+I YG M  A YD+F  E  SK  G CRYA+K+ 
Sbjct  32    KKWRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCRYAKKSF  91

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               +    NGNP+ Y VTK+ Y+ S I     ++I+S   +   ++SNW+GYVAVATD+GK
Sbjct  92    FSKVALVNGNPYTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGK  151

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             AALGRRDI++ WRGTV+  EW+ + QFL V AP +FG++++P VH+G+Y +YT+ +P   
Sbjct  152   AALGRRDIVIVWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQGWYSIYTSEDPRSP  211

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS----  907
                 SAR Q+  EVRRLVE YK+EE+SIT+ GHSLG+++ATLNAVD+VTN  NK +    
Sbjct  212   FNQTSARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKPNDPSL  271

Query  908   -PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTA +FASP+VG+ NF+   S   D L  +R+ +  DIVP             P++
Sbjct  272   KASPVTAIVFASPRVGDINFQKVFSGYKD-LTTIRIRNELDIVP-----------NYPLV  319

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E + D  KS YL   G  +SWH L  YLHGV G QGS+GGF L    D+AL+N
Sbjct  320   GYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSKGGFNLEVHRDIALVN  379

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K +D LK    L+ P  W + KN GM QQ+DG+W L DHE DD
Sbjct  380   KTLDALKD--ELLVPVSWRIEKNKGMFQQNDGSWKLMDHEEDD  420



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score =   394 bits (1012),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 204/397 (51%), Positives = 262/397 (66%), Gaps = 22/397 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  NW+GLLDPLD DLRRY+IHYG M  A YD+F  E  SK  G  RYARK+ 
Sbjct  38    KKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKYAGSSRYARKSF  97

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                   + GN FKY VTK+ Y+ S I+    +LI+S   ++  K+SNWMGYVAVATD+GK
Sbjct  98    FSRVCLEKGNAFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMGYVAVATDEGK  157

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             AALGRRDI++AWRGTV++ EW+ + QF  V A  + G+D +P VH+G+Y +YT+ +    
Sbjct  158   AALGRRDIVIAWRGTVQSLEWVNDLQFNLVSASKLLGEDGDPKVHEGWYSIYTSDDSRSP  217

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP-  910
                 SAR Q+ EEVRRLVEQ+KDEE+SIT+ GHSLG+++ATLNAVD+V N +N  K+ P 
Sbjct  218   FNKTSARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATLNAVDIVANGVNRPKEQPN  277

Query  911   --IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLP-PFGVKVNTTLPI  1081
                PVTA +FASP+VG+ NF+   S   D ++ LR+ +A D+VP  P P G         
Sbjct  278   KACPVTAIVFASPRVGDSNFEKVFSGHKD-VRALRVRNALDVVPNYPIPLG---------  327

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
               Y +VG E   D  KS YL   G  ASWH L  YLHGV G QGS+GGFKL    D+AL+
Sbjct  328   --YSNVGEELAIDTRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSKGGFKLEVKRDIALV  385

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWIL  1366
             NK+ D LK  Y  + PA W   KN  M Q DDG+W+L
Sbjct  386   NKSADDLKEEY--LIPASWRCEKNKCMTQLDDGSWVL  420



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score =   393 bits (1009),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/406 (49%), Positives = 264/406 (65%), Gaps = 24/406 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  NWEGLLDPLD DLRRY+IHYG +  A YD+F  E  SK  G   YA+K+ 
Sbjct  25    KKWRSLSGQNNWEGLLDPLDIDLRRYMIHYGEIAQAAYDTFNTEKASKYAGDSIYAKKDF  84

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D GNP+KY VTK+FY+ S I     ++I     +   K+SNWMGYVAVATD+GK
Sbjct  85    FSKVGLDKGNPYKYNVTKFFYATSQIHVPEAFIIVPLSREAWSKESNWMGYVAVATDEGK  144

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD--SNPLVHKGFYDMYTAVNPD  733
             A LGRRDI++AWRG+++  EW+ + +F FV A  IFG D   +P VH+G+Y +YT+ +  
Sbjct  145   AVLGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVHQGWYSIYTSDDQR  204

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   SARDQ+  E+RRLV+QYK+EE+SIT+ GHSLG++LATLNAVD+  N  NK    
Sbjct  205   SPFNKTSARDQVIHEIRRLVDQYKNEEISITVTGHSLGAALATLNAVDIAANGFNKPGGQ  264

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              +   PVTA +FASP+VG+  FK  +S   D L++LR+ +  D+VPK            P
Sbjct  265   PNKACPVTAIIFASPRVGDSTFKKVLSGYQD-LRVLRIRNELDVVPK-----------YP  312

Query  1079  IISYEHVGMEFRFDASKSNYLDGFKAS---WHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
             +I YE VG E   D + S YL    A+   WH L  YLHGV G QG +GGF+L  + D++
Sbjct  313   LIGYEDVGKELTIDTTNSKYLKNGAANFSGWHNLEVYLHGVAGTQGRKGGFQLEVNRDIS  372

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             L+NK +D LK  Y  + P  W ++KN GMVQQ DG+W L DHE DD
Sbjct  373   LVNKTMDSLKDQY--LVPVSWRILKNKGMVQQADGSWKLMDHEKDD  416



>ref|XP_004232958.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=419

 Score =   392 bits (1007),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 209/397 (53%), Positives = 267/397 (67%), Gaps = 18/397 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW+ L+G  NWEGLLDPLD DLRRYLIHYG M  A+ DSF +E  SKN+G  RY++KN 
Sbjct  34    ERWEILNGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNSEIASKNLGTNRYSKKNF  93

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
              +  G D  NPFKYEVTKY Y  S + + T            +K SNW+G+VAVATD+GK
Sbjct  94    FKRVGLDKNNPFKYEVTKYIYGASDVPSKTEK----------IKSSNWIGFVAVATDEGK  143

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-NPLVHKGFYDMYTAVN-PD  733
              ALGRRDIL+AWRGT+  AEW  +  ++ V    IFG+++ + LVH+GFY +YT++N   
Sbjct  144   VALGRRDILIAWRGTMCPAEWNDDSDWVLVPPTKIFGENTHDTLVHRGFYSVYTSLNDAS  203

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
                +  SARDQ+ EEV+RLVEQYK +++SITL+GHS+GSSL+TL A+D+V N INK+   
Sbjct  204   KFNRTASARDQVIEEVKRLVEQYKRDKVSITLSGHSIGSSLSTLCAIDIVVNKINKE--F  261

Query  914   PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYE  1093
             PVTAFLFASP+ GE NFK A   L  NL+ILR+T+A D VP+ P  G    +      YE
Sbjct  262   PVTAFLFASPRTGEANFKKAHQHLK-NLQILRITNALDEVPEKPDRGQVEGSDTDWRVYE  320

Query  1094  HVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQ  1273
             HVG E + D +KS YL     + H+L  YLHG+ G  G +G FKL    D+AL+NK  D 
Sbjct  321   HVGYEVKIDTTKSEYLKK-DVNNHSLEVYLHGIAGTHGPEGEFKLEITRDIALVNKETDA  379

Query  1274  LKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             LK  Y +  P  W  V+N GMVQQ+DG+WIL+D E D
Sbjct  380   LKNEYGV--PVYWRTVQNKGMVQQEDGSWILNDREDD  414



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score =   390 bits (1001),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/405 (50%), Positives = 261/405 (64%), Gaps = 24/405 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W+ LSG  +W GLLDPLD DLRRY+IHYG M  A YD+F  E  SK  G CRYA+ +  
Sbjct  23    KWQQLSGENHWIGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKFAGSCRYAKNDFF  82

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              +   +NGNPFKY VTK+ Y+ S I     ++I+S   +   K+SNW+G+VAVA D+GK 
Sbjct  83    SKVFLENGNPFKYSVTKFIYATSEINVPEAFIIKSLSREAWSKESNWIGFVAVANDEGKD  142

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN---PLVHKGFYDMYTAVNPD  733
              LGRRDI++AWRGT++  EW+ + QFL V AP +FG  +N   P VH+G+Y +YT+ +P 
Sbjct  143   VLGRRDIVIAWRGTIQTLEWVNDLQFLLVSAPKVFGNSNNINDPKVHQGWYSIYTSEDPR  202

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS--  907
                   SAR+Q+  EVRRLVE+YK+EE+SIT+ GHSLG+++ATLNAVD+VTN  NK S  
Sbjct  203   SPFSKTSARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNAVDIVTNGFNKPSDP  262

Query  908   ---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
                  PVTA +FASP+VG+ NF+   S   D L  LR+ +  DIVP             P
Sbjct  263   SLKASPVTAIVFASPRVGDTNFQKLFSSYKD-LSTLRIRNELDIVP-----------NYP  310

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
              I Y  VG E + D  KS YL   G   SWH L  YLHGV G QGS+  FKL  + D+AL
Sbjct  311   FIGYSDVGEELKIDTRKSMYLKSPGNILSWHNLEAYLHGVAGTQGSKRVFKLEVNRDIAL  370

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             +NK +D LK  Y  + P  W VV+N GMVQQ DG+W L DHE D+
Sbjct  371   VNKTLDGLKDEY--LVPVSWRVVENKGMVQQLDGSWKLIDHEDDE  413



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score =   389 bits (999),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 204/402 (51%), Positives = 269/402 (67%), Gaps = 24/402 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W+DLSG  NWEG+LDPLD DLR+Y++HYG +  A YD+F +E +S + G CRYA+++  
Sbjct  9     KWRDLSGRSNWEGMLDPLDIDLRQYILHYGQLAQATYDAFNSEKLSMHAGNCRYAKRDFF  68

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G ++GNPFKYEVT++ Y+ S    +  + ++    D    +SNW+GYVAVATD+GKA
Sbjct  69    SKVGLEHGNPFKYEVTEFLYATSKATASKQFALKLFSKDEWGMESNWIGYVAVATDEGKA  128

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI+VAWRGTV+ +EW+++       APLIF +D+   +H GFY +YT+ NPD  +
Sbjct  129   ALGRRDIVVAWRGTVQGSEWVQDLHIPLDPAPLIF-RDARAELHNGFYSVYTSNNPDSHI  187

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP--  910
                SAR+Q+ EEVRRLVE+YK+EE+SI++ GHSLG++LATLNAVD+    +N  KD P  
Sbjct  188   TQTSARNQVLEEVRRLVEKYKNEEISISVTGHSLGAALATLNAVDIAAQGLNKPKDQPHR  247

Query  911   -IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
               PVTAFLFASP+VG  +F    S+   +L+ LR+ + KD VPKL P G+ V        
Sbjct  248   VFPVTAFLFASPRVGNSHFGKIFSEY-KHLRALRIRNKKDQVPKL-PIGLAV--------  297

Query  1088  YEHVGMEFRFDASKSNYL-DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
                VG E   D  KS YL +G  A  H L  YLHGV G QG +GGF L  + D+ALLNK 
Sbjct  298   ---VGQELVIDTRKSKYLKEGVSA--HNLEAYLHGVAGTQGKKGGFNLEVNRDIALLNKG  352

Query  1265  IDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             +D LK  Y  + P EW V +N GMVQQ DGTW L DH  D I
Sbjct  353   MDALKDEY--LVPVEWRVHENKGMVQQSDGTWKLFDHNEDVI  392



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score =   388 bits (997),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 199/403 (49%), Positives = 264/403 (66%), Gaps = 22/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG  NW+ LL+PLD DLRR++IHYG M  A YD+F ++  SK  G   YA+   
Sbjct  8     KRWKHLSGENNWKNLLEPLDIDLRRFIIHYGEMAQATYDAFNSQKASKFAGSSLYAKNGF  67

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D GNP+KY VTK+FY+ S I+    ++++S   +   K+SNWMGY+AVATD+G 
Sbjct  68    FSKVGLDKGNPYKYTVTKFFYATSQIQLPEAFIVKSLSREAWSKESNWMGYIAVATDEGT  127

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN-PLVHKGFYDMYTAVNPDP  736
             A LGRRDI++AWRGTVR  EW+ + +F+ V A  + G+  N P VH+G++ +YT+ +P  
Sbjct  128   AVLGRRDIVIAWRGTVRTLEWVDDLEFVLVSASDLLGESGNDPKVHQGWHSVYTSDDPLS  187

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----  901
                  SARDQ+  EVRRLVE+YK+EE+SIT+ GHSLG++LATLNAVD++ N  NK     
Sbjct  188   PFNKSSARDQVLNEVRRLVEKYKNEEISITVCGHSLGAALATLNAVDIIANGFNKSKTFP  247

Query  902   DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
             +   PVTA +FASP+VG+  FK   S   + L+ LR+ +  DIVP             P+
Sbjct  248   NKACPVTAIVFASPRVGDSGFKKVFSGYKE-LRALRIHNNLDIVP-----------NYPL  295

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
             I Y  VG E   D +KSNYL   G  +SWH L  YLHGV G QGS+GGFKL  + D+AL+
Sbjct  296   IGYAEVGEELVIDTTKSNYLKSPGNVSSWHNLEGYLHGVAGTQGSKGGFKLEINRDIALV  355

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             NK++D LK  Y  + P  W + KN GMVQQ DG+W L DHE D
Sbjct  356   NKSLDGLKDEY--LVPPSWRIQKNKGMVQQSDGSWKLMDHEED  396



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score =   388 bits (997),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 208/410 (51%), Positives = 271/410 (66%), Gaps = 30/410 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W+ LSG  NWEGLLDPLD DLR+Y+I YG +    YD+FI+E  SK  G  RY+ +NL
Sbjct  6     EKWEQLSGKNNWEGLLDPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G D   P KY+VTKYFY+ S+I   + +L++S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FTRAGLD---PLKYKVTKYFYATSSIPLPSAFLVKSLSREAWNKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              ALGRRDI++AWRGT++  EW+ + +FL +  P +FG         PLVH GFY++YT+ 
Sbjct  123   VALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQPLVHHGFYNIYTSE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +P  +    SARDQ+ EEV+RLVE+YK+EE+SIT+AGHSLG+SLATLNAVD+  N  NK 
Sbjct  183   DPRSMFNQASARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATLNAVDIAFNGFNKT  242

Query  905   SP---IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF+ A SKL  NL ILR+ +  DIVPK PP G       
Sbjct  243   SSGKEFPVTAFVFASPKVGDLNFQKAFSKLK-NLHILRIHNLLDIVPKYPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQ--GSQGGFKLHGDF  1240
                 +  VG E   D +KS YL    G   + H L  YLHG+DG Q  G   GFKL  + 
Sbjct  295   ----FIDVGEEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGVLAGFKLEVNR  350

Query  1241  DVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             D+AL+N+  D LK  Y +  PA W+  K+ GMVQQ+DGTW+L D E  D+
Sbjct  351   DLALVNRIWDMLKDEYCI--PAAWWTEKHKGMVQQEDGTWLLLDREDYDL  398



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score =   388 bits (996),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 202/405 (50%), Positives = 261/405 (64%), Gaps = 25/405 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W+ LSG  NWEGLLDPLD DLRR +IHYG M  A YD+F  E  S+  G  RYA+++  
Sbjct  20    KWRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYAKRDFF  79

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G D GNPFKY VTK+ Y+ S I     +LI+    +   K+SNW+GYVAVATD+GK 
Sbjct  80    SKVGLDKGNPFKYSVTKFLYATSEIHVPDAFLIKPLSREAWRKESNWIGYVAVATDEGKT  139

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI+VAWRGT +  EWI +F+F  V A  + G+ ++P VH+G+Y +Y + +P    
Sbjct  140   ALGRRDIVVAWRGTKQTLEWIDDFEFNLVSASKVLGEANDPKVHQGWYSIYNSSDPRSPF  199

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI---  913
                SAR Q+ EE+RRLV+ YK+EE+SIT+ GHSLG+++ATLNAVD+  N  NK  PI   
Sbjct  200   NKKSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDITANAFNK--PIGHQ  257

Query  914   ----PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                 PVTA  FASP+VG+ NF+   S+LAD L+ LR+ +A DIVP             P+
Sbjct  258   TNGCPVTAITFASPRVGDSNFRKVFSELAD-LRALRVRNALDIVP-----------NYPL  305

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
             I Y  VG E   D+ KS YL   G  +SWH L  YLH V G QG+  GF+L  D D  L+
Sbjct  306   IGYSDVGEELAVDSRKSKYLKSPGNVSSWHGLEVYLHCVAGTQGTNDGFELMVDHDATLI  365

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             NK +D LK  Y  + PA W+  KN GMVQQ DG+W L D+E DD+
Sbjct  366   NKALDALKDEY--LVPASWWCPKNKGMVQQADGSWKLMDYEADDL  408



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score =   385 bits (989),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 210/407 (52%), Positives = 260/407 (64%), Gaps = 28/407 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W+ LSG  NWEGLL+PLD DLR+YLI YG +  A YD+FI E  SKN G  RY+ +NL
Sbjct  6     EKWEQLSGKNNWEGLLNPLDLDLRKYLIQYGELAQATYDTFITEEKSKNAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G D   P KY VTK+FY+ S+I       ++S   +   K+SN+MGYVAVATD+GK
Sbjct  66    FTRVGLD---PLKYRVTKFFYATSSIPLPDGLFVRSLSLEAWSKESNFMGYVAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
               LGRRDI++AWRGT+   EW+ NFQF  V AP +FG         PLVH GFY++YT  
Sbjct  123   VELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDRGLLHLLQPLVHHGFYNIYTTN  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             NP       SARDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  183   NPRSQFNHTSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF FASPKVG+  FK A  KL  +++ LR+ +  D+VPK+PP G       
Sbjct  243   SEGREFPVTAFAFASPKVGDLKFKAAFDKL-KSVRTLRIHNLWDVVPKVPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
                 Y  VG E   D +KS Y+   G   SWH L  YLHG+ G QG + GFKL  D D++
Sbjct  295   ----YIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLR-GFKLEVDRDIS  349

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             L+NK  D LK  Y +  P  W V KN GMVQQ DG+W+L D E  D 
Sbjct  350   LVNKQWDILKDEYGI--PGRWLVEKNKGMVQQKDGSWLLMDREEYDF  394



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score =   386 bits (991),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 212/410 (52%), Positives = 272/410 (66%), Gaps = 27/410 (7%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +WK LSG+ NW+GLLDPLD DLR+Y+IHYG M  A YD+F +E  SK  G  RY++ NLL
Sbjct  29    KWKLLSGANNWQGLLDPLDLDLRKYIIHYGQMSQATYDTFNSEKASKYAGSSRYSKDNLL  88

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATN-YLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
              + G D  NPFKY VTKY Y+ S++    + ++++S   +   K+SNW+GYVAVATD+GK
Sbjct  89    SKVGVDKANPFKYRVTKYVYATSSLTEVPDAFILRSWSREAWTKESNWIGYVAVATDEGK  148

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ----DSNPLVHKGFYDMYTAVN  727
              ALGRRDIL+AWRGTVR  EWI +F+F  V APLIFG     D  P VH G+Y +YT+ +
Sbjct  149   LALGRRDILIAWRGTVRTLEWINDFEFSLVDAPLIFGAANDGDDQPRVHLGWYSIYTSDD  208

Query  728   PDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK--  901
             P       SAR+Q+ EEV+RLVE+YK+EE SIT+ GHSLG+++ TLNA D+V N  NK  
Sbjct  209   PRSPFNKTSARNQVLEEVKRLVEEYKNEETSITVTGHSLGAAVCTLNASDIVVNKYNKPN  268

Query  902   ---DSPIPVTAFLFASPKVGERNFKNAVSKLA--DNLKILRLTDAKDIVPKLPPFGVKVN  1066
                D   PVT F FASP+VG+  F+  +S L   +NL ILR+ +AKDIVPK         
Sbjct  269   DMPDKSCPVTVFAFASPRVGDDKFRKILSSLKTNNNLNILRVRNAKDIVPK---------  319

Query  1067  TTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDF  1240
                P I Y  VG+E   D  KS+YL   G  +SWH+L  YLHGV G QGS+GGFKL  + 
Sbjct  320   --YPFIDYSEVGVELVIDTDKSSYLKSPGNLSSWHSLEGYLHGVAGTQGSRGGFKLEVNR  377

Query  1241  DVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
              +AL+NK++D LK  Y +  P  W+  +N  MVQ DDG+W L DHE DD 
Sbjct  378   SLALVNKHMDGLKDEYCV--PVSWWCERNKSMVQSDDGSWELIDHEDDDF  425



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score =   385 bits (989),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 204/402 (51%), Positives = 267/402 (66%), Gaps = 21/402 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG  +W+ LLDPLD DLR Y+IHYG M  A YD+F  +  SKN G   Y ++  
Sbjct  30    KRWKHLSGEHHWKDLLDPLDIDLRHYIIHYGEMAQAAYDAFNTQKASKNAGSSLYTKEAF  89

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G +NGNP+KY+VTK+ Y+ S I+    ++I+S   +   K+SNWMGYVAVATD+GK
Sbjct  90    FSKVGLENGNPYKYQVTKFLYATSQIQLPEAFIIKSLSREAWSKESNWMGYVAVATDEGK  149

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRDI++AWRGTV+  EW+ +FQF  V AP IFG+ ++  VH+G+Y +YT+ +P   
Sbjct  150   AVLGRRDIVIAWRGTVQTLEWVNDFQFTLVPAPKIFGESNDRKVHQGWYSVYTSDDPRSP  209

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----D  904
                 SARDQ+  EVRRLVEQYKDEE+SIT+ GHSLG+++ATLNA D+V N  NK     +
Sbjct  210   YNKSSARDQVLNEVRRLVEQYKDEEISITVCGHSLGAAVATLNAADIVANGFNKSKSWPN  269

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
              P PVTA +FASP+VG+ +FK   S   D L++LR+ +  D+VP             P+I
Sbjct  270   KPCPVTAIVFASPRVGDSDFKKVFSGYKD-LRVLRVHNLLDVVP-----------NYPLI  317

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E   D +KS YL   G  +SWH L  YLHGV G QGS GGFKL  + D+AL+N
Sbjct  318   GYADVGEELTIDTTKSKYLKSPGNVSSWHNLEGYLHGVAGTQGSTGGFKLEVNRDIALVN  377

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             K++D LK  Y  + P  W + KN GM+QQ DG+W L DHE D
Sbjct  378   KSLDGLKDEY--LVPTSWRIQKNKGMIQQADGSWKLMDHEED  417



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score =   384 bits (987),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 207/410 (50%), Positives = 269/410 (66%), Gaps = 30/410 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W+ LSG  NWEGLL+PLD DLR+Y+I YG +    YD+FI+E  SK  G  RY+ +NL
Sbjct  6     EKWEHLSGKNNWEGLLNPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G D   P  Y+VTKYFY+ S+I   + +L++S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FTRAGLD---PLNYKVTKYFYATSSIPLPSAFLVKSLSREAWSKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              ALGRRDI++AWRGT++  EW+ + +FL +  P +FG         PLVH GFY++YT+ 
Sbjct  123   VALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFKPLVHHGFYNIYTSE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +P       SARDQ+ EEV+RLVE+YK+EE+SIT+AGHSLG+SLATLNAVD+  N INK 
Sbjct  183   DPRSKFNQASARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATLNAVDIAFNGINKT  242

Query  905   SP---IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF+   SKL  NL ILR+ +  DIVPK PP G       
Sbjct  243   SSGKEFPVTAFVFASPKVGDLNFQKTFSKLK-NLHILRIHNLLDIVPKYPPVG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDF  1240
                 Y  VG E   D +KS YL    G   + H L  YLHG+DG QG     GFKL  + 
Sbjct  295   ----YIDVGEEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGILAGFKLEVNR  350

Query  1241  DVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             D+AL+N+  D LK  Y +  PA W+  K+ GMVQQ+DGTW+L D E  D+
Sbjct  351   DLALVNRIWDMLKDEYCI--PAAWWTEKHKGMVQQEDGTWLLLDREDYDL  398



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   384 bits (986),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 203/409 (50%), Positives = 266/409 (65%), Gaps = 29/409 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++LSG   WEGLL+PLD DLR+Y+I YG +    YD+FI++ +SK  G  RY+ +NL
Sbjct  6     EKWEELSGKNKWEGLLNPLDVDLRKYIIQYGELAEVTYDTFISDKVSKYAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G D   P KY VTKYFY+ S+I     ++ +S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FSNVGLD---PSKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              +LGRRDI++AWRGT++  EW+ + QFL +  P +FG         PLVH GFY++YT+ 
Sbjct  123   VSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPGPKVFGDGGLLPLFKPLVHHGFYNVYTSE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +        SARDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNA D+  N INK 
Sbjct  183   SARSNFNKKSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAFDIAYNKINKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF NA +KL  +L ++R+ +  DIVPK PP G       
Sbjct  243   SEGKEFPVTAFVFASPKVGDINFVNAFNKL-KHLHVMRIHNVLDIVPKYPPLG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS YL+  G   +WH L  YLHGV G QG     GFKL  D D
Sbjct  295   ----YFDVGQEIIIDTTKSPYLNLPGDILTWHNLECYLHGVAGTQGIGLLAGFKLEVDRD  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             +AL+NK+   LK  Y  + PA W+  KN GMVQQ+DG W+L+D E  DI
Sbjct  351   IALVNKSSGALKSEY--LVPANWWTAKNKGMVQQEDGKWVLNDREEYDI  397



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score =   384 bits (986),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 201/403 (50%), Positives = 262/403 (65%), Gaps = 22/403 (5%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W+ LSG  NW GLL PLD DLRRY+IHYG M  A YD+F  E  SK  G CRYA+ +  
Sbjct  26    KWRQLSGENNWNGLLYPLDIDLRRYIIHYGEMAQATYDAFNTEKASKFAGSCRYAKNDFF  85

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              +   +NGNPFKY VTKY Y+ S +     ++I+S   +   K+SNW+GYV V++D+GK 
Sbjct  86    SKVYLENGNPFKYNVTKYIYATSEMDVPEAFIIKSFSREAWSKESNWIGYVGVSSDEGKD  145

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD-SNPLVHKGFYDMYTAVNPDPI  739
              LGRRDI++AWRGT+R+ EW+ +  F+ V AP +FG +  +P VH+G+Y +YT+ +P   
Sbjct  146   VLGRRDIVIAWRGTIRSLEWVNDLNFVLVSAPKLFGNNIIDPKVHQGWYSIYTSEDPRSP  205

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK--DSPI  913
                 SAR+Q+  EVRRLVE+YK+EE+SIT+ GHSLG+++ATLNAVD+VTN  NK  DS I
Sbjct  206   FNKTSARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNAVDIVTNGYNKPNDSSI  265

Query  914   ---PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTA +FASP+VG+ NF+   S   D L  LR+ +  DIVP             P I
Sbjct  266   KASPVTAIVFASPRVGDTNFQKVFSDQKD-LSTLRIRNELDIVP-----------NYPFI  313

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E + D +KS YL   G   SWH L  YLHGV G QGS+ GFKL  + D++L+N
Sbjct  314   GYSDVGEELKIDTTKSMYLKSPGNPLSWHNLEAYLHGVAGTQGSKRGFKLEVNRDISLVN  373

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K +D LK  Y  + P  W VV+N GMVQQ DG+W L D E  D
Sbjct  374   KTLDVLKDEY--LVPISWRVVENKGMVQQPDGSWKLVDPEDGD  414



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   383 bits (983),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 198/402 (49%), Positives = 264/402 (66%), Gaps = 21/402 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ L+G + W+ LLDPLD DLRR +IHYG M  A YD+FI E +SK  G  RYA+++ 
Sbjct  6     KRWRLLNGQEMWKNLLDPLDIDLRRSIIHYGEMAQATYDAFITEKVSKFAGSSRYAKRDF  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G  N NP+KY VTK+ Y+ S +     ++I+S   +   ++SNWMGYVAVATD+GK
Sbjct  66    FSKVGLVNANPYKYNVTKFLYATSRMDVPEAFIIKSLSREAWSRESNWMGYVAVATDEGK  125

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             AALGRRDI++AWRG+++A EWI +F F+ V A  I G+  +P VH+G+  +YT+ +P   
Sbjct  126   AALGRRDIVIAWRGSLQALEWIDDFSFIMVSASQILGRTIDPFVHQGWLSIYTSDDPRAP  185

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----D  904
                 SARDQ+  EVRRLVE+YKDEE+SIT+ GHSLG++L TLNAVD+V N  N+     D
Sbjct  186   FNRTSARDQVLSEVRRLVEEYKDEEISITITGHSLGAALGTLNAVDIVANGFNRPKDRPD  245

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                 VTAFLFASP+VG+  F+  +S L +NL++LR+ +A DIVP             P+I
Sbjct  246   KACLVTAFLFASPRVGDDKFQKLLSSL-ENLRLLRVRNALDIVP-----------NYPLI  293

Query  1085  SYEHVGMEFRFDASKSNYLDGFK--ASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E   D  KS +L      +  H L  YLHGV G QGS+GGFKL  + D+AL+N
Sbjct  294   GYSDVGQELVIDTQKSTFLKSPANLSVSHNLEGYLHGVAGTQGSKGGFKLEVERDIALVN  353

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             K+ID L+  Y ++  A W   KN GMVQ  DG+W L DHE D
Sbjct  354   KSIDGLRDEYLVL--ASWRCEKNKGMVQGADGSWKLMDHEED  393



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score =   382 bits (982),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 204/409 (50%), Positives = 266/409 (65%), Gaps = 29/409 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++LSG  NWEGLL+PLD DLR+Y+I YG      YD+FI++ +SK  G  RY+ +NL
Sbjct  3     EKWEELSGKNNWEGLLNPLDVDLRKYIIQYGEKAEVTYDTFISDKVSKYAGASRYSMENL  62

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G D   P KY VTKYFY+ S++     ++ +S   +   K+SN+MGYVAVATD+GK
Sbjct  63    FSNVGLD---PSKYRVTKYFYATSSMPLPDAFITKSLSREAWSKESNFMGYVAVATDEGK  119

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              +LGRRDI++AWRGT++  EW+ + QFL +  P +FG         PLVH GFY++YT+ 
Sbjct  120   VSLGRRDIVIAWRGTIQTLEWVNDLQFLPIPGPKVFGDGGLLPLFKPLVHHGFYNVYTSE  179

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +        SARDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  180   SARSKFNKTSARDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAYNKINKS  239

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF NA +KL   L ++R+ +  DIVPK PP G       
Sbjct  240   SHGKEFPVTAFVFASPKVGDLNFLNAFNKL-KYLHVMRIHNILDIVPKYPPIG-------  291

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS YL+  G   +WH L  Y+HGV G QG     GFKL  D D
Sbjct  292   ----YLDVGQEIIIDTTKSPYLNLPGDILTWHNLECYMHGVAGTQGIGLLTGFKLEVDRD  347

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             +AL+NK+   LK  Y  + PA W+ VKN GM QQ+DG W+L+D E  DI
Sbjct  348   IALVNKSSGALKSEY--LVPANWWTVKNKGMFQQEDGKWVLNDREEYDI  394



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   381 bits (978),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 201/400 (50%), Positives = 257/400 (64%), Gaps = 42/400 (11%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ LSG  NWEGLLDPLD DLRRY+IHYG M  A YD+F +E  S+  G  RYA+K+ 
Sbjct  6     KKWRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFAGSSRYAKKDF  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D GNPFKY VTKYF                       K+SNWMGYVAVATD+GK
Sbjct  66    FSKVGIDIGNPFKYYVTKYF-----------------------KESNWMGYVAVATDEGK  102

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ-DSNPLVHKGFYDMYTAVNPDP  736
             A LGRRDI++AWRGTV+  EW+ +F+F  V A  I G+    P VH+G+Y +YT+ +P  
Sbjct  103   AVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQGWYSIYTSDDPLS  162

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  SARDQ+  EVRRLVE++K+EE+SI+L GHSLG+++ATLNAVD+V N +N+    P
Sbjct  163   SFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVDIVANGLNQG--CP  220

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             VTA +FASP+VG+ NF    S L  NL++LR+ +A DI+P  P  G           Y  
Sbjct  221   VTAVVFASPRVGDSNFLKLFSALK-NLRVLRVRNASDIIPNYPLLG-----------YSD  268

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
             VG E   D  KS YL   G  ++WH L  +LHGV G QGS+GGF+L  + D+AL+NK+ID
Sbjct  269   VGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIALVNKSID  328

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
              L   Y  + P  W   KN GMVQQ DG+W L DHE DD+
Sbjct  329   ALNDEY--LVPVSWRCEKNKGMVQQVDGSWKLMDHEEDDL  366



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score =   380 bits (976),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 205/409 (50%), Positives = 263/409 (64%), Gaps = 29/409 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W+ LSG  NWEGLL+PLD DLR+Y+I YG      YD+FI+E  SK  G  RY+ +NL
Sbjct  6     EKWEQLSGKNNWEGLLNPLDLDLRKYIIQYGEKAEVTYDTFISETASKYAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTK+FY+ S+I   + +L++S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FAKVGLD---PSKYRVTKFFYATSSIPLPSAFLVKSLSREAWNKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              ALGRRDI++AWRGT++  EW+ + +FL +  P +FG         PLVH GFY +YT  
Sbjct  123   VALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGNGGLVPLFKPLVHHGFYSIYTTE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             NP       S RDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  183   NPRSKFNQYSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKT  242

Query  905   SP---IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF+ A SKL   L ILR+ +  DIVPK PP G       
Sbjct  243   SSGKEFPVTAFVFASPKVGDLNFQMAFSKL-KTLHILRIHNLLDIVPKYPPLG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS YL   G   +WH L  Y+HGV G QG     GFKL  + D
Sbjct  295   ----YIDVGEELIIDTTKSPYLKLPGDVLTWHNLECYMHGVAGTQGLGLLTGFKLEVNRD  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             +AL NK+   LK  Y +  PA W+  K+ GM+QQ+DGTW+L D E  D+
Sbjct  351   LALANKSSGALKDEYCI--PANWWTEKHKGMIQQEDGTWLLLDREDYDL  397



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 201/405 (50%), Positives = 258/405 (64%), Gaps = 27/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ L+G +NW+ LLDPLD DLRR +IHYG M  A YD+FI E  SK  G  RYAR + 
Sbjct  7     KRWRLLNGQENWKNLLDPLDIDLRRNIIHYGEMAQATYDTFITEKASKFAGSSRYARADF  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G    NPFKY+VTK+ Y+ S I     ++I+S   +   ++SNWMGYVAVATD+GK
Sbjct  67    FSKVGLVKTNPFKYQVTKFLYATSRIEVPEAFIIKSLSREAWSRESNWMGYVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRDI+VAWRGTV   EW+ +F F  V A  I G  ++P VH+G+  +YT+ +P   
Sbjct  127   AVLGRRDIVVAWRGTVEDLEWVDDFSFNLVSASEILGGTNDPKVHQGWLSIYTSDDPRSP  186

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP-  916
                 SARDQ+  EVRRLVE +KDEE+SIT+ GHSLG++L TLNA D+V + +NK    P 
Sbjct  187   FNKASARDQVLSEVRRLVELFKDEEISITITGHSLGAALGTLNAADIVAHGLNKPRNHPH  246

Query  917   ----VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                 VTA LFASP+VG+ NF+   S L +NL++LR+ +A D+VP  P  G          
Sbjct  247   RACLVTAILFASPRVGDDNFQEVFSGL-ENLRLLRVRNALDVVPNYPLLG----------  295

Query  1085  SYEHVGMEFRFDASKSNYLDGFKAS-----WHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
              Y  VG E   D  KS ++   KAS     WH L  YLHGV G QG++GGFKL    D+A
Sbjct  296   -YSDVGEELAIDFRKSKFI---KASANPSLWHNLECYLHGVAGTQGAKGGFKLEVGRDIA  351

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             L+NK  D LK  +  + P  W+  KN GMVQ+DDGTW L DHE D
Sbjct  352   LVNKTTDALKDEH--LVPVSWWCEKNKGMVQRDDGTWKLMDHEED  394



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 204/405 (50%), Positives = 263/405 (65%), Gaps = 29/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W+ LSG  NWE LL+PLD DLR+Y+I YG +  A YD+FI E  SK  G  RY+ +NL
Sbjct  6     EKWEQLSGKDNWEALLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 GHD   P KY VTK+FY+ S+I     ++++S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FTGVGHD---PLKYRVTKFFYATSSIPLPDAFVVKSLSREAWSKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              +LGRRDI++ WRGT++  EW+ +FQFL V AP +FG         PLVH GFY++YT+ 
Sbjct  123   VSLGRRDIVINWRGTMQNLEWVNDFQFLLVPAPKVFGDGGLLPLFQPLVHHGFYNIYTSE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +          RDQ+ EEV+RLVE+YK+E++SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  183   SSRSQFNKTCVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATLNAVDITFNGINKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             +     PVTAF+FASPKVG+ NF  A SKL +NL ILR+ +  DIVPK PP G       
Sbjct  243   TEGKEFPVTAFVFASPKVGDFNFHKAFSKL-NNLHILRIHNLLDIVPKYPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G  ASWH L  YLHGV G QG     GFKL  + D
Sbjct  295   ----YIDVGKELMIDTTKSPYVKPPGDIASWHLLEPYLHGVAGTQGIGILAGFKLEVNRD  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK  D LK  + +  P  W+V K+ GMVQQ DGTW+L D E
Sbjct  351   ISLVNKMGDTLKDEHCI--PGHWWVEKHKGMVQQQDGTWLLLDRE  393



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   377 bits (969),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 202/405 (50%), Positives = 265/405 (65%), Gaps = 29/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++LSG  NW+GLL+PLD DLR+Y+IHYG +  A YD+FI+E  SK  G  RY+ +N 
Sbjct  7     EKWEELSGKNNWDGLLNPLDLDLRKYIIHYGELAQATYDTFISERASKYAGASRYSMENF  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTKYFY+ S++     ++ +S   +   K+SN+MGY+AVATD+GK
Sbjct  67    FTKVGLD---PKKYCVTKYFYATSSMPLPDAFITKSLSREAWSKESNFMGYIAVATDEGK  123

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
             A+LGRRDI++ WRGT++  EW+ + QFL V AP +FG        +PLVH GF+++YT  
Sbjct  124   ASLGRRDIVINWRGTLQVLEWVNDLQFLLVPAPQVFGDGGLLPLFHPLVHHGFHNIYTTE  183

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             NP         RDQ+ EEV+RLVE+YKDEE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  184   NPRSQFNKTCVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNKINKA  243

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF NA SKL  +L ILR+ +  DIVPK PP G       
Sbjct  244   SNGKEFPVTAFVFASPKVGDVNFLNAFSKL-KHLHILRIHNVLDIVPKYPPIG-------  295

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQ--GSQGGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHG+ G Q  G   GFKL  + D
Sbjct  296   ----YFDVGQEIMIDTTKSPYVKPPGEPVSWHLLEPYLHGIAGTQGIGMLAGFKLEVNRD  351

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK  + LK  + +  P  W+  K+ GMVQQ+DGTW+L D +
Sbjct  352   ISLVNKQWNVLKDEHCI--PPLWWSEKHKGMVQQEDGTWLLQDRD  394



>ref|XP_004232956.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=410

 Score =   378 bits (970),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 206/398 (52%), Positives = 265/398 (67%), Gaps = 26/398 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW+ LSG  NWEGLLDPLD DLRRYLIHYG M  A+YDSF NE +SK  G  RY++KNL
Sbjct  34    ERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAIYDSFNNEKVSKYRGTSRYSKKNL  93

Query  380   LRESG-HDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
                 G H N    KYE+TKYFY  S+         ++++    +K SNW+G+VAVATD+G
Sbjct  94    FTRVGLHRN----KYEITKYFYGASS---------KTEK----VKVSNWIGFVAVATDEG  136

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-NPLVHKGFYDMYTAVN-P  730
             K ALGRRDIL+ WRGT+  +EW  +F+   V+   IF +++ N LVHKGFY +YT++N  
Sbjct  137   KVALGRRDILIVWRGTITVSEWNDDFESSMVQPIEIFRENTDNILVHKGFYSIYTSLNHA  196

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
                 +  SARDQ+ EEV+RL++QYK EE+SI++ GHSLGSSLATL A+D+  + +NK   
Sbjct  197   SNFNRTTSARDQVLEEVKRLMDQYKKEEVSISVTGHSLGSSLATLCAIDIAVSQVNK--G  254

Query  911   IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISY  1090
              PVTAFLFASP+VGE NFK A   L  NL ILR+T+A D++ KLP  G           Y
Sbjct  255   FPVTAFLFASPRVGEINFKKACENLK-NLHILRITNASDLITKLPDRGQVEGCETDWRVY  313

Query  1091  EHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
             E VG E   D +KS+YL   + + H L  YLHG+ G  G +G FKL  + D+AL+NK  D
Sbjct  314   EDVGFELSIDTTKSDYLKK-EINGHILEVYLHGIAGTHGFEGEFKLEMNRDIALMNKADD  372

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
              LK  Y +  PA W++ KN GMVQ ++G+WIL DHE D
Sbjct  373   VLKDEYGV--PASWWIEKNKGMVQHENGSWILMDHEDD  408



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 205/406 (50%), Positives = 268/406 (66%), Gaps = 30/406 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++LSG   WEGLL+PLD DLRRY+I YG +    YD+FI+E  SK  G  RY+ +NL
Sbjct  6     EKWEELSGKNKWEGLLNPLDVDLRRYIIQYGELAHVTYDTFISEKASKYAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               ++G D   P KY VTKYFY+ S+I     ++ +S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FSKAGLD---PTKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
             A+LGRRDIL+AWRGT++  EW+ + QFL +  P +FG         PLVH GFY++YT+ 
Sbjct  123   ASLGRRDILIAWRGTIQTLEWVNDLQFLLIPGPKVFGDGGLLPLFKPLVHHGFYNVYTSE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +        SARDQ+ EEV+RLVE+YKD+E+SIT+AGHSLG+SLATLNAVD+  N INK 
Sbjct  183   SARSKYNQASARDQVIEEVKRLVEEYKDDEVSITVAGHSLGASLATLNAVDIAYNGINKT  242

Query  905   SP---IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF NAV+KL ++L I+R+ +  DIV K PP G       
Sbjct  243   SSGKEFPVTAFVFASPKVGDLNFVNAVNKL-EHLHIMRIHNLLDIVSKYPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQ--GSQGGFKLHGDF  1240
                 Y  VG E   D +KS YL    G   + H L  YLHG+DG Q  G   GFKL  + 
Sbjct  295   ----YFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGPLDGFKLEVNR  350

Query  1241  DVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             D++L+N+  D LK  Y  + P  W+V K++GMVQQ+DG WIL D E
Sbjct  351   DLSLVNRIWDILKDEY--LVPGAWWVEKHNGMVQQEDGKWILMDRE  394



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 202/406 (50%), Positives = 268/406 (66%), Gaps = 30/406 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W++LSG   WEGLL+PLD DLR+Y+I YG +    YD+FI E  SK  G  RY+ +NL
Sbjct  6     DKWEELSGKNKWEGLLNPLDVDLRKYIIQYGELAHVTYDTFITEKASKYAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               ++G D   P KY VTKYFY+ S+I     ++ +S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FSKAGLD---PSKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD-----SNPLVHKGFYDMYTAV  724
              +LGRRDI++AWRGT++  EW+ + QFL + AP +FG+      + PLVH GFY++YT+ 
Sbjct  123   VSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPAPEVFGKGGLLPLTQPLVHHGFYNIYTSE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +        SARDQ+ EEV+RLVE+YKD+E+SIT+AGHSLG+SLATLNAVD+  N INK 
Sbjct  183   SERSKFNKTSARDQVLEEVKRLVEEYKDDEVSITVAGHSLGASLATLNAVDIAFNGINKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF N  +KL  NL I+R+ +  DIVPK PP G       
Sbjct  243   SEGKEFPVTAFVFASPKVGDVNFVNTFNKLK-NLHIMRIDNLLDIVPKYPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQ--GSQGGFKLHGDF  1240
                 Y  VG E   D +KS YL    G   + H L  YLHG+DG Q  G   GFKL  + 
Sbjct  295   ----YFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGPLDGFKLEVNR  350

Query  1241  DVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             D+AL+N+  D LK  +  + P  W+V K++GMVQQ++G WIL DHE
Sbjct  351   DLALVNRIWDILKDEH--LVPGAWWVEKHNGMVQQENGKWILMDHE  394



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score =   377 bits (967),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 195/404 (48%), Positives = 262/404 (65%), Gaps = 22/404 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG  +W  LLDPLD DLRRY+IHYG M  A YD+F NE  SK  G   Y +++ 
Sbjct  24    KRWKPLSGQNHWGELLDPLDIDLRRYIIHYGEMAQATYDAFNNEKASKFAGSSLYGKEDF  83

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               +   + GNP++Y+VTK+ Y+ S I+    ++++S   +   K+SNW+GYVAVATD+GK
Sbjct  84    FSKVNLEKGNPYRYQVTKFLYATSQIQLPEAFIVKSSSREAWSKESNWIGYVAVATDEGK  143

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPDP  736
               LGRRDI++AWRGTV+  EWI + +F  V    IFG +   + VH+G+Y +YT+ +   
Sbjct  144   DVLGRRDIVIAWRGTVQTLEWINDIEFNLVSPEKIFGHERRDIKVHEGWYSIYTSEDSRS  203

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----  901
                  SARDQ+  EVRRLV+Q+K+EE+SIT+ GHSLG++LATLNA+D+V N  N+     
Sbjct  204   PYNKSSARDQVLNEVRRLVDQFKNEEISITVTGHSLGAALATLNAIDIVANGYNRPKSQS  263

Query  902   DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                 PVTAFLFASP+VG+ +FK A +   D L+ LR+ +A D+VP             P+
Sbjct  264   RKASPVTAFLFASPRVGDSDFKKAFTGFKD-LRALRVGNALDVVP-----------NYPL  311

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
             + Y  VG E   D  KS YL+  G  +SWH L  YLHGV G QGS+GGF L  + D+AL+
Sbjct  312   VGYSDVGEELAIDTRKSKYLNSPGNLSSWHNLEAYLHGVAGTQGSKGGFALVVNRDIALV  371

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             NK+ID LK  Y  + P  W + KN GMVQQ+DG+W L DHE  D
Sbjct  372   NKSIDGLKDEY--LVPVSWRIEKNKGMVQQEDGSWKLMDHEGQD  413



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score =   375 bits (964),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 195/400 (49%), Positives = 258/400 (65%), Gaps = 22/400 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W++LSG  NW+GLLDPLD DLRRY+IHYG +  A YD F +E  S   G  RY+++   
Sbjct  7     KWRELSGRSNWKGLLDPLDIDLRRYIIHYGQLAQATYDGFNSEKASNLAGNSRYSKREFF  66

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G +NGNPFKY VTK+ Y+ S    +  +L++S   D    QSNW+GYVAVATD+GK 
Sbjct  67    GKVGLENGNPFKYLVTKFLYATSKASDSEKFLLRSFSKDAWSLQSNWIGYVAVATDEGKE  126

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI+VAWRGT++AAEW+K+F F    AP IFG  ++  +H GFY +YT+ NP    
Sbjct  127   ALGRRDIVVAWRGTIQAAEWVKDFHFHLDPAPEIFGDAASAELHHGFYSLYTSKNPGSKF  186

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----DS  907
                SAR+Q+ EEV RLVE+YK+EE+SI++ GHSLG++LATLNAVD+    +NK       
Sbjct  187   TNTSARNQVLEEVGRLVEEYKNEEISISVTGHSLGAALATLNAVDIAAQGLNKPKGQPQK  246

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
               PVTAF +ASP+VG+ +F++A +   D L+ LR+ +  DIVP              ++ 
Sbjct  247   ACPVTAFAYASPRVGDSSFEDAFNGYKD-LRALRIRNETDIVP-----------VSLLLG  294

Query  1088  YEHVGMEFRFDASKSNYL-DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
             +  VG E   D  KS +L +G  A  H L  YLHGV G QG +GGF L  + D+ALLNK 
Sbjct  295   FSDVGEELLIDTRKSKFLKEGVSA--HNLEAYLHGVAGTQGKKGGFNLEVNRDIALLNKG  352

Query  1265  IDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             +D LK  Y  + P EW V +N GMVQQ DGTW L +   D
Sbjct  353   MDALKDEY--LVPVEWRVQENKGMVQQLDGTWKLIEKNED  390



>ref|XP_009757709.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   375 bits (964),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 208/405 (51%), Positives = 258/405 (64%), Gaps = 29/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W+ LSG  NWEGLL+PLD DLR+YLI YG +  A YD+FI E  SKN G  RY+ +NL
Sbjct  6     EKWEQLSGKNNWEGLLNPLDFDLRKYLIQYGELAQATYDTFITEEKSKNAGASRYSLENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G D   P KY VTK+FY+ S+I     + ++S   +   K SN+MGYVAVATD+GK
Sbjct  66    FTRVGLD---PLKYRVTKFFYATSSIPLPDGFFVRSLSLEAWSKDSNFMGYVAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG-----QDSNPLVHKGFYDMYTAV  724
               LGRRDI++AWRGT+   EW+ NFQF  V AP +FG         PLVH GFY++YT  
Sbjct  123   VELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQPLVHHGFYNIYTTD  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             NP       S RDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N +NK 
Sbjct  183   NPRSQFNQTSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGVNKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S      VTAF FASPKVG+  FK A  KL  +L+ LR+ +  D+VPK+PP G       
Sbjct  243   SEGKEFQVTAFAFASPKVGDLKFKAAFDKLK-SLRTLRIHNLWDVVPKVPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQG--GFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHG+ G QG  G  GFKL  + D
Sbjct  295   ----YIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLIGLIGFKLEVNRD  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK  D LK  Y +  P  W+V KN GMVQQ DG+WIL D E
Sbjct  351   ISLVNKQWDILKDEYGI--PGLWWVEKNKGMVQQQDGSWILMDRE  393



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score =   375 bits (964),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 198/409 (48%), Positives = 261/409 (64%), Gaps = 22/409 (5%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W+DLSG  NW+GLLDPLD DLR Y+IHYG +  A YD+F +E  SK  G  RY +K+  
Sbjct  8     KWRDLSGRSNWKGLLDPLDIDLRPYIIHYGQLAQATYDAFNSEKTSKYAGNSRYPKKDFF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G +NGNPF+Y+V K+ Y+ S    A  +L++S   D+  KQSNW+GYVAVATD GK 
Sbjct  68    SKVGLENGNPFRYDVKKFLYATSKASDAEAFLLKSFSKDSWSKQSNWIGYVAVATDAGKE  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI+VAWRGT++AAEW+K+F F    AP IFG DS+  VH GFY +YT+ NP    
Sbjct  128   ALGRRDIVVAWRGTIQAAEWVKDFHFHLDLAPEIFGGDSSAQVHHGFYSLYTSSNPGSKF  187

Query  743   KGVSARDQIREEVRRLVEQY--KDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP  910
                SAR+Q+  EV RLVE+Y  K+EE+SI++ GHSLG++LATLNAVD+    +N  K+ P
Sbjct  188   TDTSARNQVLGEVGRLVEEYTSKNEEISISVTGHSLGAALATLNAVDIAAQGLNIPKNQP  247

Query  911   ---IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                 PVTAF +A P+VG+ +F+   +   D L+ LR+ +  DIVP             P 
Sbjct  248   QKAFPVTAFAYACPRVGDSSFEETFNGYKD-LRSLRIRNVTDIVP-----------ITPF  295

Query  1082  ISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNK  1261
             + +  VG E   D  KS YL     S H L  YLHGV G QG +GGF L  + D+AL+NK
Sbjct  296   LGFSDVGEELVIDTRKSKYLKS-GVSAHNLEAYLHGVAGTQGEKGGFNLEVNRDIALVNK  354

Query  1262  NIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI*YLKKN  1408
             ++D LK  Y  + P  W V +N GMVQQ DG+W + D   DD+  +  N
Sbjct  355   SMDALKDEY--LVPVAWRVQENKGMVQQSDGSWKIVDQVHDDMESIHSN  401



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score =   375 bits (962),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 204/415 (49%), Positives = 270/415 (65%), Gaps = 35/415 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++LSG +NW+GLL+PLD +LR+Y+I YG +  A YD+FI++  SK  G  RY+++NL
Sbjct  6     EKWEELSGKENWKGLLNPLDVNLRKYIIQYGELAQATYDTFISDRASKYAGSSRYSKENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P  Y VTKYFY+ S+      ++++S   +   K+SN+MGYVAVATD GK
Sbjct  66    FAKVGLD---PEMYHVTKYFYATSSFPLPEAFMVKSWSREAWSKESNFMGYVAVATDKGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN------PLVHKGFYDMYTA  721
             A LGRRDI++AWRGT+R  EW+ + QFL V AP +FG  ++      PLVH+G+  +YT+
Sbjct  123   AVLGRRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGGGNSILPLFKPLVHQGWKSIYTS  182

Query  722   VNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
              +P       SARDQ+ EEV++LVE+YK+EE+SIT+ GHSLG+++ATLNAVD+V N  NK
Sbjct  183   DDPKSPFNKASARDQVLEEVKKLVEKYKNEEVSITVTGHSLGAAVATLNAVDIVYNGFNK  242

Query  902   DS---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
              S     PVTA +FASP VG+ NF+ A SKL  NL ILR+ +  DIVPK PP G      
Sbjct  243   TSNGKEFPVTACVFASPNVGDLNFRVAFSKL-KNLHILRVDNIVDIVPKYPPIG------  295

Query  1073  LPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ-------GGFK  1225
                  Y  VG     D +KS+YL   G   +WH L  YLHGV G QG         G FK
Sbjct  296   -----YIDVGEVLVIDTAKSDYLKSPGNLQTWHNLEAYLHGVAGTQGVGILIGEFFGDFK  350

Query  1226  LHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             L  D D+AL+NK+ D LKG Y +  PA W+V KN GMVQ+ D TW+L D E  +I
Sbjct  351   LEVDRDIALVNKSTDALKGEYGV--PANWWVEKNKGMVQKKDKTWVLMDREEYEI  403



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 202/409 (49%), Positives = 263/409 (64%), Gaps = 29/409 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++LSG  NWEGLL PLD DLR+Y+IHYG +  A YD+FI E  SK  G  RY+ +NL
Sbjct  3     EKWEELSGKNNWEGLLHPLDVDLRKYIIHYGELAQATYDTFITERASKYAGASRYSMENL  62

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTK+FY+ ++I     ++++S   +   K+SN+MGY+AVATD+GK
Sbjct  63    FTKVGLD---PNKYRVTKFFYATASIPLPDGFIVKSLSREAWSKESNFMGYIAVATDEGK  119

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              +LGRRDI++AWRGT++  EW+ + QFL V AP +FG         PLVH GFY+ YT+ 
Sbjct  120   VSLGRRDIVIAWRGTMQKLEWVNDLQFLLVPAPQVFGDGGLLPLFQPLVHHGFYNAYTSS  179

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +        SARDQ+ EEV+RLVE+YK EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  180   SSRSQFNLTSARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFNGINKT  239

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF FASPKVG+  FK A  K+   L++L++ +  DIVPK PP G       
Sbjct  240   SEGKEFPVTAFPFASPKVGDLQFKAAFDKI-KGLRVLKIHNLLDIVPKYPPIG-------  291

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHGV G QG     GFKL  + D
Sbjct  292   ----YFDVGQELMIDTTKSPYVKPPGEPVSWHLLEPYLHGVAGTQGLGLLAGFKLEVNRD  347

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             ++L+NK  D LK  Y +  P  W+V KN GMVQQ+DG+W++ D +  D 
Sbjct  348   ISLVNKQWDVLKDEYCI--PGLWWVEKNKGMVQQEDGSWLMLDRDEYDF  394



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 259/403 (64%), Gaps = 21/403 (5%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RWK L+G  NW+ LLDPLD DLRR +I YG    A YD+F +E  S   G  RY++ N  
Sbjct  8     RWKLLNGQNNWKNLLDPLDVDLRRNIIQYGERAQATYDTFNSEKASMFAGSSRYSKANFF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G +  NP+KY VTK+ Y+ S I     ++I+S   +   ++SNWMGYVAVATD+GKA
Sbjct  68    SKLGLEKANPYKYNVTKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVAVATDEGKA  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
              LGRRDIL+AWRG+V+A EWI +F F+ V A  I G  ++P VH+G+  +YT+ +P    
Sbjct  128   VLGRRDILIAWRGSVQALEWINDFNFILVSASGILGTKNDPNVHQGWLSIYTSDDPRSAY  187

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP--  916
                SAR Q+ EEV+RLVE++KDEE+SIT+ GHSLG++L TLNAVD+V N +NK    P  
Sbjct  188   NTTSARQQVLEEVKRLVEEFKDEEISITVTGHSLGAALGTLNAVDIVANGVNKPKDHPEK  247

Query  917   ---VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
                VTAFLF  P+VG+ NF+  VS L +NL++LR+ ++ D+VP             P++ 
Sbjct  248   ACLVTAFLFGCPRVGDANFQKVVSSL-ENLRLLRVRNSLDLVP-----------NYPLVG  295

Query  1088  YEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNK  1261
             Y  VG E   D  +S++L       +WH +  YLHGV G QG++GGFKL    D++L+NK
Sbjct  296   YSDVGQELVIDTRQSSFLKSSVDPGNWHNMEGYLHGVAGTQGTKGGFKLEVGRDISLVNK  355

Query  1262  NIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             + D LK  Y  + P  W+  KN GM+Q +DG+W L DHE D I
Sbjct  356   STDALKDEY--LVPMMWWCEKNKGMIQGEDGSWKLVDHEPDAI  396



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score =   375 bits (964),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/403 (48%), Positives = 261/403 (65%), Gaps = 22/403 (5%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             WK L GS NW+GLL+PL  DLRRYLIHYG M  A YD+F  E +SK  G  RY++++   
Sbjct  50    WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKVSKFAGSSRYSKQDFFA  109

Query  386   ESGHDNGN--PFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             + G   G   P+KY VTK+ Y+ S ++    ++++S   +   K+SNW+GYVAV+TD+G 
Sbjct  110   KIGLGKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVAVSTDEGA  169

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRD+++AWRGTVR+ EWI +F+F  V AP IFG+ S+  +H+G+Y +YT+ +    
Sbjct  170   AELGRRDVVIAWRGTVRSLEWIDDFEFGLVSAPQIFGESSDVKIHQGWYSIYTSDDRRSP  229

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN----KDS  907
                 S R+Q+  EV+RLVE+YK+EE+SI   GHSLG++LATLNAVD+  N +N       
Sbjct  230   FTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAVDIAANKLNIAAATGQ  289

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
               PVT+F+FA P+VG+  FK A S+  D + +LR+ +A D+VP  P F          I 
Sbjct  290   AYPVTSFVFACPRVGDSEFKRAFSEYKD-VHVLRVKNAMDVVPNYPMF----------IG  338

Query  1088  YEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQG-SQGGFKLHGDFDVALLN  1258
             Y  VG E   D  KS YL   G  +SWH L  YLHGV G QG ++GGF+L  + D+ALLN
Sbjct  339   YSEVGEELEIDTRKSKYLKSPGSLSSWHNLEGYLHGVAGTQGKNKGGFRLEIERDIALLN  398

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K++D LK  Y  + P  W  ++N GMVQQ DG+W L DHE DD
Sbjct  399   KSLDALKDEY--LVPVAWRCLQNKGMVQQTDGSWKLMDHEEDD  439



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score =   375 bits (962),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/403 (47%), Positives = 261/403 (65%), Gaps = 23/403 (6%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             WK L GS NW+GLL+PL  DLRRYLIHYG M  A YD+F  E  SK  G  RY++++   
Sbjct  44    WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRYSKQDFFA  103

Query  386   ESGHDNGN--PFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             + G + G   P+KY VTK+ Y+ S ++    ++++S   +   K+SNW+GYVAV TD+G 
Sbjct  104   KIGLEKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVAVGTDEGA  163

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRD+++AWRGTVR+ EW+ +F+F  V AP IFG+ S+  +H+G+Y +YT+ +    
Sbjct  164   AELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIFGESSDVKIHQGWYSIYTSDDRRSP  223

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN----KDS  907
                 S R+Q+  EV+RLVE+YK+EE+SI   GHSLG++LATLNA D+  N +N       
Sbjct  224   FTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAFDMAANKLNVAATTGE  283

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
               PVT+F+FASP+VG+ +FK A S+  D + +LR+ +A D+VP             PII 
Sbjct  284   AYPVTSFVFASPRVGDSDFKRAFSEYKD-VHVLRVKNAMDVVP-----------NYPIIG  331

Query  1088  YEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQG-SQGGFKLHGDFDVALLN  1258
             Y  VG E   D  KS YL   G  +SWH L  YLHGV G QG ++GGF+L  + D+ALLN
Sbjct  332   YSEVGEELEIDTRKSKYLKSPGSLSSWHNLEAYLHGVAGTQGKNKGGFRLEIERDIALLN  391

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K++D LK  Y  + P  W  ++N GMVQQ DG+W L DHE DD
Sbjct  392   KSLDALKDEY--LVPVAWRCLQNKGMVQQSDGSWKLMDHEEDD  432



>ref|XP_009757707.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=394

 Score =   373 bits (958),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 208/407 (51%), Positives = 258/407 (63%), Gaps = 28/407 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W+ LSG  NWEGLL+PLD DLR+YLI YG +  A YD+FI E  SKN G  RY+ +NL
Sbjct  6     EKWEQLSGKNNWEGLLNPLDFDLRKYLIQYGELAQATYDTFITEEKSKNAGASRYSLENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G D   P KY VTK+FY+ S+I     + ++S   +   K SN+MGYVAVATD+GK
Sbjct  66    FTRVGLD---PLKYRVTKFFYATSSIPLPDGFFVRSLSLEAWSKDSNFMGYVAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG-----QDSNPLVHKGFYDMYTAV  724
               LGRRDI++AWRGT+   EW+ NFQF  V AP +FG         PLVH GFY++YT  
Sbjct  123   VELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQPLVHHGFYNIYTTD  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             NP       S RDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N +NK 
Sbjct  183   NPRSQFNQTSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGVNKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S      VTAF FASPKVG+  FK A  KL  +L+ LR+ +  D+VPK+PP G       
Sbjct  243   SEGKEFQVTAFAFASPKVGDLKFKAAFDKLK-SLRTLRIHNLWDVVPKVPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
                 Y  VG E   D +KS Y+   G   SWH L  YLHG+ G QG   GFKL  + D++
Sbjct  295   ----YIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLI-GFKLEVNRDIS  349

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             L+NK  D LK  Y +  P  W+V KN GMVQQ DG+WIL D E  D 
Sbjct  350   LVNKQWDILKDEYGI--PGLWWVEKNKGMVQQQDGSWILMDREEYDF  394



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score =   375 bits (962),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 191/403 (47%), Positives = 261/403 (65%), Gaps = 23/403 (6%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             WK L GS NW+GLL+PL  DLRRYLIHYG M  A YD+F  E  SK  G  RY++++   
Sbjct  50    WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRYSKQDFFA  109

Query  386   ESGHDNGN--PFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             + G + G   P+KY VTK+ Y+ S ++    ++++S   +   K+SNW+GYVAV TD+G 
Sbjct  110   KIGLEKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVAVGTDEGA  169

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRD+++AWRGTVR+ EW+ +F+F  V AP IFG+ S+  +H+G+Y +YT+ +    
Sbjct  170   AELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIFGESSDVKIHQGWYSIYTSDDRRSP  229

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN----KDS  907
                 S R+Q+  EV+RLVE+YK+EE+SI   GHSLG++LATLNA D+  N +N       
Sbjct  230   FTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAFDMAANKLNVAATTGE  289

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
               PVT+F+FASP+VG+ +FK A S+  D + +LR+ +A D+VP             PII 
Sbjct  290   AYPVTSFVFASPRVGDSDFKRAFSEYKD-VHVLRVKNAMDVVP-----------NYPIIG  337

Query  1088  YEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQG-SQGGFKLHGDFDVALLN  1258
             Y  VG E   D  KS YL   G  +SWH L  YLHGV G QG ++GGF+L  + D+ALLN
Sbjct  338   YSEVGEELEIDTRKSKYLKSPGSLSSWHNLEAYLHGVAGTQGKNKGGFRLEIERDIALLN  397

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K++D LK  Y  + P  W  ++N GMVQQ DG+W L DHE DD
Sbjct  398   KSLDALKDEY--LVPVAWRCLQNKGMVQQSDGSWKLMDHEEDD  438



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   372 bits (955),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 202/405 (50%), Positives = 261/405 (64%), Gaps = 29/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W+ LSG  NWEGLL+PLD DLRRY+I YG +  A YD+FI E  SK  G  RY+ +NL
Sbjct  6     EKWEQLSGKDNWEGLLNPLDLDLRRYIIQYGELAQATYDTFITEKASKYAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G D   P KY VTK+FY+ S+I     ++++S   +   K+SN+MGYVAVATD+GK
Sbjct  66    FTGVGLD---PLKYRVTKFFYATSSIPLPDAFVVKSLSREAWSKESNFMGYVAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              +LGRRDI++ WRGT++  EW+ +FQFL V AP +FG         PLVH GFY++YT+ 
Sbjct  123   VSLGRRDIVINWRGTMQNLEWVNDFQFLLVPAPKVFGDGGLLPLFQPLVHHGFYNIYTSE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +          RDQ+ EEV+RLVE+YK+E++SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  183   SSRSQFNKTCVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATLNAVDITFNGINKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             +     PVTAF+FASPKVG+ NF  A SKL +NL ILR+ +  DIVPK PP G       
Sbjct  243   TEGKEFPVTAFVFASPKVGDFNFHKAFSKL-NNLHILRIHNVLDIVPKYPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHGV G QG     GFKL  + +
Sbjct  295   ----YIDVGKELMIDTTKSPYVKPPGDIVSWHLLEPYLHGVAGTQGISILAGFKLEVNRN  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK  + LK  + +  P  W+V K+ GMVQQ DGTW+  D E
Sbjct  351   ISLVNKMGNILKDEHCI--PGLWWVEKHKGMVQQQDGTWLFLDRE  393



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 201/411 (49%), Positives = 269/411 (65%), Gaps = 35/411 (9%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E W+ LSG +NW+GLL+PLD +LR+Y+I YG +  A YD+FI+E  SK  G  RY+++NL
Sbjct  6     ENWEQLSGKENWKGLLNPLDFNLRKYIIQYGELAQATYDTFISERASKYAGSSRYSKENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
              +  G D   P  Y +TKYFY+ S+      ++I+S   +   K+SN+MG+VAVATD GK
Sbjct  66    FKRVGLD---PEMYHITKYFYATSSFPLPEAFMIRSWSREAWSKESNFMGFVAVATDKGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN------PLVHKGFYDMYTA  721
             A LGRRDI++AWRGT+R  EW+ + QFL V AP +FG  ++      PLVH+G+  +YT+
Sbjct  123   AVLGRRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGAGNSILPLLKPLVHQGWNSVYTS  182

Query  722   VNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
              +P       SARDQ+ EEV+RLVE+YK+E++SIT+ GHSLG++LATLNAVD+V N INK
Sbjct  183   DDPRSPFNKASARDQVLEEVKRLVEKYKNEKVSITVTGHSLGAALATLNAVDIVYNGINK  242

Query  902   DS---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
              S     PVTAF+FASP VG+ NF+ A SKL  NL ILR+ +  DIVPK PP G      
Sbjct  243   KSNGKEFPVTAFVFASPNVGDLNFRAAFSKL-KNLHILRIDNLLDIVPKYPPIG------  295

Query  1073  LPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ-------GGFK  1225
                  Y  VG     D +KS+Y+   G   +WH L  Y+HGV G QG         G FK
Sbjct  296   -----YIDVGQVLVIDTAKSDYVKSPGNILTWHNLEAYMHGVAGTQGVGILPGELLGEFK  350

Query  1226  LHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             L  + D+AL+NK++D LK  Y +  PA W+V KN+GMVQ+ D +W+L D E
Sbjct  351   LEVNRDIALVNKSMDALKEEYGV--PANWWVEKNNGMVQRADRSWVLMDRE  399



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score =   371 bits (953),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 203/409 (50%), Positives = 266/409 (65%), Gaps = 29/409 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++LSG  NWEGLL PLD DLR+Y+I YG +  A YD+FI E  SK  G  RY+ +NL
Sbjct  3     EKWEELSGKNNWEGLLHPLDIDLRKYIIQYGELAQATYDTFITERASKYAGASRYSMENL  62

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTK+FY+ ++I     ++++S   +   K+SN+MGY+AVATD+GK
Sbjct  63    FTKVGLD---PNKYRVTKFFYATASIPLPDAFIVKSFSREAWSKESNFMGYIAVATDEGK  119

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              +LGRRDI++ WRGT++  EW+ + QFL V AP +FG         PLVH GFY++YT+ 
Sbjct  120   VSLGRRDIVINWRGTLQKMEWVNDLQFLPVPAPKVFGDGGLLPLFKPLVHHGFYNVYTSA  179

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +        SARDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  180   SSRSQFNLTSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKT  239

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF FASPKVG+  FK A  KL  +L+IL++ +  DIVPK PP G       
Sbjct  240   SEGKEFPVTAFPFASPKVGDLQFKAAFDKL-KSLRILKIHNLLDIVPKYPPIG-------  291

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D ++S Y+   G  ASWH L  YLHGV G QG     GFKL  + D
Sbjct  292   ----YFDVGKELMIDTARSPYVKPPGDPASWHLLEPYLHGVAGTQGLGLLAGFKLEVNRD  347

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             ++L+NK  + LK  Y +  P  W+V KN GMVQQ+DG+W+  DH+V D 
Sbjct  348   ISLVNKQWNVLKDEYCI--PGFWWVEKNKGMVQQEDGSWLQLDHDVYDF  394



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   371 bits (953),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 206/405 (51%), Positives = 262/405 (65%), Gaps = 29/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W+ LSG  NWEGLL+PLD DLR+Y+I YG +  A YD+FI E  SK  G  RY+ +NL
Sbjct  6     EKWEQLSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTK+FY+ S+I     ++++S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FTKVGLD---PLKYRVTKFFYATSSIPLPDAFIVKSLSREAWSKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG-----QDSNPLVHKGFYDMYTAV  724
              ALGRRDI+V WRGT++  EW+ + QFL V  P +FG         PLVH GFY++YT  
Sbjct  123   VALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLPLLKPLVHHGFYNIYTTE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +        SARDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  183   DLRSQFNQASARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF  A SKL +NL ILR+ +  DIVPK PP G       
Sbjct  243   SEGKEFPVTAFVFASPKVGDLNFHKAFSKL-NNLHILRIHNVLDIVPKYPPVG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHGV G QG     GFKL  + D
Sbjct  295   ----YIDVGEELIIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKLEVNRD  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK  D +K  Y +  P  W+V K+ GMVQQ DG+W+L D E
Sbjct  351   ISLVNKQWDIIKDEYCI--PGLWWVDKHKGMVQQQDGSWLLLDRE  393



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score =   370 bits (951),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 200/405 (49%), Positives = 259/405 (64%), Gaps = 29/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++LSG  NWEGLL+PLD DLR+Y+I YG +  A YD+FI+E  SK  G  RY+ +N 
Sbjct  6     EKWEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRYSMENF  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTK+FY  S+I     ++ +S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FTKVGLD---PSKYHVTKFFYGTSSIPLPDAFMTRSLSREAWSKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              ALGRRDI++ WRGT++  EW+ + QFL V AP +FG        +PLVH GF+++YT  
Sbjct  123   VALGRRDIVINWRGTLQVLEWVNDLQFLLVPAPKVFGDGGLLPLFHPLVHHGFHNIYTTE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             NP         RDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  183   NPRSQFNKTCVRDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKS  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF  A SKL  +L ILR+ +  DIVPK PP G       
Sbjct  243   SNGKEFPVTAFVFASPKVGDLNFHKAFSKL-KHLHILRIHNLLDIVPKYPPVG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQ--GSQGGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHG+ G Q  G   GFKL  + D
Sbjct  295   ----YFDVGQELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGIGMTAGFKLEVNRD  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK    LK  Y +  P  W+  K+ GMVQQ DG+W+L D +
Sbjct  351   ISLVNKQWMILKDEYCI--PPLWWSEKHKGMVQQQDGSWLLQDRD  393



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 199/398 (50%), Positives = 258/398 (65%), Gaps = 19/398 (5%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             WK LSG  NW+ LLDPLD+DLR Y+IHYG M  A YDSF  + +SK  G   YA+     
Sbjct  9     WKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKVSKYAGSSLYAKDEFFN  68

Query  386   ESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKAA  565
                 + GNPFKY VTK+ Y+ S +  +  ++I+S   +   K+SNWMG+VAV+TD+GK A
Sbjct  69    RVHLEKGNPFKYRVTKFLYATSQVHISEAFIIKSLSREAWSKESNWMGFVAVSTDEGKVA  128

Query  566   LGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPILK  745
             LGRRDI++AWRGT++  EW+ +F+F  V A  I G+  NP VH+G+Y +YT+ +      
Sbjct  129   LGRRDIVIAWRGTIQILEWVNDFEFNLVSASKILGESGNPKVHQGWYSIYTSDDSRSPYN  188

Query  746   GVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK---DSPIP  916
               SARDQ+  EV RLV+Q+K+EE+SIT+ GHSLG++LATLNAVD+V N  NK   +   P
Sbjct  189   KNSARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDIVANGFNKSHENKGCP  248

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             VTA LFASP+VG+ NFK   S+  D LK LR+ +  D+VPK            P I Y  
Sbjct  249   VTAMLFASPRVGDSNFKKVFSRYMD-LKALRVHNVLDVVPK-----------YPFIGYAD  296

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
             VG E   D +KS YL   G  +SWH L  YLHGV G QGS+GGF+L  + D+AL+NK  D
Sbjct  297   VGEELIIDTTKSKYLKSPGNVSSWHNLEAYLHGVAGTQGSKGGFELVANRDIALINKTTD  356

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
              LK  Y  + PA W + +N GMVQQ DG+W L DHE D
Sbjct  357   GLKDEY--LVPASWRIQENKGMVQQADGSWKLVDHEED  392



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/403 (48%), Positives = 264/403 (66%), Gaps = 27/403 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W++LSG  NWEGLL+PLD DLR+Y+I YG +  A+ D+FI E  SK  G  RY+ +NL
Sbjct  6     DKWEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQAINDTFITEKASKYAGASRYSMENL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATN-YLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G D   P KY VTKYFY+ ++I      + ++S   +   K+SN+MGY+AVATD+G
Sbjct  66    FTKVGLD---PTKYRVTKYFYATASIPLPDGVFFVKSLSREAWSKESNFMGYIAVATDEG  122

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS--NPLVHKGFYDMYTAVNP  730
             K +LGRRDI++ WRG+++  EW+ + QF+ V AP +FG      PLVH+GFY++YTA + 
Sbjct  123   KVSLGRRDIVINWRGSMQTLEWVNDLQFVLVPAPEVFGDGGLLQPLVHQGFYNVYTASSS  182

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS-  907
                    SARDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N INK S 
Sbjct  183   RSQFNVTSARDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNKINKASN  242

Query  908   --PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                 PVTAF FA PKVG+  FK A  K+   L+ILR+ +  DI PK PP G         
Sbjct  243   GKEFPVTAFPFACPKVGDLQFKAAFDKII-GLRILRIDNLLDIAPKYPPIG---------  292

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFDVA  1249
               Y  VG E   D +KS Y+   G   +WH+L +YLHG+ G QG+    GF L  + D++
Sbjct  293   --YFDVGQELMIDTTKSPYVKPPGQPVNWHSLESYLHGIAGTQGTGLLAGFNLEVNRDIS  350

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             L+NK +D LK  Y +  P  W+V KN GMVQQ+DG+W+L D +
Sbjct  351   LINKQLDGLKDEYCI--PVNWWVEKNKGMVQQEDGSWLLLDRD  391



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/405 (50%), Positives = 261/405 (64%), Gaps = 29/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++LSG  NW+GL+ PL  DLR+Y+I YG +  A YD+FI E  SK  G  RY+ +N 
Sbjct  6     EKWEELSGKSNWDGLVHPLAVDLRKYIIQYGELAQATYDTFITERASKYAGASRYSNENF  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTK+FY+ ++I     ++ +S   +   K+SN+MGYVAVATD+GK
Sbjct  66    FTKVGLD---PNKYGVTKFFYATASIPLPDAFITRSFSREAWSKESNFMGYVAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              +LGRRDI+VAWRGT +A EW+ + QFL V AP +FG         PLVH GFY++YT+ 
Sbjct  123   VSLGRRDIVVAWRGTKQALEWVNDLQFLLVPAPNVFGNGGLLPLFQPLVHHGFYNIYTSE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +        S RDQ+ EEV+RLVE+YKDEE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  183   SARSQFNQTSVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNGINKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF N  SKL  +L ILR+ +  DIVPK PP G       
Sbjct  243   SEGKEFPVTAFVFASPKVGDINFLNKFSKL-KHLHILRIHNLLDIVPKYPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHGV G QG     GFKL  + D
Sbjct  295   ----YFDVGQEIMIDTTKSPYVKPPGEIVSWHLLEPYLHGVAGTQGLGLLAGFKLEVNRD  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK  D LK  Y +  PA W+  K+ GMVQQ++G+W+L D +
Sbjct  351   ISLVNKEWDILKNEYCV--PAFWWTEKHKGMVQQENGSWLLMDRD  393



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   367 bits (943),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 199/409 (49%), Positives = 260/409 (64%), Gaps = 29/409 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++L G  NW GLL+PL  DLR+Y+IHYG +  A YD+FI E  SK  G  RY+ +N 
Sbjct  6     EKWEELGGKNNWNGLLNPLAVDLRKYIIHYGELAQATYDTFIMERASKYAGASRYSMENF  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTK+FY+ S+I     ++++S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FTKVGLD---PNKYRVTKFFYATSSIPLPDGFIVKSFSREAWSKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
             A+LGRRDI+V WRGT++  EW+ + QFL + AP IFG         PLVH GFY++YT+ 
Sbjct  123   ASLGRRDIVVNWRGTIQKMEWVNDLQFLLIPAPKIFGAGGLLPLFKPLVHHGFYNVYTSA  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +        S RDQ+ +EV+RLVE+YKDEE+SIT+ GHSLG+SLAT+NAVD+  N INK 
Sbjct  183   SSRSQFNKTSVRDQVIKEVKRLVEEYKDEEVSITVTGHSLGASLATMNAVDIAFNKINKA  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF FASPKVG+  FK    KL  +L ILR+ +  DIVPK PP G       
Sbjct  243   SNGKEFPVTAFAFASPKVGDIQFKATFDKL-KHLHILRIHNLLDIVPKYPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHGV G QG     GFKL  + D
Sbjct  295   ----YFDVGKELMIDTTKSPYVKPPGENVSWHLLEPYLHGVAGTQGLGLFAGFKLEVNRD  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             ++L+NK  + LK  Y +  P  W+V KN GMVQQ+DG+W++ D +  D 
Sbjct  351   ISLVNKQWNILKDEYCI--PGMWWVEKNKGMVQQEDGSWLMLDRDEYDF  397



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   367 bits (943),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 199/409 (49%), Positives = 263/409 (64%), Gaps = 29/409 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W++LSG  NW+GLL+PLD DLR+Y+I YG +  A YD+FI+E  SK  G  RY+ +N 
Sbjct  7     DKWEELSGKNNWDGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRYSMENF  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTKYFY+ S++     ++ +S   +   K+SN+MGY+AVATD+GK
Sbjct  67    FTKVGLD---PKKYCVTKYFYATSSMPLPDAFITKSFSREAWSKESNFMGYIAVATDEGK  123

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
             A+LGRRDI++ WRGT++  EW+ + QFL V AP +FG        +PLVH GF+++YT  
Sbjct  124   ASLGRRDIVINWRGTLQVLEWVNDLQFLLVPAPKVFGDGGLLPLFHPLVHHGFHNIYTTE  183

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             NP         RDQ+ EEV+RLVE+YK EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  184   NPRSQFNKTCVRDQVMEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFNKINKA  243

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF NA SKL  +L ILR+ +  DIVPK PP G       
Sbjct  244   SNGKEFPVTAFVFASPKVGDVNFLNAFSKL-KHLHILRIHNLLDIVPKYPPIG-------  295

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHG+ G QG     GFKL  + D
Sbjct  296   ----YFDVGQEIMIDTTKSPYVKPPGEPVSWHLLEPYLHGIAGTQGIGMFAGFKLEVNRD  351

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             ++L+NK  + LK  + +  P  W+  K+ GMVQQ+DG W+L D +  D 
Sbjct  352   ISLVNKQWNILKDEHCI--PPLWWSEKHKGMVQQEDGCWLLQDRDEYDF  398



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score =   367 bits (942),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 185/403 (46%), Positives = 255/403 (63%), Gaps = 23/403 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ LSG  NW+ LLDPLD DLR+Y++HYG M  A YDSF +  +SK  G   ++RKNL 
Sbjct  8     RWRLLSGEDNWKNLLDPLDIDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSHFSRKNLF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
                G    NP+KY +TK+ Y+ S I  +  +L++S   +   K+SNW+GY+AVATD+GKA
Sbjct  68    SRVGLAIANPYKYNITKFLYATSGIEVSEAFLLRSLSREAWNKESNWIGYIAVATDEGKA  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI++AWRGT++A EW+ +F+F  V A  +FG  ++  VHKG+  +YT+ +     
Sbjct  128   ALGRRDIVIAWRGTIQALEWVNDFEFPLVPADKLFGASNDSKVHKGWLSIYTSQDARSPF  187

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----DS  907
                SAR Q+  E+ +L+E+++DE++SIT+ GHSLG++L TLNA D++ N IN+       
Sbjct  188   NTNSARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDIIANQINRGKKQPQK  247

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
             P PVT FLF SP VG+RNF+   + + + L +LR  +  DIVP             P+  
Sbjct  248   PCPVTVFLFGSPHVGDRNFRKTFNSM-NELHLLRTRNKADIVPD-----------YPLTG  295

Query  1088  YEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
             Y  VG E   D  KS YL    GFK SWH+L  YLHGV G QG++GGF L    D+A +N
Sbjct  296   YAKVGEELIIDTRKSEYLKSPGGFK-SWHSLEAYLHGVAGTQGNEGGFTLEVKRDIARVN  354

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K ++ LK  Y  + P  W+  +N GMVQ  DG W LDDHE D+
Sbjct  355   KALNALKEEY--LVPESWWCAQNKGMVQDADGFWKLDDHETDE  395



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/406 (48%), Positives = 262/406 (65%), Gaps = 24/406 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             + WK+LSG  NWEGLLDPLD +LRR +I YG M  A YD+F +  ISK  G  RY +K+ 
Sbjct  11    KNWKNLSGQNNWEGLLDPLDINLRRSIIRYGEMAQASYDTFNSTNISKYAGSSRYTKKDF  70

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G   G P+KY VTK+ Y+ S I   + ++ +S   +   K+SN++GYVAVA D+  
Sbjct  71    FTKVGLAMGKPYKYRVTKFLYATSGIDLPSAFMFKSLSREAWSKESNFIGYVAVAEDESV  130

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ---DSNPLVHKGFYDMYTAVNP  730
             AALGRRDI+++WRGT+++ EW+ + QFL V A  I G+   + +P VH+G+Y +YT+ +P
Sbjct  131   AALGRRDIVISWRGTIQSLEWVNDLQFLQVSASSIVGKSDGNDDPKVHQGWYSVYTSDDP  190

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
                    SAR Q+ +E+  LVEQYKDEE+SIT+ GHSLG++LATLNA+D+V N  NK   
Sbjct  191   KSPFNKTSARYQVLQEIENLVEQYKDEEISITITGHSLGAALATLNAIDIVVNNKNKPKD  250

Query  911   IP-----VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
              P     VTA +FASP+VG+ NFK    K  DNLK+LR+ +  DIVP  P  G       
Sbjct  251   NPQKQCLVTAIIFASPRVGDSNFKKIFPKY-DNLKLLRVHNTLDIVPNYPLLG-------  302

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
                 Y  VG E   D +KS YL   G  ++WH +  YLHGV G QGS+ GFKL  D D+A
Sbjct  303   ----YSDVGQELLIDTTKSPYLKVPGTFSNWHNMEAYLHGVAGTQGSKNGFKLVVDRDIA  358

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             L+NK++D LK  Y  + P  W+ +KN GMVQQ DG+W+L D+E+ D
Sbjct  359   LVNKSMDNLKDEY--LIPVAWWSLKNKGMVQQSDGSWLLMDNEMSD  402



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 199/402 (50%), Positives = 262/402 (65%), Gaps = 19/402 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG  +W+ LLDPLD+DLRRY+IHYG M  A YDSF  +  SK  G   YA+ + 
Sbjct  24    KRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDSFNAQKASKYAGSSLYAKDDF  83

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               +   + GNPFKY VTK+ Y+ S ++    ++++S   +   K+SNW+G+VAVATD+GK
Sbjct  84    FSKVHLEKGNPFKYRVTKFLYATSQVQLPEAFIVKSLSREAWSKESNWIGFVAVATDEGK  143

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
               LGRRDI++AWRGT+R  EW+ +F+F FV A  I G+  +P VH+G+Y +YT+ +    
Sbjct  144   TTLGRRDIVIAWRGTIRTLEWVNDFEFNFVSASKILGESGDPKVHQGWYSIYTSDDSRSQ  203

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN---KDSP  910
                 SARDQ+  EVRRLV++Y +EE+SIT+ GHSLG+++ATLNAVD+V N  N   K+  
Sbjct  204   YNKNSARDQVLNEVRRLVDKYTNEEISITIVGHSLGAAVATLNAVDIVANGFNQSQKNKR  263

Query  911   IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISY  1090
              PVTA LFASP+VG+ NFK   S   D L+ LR+ + +D+VP             P+I Y
Sbjct  264   CPVTAMLFASPRVGDSNFKRVFSGYKD-LRALRIHNVRDVVP-----------NYPLIGY  311

Query  1091  EHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
               VG E   D +KS YL   G  +SWH L  YLHGV G QG +GGFKL  + D+ALLNK 
Sbjct  312   ADVGEELVIDTTKSKYLKSPGNLSSWHNLEGYLHGVAGTQGPKGGFKLEVNRDIALLNKT  371

Query  1265  IDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             ID LK  Y  + PA W V +N GMVQQ DG+W L D E D I
Sbjct  372   IDSLKDEY--LVPASWRVQENKGMVQQADGSWKLMDLEEDFI  411



>emb|CDP11819.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   365 bits (936),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 195/402 (49%), Positives = 253/402 (63%), Gaps = 22/402 (5%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ LSG  NW+ LLDPLD DLRRY+IHYG    A YD+F +E  SK  G   Y    L 
Sbjct  8     RWRLLSGQDNWKNLLDPLDIDLRRYIIHYGERAQATYDTFDHEKASKYAGSSLYKPDVLF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
             +  G    NPFKY+V KY Y+ S I     ++ +S   D+V K+SN+MGYVAVATD+GK 
Sbjct  68    KSVGLCKRNPFKYKVVKYLYATSKISVPDAFIEKSLSKDSVCKESNFMGYVAVATDEGKI  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDILVAWRGT+R  E  K+F F  V A +I G+D N  VHKG   +YT+ +P    
Sbjct  128   ALGRRDILVAWRGTIRNIELAKDFDFPLVPASMILGKDINAKVHKGVLSIYTSSDPQSTY  187

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP--  916
                SAR Q+ E ++ LVE++K EE+SIT+AGHSLG++L+T+NA D+V N  NK   +P  
Sbjct  188   NKQSARVQVLEAIKSLVEEFKKEEVSITIAGHSLGAALSTMNAADIVANGYNKTRGMPNK  247

Query  917   ---VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
                VTAF F SP+VG+ NF+NA   + D L +LR+ +  D+VP++PP           I 
Sbjct  248   SCMVTAFAFGSPRVGDSNFRNAFESMND-LHLLRVRNIPDLVPQVPP-----------IP  295

Query  1088  YEHVGMEFRFDASKSNYLD--GFKASWHTL-VTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
             Y  VG E   D+ KS YL   G    WH L   YLH V G QGS+GGF L    D++L+N
Sbjct  296   YADVGEELLIDSRKSPYLKRIGNLEIWHNLEAAYLHAVAGTQGSKGGFHLEVKRDISLVN  355

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             K +D +K  Y  + P  W+ +KN GMVQQDDG+W L+DH+ D
Sbjct  356   KILDAVKDEY--LIPTGWWCLKNKGMVQQDDGSWKLEDHDRD  395



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score =   364 bits (934),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 197/400 (49%), Positives = 258/400 (65%), Gaps = 19/400 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG  NW+ LLDPLD+DLR Y+IHYG M  A YDSF  +  SK  G   YA+   
Sbjct  7     KRWKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKASKYAGCSLYAKDEF  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                   + GNPFKY VTK+ Y+ S +  +  ++I+S   +   K+SNWMG+VAV+TD+GK
Sbjct  67    FNRVHLEKGNPFKYRVTKFVYATSQVHISEAFIIKSLSREAWSKESNWMGFVAVSTDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              ALGRRDI++AWRGTV+  EW+ +F+F  V A  I G+  NP VH+G+Y +YT+ +    
Sbjct  127   VALGRRDIVIAWRGTVQTLEWVNDFEFNLVSASKILGESGNPKVHQGWYSIYTSDDSRSP  186

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN---KDSP  910
                 SARDQ+  EV RLV+Q+K+EE+SIT+ GHSLG++LATLNAVD+V N  N   ++  
Sbjct  187   YNKNSARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDIVANGFNMSHENKG  246

Query  911   IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISY  1090
              PVTA LFASP+VG+ NFK   S   D LK +R+ +  D+VPK            P I Y
Sbjct  247   CPVTAMLFASPRVGDSNFKKVFSGYMD-LKAIRIHNFLDVVPK-----------YPFIGY  294

Query  1091  EHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
               VG E   D +KS YL   G  +SWH L  YLHGV G QG +GGF+L  + D+AL+NK 
Sbjct  295   ADVGEELIIDTTKSKYLKSPGNVSSWHNLEAYLHGVAGTQGFKGGFELVVNRDIALINKT  354

Query  1265  IDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             ID LK  Y  + P  W + +N GMVQ+ DG+W L+DHE D
Sbjct  355   IDGLKDEY--LVPVSWRIQENKGMVQEADGSWKLEDHEED  392



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 202/405 (50%), Positives = 260/405 (64%), Gaps = 26/405 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYA-RKN  376
             E+W++LSG  NW+GLL+PLD DLR+Y+I YG +  A+YD+FI E  SK  G  RY+  K 
Sbjct  3     EKWEELSGKNNWDGLLNPLDIDLRKYIIQYGELCQAIYDTFITETASKYAGASRYSMEKP  62

Query  377   LLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
                  G D   P KY VTKYFY+ S+I     ++ +S   +   K+SN+MGY+AVATD+G
Sbjct  63    FFTRFGLD---PNKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVATDEG  119

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS--NPLVHKGFYDMYTAVNP  730
             K +LGRRDI++ WRGT +  E+I + QFL V AP +FG      PLVH GFY++YT+ + 
Sbjct  120   KVSLGRRDIVINWRGTQQKLEFINDLQFLLVPAPKVFGDGGLLQPLVHNGFYNVYTSASS  179

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS-  907
                    SARDQ+ EEV+RLVE+YK EE+SIT+ GHSLG+SLATLNAVD+  N INK S 
Sbjct  180   RSQFNLTSARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFNGINKTSE  239

Query  908   --PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                 PVTAF FASPKVG+  FK A  K+  +L+IL++ +  DI PK PP G         
Sbjct  240   GKEFPVTAFPFASPKVGDLQFKAAFDKIK-SLRILKIHNLLDIFPKYPPIG---------  289

Query  1082  ISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
               Y  VG E   D +KS Y+   G   SWH L  YLHGV G QG   GFKL  + D++L+
Sbjct  290   --YFDVGQELMIDTTKSPYVRPPGEPFSWHLLEPYLHGVAGTQG-LAGFKLEVNRDISLV  346

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             NK  D LK  Y +  P  W+V KN GMVQQ+DG+W+L DH+  D 
Sbjct  347   NKQWDVLKDEYCI--PGFWWVEKNKGMVQQEDGSWLLLDHDEYDF  389



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score =   367 bits (941),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/403 (46%), Positives = 255/403 (63%), Gaps = 23/403 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ LSG  NW+ LLDPLD DLR+Y++HYG M  A YDSF +  +SK  G   ++RKNL 
Sbjct  89    RWRLLSGEDNWKSLLDPLDVDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSHFSRKNLF  148

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
                G    NP+KY +TK+ Y+ S I  +  +L++S   +   K+SNW+GY+AVATD+GKA
Sbjct  149   SRVGLSIANPYKYNITKFLYATSGIEVSEAFLLRSLSREAWNKESNWIGYIAVATDEGKA  208

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI++AWRGTV+A EW+ +F+F  V A  +FG  ++  VHKG+  +YT+ +     
Sbjct  209   ALGRRDIVIAWRGTVQALEWVNDFEFPLVPADKLFGAANDSKVHKGWLSIYTSQDARSPF  268

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----DS  907
                SAR Q+  E+ +L+E+++DE++SIT+ GHSLG++L TLNA D++ N INK       
Sbjct  269   NINSARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDIIANRINKGKKQPQK  328

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
             P PVTAFLF  P VG+RNF+   + + + L +LR  +  DIVP  P  G           
Sbjct  329   PCPVTAFLFGCPHVGDRNFRKTFNSM-NELHLLRTRNKADIVPDYPLTG-----------  376

Query  1088  YEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
             Y  VG E   D  KS YL    GFK SWH+L  YLHGV G QG++GGF L    D+A +N
Sbjct  377   YAKVGEELIIDTRKSEYLKSPGGFK-SWHSLEAYLHGVAGTQGNEGGFMLEVKRDIARVN  435

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K ++ LK  Y  + P  W+  +N GMVQ  DG W LDDHE ++
Sbjct  436   KALNALKEEY--LVPGSWWCAQNKGMVQDADGFWKLDDHETEE  476



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score =   363 bits (933),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 194/406 (48%), Positives = 258/406 (64%), Gaps = 23/406 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +R ++L+G  N +GL DPLD DLRR ++ YG M  A YD+FI E  S+  G CRYAR++ 
Sbjct  7     KRLRELNGRDNRKGLSDPLDIDLRRNILLYGEMAQATYDAFITEKKSRYAGDCRYARRDF  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               +          Y VTK+FY+ S+I     +LI+S   +   K+SNWMGYVAVATD+GK
Sbjct  67    FDKVATSTDQQSLYRVTKFFYATSSIDVPEAFLIKSLSREAWSKESNWMGYVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS--NPLVHKGFYDMYTAVNPD  733
               LGRRD++VAWRGTV+A EWI +  F  V A  I G+ S  NP VH+G+  +YT+ +P 
Sbjct  127   KVLGRRDVVVAWRGTVQALEWINDLDFTLVSASAILGKGSSGNPQVHRGWLSIYTSNDPR  186

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP-  910
                   SARDQ+  E+ RL+E+YKDEE SIT+ GHSLG++LATLNA D+ +N +NK +  
Sbjct  187   SPYNKDSARDQVLSEIGRLMEEYKDEETSITITGHSLGAALATLNAADIASNGLNKSNAH  246

Query  911   ----IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
                  PVTAF+FASP+VG+ +F+ A SK+ + L++LR+ +  D+VP  P  G        
Sbjct  247   PNKNSPVTAFVFASPRVGDSDFREAFSKIPE-LRLLRIRNVPDLVPNYPLLG--------  297

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
                Y+ VG+E   D  KS YL   G  +SWH L  YLHGV G +G + GFKL  D DVAL
Sbjct  298   ---YDDVGVELTIDTRKSQYLKSPGNLSSWHNLEAYLHGVAGTRGGKKGFKLEVDRDVAL  354

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             +NK++D LK  Y  + PA W V KN GMV+  DG W L DHE D +
Sbjct  355   VNKSMDALKDEY--LVPASWRVEKNKGMVKGADGHWRLMDHEEDSV  398



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score =   363 bits (933),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 195/405 (48%), Positives = 260/405 (64%), Gaps = 29/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E+W++LSG  NW+GLL+PLD DLR+Y+IHYG +  A YD+ I E  SK  G  RY+ +N 
Sbjct  6     EKWEELSGKNNWDGLLNPLDVDLRKYIIHYGELAHATYDTLIMERASKYAGASRYSMENF  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTK+FY+ ++I     ++++S   +   K+SN+MGY+AV+TD+GK
Sbjct  66    FTKVGLD---PNKYRVTKFFYATASIPLPDAFIVKSFSREAWSKESNFMGYIAVSTDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
             A+LGRRDI++ WRGT++  EW+ + QFL + AP IFG         PLVH GFY++YT+ 
Sbjct  123   ASLGRRDIVINWRGTIQKMEWVNDLQFLLIPAPKIFGDGGLLHLFKPLVHHGFYNVYTSA  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +        S RDQ+ +EV+RLVE+YK EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  183   SSRSQFNQTSVRDQVIKEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDITFNGINKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF FASPKVG+  FK A  KL  +L +LR+ +  DIVPK PP G       
Sbjct  243   SEGKEFPVTAFAFASPKVGDLQFKAAFDKL-KHLHVLRIHNLMDIVPKYPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHGV G QG     GFKL  + D
Sbjct  295   ----YFDVGKELMIDTTKSPYVKPPGEPLSWHLLEPYLHGVAGTQGLGIFAGFKLEVNRD  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK  + LK  Y +  P  W+V K  GMVQQ+DG+W++ D +
Sbjct  351   ISLVNKQWNILKDEYCI--PGRWWVEKCKGMVQQEDGSWLMLDRD  393



>ref|XP_010657149.1| PREDICTED: phospholipase A1-IIgamma-like [Vitis vinifera]
Length=407

 Score =   363 bits (933),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 192/415 (46%), Positives = 258/415 (62%), Gaps = 36/415 (9%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ LSG  +W+ LLDPLD DLR+Y+IHYG M  A YD+F  EP SK  G   Y+R+NL
Sbjct  7     KRWRTLSGQDDWKTLLDPLDIDLRQYIIHYGEMAQATYDTFNREPKSKFAGSSIYSRRNL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G    NP+ Y  TKY Y+ S I+  T ++++    D   KQSNW+G+VAVATD+GK
Sbjct  67    FSQVGLAKPNPYTYTPTKYLYATSEIKVPTAFILKPIPIDAWSKQSNWIGFVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNP---  730
              ALGRRDI+VAWRG+V+  EW+K+F F    A +I G+  NP  H+ +  +YT+ +P   
Sbjct  127   TALGRRDIVVAWRGSVQIVEWLKDFDFPLASASMIVGEKGNPYAHRCWVSIYTSHDPKSR  186

Query  731   -------DPILKGVSARDQIR--EEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLV  883
                    D ++ G+ A  Q+R   EV+RLV++YKDEE+SIT+ GHSLG++L TL A D+V
Sbjct  187   FNKQSARDQVIVGICAHKQMRFLSEVKRLVDKYKDEEISITITGHSLGAALGTLCAADIV  246

Query  884   TNPINK-----DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPP  1048
              N  NK         PVTAFLF SP+VG+ NF+N +  L +NL ++R+T+  DIV  LPP
Sbjct  247   ANKFNKPKNKPQKSCPVTAFLFGSPRVGDLNFRNMLLSL-ENLHLIRVTNVPDIVTTLPP  305

Query  1049  FGVKVNTTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGF  1222
              G           Y  VG E   D   SN+L   G   +WH+L  +LHGV G QGS+GGF
Sbjct  306   EGY----------YSEVGQELVIDTRFSNFLKFPGCYDTWHSLEAHLHGVAGTQGSKGGF  355

Query  1223  KLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L  D  +AL+NK +D LK  Y +  PA W+ ++N GM     G+W L DHE DD
Sbjct  356   HLEVDRSIALVNKMLDALKDEYPV--PASWWCMRNKGM----KGSWELKDHEKDD  404



>ref|XP_004505132.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Cicer arietinum]
Length=401

 Score =   362 bits (929),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 193/399 (48%), Positives = 257/399 (64%), Gaps = 22/399 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W++LSG   W+GLLDPL  DLR+YL+HYG +  + YD+F +E  SK  G C Y++K+L 
Sbjct  7     KWRELSGESKWKGLLDPLKIDLRKYLLHYGQLAQSTYDAFNSEKASKYAGNCLYSKKDLF  66

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQS-QRPDTVLKQSNWMGYVAVATDDGK  559
              +   + GNPFKY +TK+ Y+ S    + ++L++S    D    +SNW+GYVAVATD+GK
Sbjct  67    SKVNLEKGNPFKYSITKFIYATSKASDSESFLLRSILSKDAWSMESNWIGYVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              +LGRRDI+VAWRGT++ +EWIK+F F    APLIFG  S   +H GFY +YT+ NP   
Sbjct  127   VSLGRRDIVVAWRGTIQGSEWIKDFHFHLDSAPLIFGLQSPVQIHNGFYSLYTSDNPGFQ  186

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP-  910
                 SAR+Q+  E+ RLVEQYK+EE+SIT+ GHSLG++LA +N+VD+V N  N  K+ P 
Sbjct  187   SANSSARNQVLSEISRLVEQYKNEEISITITGHSLGAALAVINSVDIVANKFNISKEQPQ  246

Query  911   --IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVT F FASP+VG  +F N  S   D L  L + +  DIVP +  F          +
Sbjct  247   KSCPVTTFAFASPRVGNSSFGNIFSNYKD-LNALLIRNQTDIVP-ISLF----------L  294

Query  1085  SYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
              Y  VG E   D  KS YL    +S H L  YLHGV G QGS+GGF L  + D+AL+NK+
Sbjct  295   GYSEVGEELLIDTKKSKYLKSGVSS-HNLEVYLHGVAGTQGSKGGFNLEVNRDIALVNKS  353

Query  1265  IDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTW-ILDDHE  1378
              D LK  Y +  P  W VV+N GMVQQ DGTW ++DD+E
Sbjct  354   NDGLKDEYRV--PNAWRVVENKGMVQQFDGTWKLMDDNE  390



>ref|XP_004232955.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Solanum lycopersicum]
Length=408

 Score =   362 bits (928),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 204/399 (51%), Positives = 259/399 (65%), Gaps = 29/399 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW+ LSG  NWEGLLDPLD DLRRYLIHYG M  A+ DSF NE +SK  G  RY++KNL
Sbjct  34    ERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNNEKVSKYRGTSRYSKKNL  93

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G D  NP  YE+TKY Y+ S+    T             K+SNW+G+VAVATD+GK
Sbjct  94    FTRVGLDK-NP--YEITKYVYAASSKTEET-------------KESNWIGFVAVATDEGK  137

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD-SNPLVHKGFYDMYTAVNPDP  736
              ALGRRDIL+AWRGT   +E  ++ ++  V+   IFG++  N LVHKGFY +YT +N   
Sbjct  138   VALGRRDILIAWRGTKTKSEMNEDDKWSLVQPSKIFGENRDNILVHKGFYSVYTCLNEAS  197

Query  737   IL-KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
                +  SARDQ+ EE++RL++QY  EE+SI++ G S+GSSL TL A+D+V N INK+   
Sbjct  198   NFNRTTSARDQVLEEIKRLLKQYSKEEISISVTGQSMGSSLGTLCAIDIVVNEINKE--F  255

Query  914   PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFG-VKVNTTLPIISY  1090
             PVTAFLF+SP+VGE NFK A   L  NL ILR+T+  D +PKL   G V+        +Y
Sbjct  256   PVTAFLFSSPRVGEANFKKAYRNLK-NLHILRITNVPDPIPKLMERGQVEGCAITEWRAY  314

Query  1091  EHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
             E VG E   D +KS YL  D F    H L  YLHG+ G  G +G FKL  + D+AL+NK 
Sbjct  315   EDVGFELVIDTTKSEYLKKDIFS---HFLEVYLHGIAGTHGVEGEFKLEINRDIALVNKQ  371

Query  1265  IDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEV  1381
              D LK  Y +  P+ W++ KN GMVQQ+DG+WIL DHE 
Sbjct  372   GDFLKEEYGV--PSAWWIEKNKGMVQQEDGSWILIDHET  408



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score =   362 bits (930),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 193/412 (47%), Positives = 263/412 (64%), Gaps = 29/412 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             + WK+LSG  NW+GLL PLD DLRRY+IHYG M  + YD+F +  +SK  G   Y++K+ 
Sbjct  27    KEWKELSGENNWDGLLSPLDMDLRRYVIHYGEMSQSTYDTFNSSKLSKYGGSSIYSKKDF  86

Query  380   LRESGHDNGN--PFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDD  553
               + G   GN  P+KY VTKY Y+ S I     ++++S   +   K+SN++GYVAVA D 
Sbjct  87    FSKVGLVKGNNDPYKYRVTKYLYATSGIDVPDAFILKSSSREAWSKESNFIGYVAVAEDT  146

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG-------QDSNPLVHKGFYDM  712
               A+LGRRDI++AWRG++++ EW+ N QFL V A  + G         +   VH+G+Y +
Sbjct  147   AVASLGRRDIVIAWRGSIQSLEWVNNLQFLQVSASDVVGDGDVADHDKAKAKVHQGWYSI  206

Query  713   YTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNP  892
             YT+ +P       SARDQ+  E++ L+EQYK+EE+SIT+ GHS+G++LATLNAVDLV N 
Sbjct  207   YTSDDPRSPFNKTSARDQVLLEIQSLMEQYKNEEISITITGHSMGAALATLNAVDLVANN  266

Query  893   IN-----KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGV  1057
             IN       +P  VTA LFASP+VG+ NFKN +SK   +LK+LR+ +A D+V   PP G 
Sbjct  267   INIPKSSPKNPCLVTAILFASPRVGDFNFKNIISKYDHSLKLLRVCNALDVVLHYPPIG-  325

Query  1058  KVNTTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLH  1231
                       Y HVG E   D  +S YL   G   +WH    YLHG+ G QGS+  FKL 
Sbjct  326   ----------YCHVGKELSIDTIRSPYLKFPGNFWTWHNSEAYLHGIAGGQGSEEEFKLV  375

Query  1232  GDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              D D++LLNK+ D LK  Y  + PA W+ ++N GMVQQ DG+W+L DHE+DD
Sbjct  376   VDRDLSLLNKHWDNLKDEY--LIPAFWWTLRNKGMVQQSDGSWLLMDHEMDD  425



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   361 bits (926),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 194/403 (48%), Positives = 254/403 (63%), Gaps = 22/403 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ L G  +W+GLLDPLD DLRR L+ YG M  AVYD FI +  S+  G   YAR N+
Sbjct  7     KRWRVLQGKDSWKGLLDPLDVDLRRSLVLYGEMAQAVYDGFIRQKKSRFAGAPLYARSNI  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L++     G    Y VTK+FY+ S ++    ++I+S       K SNWMGYVAVATD+G 
Sbjct  67    LQKVALSQGQERLYRVTKFFYATSGVQVPDAFIIKSLSRQAWSKDSNWMGYVAVATDEGA  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRD+LVAWRGT+   EWI +  F  V AP + G  S+PLVH+G+  +YT+ +P   
Sbjct  127   AQLGRRDVLVAWRGTLLPLEWINDLDFTMVPAPEVLGS-SSPLVHRGWLSIYTSEDPKSP  185

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS----  907
                 SAR+Q+ +EV RL+E+YKDEE SIT+ GHSLG+++ATLNAVD+V N  N+ S    
Sbjct  186   YSKSSARNQVLKEVGRLIEEYKDEETSITITGHSLGAAVATLNAVDIVANSFNRSSNPSS  245

Query  908   -PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTAF+FASP+VG+  F+   S   D L++LR+ +A D+VP             PII
Sbjct  246   TGCPVTAFVFASPRVGDFEFQKLFSGTPD-LRLLRVRNAPDLVP-----------NYPII  293

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG+E   D  KS YL   G   +WH L  YLHG  G QG +GGFKL  D DVAL+N
Sbjct  294   PYVDVGVELAIDTRKSEYLKAPGDLTTWHNLECYLHGTAGAQGRRGGFKLAIDRDVALVN  353

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             K+ D LK  Y  + P  W+V KN GM++  DG + L+DHE D+
Sbjct  354   KSTDALKDEY--LVPDSWWVEKNKGMMKGADGHYKLEDHEEDN  394



>emb|CBI21954.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   360 bits (925),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 190/404 (47%), Positives = 253/404 (63%), Gaps = 25/404 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ LSG  +W+ LLDPLD DLR+Y+IHYG M  A YD+F  EP SK  G   Y+R+NL
Sbjct  7     KRWRTLSGQDDWKTLLDPLDIDLRQYIIHYGEMAQATYDTFNREPKSKFAGSSIYSRRNL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G    NP+ Y  TKY Y+ S I+  T ++++    D   KQSNW+G+VAVATD+GK
Sbjct  67    FSQVGLAKPNPYTYTPTKYLYATSEIKVPTAFILKPIPIDAWSKQSNWIGFVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              ALGRRDI+VAWRG+V+  EW+K+F F    A +I G+  NP  H+ +  +YT+ +P   
Sbjct  127   TALGRRDIVVAWRGSVQIVEWLKDFDFPLASASMIVGEKGNPYAHRCWVSIYTSHDPKSR  186

Query  740   LKGVSARDQIREEV-RRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----  901
                 SARDQ+   +  RLV++YKDEE+SIT+ GHSLG++L TL A D+V N  NK     
Sbjct  187   FNKQSARDQVYIYIPTRLVDKYKDEEISITITGHSLGAALGTLCAADIVANKFNKPKNKP  246

Query  902   DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                 PVTAFLF SP+VG+ NF+N +  L +NL ++R+T+  DIV  LPP G         
Sbjct  247   QKSCPVTAFLFGSPRVGDLNFRNMLLSL-ENLHLIRVTNVPDIVTTLPPEGY--------  297

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
               Y  VG E   D   SN+L   G   +WH+L  +LHGV G QGS+GGF L  D  +AL+
Sbjct  298   --YSEVGQELVIDTRFSNFLKFPGCYDTWHSLEAHLHGVAGTQGSKGGFHLEVDRSIALV  355

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             NK +D LK  Y +  PA W+ ++N GM     G+W L DHE DD
Sbjct  356   NKMLDALKDEYPV--PASWWCMRNKGM----KGSWELKDHEKDD  393



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score =   361 bits (926),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 196/403 (49%), Positives = 254/403 (63%), Gaps = 24/403 (6%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             W+DLSG  NW+GLL PLD DLR+Y+IHYG M  A YD+F +   SK  G   Y+R++   
Sbjct  9     WRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSIYSRQDFFS  68

Query  386   ESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
             + G +  NP+ KY+VTK+ Y+ S I    ++L+     +   K+SNWMGYVAV TD+G  
Sbjct  69    KVGLEKNNPYSKYQVTKFLYATSQIEVPDSFLVFPVSREGRTKESNWMGYVAVTTDEGTE  128

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPDPI  739
              LGRRDI+VAWRG+++  EWI +F F+ V A  IFG+ S  + VH+G+Y +YT+ +    
Sbjct  129   LLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGVQVHQGWYSIYTSSDERSP  188

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----D  904
                 SARDQ+ +EVRRLVE+YKDEE+SIT+ GHSLG++LATLNA D+V N  N      D
Sbjct  189   FNKSSARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAADIVANGYNATQNRPD  248

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
              P  VTAF+FASP+VG  +FK   S    +L+ LR+ +  DIVP  PP G          
Sbjct  249   KPCLVTAFVFASPRVGNPDFKKLFSGYK-SLRGLRVRNLPDIVPTYPPLG----------  297

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG-FKLHGDFDVALL  1255
              Y  VG E   D  KS YL   G   S+H L   LHGV G QG+    FKL    D++L+
Sbjct  298   -YSDVGEELTIDTRKSPYLKTPGDLVSFHNLEANLHGVAGTQGTTTKEFKLQVKRDISLI  356

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             NK+ID LK  Y  M P  W V+KN GMVQQDDG+W L DHE+D
Sbjct  357   NKSIDALKDEY--MVPGSWRVLKNKGMVQQDDGSWKLMDHEMD  397



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   359 bits (922),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 207/408 (51%), Positives = 262/408 (64%), Gaps = 29/408 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E W+ LSG  NWEGLL PLD DLR+Y+I YG +  A YD+FI E  SK  G  RY+ ++L
Sbjct  6     ENWEQLSGKNNWEGLLRPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSMESL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTK+FY+ ++I     ++++S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FTKVGLD---PLKYRVTKFFYATASIPLPDAFIVKSLSREAWSKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              ALGRRDI+V WRGT++  EW+ + QFL V  P +FG         PLVH GFY++YT  
Sbjct  123   VALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLSLLQPLVHHGFYNIYTTE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +P      VSARDQ+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  183   DPRSQFNQVSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKT  242

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF  A SKL +NL ILR+ +  DIVPK PP G       
Sbjct  243   SEGKEFPVTAFVFASPKVGDLNFHKAFSKL-NNLHILRIHNVLDIVPKYPPIG-------  294

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHGV G QG     GFKL  + D
Sbjct  295   ----YIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKLEVNRD  350

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             ++L+NK  D LK  Y +  P  W+  K+ GMVQQ DG+W+L D E  D
Sbjct  351   ISLVNKQWDILKDEYCI--PGLWWADKHKGMVQQQDGSWLLLDREEYD  396



>ref|XP_003528482.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31003.1| Phospholipase A1-IIgamma [Glycine soja]
Length=408

 Score =   359 bits (922),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 197/408 (48%), Positives = 255/408 (63%), Gaps = 19/408 (5%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W+DLSG  NW+GLLDPLD+DLRRY+IHYG +  A YD+F  E  SK  G  RYA  +  
Sbjct  7     KWRDLSGQSNWKGLLDPLDTDLRRYIIHYGQLAQAAYDAFNTEKASKCAGNSRYAMSDFF  66

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G +NGN FKY VTK+ Y+      + +++++S   D   ++SNW+GYVAVATD+GKA
Sbjct  67    SKVGLENGNCFKYVVTKFLYATCKAGASESFILKSFNKDAWSQESNWIGYVAVATDEGKA  126

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI+VAWRGT+ AAEW+++  F    APLIF  D+   VH GFY +YT+  P    
Sbjct  127   ALGRRDIVVAWRGTINAAEWVQDLHFHLDSAPLIF-DDARAKVHHGFYSVYTSNKPGSEF  185

Query  743   KGVSARDQIREEVRRLVEQY--KDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP  910
                  R Q+ EEVRRLVE+Y  K+EE+SIT+ GHSLG++LAT+NAVD+V   +N  KD P
Sbjct  186   NDTCVRHQVLEEVRRLVEEYNRKNEEISITVIGHSLGAALATINAVDIVAKGLNIPKDQP  245

Query  911   ---IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                  VT F+FASP+VG  +F    +    +L+ LR+ +  D+VPKLP     +     +
Sbjct  246   EKACSVTTFVFASPRVGNSHFAKIFTG-HKHLRALRIRNETDVVPKLP-----LKHLFFL  299

Query  1082  ISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGG-FKLHGDF-DVALL  1255
               +  VG E   D +KS YL   + S H L  YLHGV G QG  G  F L     D+ALL
Sbjct  300   DGFSDVGEELVIDTTKSKYLKK-EVSAHNLEVYLHGVAGTQGKNGEIFDLDESLRDIALL  358

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI*YL  1399
             NK+ D LK  Y    P  W V +N GMVQQ DGTW L DH  D I +L
Sbjct  359   NKSKDALKDEYH--CPVAWRVHENKGMVQQKDGTWKLMDHNKDGILFL  404



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score =   359 bits (922),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 195/402 (49%), Positives = 261/402 (65%), Gaps = 19/402 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG  +W+ LLDPLD+DLRRY+IHYG M  A YD F  +  SK  G   YA+ + 
Sbjct  24    KRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDGFNAQKASKYAGSSLYAKDDF  83

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               +   + GNPFKY VTK+ Y+ S ++    ++++S   +   K+SNW+G+VAVATD+GK
Sbjct  84    FTKVHLEKGNPFKYRVTKFLYATSQVQLPEAFIVKSLSREAWSKESNWIGFVAVATDEGK  143

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
               LGRRDI++AWRGT++  EW+ +F+F FV A  I G+  +P VH+G+Y +YT+ +    
Sbjct  144   TTLGRRDIVIAWRGTIQTLEWVNDFEFNFVSASKILGESGDPKVHQGWYSIYTSDDSRSP  203

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN---KDSP  910
                 SARDQ+  E+RRLV++Y +EE+SIT+ GHSLG+++ATLNAVD+V N  N   K+  
Sbjct  204   YNKNSARDQVLNEIRRLVDKYTNEEISITIVGHSLGAAVATLNAVDIVANGFNQSQKNKR  263

Query  911   IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISY  1090
              PVTA LFASP+VG+ NFK   S   D L+ LR+ +  D+VP           + P+I Y
Sbjct  264   CPVTAILFASPRVGDSNFKKVFSGYKD-LRALRIHNVLDVVP-----------SYPLIGY  311

Query  1091  EHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
               VG E   D +KS YL   G  +SWH L  YLHGV G QG +GGFKL  + D+AL+NK 
Sbjct  312   ADVGEELVIDTTKSKYLKSPGNLSSWHNLEGYLHGVAGTQGPKGGFKLEVNRDIALVNKT  371

Query  1265  IDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             ID LK  Y  + PA W V +N GMVQQ DG+W L D E D I
Sbjct  372   IDSLKDEY--LVPASWRVQENKGMVQQADGSWKLMDVEEDFI  411



>ref|XP_010316799.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Solanum lycopersicum]
Length=410

 Score =   357 bits (916),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 204/401 (51%), Positives = 259/401 (65%), Gaps = 31/401 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW+ LSG  NWEGLLDPLD DLRRYLIHYG M  A+ DSF NE +SK  G  RY++KNL
Sbjct  34    ERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNNEKVSKYRGTSRYSKKNL  93

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G D  NP  YE+TKY Y+ S+    T             K+SNW+G+VAVATD+GK
Sbjct  94    FTRVGLDK-NP--YEITKYVYAASSKTEET-------------KESNWIGFVAVATDEGK  137

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD-SNPLVHKGFYDMYTAVNPDP  736
              ALGRRDIL+AWRGT   +E  ++ ++  V+   IFG++  N LVHKGFY +YT +N   
Sbjct  138   VALGRRDILIAWRGTKTKSEMNEDDKWSLVQPSKIFGENRDNILVHKGFYSVYTCLNEAS  197

Query  737   IL-KGVSARD--QIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS  907
                +  SARD  Q+ EE++RL++QY  EE+SI++ G S+GSSL TL A+D+V N INK+ 
Sbjct  198   NFNRTTSARDQRQVLEEIKRLLKQYSKEEISISVTGQSMGSSLGTLCAIDIVVNEINKE-  256

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFG-VKVNTTLPII  1084
               PVTAFLF+SP+VGE NFK A   L  NL ILR+T+  D +PKL   G V+        
Sbjct  257   -FPVTAFLFSSPRVGEANFKKAYRNLK-NLHILRITNVPDPIPKLMERGQVEGCAITEWR  314

Query  1085  SYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
             +YE VG E   D +KS YL  D F    H L  YLHG+ G  G +G FKL  + D+AL+N
Sbjct  315   AYEDVGFELVIDTTKSEYLKKDIFS---HFLEVYLHGIAGTHGVEGEFKLEINRDIALVN  371

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEV  1381
             K  D LK  Y +  P+ W++ KN GMVQQ+DG+WIL DHE 
Sbjct  372   KQGDFLKEEYGV--PSAWWIEKNKGMVQQEDGSWILIDHET  410



>ref|XP_007025432.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY28054.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=406

 Score =   355 bits (912),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 192/404 (48%), Positives = 256/404 (63%), Gaps = 30/404 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW++LSG  NWEGLLDPLD DLR+Y+IHYG    AV D+F  E  SK VG  RY+ ++ 
Sbjct  16    QRWRELSGENNWEGLLDPLDKDLRKYIIHYGERTQAVMDAFNGEKASKWVGFSRYSTEDF  75

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G + GNP+KY+VTK+FY+ S I+    +            +SNW+GYVAV TD+GK
Sbjct  76    FSKVGLEMGNPYKYKVTKFFYARSEIQILDWF---------AAVESNWIGYVAVTTDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             A LGRRDIL+ WRGT+R  E I + +   V A  I G + +P VH G++ +YTA +   +
Sbjct  127   AVLGRRDILICWRGTMRNLEVINDIKADLVSAADILGDNGDPKVHHGWHSIYTAKDSKSV  186

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP-  916
                 SAR+Q+  EVRRLV+ Y+DEE+SITL GHSLG ++ATLNAVD++ N  NK +  P 
Sbjct  187   YNQASAREQVLSEVRRLVDLYQDEEISITLTGHSLGGAVATLNAVDIIANGYNKSTTKPD  246

Query  917   ----VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                 VTAF+FASP+VG+  FK   S L  NL +LR+ +  D+V         +   LP++
Sbjct  247   KEYLVTAFVFASPRVGDSGFKKVFSGLK-NLHVLRIKNELDMV-------PSLPIPLPLL  298

Query  1085  SYEHVGMEFRFDASKSNYLDGF------KASWHTLVTYLHGVDGFQGSQGGFKLHGDFDV  1246
              Y HVG +   D+ KS Y+             H L  YLHGV G QG++G FKL  + D+
Sbjct  299   HYTHVGEKLLIDSHKSPYMKSHLDISENLVIAHQLEPYLHGVAGSQGAKGEFKLEVNRDI  358

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ALLNK++D LK  Y +  P EW++ KN GM QQDDG+WILDDHE
Sbjct  359   ALLNKSLDALKDEYKV--PVEWWIEKNKGMAQQDDGSWILDDHE  400



>gb|EPS70940.1| hypothetical protein M569_03817 [Genlisea aurea]
Length=397

 Score =   354 bits (908),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 256/403 (64%), Gaps = 26/403 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG  NW  LLDPLD DL++Y+IHYG+M  A YD+F ++P+S+N G   +++ N+
Sbjct  10    QRWKSLSGDGNWRSLLDPLDVDLQQYIIHYGAMAQATYDNFNSDPVSRNAGCNIHSKSNM  69

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G D GNPFKY VTKY Y+ S+I    ++L +S       K+SNW+GYVAVATD+GK
Sbjct  70    FSSVGLDKGNPFKYRVTKYIYATSSIALPLSFLCKSLSEKAWSKESNWIGYVAVATDEGK  129

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              ALGRRD++VAWRGT+   EW+ + +F  V A  +FG+     VH+GF  +YT+ N    
Sbjct  130   VALGRRDVVVAWRGTIMPMEWVNDLEFPLVPASELFGESGVANVHQGFLSLYTSTNESVS  189

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP---  910
             +   SARDQ+  EVR+ V+ ++DEE+SIT+ GHSLG SL+TLNA+D+  N +NK S    
Sbjct  190   VSRTSARDQVLSEVRKQVDLHQDEEISITVVGHSLGGSLSTLNAMDITYNGVNKPSSREK  249

Query  911   -IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
               PV AF FA P+ G+ NF++ +  L D L ILR+++A DIVP++PPF            
Sbjct  250   GCPVAAFAFACPRSGDINFRSVMRSLHD-LHILRISNATDIVPRIPPF-----------L  297

Query  1088  YEHVGMEFRFDASKSNYLDGFK--ASWHTL-VTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
             Y  VG+E   D++KS +L  F   ++ H L V YLH +    G +   +     D+AL N
Sbjct  298   YVDVGVELTVDSTKSKFLKVFSDFSNHHNLEVAYLHPLAIANGDEDIRR-----DIALAN  352

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             KN D L+  Y  +    W+  +N GMVQQ+DG+W L+DHE DD
Sbjct  353   KNSDALRSKY--LIKTNWWCQQNHGMVQQEDGSWKLEDHEHDD  393



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score =   355 bits (911),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/405 (46%), Positives = 253/405 (62%), Gaps = 23/405 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W GLL+PLD DLR+Y++HYG MV A YD+F +   S+  G   Y+R++ 
Sbjct  43    QRWRDLSGQSHWNGLLEPLDLDLRQYIVHYGEMVQAAYDTFNSCTESQYAGSSIYSRQDF  102

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G  NGNP+ KY+VTK+ Y+ S  R    +++         KQSNW+GYVAVAT+DG
Sbjct  103   FSKVGIVNGNPYCKYQVTKFLYATSEARMPGAFMVFPASGQGWTKQSNWIGYVAVATNDG  162

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+VAWRGT+   EWI +F F  V    IF   S P+ VH+G+  +YT+ +  
Sbjct  163   TAVLGRRDIVVAWRGTIETTEWIDDFDFGLVDGSKIFAGKSKPIKVHRGWLSIYTSYDTR  222

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                  + ARDQ+ +E+ RLVE YKDE++SIT+ GHSLG++LATL+A D+V N  NK    
Sbjct  223   SKFNKICARDQLLQEISRLVELYKDEDISITVCGHSLGAALATLSATDIVFNGYNKPKGR  282

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF FA P+VG  +FKN  S L DNL+ LR  +  D+V              P
Sbjct  283   PDKACPVTAFPFACPRVGASDFKNLFSGL-DNLRALRTKNLPDVV-----------CAYP  330

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
             ++ Y  VG E   D  KS YL   G   ++H++  Y+HGV G  G++G F+L  + D++L
Sbjct  331   MVGYSDVGDELAIDTRKSPYLKSPGNVTTFHSMEHYMHGVAGTHGTKGEFRLEINRDISL  390

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             +NKN D LK  +  M P  W V+KN GMVQQ DG+W L DHE DD
Sbjct  391   VNKNTDSLKDEH--MVPDHWRVLKNKGMVQQGDGSWKLMDHEPDD  433



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 248/401 (62%), Gaps = 21/401 (5%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             W++LSG   W+GLL+PL  DLRRYL+HYG    A YD F  E  SK  G CRY++K+   
Sbjct  8     WRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRYSKKDFFS  67

Query  386   ESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQ-RPDTVLKQSNWMGYVAVATDDGKA  562
             +   + GNPFKY VTKY Y+ S  R +  +L+ S    D    ++NWMGYVAVATD+ K 
Sbjct  68    KVYLEKGNPFKYSVTKYLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAVATDEAKE  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI+VAWRGT++ AEW++NF      APLIFG  S+  +H GFY +YT+ N    L
Sbjct  128   ALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNGFYSLYTSDNSSLPL  187

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP--  910
                SAR Q+  E+ RLVE YK+EE+SIT+ GHSLG +LAT++++D+V N  N  K  P  
Sbjct  188   ADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDIVANKFNIPKGQPQK  247

Query  911   -IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
               PVT F F SP+VG  NF+   S   D L+ L + +  DIVP          ++L  ++
Sbjct  248   TCPVTLFAFGSPRVGNSNFEKIFSDNND-LRALFIRNNNDIVP----------SSLR-LA  295

Query  1088  YEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
             Y  VG E   D  KS YL     S H +  YLHG+ G QGS+GGF L  + D+ALLNK+ 
Sbjct  296   YSKVGEELEIDTEKSKYLKS-GVSEHNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSN  354

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             D LK  Y +  P  W VV+N GMVQQ DGTW L D   DD+
Sbjct  355   DGLKDEYHI--PENWRVVENKGMVQQSDGTWKLMDDHNDDV  393



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score =   354 bits (909),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 187/405 (46%), Positives = 256/405 (63%), Gaps = 23/405 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+  L+PLD +LR+Y+IHYG M  A YD+F     SK  G   Y+R++ 
Sbjct  29    KRWRDLSGRNHWKDALEPLDLELRQYIIHYGEMAQATYDTFNANTKSKYAGSSIYSRQDF  88

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G + G+P+ KY+VTK+ YS S I    ++L+     +   K+SNW+GYVAVATD G
Sbjct  89    FSKVGLEKGHPYCKYQVTKFLYSTSQISVPDSFLVFPVSREGWTKESNWIGYVAVATDQG  148

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
             K  LGRRDI+VAWRGT++  EWI +F F  + A  IFG + + + VH+G+Y +YT+ +  
Sbjct  149   KQVLGRRDIVVAWRGTIQTLEWINDFDFGTINAKKIFGDNGDGVGVHQGWYSIYTSEDER  208

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   SARDQ+  E+RRLVE+YKDEE+SIT+ GHSLG++L+TL+A D+V N  N+    
Sbjct  209   SPFNKASARDQVLREIRRLVEKYKDEEISITICGHSLGAALSTLSAADIVANGYNRPKNL  268

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVT F FASP+VG+ +FK   S L D+L+ LR+ +  D+VP  PP G        
Sbjct  269   PDKSCPVTVFAFASPRVGDSDFKRLFSGL-DDLRALRIRNLPDVVPIYPPIG--------  319

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
                Y  VG E   D  KS YL   G    +HT+  YLHG+ G +G++  FKL  + D+AL
Sbjct  320   ---YSEVGEELVMDTRKSPYLKSPGNPTLFHTMEVYLHGIAGTRGTKSDFKLEIERDIAL  376

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             +NK ID LK  +  M P  W  +KN GM QQ+DG+W L DHE DD
Sbjct  377   VNKPIDGLKDEF--MVPGSWRALKNKGMAQQNDGSWKLMDHETDD  419



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/407 (45%), Positives = 256/407 (63%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+GLL PLD DLR+Y+IHYG M  A YD+F     SK  G   Y+RK+ 
Sbjct  37    KRWRDLSGQNHWKGLLQPLDQDLRQYIIHYGEMAQAGYDTFNINTESKYAGASIYSRKDF  96

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ Y+ S I     +L+     +   K+SNWMGYVAV  D G
Sbjct  97    FAKVGLEKAHPYTKYKVTKFLYATSEIHVPEAFLLFPVSREGWSKESNWMGYVAVTDDQG  156

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI++AWRG+V+  EW+ +F F  V A  IFG+  N + +H+G++ +Y + +  
Sbjct  157   TAVLGRRDIVIAWRGSVQPLEWVSDFDFSLVNAKKIFGEKYNQVQIHQGWHSIYMSEDER  216

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +ARDQ+ +E+ RL+E+YKDEE+SI++ GHSLG++LATLNA D+V N  N+    
Sbjct  217   SHFNKANARDQVLQELGRLLEKYKDEEVSISICGHSLGAALATLNATDIVANGYNRPKSR  276

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
                  PVTAF+FASP+VG   +K   S L D +++LR+ +  D+VP  PP G        
Sbjct  277   LGKSCPVTAFVFASPRVGNSEYKKLFSGLED-IRVLRVRNLPDVVPIYPPLG--------  327

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG EF  D  KS Y+   G  A++H L +YLHGV G QG+     F+L    D+
Sbjct  328   ---YAEVGDEFPIDTRKSQYMKTPGNFATFHCLESYLHGVAGTQGTSSADLFRLDVKRDI  384

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK  Y  M P  W V+KN GMVQQDDG+W+L DHE+DD
Sbjct  385   GLVNKSVDGLKDQY--MIPGHWRVLKNKGMVQQDDGSWVLLDHEIDD  429



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 187/407 (46%), Positives = 257/407 (63%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+G+L PLD DLR Y+IHYG M  A YD+F     SK  G   Y+RK+ 
Sbjct  37    KRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDF  96

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ Y+ S +    ++L+     +   K+SNWMGYVAV  D G
Sbjct  97    FAKVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQG  156

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+VAWRG+V+  EW+ +F+F  V A  IFG+ ++ + +H+G+Y +Y + +  
Sbjct  157   TALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIYMSQDER  216

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                  V+ARDQ+  EV RL+++YKDEE+SIT+ GHSLG++LATLNA D+V N  N+    
Sbjct  217   SPFTKVNARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIVANGYNRPKSR  276

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +FK   S L D L++LR  +  D++P  PP G        
Sbjct  277   PDKSFPVTAFVFASPRVGDSDFKKLFSGLED-LRVLRTRNLPDVIPIYPPIG--------  327

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG E   D  KS Y+   G  A++H L  YLHGV G QG+     F+L    DV
Sbjct  328   ---YSEVGDEIPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADLFRLDVKRDV  384

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D L  N   M P +W V+KN GMVQQDDG+W L DHE+DD
Sbjct  385   GLVNKSVDGL--NVECMVPGKWRVLKNKGMVQQDDGSWKLLDHEIDD  429



>sp|B9EYD3.2|PLA4_ORYSJ RecName: Full=Phospholipase A1-II 4 [Oryza sativa Japonica Group]
Length=396

 Score =   349 bits (895),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 181/401 (45%), Positives = 249/401 (62%), Gaps = 25/401 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW++L G  +W+GLLDPLD+DLRR +I YG +  A  D+FI E  S + G CRY+R   
Sbjct  11    ERWRELHGEDHWKGLLDPLDADLRRSVIGYGELAQATNDAFIREAWSPHAGACRYSRDRF  70

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L ++         YEVT +FY+ +         +   R      +SNWMGYVAVATD G 
Sbjct  71    LEKAQASTQLAGLYEVTAFFYATAGAGGVPAPFMVRNR------ESNWMGYVAVATDAGV  124

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG---QDSNPLVHKGFYDMYTAVNP  730
             AALGRRD++VAWRGTVR  EW+ +  F  V A  + G   +   P VH+G+  +YTA +P
Sbjct  125   AALGRRDVVVAWRGTVRPMEWLNDLDFTLVSAAGVLGAGGRSPAPRVHRGWLSIYTASDP  184

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
                   +SAR+QI +E++RL+++YKDEE SIT+ GHSLG+++ATLNA D+V+N +N+   
Sbjct  185   ASKYSKLSAREQISDEIKRLMDKYKDEETSITVVGHSLGAAVATLNAADIVSNGLNQHGA  244

Query  911   IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISY  1090
              PVTA  FA P+VG+  F+    +L   L++LR+ ++ D+VPK PP G           Y
Sbjct  245   CPVTAVAFACPRVGDSGFRKLFDELP-GLRLLRVCNSPDVVPKYPPMG-----------Y  292

Query  1091  EHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
               VG+E   D  +S YL   G +A WH+L  Y+HGV G QG +GGFKL  D DVAL+NKN
Sbjct  293   ADVGVELPVDTRRSPYLKSPGNQAVWHSLECYMHGVAGAQGKRGGFKLEVDRDVALVNKN  352

Query  1265  IDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             +D LK  Y +  P  W V ++ GMV+  DG W L D+E ++
Sbjct  353   VDALKEEYHV--PPSWSVQRDKGMVRGADGHWKLMDYEGEE  391



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score =   349 bits (895),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 186/402 (46%), Positives = 254/402 (63%), Gaps = 19/402 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG + WEGLLDPLD DLRRYLIHYG M  A YD+FI E +SK  G  RY+ KNL
Sbjct  8     KRWKLLSGQQKWEGLLDPLDLDLRRYLIHYGEMAQATYDTFIMEKVSKYAGDSRYSMKNL  67

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               E G    NPF Y+  KY Y+ S I    +++++    D   ++SNW+GY+AVATD GK
Sbjct  68    FSEVGLVLNNPFVYQPVKYLYATSKIDVPESFILKPLSRDAWNRESNWIGYIAVATDQGK  127

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              ALGRRDI +AWRGT++  EWIK+F F    A  I G + +  VH+GF  +YT+ NP   
Sbjct  128   QALGRRDITIAWRGTIQPLEWIKDFDFPLTSASDIVGVEKDAQVHQGFLSIYTSDNPQSQ  187

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----D  904
                 S R+QI E ++ LV++Y++E++S+T+ GHSLG++LATL+AVD+V N +N+      
Sbjct  188   FNKTSVREQIFETLKELVDKYENEDISVTVTGHSLGAALATLSAVDIVANGLNRSDDQAS  247

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVTAF+FA P+ G+  F+      +D L+ILR+T+  DI+PK+PP           I
Sbjct  248   KACPVTAFVFACPRTGDLAFREVSDSFSD-LRILRVTNTPDIIPKVPPLA---------I  297

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG     D+ KS YL   G   +WH L  Y+H + G QG +  F L  + D+AL+N
Sbjct  298   GYRDVGQNLELDSRKSTYLKPTGAFITWHNLEAYMHCIAGTQGGKPDFHLEVNRDIALVN  357

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             K ++ LK  Y  + P+ W+  K+ GMVQQ+DG+W LDDHE D
Sbjct  358   KKLNSLKDIY--LVPSAWWQEKHKGMVQQEDGSWKLDDHEDD  397



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score =   349 bits (896),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 184/407 (45%), Positives = 259/407 (64%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+GLL PLD DLR+YLIHYG M  A YD+F     SK  G   Y+RK+ 
Sbjct  36    KRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSKFAGSSIYSRKDF  95

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ ++ S I    ++L+     +   K+SNW+GYVAV  D G
Sbjct  96    FAKVGLEKAHPYTKYKVTKFLFATSQIHVPESFLLFPVSREGCTKESNWIGYVAVTDDQG  155

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              AALGRRDI+VAWRG+V+  EW+ +F+F FV A  IFG+ ++ + +H+G+Y +Y + +  
Sbjct  156   TAALGRRDIVVAWRGSVQPLEWVNDFEFGFVNAKKIFGEKNDQVQIHQGWYSIYMSKDER  215

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +ARDQ+  E+ RL+E+YKDE++SI++ GH LG+++ATLNA D+V N  N+    
Sbjct  216   SPFNKANARDQVLREIGRLLEKYKDEKISISICGHILGAAIATLNAADIVANGYNRPKSR  275

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +FK   S L D L++LR+ +  D+VP  PP G        
Sbjct  276   PDKSCPVTAFVFASPRVGDSDFKKLFSGLKD-LRVLRVRNLPDVVPIYPPLG--------  326

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG E   D  KS YL   G  A++H L  YLHG+ G QG+     F+L    D+
Sbjct  327   ---YAEVGDELPIDTRKSPYLKSPGDLATFHCLEVYLHGLAGTQGTSKADLFRLDVKRDI  383

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK  Y  M P  W ++KN GMVQQ+DG+W L DHE+DD
Sbjct  384   GLVNKSVDGLKDEY--MVPGHWRILKNKGMVQQNDGSWKLMDHEIDD  428



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score =   349 bits (895),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 196/423 (46%), Positives = 260/423 (61%), Gaps = 41/423 (10%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW++LSG  NW+ LLDPLD DLRRYLIHYG   SA YD+F +E  SK  G  RY  KNL
Sbjct  7     ERWRELSGQNNWKNLLDPLDLDLRRYLIHYGERASATYDTFNSEVKSKYAGDSRYGLKNL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G    NPF+Y  TKYFY+ S+++    +L++S   +   K+SNW+GYVAVATD GK
Sbjct  67    FSNVGLSIANPFEYTATKYFYATSSVKLPGCFLLRSLSREAWNKESNWIGYVAVATDKGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN-------------------  682
             AALGRRDIL+AWRGT++  EW  +F F    A  I G                       
Sbjct  127   AALGRRDILIAWRGTIQVLEWASDFNFPLTPATKILGGTDPDADADTAADAAADDVDDII  186

Query  683   PLVHKGFYDMYTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLAT  862
             P VH GF  +YT+ +P       SAR+Q+  EV+RLV+QYKDEE+SIT+AGHSLG++LA+
Sbjct  187   PKVHSGFLSVYTSDDPRSEFNKSSAREQVLTEVQRLVDQYKDEEISITVAGHSLGAALAS  246

Query  863   LNAVDLVTNPINKDS------PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAK  1024
             LNAVD+  N  N+        P PVTAF++ASP+VG   F N  + +  +L++LR  +  
Sbjct  247   LNAVDIAWNGYNRSCGIQSQQPCPVTAFVYASPRVGNLKFCNIANSIP-SLRLLRTANLL  305

Query  1025  DIVPKLPPFGVKVNTTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDG  1198
             D+VPK+P  G           Y   G E   +   S YL   G  + WH++ TYLHG+ G
Sbjct  306   DVVPKVPGAG-----------YSDAGQELLINTQLSKYLKNPGNISKWHSVETYLHGLAG  354

Query  1199  FQGSQGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
              QG++GGFKL    DVAL+NK+   ++  Y  + P EW+V+KN GMVQ +DG+W L+DHE
Sbjct  355   TQGTKGGFKLEVKRDVALVNKHQSFVRDEY--LVPDEWWVMKNRGMVQMEDGSWQLEDHE  412

Query  1379  VDD  1387
             +D+
Sbjct  413   MDN  415



>ref|XP_009777407.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   347 bits (890),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 203/408 (50%), Positives = 259/408 (63%), Gaps = 35/408 (9%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             E W+ LSG  NWEGLL PLD DLR+Y+I YG +  A YD+FI E  SK  G  RY+ ++L
Sbjct  6     ENWEQLSGKNNWEGLLRPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSMESL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G D   P KY VTK+FY+ ++I     ++++S   +   K+SN+MGY+AVATD+GK
Sbjct  66    FTKVGLD---PLKYRVTKFFYATASIPLPDAFIVKSLSREAWSKESNFMGYIAVATDEGK  122

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVHKGFYDMYTAV  724
              ALGRRDI+V WRGT++  EW+ + QFL V  P +FG         PLVH GFY++YT  
Sbjct  123   VALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLSLLQPLVHHGFYNIYTTE  182

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             +P       S  +Q+ EEV+RLVE+YK+EE+SIT+ GHSLG+SLATLNAVD+  N INK 
Sbjct  183   DPR------SQFNQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNGINKT  236

Query  905   S---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
             S     PVTAF+FASPKVG+ NF  A SKL +NL ILR+ +  DIVPK PP G       
Sbjct  237   SEGKEFPVTAFVFASPKVGDLNFHKAFSKL-NNLHILRIHNVLDIVPKYPPIG-------  288

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFD  1243
                 Y  VG E   D +KS Y+   G   SWH L  YLHGV G QG     GFKL  + D
Sbjct  289   ----YIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKLEVNRD  344

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             ++L+NK  D LK  Y +  P  W+  K+ GMVQQ DG+W+L D E  D
Sbjct  345   ISLVNKQWDILKDEYCI--PGLWWADKHKGMVQQQDGSWLLLDREEYD  390



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/407 (45%), Positives = 258/407 (63%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+DLSG  +W+G+L PLD DLR+Y++HYG M  A YD+F     SK  G   Y+RK+ 
Sbjct  19    KKWRDLSGQNHWKGMLHPLDQDLRQYIVHYGEMAQAGYDTFNTNTESKFAGASIYSRKDF  78

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  NP+ KY+VTK+ Y+ S I    ++L+     +   K+SNWMGYVAV  D G
Sbjct  79    FAKVGLEKANPYTKYKVTKFLYATSQIHVPDSFLLFPVSREGWTKESNWMGYVAVTDDQG  138

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+V+WRG+V+  EW+ +F+F  V A  IFG+ ++ + +H+G+Y +Y + +  
Sbjct  139   TAVLGRRDIVVSWRGSVQPLEWVNDFEFGLVDAKKIFGEKNDKVQIHQGWYSIYMSDDQR  198

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +ARDQ+  E+ RL+E+YKDEE+SI++ GHSLG++LATLNA D+V N  N+    
Sbjct  199   SPFNKANARDQVLREIGRLLEKYKDEEVSISVCGHSLGAALATLNAADIVANGYNRPKNR  258

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +FK   S L D L++LR+ +  D+VP  PP G        
Sbjct  259   PDKSCPVTAFVFASPRVGDSDFKKLFSGLED-LRVLRIRNLPDVVPIYPPLG--------  309

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG E + D  KS Y+   G  +++H L  YLHGV G QG+     F+L    D+
Sbjct  310   ---YSEVGDELQIDNRKSPYMKSPGNLSTFHNLEGYLHGVAGTQGTTKADLFRLDVKRDI  366

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK  Y  M P  W V+KN GMVQ DDG+W L DHE+DD
Sbjct  367   GLVNKSVDGLKDEY--MVPGYWRVLKNKGMVQLDDGSWKLLDHEIDD  411



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score =   347 bits (890),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 185/407 (45%), Positives = 256/407 (63%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+G+L PLD DLR Y+IHYG M  A YD+F     SK  G   Y+RK+ 
Sbjct  37    KRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDF  96

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ Y+ S +    ++L+     +   K+SNWMGYVAV  D G
Sbjct  97    FAKVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQG  156

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+VAWRG+V+  EW+ +F+F  V A  IFG+ ++ + +H+G+Y +Y + +  
Sbjct  157   TALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYLIYMSQDER  216

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +ARDQ+  EV RL+++YKDEE+SIT+ GHSLG++LATLNA D+V N  N+    
Sbjct  217   SPFTKANARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIVANGYNRPKSR  276

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +FK   S L D L++LR  +  D++P  PP G        
Sbjct  277   PDKSFPVTAFVFASPRVGDSDFKKLFSGLED-LRVLRTRNLPDVIPIYPPIG--------  327

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG E   D  KS Y+   G  A++H L  YLHGV G QG+     F+L    D+
Sbjct  328   ---YSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADEFRLDVKRDI  384

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK     M P +W V+KN GMVQQDDG+W L DHE+DD
Sbjct  385   GLVNKSVDGLKD--ECMVPGKWRVLKNKGMVQQDDGSWNLLDHEIDD  429



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   346 bits (887),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 183/407 (45%), Positives = 256/407 (63%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+G+L PLD DLR Y+IHYG M  A YD+F     S+  G   Y+RK+ 
Sbjct  20    KRWRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTDSQFAGASIYSRKDF  79

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ Y+ S I    ++L+     +   K+SNWMGYVAV  D G
Sbjct  80    FAKVGLEKAHPYTKYKVTKFLYATSEIHVPESFLLFPVSREGWTKESNWMGYVAVTDDQG  139

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+VAWRG+V+  EW+ +F+F  V A  IFG+ ++ + +H+G+Y +Y + +  
Sbjct  140   TALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIYMSQDER  199

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +ARDQ+  E+ RL+E+YKDEE+SIT+ GHSLG++LATLNA D+V N  N+    
Sbjct  200   SPFTKANARDQVLRELGRLLEKYKDEEVSITICGHSLGAALATLNATDIVANGYNRPKSR  259

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +FK  +S L D +++LR  +  D++P  PP G        
Sbjct  260   PDKSCPVTAFVFASPRVGDSDFKKLLSILED-MRVLRTRNLPDVIPIYPPIG--------  310

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG E   D  KS Y+   G  A++H L  YLHGV G QG+     F+L     +
Sbjct  311   ---YSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADLFRLDVKRAI  367

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK     M P +W V+KN GMVQQDDG+W L DHE+DD
Sbjct  368   GLVNKSVDGLKD--ECMVPGKWRVLKNKGMVQQDDGSWKLLDHEIDD  412



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score =   346 bits (888),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 255/407 (63%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W G+L PLD DLR Y+IHYG M  A YD+F     SK  G   Y+RK+ 
Sbjct  35    KRWRDLSGQNHWNGMLQPLDQDLREYVIHYGEMAQAGYDTFNINTESKFAGASIYSRKDF  94

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VT++ Y+ S I    ++L+     +   K+SNWMGYVAV  + G
Sbjct  95    FAKVGLEKAHPYTKYKVTRFLYATSQIHVPESFLLFPLSREGWTKESNWMGYVAVTDNQG  154

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+VAWRG+V+  EW+ +F+F  V A  IFG+ ++ + +H+G+Y +Y + +  
Sbjct  155   TAVLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKNIFGEKNDQVQIHQGWYSIYMSEDER  214

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +ARDQ+  E+ RL+E+YKDEE+SI++ GHSLG++LATLNA D+V N  N+    
Sbjct  215   SPFNKANARDQVLREIGRLLEKYKDEEVSISICGHSLGAALATLNATDIVANGYNRPKSR  274

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +++   S   D L++LR+ +  DIVP  PP G        
Sbjct  275   PDKSCPVTAFVFASPRVGDSDYRKLFSGFED-LRVLRVKNLPDIVPIYPPLG--------  325

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG E   D  KS Y+   G  A++H L +YLHGV G QG+     F+L    D+
Sbjct  326   ---YAEVGEELSIDTRKSQYMKSPGNFATFHCLESYLHGVAGTQGTSKNDIFRLDVKRDI  382

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D L      M P  W V+KN GMVQQDDG+W+L DHE+DD
Sbjct  383   GLVNKSVDGLTD--ECMVPGNWRVLKNKGMVQQDDGSWVLLDHEIDD  427



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score =   344 bits (882),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 187/401 (47%), Positives = 242/401 (60%), Gaps = 21/401 (5%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             W++LSG   W+GLL+PL  DLR+YL+HYG    A YD+F  E  SK  G CRY++K+   
Sbjct  17    WRELSGKSKWKGLLEPLHIDLRKYLLHYGQFAQATYDAFNFEKASKYAGNCRYSKKDFFS  76

Query  386   ESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQ-RPDTVLKQSNWMGYVAVATDDGKA  562
             +   + GNP+KY VTKY Y+ S    +  +L+ S    D    +SNW+GYVAVATD+ K 
Sbjct  77    KVYLEEGNPYKYSVTKYLYATSKASDSAAFLLTSIFSKDAWSLESNWIGYVAVATDEAKE  136

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI+V WRGT++ +EW++NF      APLIFG  SN  +H GFY +YT+ N     
Sbjct  137   ALGRRDIVVVWRGTIQGSEWVQNFNIDLDPAPLIFGPKSNVQIHNGFYSLYTSENSGLPS  196

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP--  910
                SAR Q+  E+ RLVE YK+EE+SIT+ GHSLG +LAT+++VD+V N  N  K+ P  
Sbjct  197   ADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSVDIVANKFNMPKEQPQK  256

Query  911   -IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
               PVT F F +P+VG   F+   S   D L  L + +  DIVPK   F            
Sbjct  257   ACPVTTFAFGAPRVGNSYFQKIFSDHKD-LSALFVRNENDIVPKSLTF-----------F  304

Query  1088  YEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
             Y  VG E   D  +S YL     S H +  YLHG+ G QGS+GGF L  + D+ALLNK+ 
Sbjct  305   YYKVGEELEIDTEESKYLKS-GVSAHNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSN  363

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             D LK  Y +  P  W VV+N GMVQQ DGTW L D   DD+
Sbjct  364   DGLKDEYHI--PENWRVVENKGMVQQSDGTWKLMDDHNDDV  402



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score =   343 bits (881),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/407 (45%), Positives = 254/407 (62%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW++LSG  +W+G+L PLD DLR+Y+IHYG M  A YD+F     SK  G   Y+RK+ 
Sbjct  38    KRWRELSGQNHWKGMLHPLDQDLRQYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDF  97

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ Y+ S I    ++L+     +   K+SNWMGYVAV  D G
Sbjct  98    FSKVGLEKAHPYTKYKVTKFLYATSQIHVPESFLLFPMSREGWTKESNWMGYVAVTDDQG  157

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+VAWRG+V+  EW+ +F F  V A  IFG +++ + +H+G+Y +Y + +  
Sbjct  158   TAILGRRDIVVAWRGSVQPLEWVSDFDFSLVNANKIFGDNNDHVQIHQGWYSIYMSQDER  217

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +ARDQ+  E+ RL+E+YK+EE+SIT+ GHSLG++LATLNA D+V N  N+    
Sbjct  218   SHFNKANARDQVLREIGRLLEKYKEEEVSITVCGHSLGAALATLNATDIVANGYNRPKSR  277

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +F      L D L++LR+ +  D+VP  PP G        
Sbjct  278   PDKSCPVTAFVFASPRVGDSDFMKLFYGLQD-LRVLRIRNLPDVVPIYPPLG--------  328

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG E   D  KS Y+   G  A++H L  YLHGV G QG+     F+L    D+
Sbjct  329   ---YAEVGDELPIDTRKSQYMKSPGNFATFHCLEAYLHGVAGTQGTAKSDLFRLDVKRDI  385

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK     M P  W V+KN GMVQQDDG+W L DHE+DD
Sbjct  386   GLVNKSVDGLKD--ECMIPGHWRVLKNKGMVQQDDGSWKLLDHEIDD  430



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score =   343 bits (880),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 184/407 (45%), Positives = 253/407 (62%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWKDLSG  +W+G+L PLD DLR Y+IHYG M  A YD+F     SK  G   YARK+ 
Sbjct  42    KRWKDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYARKDF  101

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               +   +  +P+ KY+VTK+ Y+ S +    ++L+     +   K+SNWMGYVAV  D G
Sbjct  102   FAKVCLEKAHPYTKYKVTKFLYATSEVHVPESFLLFPISREGWTKESNWMGYVAVTDDQG  161

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+V WRG+V+  EW+ +F+F  V A  IFG+ ++ + +H+G+Y +Y + +  
Sbjct  162   TALLGRRDIVVVWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIYMSQDDR  221

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +AR+Q+  EV RL+++YKDEE+SIT+ GHSLG++LATLNA D+V N  N+    
Sbjct  222   SPFTKANAREQVLREVGRLLDRYKDEEVSITICGHSLGAALATLNAADIVANGYNRPKSR  281

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +FK     L +NL++LR  +  D++P  PP G        
Sbjct  282   PDKACPVTAFVFASPRVGDSDFKKLFYGL-ENLRVLRTRNLPDVIPIYPPIG--------  332

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG E   D  KS Y+   G  AS+H L  YLHGV G QG+     F+L    D+
Sbjct  333   ---YSEVGDELPIDTRKSQYMKSPGNLASYHCLEAYLHGVAGTQGTAKADIFRLDVKRDI  389

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK     M P +W V+KN GMVQQDDG+W L DHE DD
Sbjct  390   GLVNKSVDGLKD--ECMVPGKWRVLKNKGMVQQDDGSWKLLDHETDD  434



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score =   342 bits (877),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 177/405 (44%), Positives = 244/405 (60%), Gaps = 22/405 (5%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ LSG + W+GLL+PLD+DLR+YLIHYG +  A YD+FI +  S+  G  R++ KNL 
Sbjct  9     RWRQLSGQQKWQGLLEPLDNDLRQYLIHYGDLAQATYDNFIMQKYSQFAGDNRFSMKNLF  68

Query  383   RESGHD-NGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLK--QSNWMGYVAVATDD  553
                G     N F Y+  KY Y+ S +    ++++        +   +SNW+GY+AVATD 
Sbjct  69    SRVGLGMRNNQFVYKPVKYLYATSKVDVPQSFIMSPASTSRAVPNGESNWIGYIAVATDQ  128

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPD  733
              K  LGRRDI VAWRGT++  EWIK+F F    A  + G  ++  VH+GF+ +YT+ NP 
Sbjct  129   AKEKLGRRDIAVAWRGTLQPLEWIKDFDFPLTSASDVLGGHNDAQVHQGFHSVYTSDNPQ  188

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   SAR Q+ + +R LV +Y++EE+S+T+ GHSLG++LATL+A D+V N  N+    
Sbjct  189   SQTSKTSARQQVLDGLRELVNKYENEEISVTVVGHSLGAALATLSAADIVANGFNRTDKQ  248

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              +   PVTAF FA P+ G R FK     L D L+ILR+T+  D+VPK+PP          
Sbjct  249   ANKSCPVTAFAFACPRTGNRGFKQVCDSLED-LRILRITNTPDMVPKVPPL---------  298

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
             I  Y  VG     D+ KS YL   G   SWH L TYLH + G QG +  F+L    D++L
Sbjct  299   IAGYSEVGENLEIDSRKSMYLKPTGGFISWHNLETYLHTIAGTQGKRSAFRLECQRDISL  358

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             +NKN+D LK  Y  M P  W+   N+GM+QQ+DG W L D + DD
Sbjct  359   VNKNLDALKEKY--MVPGNWWCGLNNGMIQQEDGLWKLFDRDKDD  401



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 194/402 (48%), Positives = 259/402 (64%), Gaps = 21/402 (5%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ L G  NWEGLLDPLD DLRR L+ YG M  A YD+F +E +SK  G CRYA+++  
Sbjct  9     RWRILQGRDNWEGLLDPLDLDLRRLLLLYGDMAQAAYDAFNHERVSKYAGSCRYAKRDFF  68

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              +    NGNPF+Y +TK+ Y+ S+++    +LI+S   +   K+SNWMG+VAVATD+GK 
Sbjct  69    SKVNLVNGNPFEYTITKFIYATSSVQVPEAFLIRSLSREAWSKESNWMGFVAVATDNGKK  128

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
              LGRRD+++AWRGT+ A EW+++F    V A  I G   +  VH+G++ +YT+ +     
Sbjct  129   QLGRRDVVIAWRGTIEALEWVEDFDIGQVSAAPISGGGDDAKVHRGWFSIYTSDDSKSPY  188

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP--  910
                SAR+Q+  EVRRLVE YKDEEMSIT+ GHSLG++L TLNA+D+V N  N  K  P  
Sbjct  189   NNTSAREQVMSEVRRLVEAYKDEEMSITITGHSLGAALTTLNAIDIVANGTNIPKGRPGT  248

Query  911   -IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
              IPVT  +FASP+VG   FK      +  LK+LR+T+A DIVP             P+IS
Sbjct  249   QIPVTGIVFASPRVGNTEFKKRFEG-SQGLKLLRVTNALDIVP-----------NYPLIS  296

Query  1088  YEHVGMEFRFDASKSNYLDG--FKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNK  1261
             Y+ VG+    D  KS++L      +  H L  YLHGV G QG +GGFKL    D+AL+NK
Sbjct  297   YDDVGVNLGIDTRKSDFLKSPVGPSGVHNLEIYLHGVAGTQGKKGGFKLEIPRDIALVNK  356

Query  1262  NIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             ++D LK +Y++  PA W V KN GMVQ  DG+W L DHE +D
Sbjct  357   SLDVLKVDYTV--PASWKVEKNKGMVQLPDGSWKLMDHENED  396



>gb|EYU17473.1| hypothetical protein MIMGU_mgv1a008748mg [Erythranthe guttata]
Length=363

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 183/377 (49%), Positives = 249/377 (66%), Gaps = 26/377 (7%)
 Frame = +2

Query  296   MVSAVYDSFINEPISKNVGLCRYARKNLLRESGHD-NGNPFKYEVTKYFYSPSTIRTATN  472
             M  A YD+FI+E  SK  G  RY++K+LL + G +   NP+KY VTKYFY+ S+     +
Sbjct  1     MAQATYDTFISEKASKYAGASRYSKKDLLSKVGIEYKANPYKYRVTKYFYAASSSLVLGS  60

Query  473   YLIQSQRPDTVLKQSNWMGYVAVATDDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVK  652
              L+ S   +   K+SNWMG+VAVATD+G+ ALGRRDIL++WRGT++  EW+ + QF  V 
Sbjct  61    LLVVSLSREAWSKESNWMGFVAVATDEGRLALGRRDILISWRGTIQNLEWVNDLQFELVS  120

Query  653   APLIFGQDSN----PLVHKGFYDMYTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMS  820
             AP IFG+ +N    P VH G+  +YT+ +P       SAR Q+ +EVRRLVE+YK+EE S
Sbjct  121   APEIFGETNNEGDEPKVHLGWRSIYTSDDPKSPFNKTSARHQVLDEVRRLVEEYKNEETS  180

Query  821   ITLAGHSLGSSLATLNAVDLVTNPIN--KDSP---IPVTAFLFASPKVGERNFKNAVSKL  985
             IT+ GHS+G++++TLNAVD+V    N  KD P    PVTAF+FASP+VG  +F+   S L
Sbjct  181   ITITGHSMGAAVSTLNAVDIVAQGYNKPKDMPNKACPVTAFVFASPRVGNGSFQKFFSSL  240

Query  986   ADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEHVGMEFRFDASKSNYLD--GFKAS  1159
               NL+ILR+ +A+D+VP             P+I Y  VG E   D  +S+YL   G  +S
Sbjct  241   -QNLRILRVRNARDVVP-----------LYPLIGYSEVGEELVIDTEESSYLKKPGNFSS  288

Query  1160  WHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMV  1339
             WHTL  YLHGV G QGS+GGFKL  D D+AL+NK+++ LK  Y +  P  W+  +N GMV
Sbjct  289   WHTLEGYLHGVAGTQGSKGGFKLEVDRDIALVNKHMNLLKDEYCV--PESWWCERNKGMV  346

Query  1340  QQDDGTWILDDHEVDDI  1390
             Q++DG+W+L DHE DD 
Sbjct  347   QKEDGSWLLMDHEHDDF  363



>ref|XP_011047741.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score =   340 bits (872),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 186/402 (46%), Positives = 255/402 (63%), Gaps = 25/402 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLD-PLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKN  376
             + WKD SG+KNWEGLLD P+++D RRYLIHYG  V A+ D+F     S +  L RY  + 
Sbjct  6     DNWKDFSGAKNWEGLLDHPINTDFRRYLIHYGERVGAIGDAFNYVKASDSYALSRYPPEE  65

Query  377   LLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
                     NGNPFKY+VTKYFY  S      + + +    D  L+ S W+GYVAV TD+G
Sbjct  66    FFMNVNLQNGNPFKYQVTKYFYLKS------DDIAEVLELD--LEGSAWVGYVAVTTDEG  117

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDP  736
             +  LGRRDILV WRGT+ A+EW ++FQF    A  IFG  +NP VH GF+++Y A +   
Sbjct  118   QRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHGFHNVYVAKSSKS  177

Query  737   ILKGVSARDQIREEVRRLVEQY--KDEEMSITLAGHSLGSSLATLNAVDLVTNPINK---  901
                  SAR+Q+  EVRRLV+ Y    EE+SIT+AGHSLG++LATLN VD+V N  NK   
Sbjct  178   KYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGVDMVANGFNKPSG  237

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVT F +ASP+VG++ F++  + L  +L +LR+ ++KDI+P+LPP        + 
Sbjct  238   SDVGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRLPP--------VF  289

Query  1079  IISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
             ++ Y+ VG +   D+ KS YL   KA  H L  YLH + G+QG +  FKL  D D+ALLN
Sbjct  290   LLGYQDVGEKLEIDSIKSPYLKDPKAQPHNLELYLHTIAGYQGQEEEFKLVVDRDIALLN  349

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             K++D +   Y++  P  W+ VKN+GM+Q D+G W L+D+  D
Sbjct  350   KSLDLVLDKYNI--PPTWWNVKNNGMIQIDNGFWKLNDYVPD  389



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score =   340 bits (871),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 257/407 (63%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+G+L PLD DLR Y+IHYG M  A YD+F     S+  G   Y+RK+ 
Sbjct  21    KRWRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESQFAGASIYSRKDF  80

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ Y+ S I    ++L+     +   K+SNWMGYVAV  D G
Sbjct  81    FAKVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESNWMGYVAVTDDQG  140

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+V+WRG+V+  EW+++F+F  V A  IFG+ ++ + +H+G+Y +Y + +  
Sbjct  141   TALLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIYMSQDER  200

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +ARDQ+  EV RL+E+YKDEE+SIT+ GHSLG++LATL+A D+V N  N+    
Sbjct  201   SPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIVANGYNRPKSR  260

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +F+   S L D +++LR  +  D++P  PP G        
Sbjct  261   PDKSCPVTAFVFASPRVGDSDFRKLFSGLED-IRVLRTRNLPDVIPIYPPIG--------  311

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG EF  D  KS Y+   G  A++H L  YLHGV G QG+     F+L  +  +
Sbjct  312   ---YSEVGDEFPIDTRKSPYMKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDVERAI  368

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK     M P +W V+KN GM QQDDG+W L DHE+DD
Sbjct  369   GLVNKSVDGLKDE--CMVPGKWRVLKNKGMAQQDDGSWELVDHEIDD  413



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score =   339 bits (869),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 187/406 (46%), Positives = 256/406 (63%), Gaps = 23/406 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW++L+G  NW+ LLDPLD DLRR ++ YG M  A YD+FI E  S+  G CRYAR++ 
Sbjct  7     KRWRELNGKDNWKDLLDPLDIDLRRNILLYGEMAEATYDAFITEKKSRYAGDCRYARRDF  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               +     G    Y VTK+FY+ S+I     +LI+S   +   K+SNWMGYVAVATD+GK
Sbjct  67    FDKVAISTGQHSLYRVTKFFYATSSIDVPDAFLIRSLSREAWSKESNWMGYVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ--DSNPLVHKGFYDMYTAVNPD  733
               LGRRD++VAWRGTV+A EWI +  F  V A  I G+    +P VH+G+  +YT+ +P 
Sbjct  127   KVLGRRDVVVAWRGTVQALEWINDLDFTLVSASGILGKGYSGDPQVHRGWLSIYTSDDPR  186

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   SAR+Q+  E+ RL+++Y  EE SIT+ GHSLG++LATLNA D+ +N +NK    
Sbjct  187   SPYNKDSARNQVLREIGRLMDEYNKEETSITVTGHSLGAALATLNAADIASNGLNKSNAR  246

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              +   PV AF+FASP+VG+ +F+ A S + + L++LR+ +  D+VP             P
Sbjct  247   PNKSSPVAAFVFASPRVGDSDFREAFSNIPE-LRLLRIRNVPDLVP-----------NYP  294

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
             ++ Y+ +G+E   D  KS YL   G  +SWH L  YLHGV G  G +G FKL  D DVAL
Sbjct  295   LLGYDDIGVELTIDTRKSQYLKSPGNLSSWHNLEAYLHGVAGTNGGKGRFKLEVDRDVAL  354

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             +NK +D LK  Y  + PA W+V KN GMV+  DG W L DHE D +
Sbjct  355   VNKGLDALKDEY--LVPASWWVEKNKGMVKGADGHWRLMDHEEDSV  398



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score =   338 bits (868),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 181/400 (45%), Positives = 245/400 (61%), Gaps = 22/400 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
              RW++L+G   W+GLLDPLD DLRR +I+YG +  A Y     E  S+  G C + R++ 
Sbjct  12    RRWRELNGVNYWKGLLDPLDIDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLFNRRDF  71

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L  S  D  NP  YE+TK+ Y+  T+     ++++S       +QSNWMG+VAVATD+GK
Sbjct  72    L--SRVDVSNPDLYEITKFVYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGK  129

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPD  733
               LGRRD++VAWRGT+R  EW+ +     V A  I   G   NP VH G+  +YT  +P 
Sbjct  130   EVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSAINPCVHGGWLSVYTTADPG  189

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
                   SAR Q+  EV+R+ + YK+EE SIT+ GHSLG++LAT+NA+D+V+N  NK    
Sbjct  190   SQYNQESARHQVLNEVKRIQDLYKNEETSITITGHSLGAALATINAIDIVSNGYNKS--C  247

Query  914   PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYE  1093
             PV+AF+F SP+VG  +F+ A    AD L++LR+ ++ D+VPK P  G           Y 
Sbjct  248   PVSAFVFGSPRVGNPDFQKAFDSAAD-LRLLRVRNSPDVVPKWPKLG-----------YN  295

Query  1094  HVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
              VG E   D  +S YL   G   +WH +  Y+HGV G QGS GGFKL  D D+AL+NK+ 
Sbjct  296   DVGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSSGGFKLLVDRDIALVNKHE  355

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             D LK  YS+  P  W+VV+N GMV+  DG W L DHE DD
Sbjct  356   DALKNEYSI--PTSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score =   340 bits (871),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 188/453 (42%), Positives = 254/453 (56%), Gaps = 71/453 (16%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L+G  NW+ LLDPLD DLRR +IHYG    A YD+F +E  S   G  RY++ N  
Sbjct  8     RWRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSRYSKANFF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
                  + GNP+KY +TK+ Y+ S I     ++I+S   +   ++SNWMGYVAVATD+GKA
Sbjct  68    SGLFLEKGNPYKYNITKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVAVATDEGKA  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
              LGRRDIL+AWRG+V+A EWI +F+F  V A  I    ++  VH+G+  +YT+ +P    
Sbjct  128   VLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDAKVHQGWLSIYTSDDPRSPY  187

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP--  916
                SAR Q+ EEV+RLVE++KDEE++IT+ GHSLG++L  LNAVD+V N +NK +  P  
Sbjct  188   NTTSARQQVLEEVKRLVEEFKDEEINITITGHSLGAALGILNAVDIVANGLNKPTDHPDK  247

Query  917   ---VTAFLFASPKVGERNFKNAVSKL--ADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                VTAFLF  P VG+ NF+N  S L    +L++LR+ +A D+VP  P          P+
Sbjct  248   ACLVTAFLFGCPLVGDANFRNVFSILNSTQHLRLLRIRNAIDVVPNYP----------PM  297

Query  1082  ISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQ--------------  1213
             I Y  VG E   +   S +L       SWH L  YLHG+ G QGS               
Sbjct  298   IGYTQVGEELVINTDTSPFLKESAEPMSWHNLEIYLHGIAGTQGSSVLPATTNKTRTRSR  357

Query  1214  ------------------------------------GGFKLHGDFDVALLNKNIDQLKGN  1285
                                                 G FKL    D+ L+NK +D LK  
Sbjct  358   SGSSSSSKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKRDITLVNKVMDALKDE  417

Query  1286  YSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             + +  PA+W+  KN GMVQ+DDG+W L DHE D
Sbjct  418   FHV--PAKWWCEKNKGMVQEDDGSWKLMDHESD  448



>ref|XP_009333706.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=378

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/401 (46%), Positives = 244/401 (61%), Gaps = 34/401 (8%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ L G  +WEGLLDPLD DLRR ++HYG  V+A+ DSFI++P SKN GL RY + +L 
Sbjct  7     RWRLLGGETDWEGLLDPLDIDLRRCILHYGERVAAIGDSFISDPRSKNCGLPRYTKTHLF  66

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G +N NP+KY V KY Y+      AT +L           +S W+GYVAV TD+GK 
Sbjct  67    SKVGLENSNPYKYTVNKYIYA------ATEFLPG---------KSIWLGYVAVTTDEGKE  111

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
              LGRRDILV WRGT   AEW  +  F  V A  I G   +P VH G +  Y + +P+   
Sbjct  112   VLGRRDILVTWRGTELDAEWGVDLLFDLVSASDILGDKYDPKVHHGIHSYYNSADPESPY  171

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP--  916
                S R Q+   ++ +V+QYKDEE+SIT+ GHS+G + A LNA+D+V N  NK +  P  
Sbjct  172   SKTSCRAQVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNAIDIVCNGYNKPTDRPDK  231

Query  917   ---VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
                VT+ +FASP++G++ F N  S L +NL +LR+T++ DIVP LPP             
Sbjct  232   ACLVTSIVFASPRLGDQGFHNVFSSL-NNLHVLRVTNSYDIVPYLPPLE----------K  280

Query  1088  YEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
             Y  VG E + D  KS YL   K   H L  YLHGV G QG + GF+L  + D+AL+NK +
Sbjct  281   YVDVGKELKIDTLKSPYLKNAKKDAHRLEIYLHGVAGTQG-RNGFQLVINRDIALVNKKL  339

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             D LK  Y+++    W+  KN  MVQ DDG+W+L DHE DD+
Sbjct  340   DGLKDEYNVI--VNWWTEKNKSMVQMDDGSWVLLDHEKDDV  378



>ref|XP_003608122.1| Lipase [Medicago truncatula]
Length=387

 Score =   336 bits (862),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 188/401 (47%), Positives = 239/401 (60%), Gaps = 34/401 (8%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             W++LSG   W+GLL+PL  DLRRYL+HYG    A YD F  E  SK  G CRY++K+   
Sbjct  8     WRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRYSKKDFFS  67

Query  386   ESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQ-RPDTVLKQSNWMGYVAVATDDGKA  562
             +   + GNPFKY VTKY Y+ S  R +  +L+ S    D    ++NWMGYVAVATD+ K 
Sbjct  68    KVYLEKGNPFKYSVTKYLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAVATDEAKE  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI+VAWRGT++ AEW++NF      APLIFG  S+  +H GFY +YT+ N    L
Sbjct  128   ALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNGFYSLYTSDNSSLPL  187

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP--  910
                SAR Q+  E+ RLVE YK+EE+SIT+ GHSLG +LAT++++D+V N  N  K  P  
Sbjct  188   ADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDIVANKFNIPKGQPQK  247

Query  911   -IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
               PVT F F SP+VG  NF+   S   D L+ L + +  DIVP                 
Sbjct  248   TCPVTLFAFGSPRVGNSNFEKIFSDNND-LRALFIRNNNDIVPS----------------  290

Query  1088  YEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
                     R   SK  YL     S H +  YLHG+ G QGS+GGF L  + D+ALLNK+ 
Sbjct  291   ------SLRLAYSK--YLKS-GVSEHNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSN  341

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             D LK  Y +  P  W VV+N GMVQQ DGTW L D   DD+
Sbjct  342   DGLKDEYHI--PENWRVVENKGMVQQSDGTWKLMDDHNDDV  380



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   336 bits (862),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 177/405 (44%), Positives = 251/405 (62%), Gaps = 24/405 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RWK+LSG   W+GLLDPLD+DLRRY++HYG M    YD+F ++  SK  G   +++  L 
Sbjct  8     RWKELSGEHKWKGLLDPLDNDLRRYIVHYGEMAEVTYDAFNSDRRSKYAGDSYFSKTELF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               +G   GNP++Y+VTK+FY+ S+++   +++++S   +   K+SNWMGY+AVATD+GK 
Sbjct  68    ARTGFLKGNPYRYKVTKFFYATSSVKLPGSFIVKSLSREAWSKESNWMGYIAVATDEGKE  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF-GQDS--NPLVHKGFYDMYTAVNPD  733
              LGRRDI+VAWRGT++  EW  +F F    A  +F G ++   P +  G+  +YT  +P 
Sbjct  128   KLGRRDIVVAWRGTIQPYEWANDFDFPLDPASELFPGAETGHKPQIASGWLALYTTDDPR  187

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   SAR+Q+  EV RL+EQYKDEE+SITL GHSLG++++TL A D+  N   K    
Sbjct  188   SPFNKTSAREQVLGEVNRLLEQYKDEEVSITLTGHSLGATMSTLCATDIAYNGHKKMKSL  247

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
                P  VTAF FASP+VG++NFK  V  + +NL ILR+T+  D+VP+            P
Sbjct  248   QHKPFYVTAFAFASPRVGDKNFKMLVDSI-ENLNILRITNVPDVVPR-----------YP  295

Query  1079  IISYEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
             ++ Y+  G     +  KS YL       ++H +  YLHGV G QGS GGFKL  + D++ 
Sbjct  296   LLGYDDAGEVLTINTLKSKYLKQSLNLRNYHNIDIYLHGVAGTQGSLGGFKLEIEKDISS  355

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             +NK +D L   Y  + P  W+ V+N GMVQ DDG+W L  H   D
Sbjct  356   VNKRLDALDDEY--LIPGSWWCVENKGMVQMDDGSWKLYTHRTPD  398



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/400 (45%), Positives = 247/400 (62%), Gaps = 21/400 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+L+G   W+GL+DPLD DLRR +I+YG +  A Y     E  S+  G C + R++ 
Sbjct  12    KRWKELNGLNYWKGLVDPLDLDLRRNIINYGELSQATYTGLNRERRSRYAGSCLFNRRDF  71

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L  S  D  NP  YE+TK+ Y+  T+     ++++S       +QSNWMG+VAVATD+GK
Sbjct  72    L--SRVDVSNPNLYEITKFIYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGK  129

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPD  733
               LGRRD++VAWRGT+R  EW+ +     V A  I   G  +NP VH G+  +YT+ +P 
Sbjct  130   ELLGRRDVVVAWRGTIRMVEWVDDLDISLVPASEIVLPGSAANPCVHGGWLSVYTSADPG  189

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
                   SAR Q+  EV+R+ + YK EE SIT+ GHSLG++LAT+NA D+V+N  N+ S  
Sbjct  190   SQYNKESARHQVLNEVKRIQDLYKPEETSITITGHSLGAALATINATDIVSNGYNR-SCC  248

Query  914   PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYE  1093
             PV+AF+F SP+VG  +F+ A    AD L++LR+ ++ D+VPK P  G           Y 
Sbjct  249   PVSAFVFGSPRVGNLDFQKAFDSAAD-LRLLRVRNSPDVVPKWPKLG-----------YS  296

Query  1094  HVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
              VG E   D  +S YL   G   +WH +  Y+HGV G QGS GGF+L  D DVAL+NK+ 
Sbjct  297   DVGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGAQGSSGGFELLVDRDVALVNKHE  356

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             D L+  +++  P  W+VV+N GMV+  DG W L DHE DD
Sbjct  357   DALRNEFAV--PPSWWVVQNKGMVKGKDGRWHLADHEEDD  394



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/400 (44%), Positives = 248/400 (62%), Gaps = 22/400 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+L+G   W+GL+DPLD DLRR +I+YG +  A Y     E  S+  G C + R++ 
Sbjct  12    KRWKELNGLNYWKGLVDPLDLDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLFNRRDF  71

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L  S  D  NP  YE+TK+ Y+  T+     ++++S       +QSNWMG+VAVATD+GK
Sbjct  72    L--SRVDVSNPNLYEITKFIYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGK  129

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPD  733
               LGRRD++VAWRGT+R  EW+ +     V A  I   G  +NP VH G+  +YT+ +P 
Sbjct  130   EVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSATNPCVHGGWLSVYTSADPG  189

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
                   SAR Q+  EV+R+ + YK EE SI++ GHSLG++LAT+NA+D+V+N  N+    
Sbjct  190   SQYNKESARHQVLNEVKRIQDLYKTEETSISITGHSLGAALATINAIDIVSNGYNRS--C  247

Query  914   PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYE  1093
             PV+AF+F SP+VG  +F+ A    AD L++LR+ ++ D+VPK P  G           Y 
Sbjct  248   PVSAFVFGSPRVGNPDFQEAFDSAAD-LRLLRVRNSPDVVPKWPKLG-----------YS  295

Query  1094  HVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
              VG E R D  +S YL   G   +WH +  Y+HGV G QGS GGF+L  D D+AL+NK+ 
Sbjct  296   DVGTELRIDTGESPYLKSPGNPLTWHDMECYMHGVAGAQGSSGGFELAVDRDIALVNKHE  355

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             D LK  +++  P+ W+VV+N  MV+  DG W L DHE DD
Sbjct  356   DALKNEFAV--PSSWWVVQNKDMVKGKDGRWHLADHEDDD  393



>ref|XP_010108435.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19463.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=394

 Score =   333 bits (855),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 185/401 (46%), Positives = 241/401 (60%), Gaps = 24/401 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLD-PLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKN  376
             E+WK  SG  +W+GLLD PLD+D RRY+IHYG    A+ D+FI E  SKN G  RYA+++
Sbjct  6     EKWKVFSGENDWKGLLDHPLDNDFRRYIIHYGERNEALGDAFIAEEKSKNYGRSRYAKRD  65

Query  377   LLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
                + G + GNP+KYEVT + Y+   ++  +  L  + +   V+KQSN M YVAVATDDG
Sbjct  66    FFSKVGLEKGNPYKYEVTNFIYAALELKPPS--LTATWK---VIKQSNLMAYVAVATDDG  120

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDP  736
             KAALGRRDILV+WRGT+   EWIK+  F  V A  I G  ++P VH G+Y +YT  NPD 
Sbjct  121   KAALGRRDILVSWRGTMLDPEWIKDLDFASVSASKILGTANDPKVHNGWYSLYTGTNPDS  180

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----  901
              L  +SARDQI  E+++ V  YKDE++SIT  GHS+G+++ TLNA D+V N  NK     
Sbjct  181   PLTSISARDQIINEIKKQVAAYKDEDLSITFVGHSMGAAIVTLNATDIVFNGFNKLPDKP  240

Query  902   DSPIPVTAFLFASPKVGERNFKNAVSKL-ADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
             D  IPVTAF  A P++G+  F    + L   NL +LR+ +  DIVPK PP          
Sbjct  241   DKAIPVTAFCIACPRIGDEGFSKVFTGLIGSNLHVLRINNYLDIVPKYPP---------G  291

Query  1079  IISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHG-DFDVALL  1255
                Y  VG E   D+ +S YL     + H+L  +LH V G+QG    F L     D   L
Sbjct  292   YYLYSDVGQELVVDSLESPYLKKALLTLHSLEVHLHTVAGYQGPDKEFDLKAIARDKVFL  351

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             NK  D L   Y ++  AEW+  KN  M+Q DDGTW L D E
Sbjct  352   NKYGDYLDDEYRVV--AEWWTEKNKSMIQNDDGTWELKDSE  390



>ref|XP_002456058.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
 gb|EES01178.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
Length=436

 Score =   335 bits (859),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 180/405 (44%), Positives = 243/405 (60%), Gaps = 27/405 (7%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L GS +WEGLLDPLD +LRR LI YG M+ A Y++FI E  S N G+CRY R +L 
Sbjct  10    RWRELHGSNHWEGLLDPLDVNLRRCLITYGEMIMATYEAFIGESRSPNAGMCRYRRADLF  69

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
             R    D   P  YE T+Y Y+ ++       L++        ++ NWMGYVAVATD G A
Sbjct  70    RRV--DVSRPGWYEATRYLYATASAEVRGKVLLRPLCRQGRARECNWMGYVAVATDQGAA  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD----SNPLVHKGFYDMYTAVNP  730
             ALGRRDI+VAWRGT RA EW+ + +     A  I G +    S+P VH+G+  +YT+ + 
Sbjct  128   ALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGAGGSDPSVHRGYLSLYTSADE  187

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK---  901
                L   SAR Q+  E+ RL+++YKDEE SIT+ GHSLG+++ATLNA D+V N  NK   
Sbjct  188   GSNLSKQSARMQVLTEIARLMDKYKDEETSITVVGHSLGATMATLNAADIVANAYNKTPG  247

Query  902   --DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
                   PVTA +F SP+ G+R+F++   +L D L++LR+ +  D +P  PP G       
Sbjct  248   YDSRRAPVTAIVFGSPRTGDRDFRDVFHRLPD-LRMLRIRNRPDRIPHYPPVG-------  299

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
                 Y  VG+E   D  +S +L   G ++  H L  +LHGV G+QG  GGF+L  D DVA
Sbjct  300   ----YADVGVELLIDTRRSPFLKPHGNESQSHDLEVHLHGVAGWQGDHGGFELVVDRDVA  355

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             L+NK  D L   Y +  P  W V  N  MV+  DG W+L+DHE D
Sbjct  356   LVNKFDDCLADEYPV--PVGWKVHHNKNMVKGPDGRWVLEDHEPD  398



>ref|XP_004969328.1| PREDICTED: phospholipase A1-II 2-like [Setaria italica]
Length=425

 Score =   333 bits (854),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 180/406 (44%), Positives = 244/406 (60%), Gaps = 28/406 (7%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L GS +WEGLLDPLD+ LRR LI YG M++A Y++FI E  S N G+CRY R +LL
Sbjct  27    RWRELQGSDHWEGLLDPLDAGLRRCLIAYGEMITATYEAFIGERRSPNAGMCRYRRADLL  86

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
             R    D  +P  Y  T+Y Y+ ++       L+         ++ NWMGYVAVATD+G A
Sbjct  87    RRV--DVSHPGWYAATRYIYATASAEVRGEALLSPLCRHGRARECNWMGYVAVATDEGAA  144

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD----SNPLVHKGFYDMYTAVNP  730
             ALGRRDI+VAWRGT RA EW+ + +     A  I G +    S+P VH+G+  +YT+ + 
Sbjct  145   ALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGADGSDPSVHRGYLSLYTSADE  204

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
                L   SAR Q+  E+ RL+++YKDEE SIT+ GHSLG++LATLNA D+V N  NK S 
Sbjct  205   GSKLSKKSARMQVLTEIARLMDKYKDEETSITVVGHSLGATLATLNAADIVANACNKSSG  264

Query  911   I------PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                    PVTA +F SP+ G+R F++   +L   L++LR+ +  D +P  PP G      
Sbjct  265   FDDGRRAPVTAVVFGSPRTGDRAFRDVFHRLR-GLRMLRVRNKPDRIPHYPPVG------  317

Query  1073  LPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDV  1246
                  Y  VG+E   D  +S +L   G ++  H L  +LHGV G+QG  GGF+L  + DV
Sbjct  318   -----YADVGVELLIDTRRSPFLKPHGNESQSHDLEVHLHGVAGWQGDGGGFELVVERDV  372

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             AL+NK  D L   Y +  P  W V  N  MV+  DG W+L+DHE D
Sbjct  373   ALVNKFDDCLADEYPV--PVGWKVHHNKNMVKGPDGRWVLEDHEPD  416



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score =   333 bits (854),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 186/407 (46%), Positives = 256/407 (63%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+G+L PLD DLR Y+IHYG M  A YD+F     SK  G   Y+RK+ 
Sbjct  37    KRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDF  96

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ Y+ S +    ++L+     +   K+SNWMGYVAV  D G
Sbjct  97    FAKVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQG  156

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+VAWRG+V+  EW+ +F+F  V A  IFG+ ++ + +H+G+Y +Y + +  
Sbjct  157   TALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQGWYSIYMSQDER  216

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +ARDQ+  EV RL+++YKDEE+SIT+ GHSLG++LATLNA D+V N  N+    
Sbjct  217   SPFTKANARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIVANGYNRPKSR  276

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +FK   S L D L++LR  +  DI+P  PP G        
Sbjct  277   PDKSFPVTAFVFASPRVGDSDFKKLFSGLED-LRVLRTRNLPDIIPIYPPIG--------  327

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG E   D  KS Y+   G  A++H L  YLHGV G QG+     F+L    D+
Sbjct  328   ---YSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADEFRLDVKRDI  384

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK     M P +W V+KN GMVQQDDG+W L DHE+DD
Sbjct  385   GLVNKSVDGLKD--ECMVPGKWRVLKNKGMVQQDDGSWNLLDHEIDD  429



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 242/400 (61%), Gaps = 22/400 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
              RW++L+G   W+GLLDPLD DLR  +I+YG +  A Y     E  S+  G C ++RK+ 
Sbjct  12    RRWRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSRKDF  71

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L  S  D  NP  Y +TK+ Y+  T+     ++I+S       KQSNWMG+VAVATD+GK
Sbjct  72    L--SRVDVSNPNLYVITKFIYAMCTVSLPDAFMIKSWSKAAWSKQSNWMGFVAVATDEGK  129

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPD  733
               LGRRD++VAWRGT+R  EW+ +     V A  I   G   +P VH G+  +YT+ +P+
Sbjct  130   EVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSVYTSADPE  189

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
                   SAR Q+  E++RL + Y+ EE SIT+ GHSLG++LAT+NA D+V+N  NK    
Sbjct  190   SQYNKQSARYQVLNEIKRLQDMYEHEETSITITGHSLGAALATINATDIVSNGYNKS--C  247

Query  914   PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYE  1093
             PV+AF+F SP+VG  +F+ A     D L++LR+ ++ D+VP  P  G           Y 
Sbjct  248   PVSAFVFGSPRVGNPDFQKAFDSAPD-LRLLRIRNSPDVVPNWPKLG-----------YS  295

Query  1094  HVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
               G E   D  KS YL   G   +WH +  Y+HGV G QGS GGFKL  D D+AL+NK+ 
Sbjct  296   DAGTELMIDTGKSPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDIALVNKHE  355

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             D LK  Y++  P+ W+VV+N GMV+  DG W L DHE DD
Sbjct  356   DALKNEYAI--PSSWWVVQNKGMVKGTDGRWHLADHEDDD  393



>ref|XP_006491814.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
Length=407

 Score =   332 bits (851),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 198/415 (48%), Positives = 247/415 (60%), Gaps = 45/415 (11%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             + WK+LSGS +W+GLL PL+ +LRRY+IHYG    A YDSF +E ISK  G  RYA ++ 
Sbjct  8     DNWKELSGSNHWDGLLKPLNINLRRYIIHYGETAQANYDSFNDETISKMYGFPRYAPEDF  67

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                    NGNP+KY VT Y Y     R+ T+ L     PD    QS W+GYVAVATD+GK
Sbjct  68    FYHVALHNGNPYKYTVTNYLYG----RSDTD-LWDWVLPD----QSAWIGYVAVATDEGK  118

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ--DSNPLVHKGFYDMYTAVNPD  733
               LGRRDIL++WRGT  AAEW K+FQF    A  +FG   D  P+VH GF+ +Y   NPD
Sbjct  119   TLLGRRDILISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVHLGFHSLYVQSNPD  178

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD---  904
                   SA+DQ+R  VR LV++Y DEEMSIT+ GHSLGS+LATLNA DL  N  NK    
Sbjct  179   STYCKFSAKDQVRSAVRTLVDKYGDEEMSITVIGHSLGSALATLNAADLAANGYNKPTGS  238

Query  905   ---SPIPVTAFLFASPKVGERNFKNAVS--KLADNLKILRLTDAKDIVPKLPPFGVKVNT  1069
                S   VT  +FASP+VG+  FK A    KL   L++LR+T+  DIVP +PP       
Sbjct  239   DTASGCMVTTIVFASPRVGDSAFKTAFEDQKL---LRLLRVTNKNDIVPNVPPV------  289

Query  1070  TLPIISYEHVGMEFRFDASKSNYLD------GFKASWHTLVTYLHGVDGFQGSQG----G  1219
                   Y  VG E + DA+KS Y+          +  H L  YLHG+ G   SQG     
Sbjct  290   ---FSGYVDVGRELKVDATKSTYVKTVIPPLSLPSVLHNLENYLHGIAG--TSQGDDDDD  344

Query  1220  FKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             F+L  D D+ALLNK +D LK  Y +  P  W+ VKN GMVQ D+G W L+D+  D
Sbjct  345   FELAIDRDIALLNKGLDLLKDEYGV--PPNWWTVKNKGMVQLDNGFWKLEDYVPD  397



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score =   333 bits (854),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 188/460 (41%), Positives = 254/460 (55%), Gaps = 78/460 (17%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L+G  NW+ LLDPLD DLRR +IHYG    A YD+F +E  S   G  RY++ N  
Sbjct  8     RWRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSRYSKANFF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
                  + GNP+KY +TK+ Y+ S I     ++I+S   +   ++SNWMGYVAVATD+GKA
Sbjct  68    SGLFLEKGNPYKYNITKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVAVATDEGKA  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
              LGRRDIL+AWRG+V+A EWI +F+F  V A  I    ++  VH+G+  +YT+ +P    
Sbjct  128   VLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDAKVHQGWLSIYTSDDPRSPY  187

Query  743   KGVSARD-------QIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
                SAR        Q+ EEV+RLVE++KDEE++IT+ GHSLG++L  LNAVD+V N +NK
Sbjct  188   NTTSARQQSITVKFQVLEEVKRLVEEFKDEEINITITGHSLGAALGILNAVDIVANGLNK  247

Query  902   DSPIP-----VTAFLFASPKVGERNFKNAVSKL--ADNLKILRLTDAKDIVPKLPPFGVK  1060
              +  P     VTAFLF  P VG+ NF+N  S L    +L++LR+ +A D+VP  P     
Sbjct  248   PTDHPDKACLVTAFLFGCPLVGDANFRNVFSILNSTQHLRLLRIRNAIDVVPNYP-----  302

Query  1061  VNTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQ-------  1213
                  P+I Y  VG E   +   S +L       SWH L  YLHG+ G QGS        
Sbjct  303   -----PMIGYTQVGEELVINTDTSPFLKESAEPMSWHNLEIYLHGIAGTQGSSVLPATTN  357

Query  1214  -------------------------------------------GGFKLHGDFDVALLNKN  1264
                                                        G FKL    D+ L+NK 
Sbjct  358   KTRTRSRSGSSSSSKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKRDITLVNKV  417

Query  1265  IDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             +D LK  + +  PA+W+  KN GMVQ+DDG+W L DHE D
Sbjct  418   MDALKDEFHV--PAKWWCEKNKGMVQEDDGSWKLMDHESD  455



>ref|XP_006428509.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
 gb|ESR41749.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
Length=407

 Score =   330 bits (847),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 197/415 (47%), Positives = 246/415 (59%), Gaps = 45/415 (11%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             + WK+LSGS +W+GLL PL+ +LRRY+IHYG    A YDSF +E ISK  G  RYA ++ 
Sbjct  8     DNWKELSGSNHWDGLLKPLNINLRRYIIHYGETAQANYDSFNDETISKMYGFPRYAPEDF  67

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                    NGNP+KY VT Y Y     R+ T+ L     PD    QS W+GYVAVATD+GK
Sbjct  68    FYHVALHNGNPYKYTVTNYLYG----RSDTD-LWDWVLPD----QSAWIGYVAVATDEGK  118

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ--DSNPLVHKGFYDMYTAVNPD  733
               LGRRDIL++WRGT  AAEW K+FQF    A  +FG   D  P+VH GF+ +Y   NPD
Sbjct  119   TLLGRRDILISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVHLGFHSLYVQSNPD  178

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD---  904
                   SA+DQ+R  VR LV++Y DEEMSIT+ GHSLGS+LATLNA DL  N  NK    
Sbjct  179   STYCKFSAKDQVRSAVRTLVDKYGDEEMSITVIGHSLGSALATLNAADLAANGYNKPTGS  238

Query  905   ---SPIPVTAFLFASPKVGERNFKNAVS--KLADNLKILRLTDAKDIVPKLPPFGVKVNT  1069
                S   VT  +FASP+VG+  FK A    KL   L++LR+T+  DIVP +PP       
Sbjct  239   DTASGCMVTTIVFASPRVGDSAFKTAFEDQKL---LRLLRITNKNDIVPNVPPV------  289

Query  1070  TLPIISYEHVGMEFRFDASKSNYLD------GFKASWHTLVTYLHGVDGFQGSQG----G  1219
                   Y  VG E + D +KS Y+          +  H L  YLHG+ G   SQG     
Sbjct  290   ---FSGYVDVGRELKVDTTKSTYVKTVIPPLSLPSVLHNLENYLHGIAG--TSQGDDDDD  344

Query  1220  FKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             F+L  D D+ALLNK +D LK  Y +  P  W+ VKN GMVQ D+G W L+D+  D
Sbjct  345   FELAIDRDIALLNKGLDLLKDEYGV--PPNWWTVKNKGMVQLDNGFWKLEDYVPD  397



>ref|XP_008345355.1| PREDICTED: phospholipase A1-IIgamma-like [Malus domestica]
Length=407

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/401 (44%), Positives = 239/401 (60%), Gaps = 34/401 (8%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ L G  +WEGLLDPLD DLRR ++H G  V+A+ DSFI++P SKN GL RY   +L 
Sbjct  36    RWRLLGGETDWEGLLDPLDIDLRRCILHXGERVAAIGDSFISDPRSKNCGLPRYTXTHLF  95

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G +N NP+KY V KY Y+ + +                  +S W+GYVAV T +GK 
Sbjct  96    SKVGLENSNPYKYTVNKYIYAATEVLPG---------------KSIWLGYVAVTTXEGKE  140

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
              LGRRDILV WRGT   AEW  +  F  V A  I G   +P VH GF+  Y + +P+   
Sbjct  141   VLGRRDILVTWRGTELDAEWGVDLLFDLVSASDILGDKYDPKVHHGFHSYYNSADPESPY  200

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP--  916
                S R Q+   ++ +V+QYKDEE+SIT+ GHS+G + A LNA D+V N  NK +  P  
Sbjct  201   SKTSCRAQVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNATDIVCNGYNKPTDRPDK  260

Query  917   ---VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
                VT+ +FASP++G++ F +  S L  NL +LR+T++ DIVP LPP             
Sbjct  261   ACLVTSIVFASPRLGDQGFHDVFSSLK-NLHVLRVTNSYDIVPHLPPLE----------K  309

Query  1088  YEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
             Y  VG E + D  KS YL   K   H L  YLHGV G QG + GF+L  + D+AL+NK +
Sbjct  310   YVDVGKELKIDTLKSPYLKNAKKDAHRLEIYLHGVAGTQG-RNGFQLVINRDIALVNKKL  368

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
             D LK  Y+++   +W+  KN  MVQ DDG+W+L DHE DD+
Sbjct  369   DGLKDEYNVI--VKWWTEKNKSMVQMDDGSWVLLDHEKDDV  407



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 176/399 (44%), Positives = 245/399 (61%), Gaps = 22/399 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L+G+  W+GLLDPLD DLR+ +I+YG +  A Y     E  S+  G C + RK+ L
Sbjct  13    RWRELNGANYWKGLLDPLDIDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRRKDFL  72

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               S  D  NP  YE+TK+ Y+  T+    +++I+        KQSNWMG+VAVATD+GK 
Sbjct  73    --SRVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKE  130

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPDP  736
              LGRRD++VAWRGT+R  EW+ +     V A  I   G  ++P VH G+  +YT+ +P  
Sbjct  131   VLGRRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSANDPRVHGGWLSVYTSTDPGS  190

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  SAR Q+ +EV RL + YK EE SIT+ GHSLG++LAT++A D+V+N  NK    P
Sbjct  191   RYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNGYNK--TCP  248

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             V+AF+F SP+VG  +F+ A    A++L++LR+ ++ D+VP  P  G           Y  
Sbjct  249   VSAFVFGSPRVGNSDFQKAFDS-AEDLRLLRVRNSPDVVPNWPKLG-----------YSD  296

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
              G E   D  +S Y+   G   +WH +  Y+HGV G QGS GGF+L  D D+AL+NK+ D
Sbjct  297   AGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHED  356

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              LK  YS+  P  W+VV+N GMV+  DG W L DHE DD
Sbjct  357   ALKEEYSI--PPSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 175/399 (44%), Positives = 244/399 (61%), Gaps = 22/399 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L+G+  W+GLLDPLD DLR+ +I+YG +  A Y     E  S+  G C + RK+ L
Sbjct  13    RWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRRKDFL  72

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               S  D  NP  YE+TK+ Y+  T+    +++I+        KQSNWMG+VAVATD+GK 
Sbjct  73    --SRVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKE  130

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPDP  736
              LGRRD++VAWRGT+R  EW+ +       A  I   G   +P VH G+  +YT+ +P  
Sbjct  131   VLGRRDVMVAWRGTIRVLEWMDDLDISLAPASEIVRPGSADDPRVHGGWLSVYTSTDPGS  190

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  SAR Q+ +EV RL + YK EE SIT+ GHSLG++LAT++A D+V+N  NK    P
Sbjct  191   RYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNGYNK--TCP  248

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             V+AF+F SP+VG  +F+ A    A++L++LR+ ++ D+VP  P  G           Y  
Sbjct  249   VSAFVFGSPRVGNSDFQKAFDS-AEDLRLLRVRNSPDVVPNWPKLG-----------YSD  296

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
              G E   D  +S Y+   G   +WH +  Y+HGV G QGS GGF+L  D D+AL+NK+ D
Sbjct  297   AGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHED  356

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              LK  YS+  P+ W+VV+N GMV+  DG W L DHE DD
Sbjct  357   ALKKEYSI--PSSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 175/399 (44%), Positives = 245/399 (61%), Gaps = 22/399 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L+G+  W+GLLDPLD DLR+ +I+YG +  A Y     E  S+  G C + RK+ L
Sbjct  13    RWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRRKDFL  72

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               S  D  NP  YE+TK+ Y+  T+    +++I+        KQSNWMG+VAVATD+GK 
Sbjct  73    --SRVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKE  130

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPDP  736
              LGRRD++VAWRGT+R  EW+ +       A  I   G  ++P VH G+  +YT+ +P  
Sbjct  131   VLGRRDVVVAWRGTIRVLEWMDDLDISLAPASEIVRPGSANDPRVHGGWLSVYTSTDPGS  190

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  SAR Q+ +EV+RL + YK EE SIT+ GHSLG++LAT++A D+V+N  NK    P
Sbjct  191   RYNEQSARYQVLDEVKRLQDLYKQEETSITITGHSLGAALATISATDIVSNGYNK--TCP  248

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             V+AF+F SP+VG  +F+ A    A++L++LR+ ++ D+VP  P  G           Y  
Sbjct  249   VSAFVFGSPRVGNSDFRKAFDS-AEDLRLLRVRNSPDVVPNWPKLG-----------YSD  296

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
              G E   D  +S Y+   G   +WH +  Y+HGV G QGS GGF+L  D D+AL+NK+ D
Sbjct  297   AGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHED  356

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              LK  YS+  P  W+VV+N GMV+  DG W L DHE DD
Sbjct  357   ALKKEYSI--PPSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>ref|XP_006428645.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
 ref|XP_006480462.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|ESR41885.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
Length=410

 Score =   329 bits (844),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 194/412 (47%), Positives = 251/412 (61%), Gaps = 36/412 (9%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             + WK+LSG+ NW+GLL+PL+ +LRRY+IHYG  V A+YDSF  E  SK  G  RYA ++ 
Sbjct  8     DNWKELSGNNNWDGLLNPLNINLRRYIIHYGERVQAIYDSFNGETTSKMYGFPRYAPEDF  67

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                    NGNP+KY VT Y Y+    R+ T++L +   PD    QS W+GYVAVATD+GK
Sbjct  68    FSNVALQNGNPYKYIVTNYLYA----RSDTDFL-EWLLPD----QSAWIGYVAVATDEGK  118

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS---NPLVHKGFYDMYTAVNP  730
             A LGRRDIL++WRGT  AAEW K+ +F    A  IF +D+    P VH GF+ +Y   + 
Sbjct  119   AVLGRRDILISWRGTQSAAEWFKDIEFSLTAASDIF-EDTYGPTPEVHSGFHSLYVKSDS  177

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD--  904
                    SA+DQ+R  VR LV++YK+EEMSIT+ GHSLGS+LATLNA DLV N  NK   
Sbjct  178   ASTYNKSSAKDQVRSAVRTLVDKYKEEEMSITVIGHSLGSALATLNAADLVANGYNKPTG  237

Query  905   ----SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                 S   VTA +FASP+VG   FK     L ++L +LR+T+  DIVP LPP        
Sbjct  238   SDAASGCMVTAIVFASPRVGNSAFKTVFEDL-NHLHLLRITNKDDIVPDLPP------RY  290

Query  1073  LPIIS--YEHVGMEFRFDASKSNYLDGFKAS---WHTLVTYLHGVDGF---QGSQGGFKL  1228
             LP I+  Y HVG E + D +KS Y+   K S    H L  YLHG+ G          F+L
Sbjct  291   LPHIAMGYVHVGQELKIDTTKSTYVKKRKPSLSVLHNLENYLHGIAGTPKGDDDDDDFEL  350

Query  1229  HGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
               D D+AL+NK +D L+  Y +  P  W+ VKN  MVQ D+G W L+D+  D
Sbjct  351   AIDRDIALVNKGLDLLEVKYGV--PPNWWAVKNKSMVQLDNGFWKLEDYVPD  400



>ref|XP_004301748.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=392

 Score =   328 bits (840),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 180/409 (44%), Positives = 251/409 (61%), Gaps = 44/409 (11%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RWK LSG   WEGLL+PLD DLRRY+IHYG    A+  + +NEP SKN  L RYA++NL 
Sbjct  7     RWKALSGQDEWEGLLNPLDIDLRRYIIHYGERAGAI--AVVNEPKSKNYRLPRYAKENLF  64

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
                G ++GNP+KY V KY Y+     +              L++SN++GYVAV TD+G  
Sbjct  65    SNMGLESGNPYKYMVNKYLYAAHMTFS--------------LQKSNFLGYVAVTTDEGAK  110

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVN-PDPI  739
              LGRRDIL++WRGT    EW  + +   V A  I G++++PLVH+G+   YT ++   P 
Sbjct  111   VLGRRDILISWRGTQLVHEWDVDKETDLVSASHILGEENDPLVHQGWLSYYTNIDLLSPH  170

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----D  904
              +  S RDQ    ++ ++++YKDEE+SIT+ GHS+G+++A LNA D+V N  NK     +
Sbjct  171   NQLSSCRDQAVAALKEILDEYKDEEISITITGHSMGAAMAILNAADIVHNGYNKLACQPN  230

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
               IPVTA +FA P++G + F+N  S L +NL +LR+T+ +DIVP LP             
Sbjct  231   KLIPVTAIVFACPRLGNKGFENVFSGL-ENLHVLRITNDQDIVPNLPDLE----------  279

Query  1085  SYEHVGMEFRFDASKSNYLDGFK--------ASWHTLVTYLHGVDGFQGSQ-GGFKLHGD  1237
              Y HVG E R D  KS +L             + H L  YLHGV G QG +  GFK+  D
Sbjct  280   DYAHVGKELRIDTLKSPFLKVIPDTLVTERIGNLHNLEVYLHGVAGTQGVKSSGFKMEVD  339

Query  1238  FDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
              D+AL+NK+ID LK  ++++  A+W+  KN  M+Q+DDG+W+LDDHE D
Sbjct  340   RDLALVNKHIDGLKDEHNVV--AQWWTEKNKSMIQKDDGSWVLDDHEED  386



>ref|XP_008647947.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
 gb|ACN26514.1| unknown [Zea mays]
 gb|AFW79274.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   328 bits (841),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 196/410 (48%), Positives = 241/410 (59%), Gaps = 34/410 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
              RW++L G+ +W GLLDPLD DLR  LI YG +  A YD F  E  S + G C +   NL
Sbjct  8     SRWRELQGADSWSGLLDPLDIDLRANLIAYGELTQATYDGFNQERRSPHAGACVFGYSNL  67

Query  380   LRESGHDNGNPFKYEVTKYFYS----PSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVAT  547
             L  SG        Y VT++ Y+    P          +    P++  ++SNWMGYVAVAT
Sbjct  68    LAGSGAAAAG--SYAVTRFIYATSALPGVPEAFLLLPLPDLLPESWSRESNWMGYVAVAT  125

Query  548   DDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG--QDSNP--LVHKGFYDMY  715
             DDG AALGRRDILVAWRGT+R  EW+ +F F  V A  + G    +NP  LVH+GF  +Y
Sbjct  126   DDGVAALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFALVHRGFLSVY  185

Query  716   TAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPI  895
             T+ NPD      SARDQ+  EV RLV  YKDE  SIT+ GHSLG+SLATLNAVDL  N +
Sbjct  186   TSSNPDSKYNQTSARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLNAVDLAANGV  245

Query  896   N------KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFG-  1054
             N         P PVTA +FASP+VG+ NFK A++   D L+ L + +A DIVP  PP G 
Sbjct  246   NAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFPD-LRALHVKNAGDIVPTYPPLGY  304

Query  1055  VKVNTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKL  1228
             V V   LPI +             +S YL   G  A+ H L  YLHGV G QGS GGF+L
Sbjct  305   VDVAVQLPIAT------------GRSPYLRQPGTIATLHNLECYLHGVAGEQGSAGGFRL  352

Query  1229  HGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
               D DVAL+NK  D LK  Y +  PA+W+V KN  MV+  DG + L D E
Sbjct  353   EVDRDVALVNKGEDALKDQYPV--PAQWWVAKNKCMVKGADGHYALQDFE  400



>ref|XP_011005461.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score =   328 bits (842),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 187/402 (47%), Positives = 257/402 (64%), Gaps = 25/402 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLD-PLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKN  376
             + WKD SG++NWEGLLD P+++D RRYLIHYG  V A+ D+F     S +  L RY  + 
Sbjct  6     DNWKDFSGAQNWEGLLDHPINTDFRRYLIHYGERVEAIGDAFNYVKASDSYALSRYPPEE  65

Query  377   LLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
             L       NGNPFKY+VTKYFY  S      + + +    D  L+ S W+GYVAV TD+G
Sbjct  66    LFMNVNLQNGNPFKYQVTKYFYLKS------DDIAEVLELD--LEGSAWIGYVAVTTDEG  117

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDP  736
             +  LGRRDILV WRGT+ A+EW ++FQF    A  IFG  +NP VH GF+++Y A +   
Sbjct  118   QRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHGFHNVYVAKSSKS  177

Query  737   ILKGVSARDQIREEVRRLVEQY--KDEEMSITLAGHSLGSSLATLNAVDLVTNPINK---  901
                  SAR+Q+  EVRRLV+ Y    EE+SIT+AGHSLG++LATLN VD+V N  NK   
Sbjct  178   KYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGVDMVANGFNKPSG  237

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVT F +ASP+VG++ F++  + L  +L +LR+ ++KDI+P+LPP        + 
Sbjct  238   SDVGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRLPP--------VF  289

Query  1079  IISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
             ++ Y+ VG +   D+ KS YL   KA  H L  YLH + G+QG +  FKL  D D+ALLN
Sbjct  290   LLGYQDVGEKLEIDSIKSPYLKDPKAQPHNLELYLHTIAGYQGQEEEFKLVVDRDIALLN  349

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             K++D L   Y++  P +W+ VKN+GM+Q D+G W L+D+  D
Sbjct  350   KSLDLLLDKYNI--PPKWWNVKNNGMIQIDNGFWKLNDYVPD  389



>ref|XP_006374295.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
 gb|ERP52092.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
Length=412

 Score =   327 bits (837),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 183/403 (45%), Positives = 251/403 (62%), Gaps = 31/403 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLD-PLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKN  376
             + WKD SG+KNWEGLLD P+++D RRYLIHYG  V A+ D+F     S +  L R+  + 
Sbjct  21    DNWKDFSGAKNWEGLLDHPINTDFRRYLIHYGERVGAIGDAFNYVKASDSYALSRHPPEE  80

Query  377   LLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
             L       NGNPFKY+VTKYFY  S           ++  +  L+ S W+GYVAV TD+G
Sbjct  81    LFMNVNLQNGNPFKYQVTKYFYLKSED--------IAEVLELDLEGSAWIGYVAVTTDEG  132

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDP  736
             +  LGRRDILV WRGT+  AEW+K+F F+ + A  IFG  +NP VH GF+++Y A +   
Sbjct  133   QRVLGRRDILVCWRGTILPAEWLKDFLFVLIPASDIFGATNNPKVHSGFHNVYVAKSSKS  192

Query  737   ILKGVSARDQIREEVRRLVEQY--KDEEMSITLAGHSLGSSLATLNAVDLVTNPINK---  901
                  SAR+Q+  EVRRLV++Y    EE+SIT+AGHSLG++LATLNA+D+V N  NK   
Sbjct  193   KYNKTSAREQVLAEVRRLVDRYALNGEEVSITVAGHSLGAALATLNAMDIVANGYNKPSG  252

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVT F +A P+VG++ F++  + L ++L +LR+ ++KD VP+            P
Sbjct  253   SDIGFPVTVFAYACPRVGDQGFQDVFNGLTNDLHVLRIKNSKDPVPR-----------HP  301

Query  1079  IISYEHVGMEFRFDASKSNY-LDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
             ++ Y+ VG E   D+ KS Y  D  K   H L  YLH + G+QG +  FKL  D D+ALL
Sbjct  302   VLLYQDVGKELEIDSIKSPYPKDPTKP--HDLELYLHTIAGYQGKEEEFKLVVDRDIALL  359

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             NK +D L   Y +  P  W+ VKN+GM+Q D+G W L+D+  D
Sbjct  360   NKGLDLLPDKYKI--PPNWWNVKNNGMIQTDNGFWKLNDYVPD  400



>ref|NP_001151242.1| triacylglycerol lipase [Zea mays]
 gb|ACG42106.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   326 bits (836),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 195/410 (48%), Positives = 242/410 (59%), Gaps = 34/410 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
              RW++L G+ +W GLLDPLD DLR  LI YG +  A YD F  E  S + G C +   +L
Sbjct  8     SRWRELQGADSWSGLLDPLDIDLRANLIAYGELTQATYDGFNQERRSPHAGACVFGYSDL  67

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRP----DTVLKQSNWMGYVAVAT  547
             L  SG        Y VT++ Y+ S +       +    P    ++  ++SNWMGYVAVAT
Sbjct  68    LAGSGAAAAG--SYAVTRFIYATSALPGVPEAFLLLPLPDLLPESWSRESNWMGYVAVAT  125

Query  548   DDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG--QDSNP--LVHKGFYDMY  715
             DDG AALGRRDILVAWRGT+R  EW+ +F F  V A  + G    +NP  LVH+GF  +Y
Sbjct  126   DDGVAALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFALVHRGFLSVY  185

Query  716   TAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPI  895
             T+ NPD      SARDQ+  EV RLV  YKDE  SIT+ GHSLG+SLATLNAVDL  N +
Sbjct  186   TSSNPDSKYNQTSARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLNAVDLAANGV  245

Query  896   N------KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFG-  1054
             N         P PVTA +FASP+VG+ NFK A++   D L+ L + +A DIVP  PP G 
Sbjct  246   NAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFPD-LRALHVKNAGDIVPTYPPLGY  304

Query  1055  VKVNTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKL  1228
             V V   LPI +             +S YL   G  A+ H L  YLHGV G QGS GGF+L
Sbjct  305   VDVAVQLPIAT------------GRSPYLRQPGTIATLHNLECYLHGVAGEQGSAGGFRL  352

Query  1229  HGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
               D DVAL+NK  D LK  Y +  PA+W+V KN  MV+  DG + L D E
Sbjct  353   EVDRDVALVNKGEDALKDQYPV--PAQWWVAKNKCMVKGADGHYALQDFE  400



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score =   326 bits (835),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 173/399 (43%), Positives = 241/399 (60%), Gaps = 22/399 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L+G   W+GLLDPLD DLR  +I+YG +  A Y     E  S+  G C ++RK+ L
Sbjct  16    RWRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSRKDFL  75

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               S  D  NP  Y +TK+ Y+  T+     ++I+S       KQSNWMG+VAVATD+GK 
Sbjct  76    --SRVDVSNPNLYVITKFIYAMCTVNLPDGFMIKSWSKAAWSKQSNWMGFVAVATDEGKE  133

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPDP  736
              LGRRD++VAWRGT+R  EW+ +     V A  I   G   +P VH G+  +YT+ +P+ 
Sbjct  134   VLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSVYTSADPES  193

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  SAR Q+  E++RL + Y+ EE SIT+ GHSLG++LAT++A D+V+N  NK    P
Sbjct  194   QYNKQSARYQVLNEIKRLQDVYEHEETSITITGHSLGAALATISATDIVSNGYNKS--CP  251

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             V+ F+F SP+VG  +F+ A     D L++LR+ ++ D+VP  P  G           Y  
Sbjct  252   VSTFVFGSPRVGNSDFQKAFDSAPD-LRLLRIRNSPDVVPNWPKLG-----------YSD  299

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
              G E   D  +S YL   G   +WH +  Y+HGV G QGS GGFKL  D D++L+NK+ D
Sbjct  300   AGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDISLVNKHED  359

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              LK  Y++  P+ W+VV+N GMV+  DG W L DHE DD
Sbjct  360   ALKNEYAI--PSSWWVVQNKGMVKGTDGRWHLADHEDDD  396



>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1
 pdb|2YIJ|B Chain B, Crystal Structure Of Phospholipase A1
Length=419

 Score =   327 bits (837),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 177/407 (43%), Positives = 251/407 (62%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+G L PLD DLR Y+IHYG    A YD+F     S+  G   Y+RK+ 
Sbjct  21    KRWRDLSGQNHWKGXLQPLDQDLREYIIHYGEXAQAGYDTFNINTESQFAGASIYSRKDF  80

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ Y+ S I    ++L+     +   K+SNW GYVAV  D G
Sbjct  81    FAKVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESNWXGYVAVTDDQG  140

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A LGRRDI+V+WRG+V+  EW+++F+F  V A  IFG+ ++ + +H+G+Y +Y + +  
Sbjct  141   TALLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIYXSQDER  200

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   +ARDQ+  EV RL+E+YKDEE+SIT+ GHSLG++LATL+A D+V N  N+    
Sbjct  201   SPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIVANGYNRPKSR  260

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              D   PVTAF+FASP+VG+ +F+   S L D +++LR  +  D++P  PP G        
Sbjct  261   PDKSCPVTAFVFASPRVGDSDFRKLFSGLED-IRVLRTRNLPDVIPIYPPIG--------  311

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG EF  D  KS Y    G  A++H L  YLHGV G QG+     F+L  +  +
Sbjct  312   ---YSEVGDEFPIDTRKSPYXKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDVERAI  368

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK       P +W V+KN G  QQDDG+W L DHE+DD
Sbjct  369   GLVNKSVDGLKDE--CXVPGKWRVLKNKGXAQQDDGSWELVDHEIDD  413



>ref|XP_003567848.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=425

 Score =   326 bits (836),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 193/429 (45%), Positives = 246/429 (57%), Gaps = 53/429 (12%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G+ +W GLLDPLD+DLR  +I YG +  A YD F  E  S + G C Y   +LL
Sbjct  11    RWRELHGASSWAGLLDPLDADLRASVIAYGELAEATYDGFNTERRSPHAGACVYGHADLL  70

Query  383   RESGHDNGNPFKYEVTKYFYSPSTI----------------RTATNYLI---QSQRPDTV  505
               +G D  +P  Y VTK+ Y+   I                R A  +L+      + +  
Sbjct  71    --AGADVSSPGNYAVTKFLYATCGITQLASTSTTRESTSASRLAKAFLVLPVPELKEEPW  128

Query  506   LKQSNWMGYVAVATDDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG----Q  673
              ++SNWMGYVAVATDDG AALGRRDI+VAWRGT+ + EW+ +  FL   A  + G    +
Sbjct  129   CRESNWMGYVAVATDDGVAALGRRDIVVAWRGTLESLEWVNDLDFLPASAAPVLGPAAEE  188

Query  674   DSNPLVHKGFYDMYTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSS  853
               N +VH GF  +YTA + D      SARDQ+ EEV+RL+E +K E  SITL GHSLG+S
Sbjct  189   HGNAVVHHGFLTVYTASDEDSKYNKTSARDQVLEEVKRLMELHKGEVTSITLTGHSLGAS  248

Query  854   LATLNAVDLVTNPINKDS----------PIPVTAFLFASPKVGERNFKNAVSKLADNLKI  1003
             LA LNAVD+V+N +N  S          P PVTA +FA P VG  +FK+A +  +D L+ 
Sbjct  249   LAILNAVDIVSNGLNTPSTSSSSSSQLPPCPVTAIVFACPHVGNDDFKSAFASFSD-LRA  307

Query  1004  LRLTDAKDIVPKLPPFG-VKVNTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLV  1174
             L + +A+DIVP  PP G V V T              R D S+S YL   G   +WH L 
Sbjct  308   LHVINARDIVPLYPPIGYVDVATA-----------ALRIDTSRSPYLRSPGTPQTWHNLE  356

Query  1175  TYLHGVDGFQGSQG-GFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDD  1351
              YLHGV G QG QG GF+L  D DVAL+NK  D LK  Y +  PA W+VV N GMV+   
Sbjct  357   CYLHGVAGEQGGQGRGFRLEVDRDVALVNKGSDALKDEYPV--PANWWVVSNKGMVRGAG  414

Query  1352  GTWILDDHE  1378
             G W L D E
Sbjct  415   GHWKLKDFE  423



>ref|XP_006374296.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
 gb|ERP52093.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
Length=412

 Score =   325 bits (832),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 184/405 (45%), Positives = 243/405 (60%), Gaps = 32/405 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLL-DPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKN  376
             + WK  SG  NW+GLL  P+++D RRYLIHYG  V A+ D F N   S +  L RY  + 
Sbjct  6     DHWKAFSGFNNWDGLLVHPINTDFRRYLIHYGERVGAIGDGFNNVKASNSFALSRYPPEE  65

Query  377   LLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTV---LKQSNWMGYVAVAT  547
             L    G  NGNPFKY+VTKYFY           L Q    D +   +K+S W+GYVAV T
Sbjct  66    LFSHVGLQNGNPFKYQVTKYFY-----------LKQDDFADYMEFDIKESAWIGYVAVTT  114

Query  548   DDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVN  727
             D+G   LGRRDILV WRGT+ A+EW KN QF  V A  I G   NP +H GF+ +Y A +
Sbjct  115   DEGNTVLGRRDILVCWRGTILASEWAKNLQFDLVSAAEILGGAHNPKMHHGFHSVYLAKS  174

Query  728   PDPILKGVSARDQIREEVRRLVEQY--KDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
                     SAR+Q+  EVRRLV++Y    E++SIT+AGHSLG++LATLNA+D+V+N  NK
Sbjct  175   SSSKYNKTSAREQVLAEVRRLVDKYAHNGEDVSITVAGHSLGAALATLNAMDIVSNGYNK  234

Query  902   D----SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNT  1069
                  +   VT F +ASP++G++ F++  + LA NL +LR+ +  DI+P LPP     NT
Sbjct  235   PAGSYTGFRVTVFAYASPRLGDKGFQDVFNGLA-NLHVLRIKNENDIIPSLPP--AFYNT  291

Query  1070  TLPIISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
                   Y+ +G E   D+SKS YL    A  H L  YLH + G+QG  G F+L  D D+A
Sbjct  292   ------YKDIGEELEIDSSKSPYLKDPNAEPHNLDIYLHAIAGYQGKLGEFRLVIDRDIA  345

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             L+NK+ D L   Y +  P  W  V N GM+Q D+G W L+D+  D
Sbjct  346   LVNKSADVLPEKYKV--PPNWRTVMNKGMIQMDNGFWKLNDYVPD  388



>ref|XP_004961147.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=406

 Score =   324 bits (831),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 193/407 (47%), Positives = 240/407 (59%), Gaps = 32/407 (8%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G+ +W GLLDPLD DLR  LI YG +  A YD F  E  S + G C +   +LL
Sbjct  15    RWRELQGAGSWAGLLDPLDIDLRANLIAYGELTQATYDGFNQEKRSPHCGACVFGYSDLL  74

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRP---DTVLKQSNWMGYVAVATDD  553
               SG        Y VTK+ Y+ S +     +L+        ++  ++SNWMGYVAVATD 
Sbjct  75    ASSGAAAAG--SYSVTKFIYATSALPVPEAFLVLPLPDLLPESWSRESNWMGYVAVATDA  132

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNP----LVHKGFYDMYTA  721
             G AALGRRDILVAWRGT+R  EW+ +F F  V A  + G  +      LVH+GF  +Y +
Sbjct  133   GVAALGRRDILVAWRGTMRNLEWVNDFDFTPVSAAPVLGSAAAANPAALVHRGFLSVYRS  192

Query  722   VNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
              NPD      SARDQ+ EEVRRL+  YKDE  SIT+ GHSLG+SLATLNAVDL  N +N 
Sbjct  193   SNPDSKYNQSSARDQVFEEVRRLMALYKDEVTSITVTGHSLGASLATLNAVDLAANGLNA  252

Query  902   DS-----PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFG-VKV  1063
              +     P PVTAF++ASP+VG+ NFKNA +   D L+ L + +A D+VP  PP G V V
Sbjct  253   PADSSQPPCPVTAFVYASPRVGDANFKNAFASFPD-LRALHVKNAGDVVPLYPPLGYVDV  311

Query  1064  NTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGD  1237
                LPI            D  +S YL   G   + H L  YLHGV G QGS GGFKL  D
Sbjct  312   AVPLPI------------DTGRSPYLRQPGTIPTRHNLECYLHGVAGEQGSAGGFKLEVD  359

Query  1238  FDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
              DVAL NK    LK  Y +  PA+W+V KN  MV+  DG W L D +
Sbjct  360   RDVALANKEEGALKDQYPV--PADWWVAKNKFMVKGADGHWALQDFQ  404



>ref|XP_010686321.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   325 bits (832),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 187/409 (46%), Positives = 252/409 (62%), Gaps = 28/409 (7%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ L G  NWE LLDPLD DLR  +IHYG M  A YD+FI +  SK  G  R+++ N  
Sbjct  41    RWELLMGENNWEDLLDPLDKDLRELIIHYGEMAQAAYDTFIRDKYSKYAGSSRFSKNNFF  100

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQS-QRPDTVLKQSNWMGYVAVATDDGK  559
              + G + G+P+KY VTK+FY+ S I     ++ +S    +   K +N+MGY+AVA DD  
Sbjct  101   AKLGLELGHPYKYRVTKFFYATSAIDVPDAFIFKSLSSIEQSSKDTNFMGYIAVAEDDAV  160

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN-----PLVHKGFYDMYTAV  724
               LGRR+I+VAWRG+V   EW+ + +FL V A  I   + +     P VH+G++ +YT  
Sbjct  161   ELLGRREIVVAWRGSVEFMEWLNDLKFLQVSASDILAHEGDDGEPEPEVHQGWHSIYTTD  220

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-  901
             N     +  SAR Q+  E+ +LVEQYK+EE+SIT+ GHSLG++LATLNA D+V N IN+ 
Sbjct  221   NLSSPFEKTSARQQVLTELTKLVEQYKNEEISITITGHSLGAALATLNAADIVANKINQP  280

Query  902   -----DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVN  1066
                    P  VTA +FASP+VG+ NFK  +SK  D+L +LR+ +A+D VP          
Sbjct  281   KNSPNSKPCKVTAIVFASPRVGDANFKKTLSKY-DDLGVLRVRNAQDFVP----------  329

Query  1067  TTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDF  1240
                P+I Y  VG E   D ++S YL   G  +  H L  Y+HGV G QGS  GFKL  + 
Sbjct  330   -NYPLIDYSDVGEELTIDTTQSAYLKNPGLLSVSHNLEVYMHGVAGTQGSVEGFKLVVER  388

Query  1241  DVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             DVALLNK  D LK +Y  + P  W+V +  GMVQQ DG+W+L DHE+DD
Sbjct  389   DVALLNKFYDFLKDDY--LVPVGWWVAQYKGMVQQADGSWLLMDHEMDD  435



>ref|XP_003574515.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=438

 Score =   324 bits (831),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 185/405 (46%), Positives = 236/405 (58%), Gaps = 31/405 (8%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+ LLDPLD  LR  LI YG +  A YD F +E  S N G C +   +LL
Sbjct  46    RWRELHGETSWKNLLDPLDPHLRATLIAYGELAQATYDGFNSERRSPNAGSCLHGHDDLL  105

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQS--QRPDTVLKQSNWMGYVAVATDDG  556
               S     +P  Y+VT++ Y+ S+I    ++L       PD   + SNW+GYVAVATD+G
Sbjct  106   TAS--SVSSPGHYKVTRFIYATSSIPLPESFLCLPLPSLPDAWSRDSNWIGYVAVATDEG  163

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN----PLVHKGFYDMYTAV  724
               ALGRRDI+VAWRGTV+  EW+ +  F  V A  + G  +      +VH+GF  +YT+ 
Sbjct  164   AEALGRRDIVVAWRGTVKNLEWVNDLDFTPVSAAPVLGSAAGKNRLAVVHRGFLSVYTSS  223

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD  904
             N        SARDQ+ EEVRRLVE +KDEE SIT+ GHSLG+SLATLNAVDLV++  NK 
Sbjct  224   NKSSKFTKTSARDQVLEEVRRLVELHKDEETSITVTGHSLGASLATLNAVDLVSSGTNKP  283

Query  905   S-------PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKV  1063
             S       P PVTA +FASP VG+R F++A     D LK L + +  DIVP  PP G   
Sbjct  284   SSSDGDKKPFPVTAIVFASPHVGDRFFRSAFGSFPD-LKALHVQNVGDIVPLYPPLG---  339

Query  1064  NTTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGD  1237
                     Y  V  E      +S YL   G   + H L  YLHGV G QGS+GGFKL   
Sbjct  340   --------YVDVATELTIRTIRSPYLSVPGTPVTLHNLECYLHGVAGEQGSRGGFKLEVA  391

Query  1238  FDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDD  1372
              DVAL+NK +D L   + +  PA W+  K+  MV+ DDG W L D
Sbjct  392   RDVALVNKGVDALTDEHPV--PAGWWTPKHRCMVRGDDGRWTLQD  434



>ref|XP_011100290.1| PREDICTED: phospholipase A1-IIgamma-like [Sesamum indicum]
Length=395

 Score =   323 bits (827),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 182/408 (45%), Positives = 243/408 (60%), Gaps = 31/408 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ LSG  NW  LL PLDSDL+RYL+HYG M  A  D+F  + +SK +G  +++RK+L
Sbjct  7     QRWRLLSGHNNWTNLLKPLDSDLQRYLLHYGGMAQATNDAFDFDILSKYIGYSKFSRKHL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPS--TIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDD  553
                 G   GNPF+Y+  KY Y+ S   I    +++++     T  K+SNWMGY+AVATD+
Sbjct  67    FERCGLVKGNPFRYKAVKYIYATSGPGISLPESFILKPLSEKTWYKESNWMGYIAVATDE  126

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ--DSNPLVHKGFYDMYTAVN  727
             GKAALGRRDIL+AWRGT+   EW K+F+F  V A  I G+   SN  VH+GF  +YTA N
Sbjct  127   GKAALGRRDILIAWRGTIMPIEWEKDFEFPLVPASKILGKCGGSNAHVHQGFLSIYTATN  186

Query  728   PDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS  907
             P       SARDQ+  E+++L+EQYK EE+SITL GHSLG +L+TL A D+V N  NK  
Sbjct  187   PRSKYSKTSARDQVLSELKKLIEQYKHEELSITLTGHSLGGALSTLCATDIVCNGYNKIC  246

Query  908   -----PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                    PVTAF + +P VG+ NFK+    + D L +L + +  DIVPK P         
Sbjct  247   HNPYKTCPVTAFRYGAPMVGDSNFKHTAESMND-LHMLSIHNVPDIVPKSP--------A  297

Query  1073  LPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLV-TYLHGVDGFQGSQGGFKLHGDFD  1243
             +P   Y  VG E   D+ KS YL   G   +WH L   YLH +    G +         D
Sbjct  298   MP--GYTRVGQEHFVDSKKSPYLTFPGDTYTWHNLEGAYLHSLAIENGGE------PKRD  349

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             +AL+NK    LK  Y +  P  W+  +N GMVQ+ DG+W L D+E D+
Sbjct  350   LALVNKGSGALKPKYGI--PFSWWCEENKGMVQKSDGSWQLRDYEGDE  395



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/400 (43%), Positives = 241/400 (60%), Gaps = 23/400 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L+G   W+GLLDPLD DLR  +I+YG +  A Y     E  S+  G C ++RK+ L
Sbjct  16    RWRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSRKDFL  75

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               S  D  NP  Y +TK+ Y+  T+     ++I+S       KQSNWMG+VAVATD+GK 
Sbjct  76    --SRVDVSNPNLYVITKFIYAMCTVNLPDGFMIKSWSKAAWSKQSNWMGFVAVATDEGKE  133

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPDP  736
              LGRRD++VAWRGT+R  EW+ +     V A  I   G   +P VH G+  +YT+ +P+ 
Sbjct  134   VLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSVYTSADPES  193

Query  737   ILKGVSAR-DQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
                  SAR  Q+  E++RL + Y+ EE SIT+ GHSLG++LAT++A D+V+N  NK    
Sbjct  194   QYNKQSARYQQVLNEIKRLQDVYEHEETSITITGHSLGAALATISATDIVSNGYNKS--C  251

Query  914   PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYE  1093
             PV+ F+F SP+VG  +F+ A     D L++LR+ ++ D+VP  P  G           Y 
Sbjct  252   PVSTFVFGSPRVGNSDFQKAFDSAPD-LRLLRIRNSPDVVPNWPKLG-----------YS  299

Query  1094  HVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
               G E   D  +S YL   G   +WH +  Y+HGV G QGS GGFKL  D D++L+NK+ 
Sbjct  300   DAGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDISLVNKHE  359

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             D LK  Y++  P+ W+VV+N GMV+  DG W L DHE DD
Sbjct  360   DALKNEYAI--PSSWWVVQNKGMVKGTDGRWHLADHEDDD  397



>gb|KFK42950.1| hypothetical protein AALP_AA1G060100 [Arabis alpina]
Length=412

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/407 (42%), Positives = 240/407 (59%), Gaps = 27/407 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+LSG   W+GLLDPLD DLRRY+IHYG M    YD+F  +  SK  G C Y++K +
Sbjct  7     KRWKELSGLNKWQGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSKYAGDCYYSKKQV  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+Y VTKY Y+ ++I+    ++++S   D    Q+NWMGY+AVATD+GK
Sbjct  67    FARTGYLKANPFRYNVTKYIYATASIKLPICFIVKSLSKDATRVQTNWMGYIAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF---GQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F    A  +F        P +  G+ D+YTA + 
Sbjct  127   AMLGRRDIVVAWRGTLQPYEWANDFDFPLESAASVFPVTDPKDVPRIGSGWLDIYTASDS  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN----  898
             +      SA++Q++ E+ RL+E YK+EE+SIT  GHSLG  ++TL A DLV N  N    
Sbjct  187   NSPYDTTSAQEQVQGELTRLLELYKNEEISITFTGHSLGGVMSTLAAADLVHNRKNTINT  246

Query  899   --KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
               +   +P+T F F  P++G+++FK  V  L   + ILR+ +  D+ P            
Sbjct  247   GLQKKTVPITVFAFGCPRIGDQDFKKLVDSL-QQINILRIVNVPDVAPH-----------  294

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  VG E + +   S YL     F+ ++H L  YLHG+ G Q   G F L    D
Sbjct  295   YPLLLYAEVGEELQINTLNSTYLKRSLNFR-NYHNLEIYLHGLAGMQDRAGVFTLQVGRD  353

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             V+L+NK +D LK  Y  + P+ W  + N GMVQ DDGTW LD H  D
Sbjct  354   VSLVNKGLDALKDEY--LVPSIWRCLANKGMVQMDDGTWQLDVHRRD  398



>ref|XP_011005460.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=412

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 182/402 (45%), Positives = 244/402 (61%), Gaps = 26/402 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLL-DPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKN  376
             + WK  SG  NW+GLL  P+++D RRYLIHYG  V A+ D F N   S +  L RY  + 
Sbjct  6     DHWKAFSGFNNWDGLLIHPINTDFRRYLIHYGERVGAIGDGFNNVKASNSFALSRYPPEE  65

Query  377   LLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
             L    G  NGNPFKY+VTKYFY    +    +Y+      +  +K+S W+GYVAV TD+G
Sbjct  66    LFSHVGLQNGNPFKYQVTKYFYL--KLDDFADYM------EFDIKESAWIGYVAVTTDEG  117

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDP  736
                LGRRDILV WRGT+  +EW KN QF  V A  I G   NP +H GF+ +Y A +   
Sbjct  118   NTVLGRRDILVCWRGTILGSEWAKNLQFDLVSAAEILGGAHNPKMHHGFHSVYLAKSSSS  177

Query  737   ILKGVSARDQIREEVRRLVEQY--KDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD--  904
                  SAR+Q+  EVRRLV++Y    E++SIT+AGHSLG++LATLNA+D+V+N  NK   
Sbjct  178   KYNKTSAREQVLAEVRRLVDKYAHNGEDVSITVAGHSLGAALATLNAMDIVSNGYNKPAG  237

Query  905   --SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
               +   VT F +ASP++G++ F++  + LA NL +LR+ + KDI+P LPP     NT   
Sbjct  238   SYTGFRVTVFAYASPRLGDKGFQDVFNGLA-NLHVLRIKNEKDIIPNLPP--AFYNT---  291

Query  1079  IISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
                Y+ +G E   D+SKS YL    A  H L  YLH + G+QG  G F+L  D D+AL+N
Sbjct  292   ---YKDIGEELEIDSSKSPYLKDPNAEPHNLDIYLHTIAGYQGKLGEFRLVIDRDIALVN  348

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             K+ D L   Y +  P  W  V N GM+Q D+G W L+D+  D
Sbjct  349   KSADVLPEKYKV--PPNWRTVMNKGMIQLDNGFWKLNDYVPD  388



>ref|XP_010518796.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score =   322 bits (824),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 179/402 (45%), Positives = 236/402 (59%), Gaps = 51/402 (13%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             W+DLSG  NW+GLL PLD DLR+Y+IHYG M  A YD+F +   SK  G   Y+R++   
Sbjct  9     WRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSIYSRQDFFS  68

Query  386   ESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
             + G +  NP+ KY+VTK+ Y+ S I    ++L+     +   K+SNWMGYVAV TD+G  
Sbjct  69    KVGLEKNNPYSKYQVTKFLYATSQIEVPDSFLVFPVSREGRTKESNWMGYVAVTTDEGTE  128

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPDPI  739
              LGRRDI+VAWRG+++  EWI +F F+ V A  IFG+ S  + VH+G+Y +YT+ +    
Sbjct  129   LLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGVQVHQGWYSIYTSSDERSP  188

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----D  904
                 SARDQ+ +EVRRLVE+YKDEE+SIT+ GHSLG++LATLNA D+V N  N      D
Sbjct  189   FNKSSARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAADIVANGYNATQNRPD  248

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
              P  VTAF+FASP+VG  +FK   S    +L+ LR+ +  DIVP  PP G          
Sbjct  249   KPCLVTAFVFASPRVGNPDFKKLFSGYK-SLRGLRVRNLPDIVPTYPPLG----------  297

Query  1085  SYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
              Y  VG E   D  KS YL   G   S+H L   LHGV G QG+                
Sbjct  298   -YSDVGEELTIDTRKSPYLKTPGDLVSFHNLEANLHGVAGTQGTT---------------  341

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
                             + + ++N GMVQQDDG+W L DHE+D
Sbjct  342   ---------------TKEFKLQNKGMVQQDDGSWKLMDHEMD  368



>ref|XP_011027708.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
 ref|XP_011015585.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=396

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 176/399 (44%), Positives = 247/399 (62%), Gaps = 30/399 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPI--SKNVGLCRYARK  373
             +RW++LS  K+W+GLL+PLD DLRR +I+YG   +A+ ++F N  +  +   G  RYA +
Sbjct  14    DRWRELSSEKSWKGLLNPLDIDLRRSIINYGDRATAIGNAFNNTSLRSTNCCGFSRYAPR  73

Query  374   NLLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDD  553
             +   ++G    NP+KY+VT + Y     +     LI          +S W  YVAVAT++
Sbjct  74    DFFSKTGIQTRNPYKYQVTDFIYGEVDAKI----LILDD------SESTWSAYVAVATNE  123

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPD  733
             GKA LGRRDI+V+WRGT+ + EW+K+F    + AP IF  D   + HKGF+ +YTA +  
Sbjct  124   GKALLGRRDIVVSWRGTLLSVEWLKDFDAELISAPEIFRNDVAKM-HKGFHSLYTAKDDK  182

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   SARDQ+   V +LVEQYKDEE+SIT+ GHSLG+++ATLNA+D+V    NK    
Sbjct  183   STYSKTSARDQVLAAVSKLVEQYKDEEISITVTGHSLGAAIATLNALDIVVKGCNKTTGE  242

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              +   PVTA +FASP+VG+ NFK  + +  ++L +LR+T+ +DIVP LP          P
Sbjct  243   QNKAFPVTAIVFASPRVGDANFKK-LCEGQEDLHVLRVTNERDIVPNLPL------DMPP  295

Query  1079  IISYEHVGMEFRFDASKSNYLDGFK--ASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
               S++HVG E R D  KS Y+        +H L  Y+HGV G QGS+GGF L  D D+AL
Sbjct  296   YFSFKHVGEELRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSEGGFNLEVDRDIAL  355

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVK-NSGMVQQDDGTWIL  1366
             +NK++D LK  Y +  PA W+ ++ N GMV  DDG W L
Sbjct  356   VNKDLDGLKDEYKI--PAGWWGIEDNKGMVLGDDGRWKL  392



>ref|XP_010457749.1| PREDICTED: phospholipase A1-IIalpha [Camelina sativa]
Length=423

 Score =   321 bits (823),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 170/405 (42%), Positives = 243/405 (60%), Gaps = 27/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+L+G K W+GLLDPLD DLRR LIHYG M    YD+F  +  S+  G C Y++K L
Sbjct  7     KRWKELNGQKKWQGLLDPLDPDLRRCLIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKKQL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G    NPF+YEVTKY Y+ ++I+    ++++S   D    Q+NWMGY+AVATD GK
Sbjct  67    FARTGFLKANPFRYEVTKYIYATASIKLPICFIVKSLSKDASRVQTNWMGYIAVATDQGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF---GQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F    A  +F       NP +  G+ D+YTA +P
Sbjct  127   AMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVKDPKDNPRIGSGWLDIYTASDP  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLV---TNPIN-  898
                    SAR+Q++ E++RL+E YK+EE+SIT  GHSLG+ ++ L+A D+V    + IN 
Sbjct  187   RSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAADIVYGKNSNINI  246

Query  899   --KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
               +   +P+T F F SP++G+++FK  V  L   L ILR+ +  D+ P            
Sbjct  247   SLQKKQVPITVFAFGSPRIGDQDFKKIVDSLQP-LNILRIVNVPDVAPH-----------  294

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  +G     +   S YL     F+ ++H L  YLHG+ G Q + G FKL    D
Sbjct  295   YPLLLYAEIGEVLEINTLNSTYLKRSLNFR-NYHNLEIYLHGIAGMQDAAGVFKLEIGRD  353

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK +D LK  Y  + P+ W  + N GMVQ +DGTW L+ H 
Sbjct  354   ISLVNKGLDALKDEY--LVPSTWRCLANKGMVQMNDGTWKLNVHR  396



>ref|XP_002305084.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
 gb|EEE85595.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
Length=396

 Score =   320 bits (821),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 177/399 (44%), Positives = 243/399 (61%), Gaps = 30/399 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPI--SKNVGLCRYARK  373
             +RW++LSG K+W GLL+PLD DLRR +I+YG   +A+ ++F    +  +   G  RYA +
Sbjct  14    DRWRELSGEKSWNGLLNPLDIDLRRSIINYGDRATAIGNAFNKTSLRSANCCGFSRYAPR  73

Query  374   NLLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDD  553
             +   ++G    NP+KY+VT + Y     +     L+          +S W  YVAVAT++
Sbjct  74    DFFSKTGIQTRNPYKYQVTDFIYGEVDAKI---LLLDDS-------ESTWSAYVAVATNE  123

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPD  733
             GKA LGRRDI+V+WRGT  + EW+K+F    +  P IFG D   + HKGF+ +YTA +  
Sbjct  124   GKALLGRRDIVVSWRGTSLSVEWLKDFDAELISVPGIFGNDVAKM-HKGFHSLYTAKDDK  182

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   SARDQ    V +LV+QYKDEE+SIT+ GHSLG+++ATLNA+D+V    NK    
Sbjct  183   STYSKTSARDQALAAVSKLVDQYKDEEISITVTGHSLGAAIATLNALDIVVKGYNKTTGE  242

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              +   PVTA +FASP+VG+ NFK     L D L +LR+T+ KDIVP LP          P
Sbjct  243   QNKAFPVTAIVFASPRVGDANFKKLCEGLED-LHVLRVTNEKDIVPNLPL------DIPP  295

Query  1079  IISYEHVGMEFRFDASKSNYLDGFK--ASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
               S++HVG E R D  KS Y+        +H L  Y+HGV G QGS+GGF L  D D+AL
Sbjct  296   SFSFKHVGEELRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSEGGFNLEVDRDIAL  355

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVK-NSGMVQQDDGTWIL  1366
             +NK++D LK  Y++  PA W+ ++ N GMV  DDG W L
Sbjct  356   VNKDLDGLKDEYNI--PAGWWGIEDNKGMVLGDDGRWKL  392



>ref|XP_003569464.1| PREDICTED: phospholipase A1-II 3-like [Brachypodium distachyon]
Length=418

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 173/404 (43%), Positives = 228/404 (56%), Gaps = 25/404 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+++SG   W GLLDPL+ +LRR +I YG +  A  D+FI +P S   G  RY     
Sbjct  23    QRWREISGRDQWSGLLDPLNIELRREIIRYGELAQATSDAFIGDPASPYAGASRYGPGTF  82

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               +      +P  Y VT++ Y+ S+ R    ++ +         +SNWMGYVAVATD   
Sbjct  83    FYKV--QAADPGAYRVTRFLYATSSARLRDAFMTRPVPAGAWSTESNWMGYVAVATDGAA  140

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              ALGRRD++VAWRGT R  EW  +   + V A  + G      VH+GF  +YT+ N    
Sbjct  141   RALGRRDVVVAWRGTKRMVEWASDLDIVLVPAAGVVGPGGRGSVHRGFLSLYTSKNSTSR  200

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK------  901
                 SAR+Q+  EVRRL++ YKDE  S+TL GHSLG++L+TLNA+D+V N IN       
Sbjct  201   FNKQSAREQVLTEVRRLLDTYKDENCSVTLTGHSLGAALSTLNAIDIVANGINALRSSSG  260

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              +  +PVTA LF SP+VG+  FK A+  +A  + +LR+ +A DIVP          T LP
Sbjct  261   DNITVPVTAILFGSPRVGDEQFKKALDSMAGAVSLLRVRNAPDIVP----------TILP  310

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQ--GSQGGFKLHGDFDV  1246
                Y  VG+E   D  KS YL      A WH L  YLH V G Q  G   GF L  D DV
Sbjct  311   TPFYRDVGVELLVDTLKSPYLKTPAGPAQWHNLECYLHAVAGTQGPGDDAGFSLEVDRDV  370

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             AL+NK  D LKG Y +  PA W+   N GMV+   G W+L+DHE
Sbjct  371   ALVNKEEDALKGEYPV--PASWWAENNKGMVKNATGHWVLEDHE  412



>ref|NP_001152663.1| triacylglycerol lipase precursor [Zea mays]
 gb|ACF88339.1| unknown [Zea mays]
 gb|ACG48810.1| triacylglycerol lipase [Zea mays]
 gb|AFW83435.1| Triacylglycerol lipase [Zea mays]
Length=430

 Score =   321 bits (823),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/403 (44%), Positives = 230/403 (57%), Gaps = 27/403 (7%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             W +LSG  NW+GLLDPLD DLRR +I YG +  A  D+FI +P S   G  RYA    LR
Sbjct  37    WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  96

Query  386   ESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKAA  565
              +     +P  Y VT++ Y+ S+ R    ++ +   P     +SNWMGYVAVATD G A 
Sbjct  97    RA--QAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAVATDAGVAR  154

Query  566   LGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD---SNPLVHKGFYDMYTAVNPDP  736
             LGRRDI+VAWRGT RA EW  +     V A  + G     S P VH+GF  +Y + N   
Sbjct  155   LGRRDIVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYASRNSTS  214

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP--  910
                  SAR+Q+  E+RRL++ YK E  SITL GHSLG++L+TL A+D+V N +N   P  
Sbjct  215   RFNKQSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTAIDIVANGLNVRGPNN  274

Query  911   --IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
               +PV A +F SP+VG+  FK A        ++LR+ +A D+VP          T LP  
Sbjct  275   DTVPVAAIVFGSPRVGDDQFKKAFDS-TPGARLLRVRNAPDVVP----------TVLPNA  323

Query  1085  SYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGS--QGGFKLHGDFDVA  1249
              Y+ VG+E   D  KS +L       A+WH L  YLHGV G QG+    GF L  D DVA
Sbjct  324   FYKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSLEVDRDVA  383

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             L+NK +D L  +Y +  PA W+V  N GM +   G W+L DHE
Sbjct  384   LVNKEVDALSDDYPV--PAAWWVEGNKGMTRDASGRWVLQDHE  424



>ref|NP_001132361.1| uncharacterized protein LOC100193806 precursor [Zea mays]
 gb|ACF81176.1| unknown [Zea mays]
 gb|AFW74937.1| hypothetical protein ZEAMMB73_515693 [Zea mays]
Length=427

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 184/408 (45%), Positives = 242/408 (59%), Gaps = 30/408 (7%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G+ +W GLLDPLD DLRR +I YG +V A YD F  E  S + G C Y R +LL
Sbjct  32    RWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACLYGRADLL  91

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTV---LKQSNWMGYVAVATDD  553
                G       +Y VT++ Y+ S +    +       P+T     ++SNW+GYVAVATD+
Sbjct  92    PGVGVAAAG--RYAVTRFVYATSALPVPGSDFPLLPLPETREAWTRESNWIGYVAVATDE  149

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS--NPL--VHKGFYDMYTA  721
             G A LGRRD++VAWRGTV+  EW  +F F  V A  + G  +  NPL  VH+GF  +YT+
Sbjct  150   GAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAAPVLGSAAAANPLAVVHQGFLSVYTS  209

Query  722   VNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
              N D      SARDQ+ EEVRRL+E YK E  SIT+ GHSLG++LATLNAVD+  N +N+
Sbjct  210   SNADSRFNKASARDQVLEEVRRLMELYKGEATSITVVGHSLGAALATLNAVDIAANGLNE  269

Query  902   DS------PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKV  1063
              S      P PVTA LFA P VG+R F+ A      +L+ L + +A D+VP +PP    V
Sbjct  270   GSGSSQQLPCPVTAILFACPHVGDRFFRAAFVGYFRDLRALHVRNAGDVVPVVPPLAY-V  328

Query  1064  NTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGS-QGGFKLHG  1234
             +  + ++           D S+S YL   G   + H L  YLHGV G QGS  GGF+L  
Sbjct  329   DVAVAVLP---------IDTSRSPYLRSPGPAGTLHNLECYLHGVAGEQGSAAGGFRLEV  379

Query  1235  DFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             D DVAL+NK  D L+  Y +  PA W+V +N  MV+  DG W+L D E
Sbjct  380   DRDVALVNKGADALRDEYPV--PANWWVPENRWMVRGSDGHWVLKDFE  425



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/409 (42%), Positives = 243/409 (59%), Gaps = 31/409 (8%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +WK+L GS +WEGLLDPLD  LRR L+ YG M+ A Y++FI E  S N G+CRY R +L 
Sbjct  10    QWKELQGSNHWEGLLDPLDVGLRRCLVTYGEMIMATYEAFIGESRSPNAGMCRYRRADLF  69

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
             +    D  +P  YE T+Y Y+ ++       L++    +   ++ NWMGYVAVATD+G A
Sbjct  70    QRV--DVSHPGWYEATRYLYATASAEVRGKVLLRPLCRERCARECNWMGYVAVATDEGAA  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD--------SNPLVHKGFYDMYT  718
             ALGRRDI+VAWRGT RA EW+ + +     A  I G +        S+P VH+G+  +YT
Sbjct  128   ALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGGGGGSGGSDPSVHRGYLSLYT  187

Query  719   AVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN  898
             +      L   SAR Q+  E+ RL+++YK EE SIT+ GHSLG+++ATLNAVD+  N  N
Sbjct  188   SDYEGSNLSKQSARMQVLTEIVRLMDKYKGEETSITVVGHSLGATMATLNAVDIAANAYN  247

Query  899   K-----DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKV  1063
             K         PVTA +F SP+ G+++F++   +  D L++LR+ +  D +P  PP G   
Sbjct  248   KIPGYDSRRAPVTAIVFGSPRTGDQDFRDVFHRTPD-LRMLRVRNRPDRIPHYPPVG---  303

Query  1064  NTTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGD  1237
                     Y  VG+E   D  +S +L   G ++  H L  +LHG+ G+QG +GGF+L  D
Sbjct  304   --------YADVGVELLIDTRRSPFLKHHGSESQSHDLEVHLHGIAGWQGDRGGFELVVD  355

Query  1238  FDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
              DVAL+NK  D L   Y +  P  W V  N  MV+  DG W+L+DH+ D
Sbjct  356   RDVALVNKFDDCLADEYPV--PVRWKVHHNKSMVKGGDGRWVLEDHDPD  402



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 185/404 (46%), Positives = 242/404 (60%), Gaps = 31/404 (8%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+GLLDPLD  LR  +I YG MV A YD F  E  S + G C Y   +LL
Sbjct  43    RWRELHGENSWKGLLDPLDLHLRATIISYGEMVQATYDGFNTERRSPHCGACFYGHDDLL  102

Query  383   RESG--HDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRP--DTVLKQSNWMGYVAVATD  550
                G  H   N   Y+VTK+ Y+ S++    ++L+       D   ++SNWMGYVAVATD
Sbjct  103   AGVGVPHHANN---YQVTKFVYATSSLPLPESFLLLPLPSLPDVWSRESNWMGYVAVATD  159

Query  551   DGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG----QDSNPLVHKGFYDMYT  718
             +G AALGRRDI+VAWRGT++  EW+ +  F  V A  + G    Q+   +VH+GF  +YT
Sbjct  160   EGAAALGRRDIVVAWRGTIKNLEWVNDLDFTPVPAAPVLGSAASQNRFAVVHRGFLSVYT  219

Query  719   AVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN  898
             + N        SA++Q+ +EVRRLVE YKDEE+SIT+ GHSLG+SLATLNAVDLV++  N
Sbjct  220   SSNKSSEFTKTSAKEQVLKEVRRLVELYKDEEVSITVCGHSLGASLATLNAVDLVSSGAN  279

Query  899   K----DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVN  1066
             K        PVTA +FASP VG+R F++A +   D LK L + +A DIVP  PP G    
Sbjct  280   KPESSTKSFPVTAIVFASPHVGDRFFRSAFNSFPD-LKALHVQNAGDIVPMYPPLG----  334

Query  1067  TTLPIISYEHVGMEFRFDASKSNY--LDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDF  1240
                    Y  V +E      +S Y  +     + H L  YLHGV G QGS GGFKL  + 
Sbjct  335   -------YVDVAVELTIRTIRSPYMRMPATVLTLHNLECYLHGVAGEQGSAGGFKLEVER  387

Query  1241  DVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDD  1372
             DVAL+NK +D L   + +  PAEW+V K+  MV+  DG W L D
Sbjct  388   DVALVNKGVDALTNEHPV--PAEWWVPKHKFMVKGKDGRWTLQD  429



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score =   331 bits (848),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/399 (44%), Positives = 244/399 (61%), Gaps = 22/399 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L+G+  W+GLLDPLD DLR+ +I+YG +  A Y     E  S+  G C + RK+ L
Sbjct  416   RWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRRKDFL  475

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               S  D  NP  YE+TK+ Y+  T+    +++I+        KQSNWMG+VAVATD+GK 
Sbjct  476   --SRVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKE  533

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPDP  736
              LGRRD++VAWRGT+R  EW+ +     V A  I   G   +P VH G+  +YT+ +P  
Sbjct  534   VLGRRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSAHDPRVHGGWLSVYTSTDPGS  593

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  SAR Q+ +EV RL + YK EE SIT+ GHSLG++LAT++A D+V+N  NK    P
Sbjct  594   RYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNGYNK--TCP  651

Query  917   VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEH  1096
             V+AF+F SP+VG  +F+ A    A++L++LR+ ++ D+VP  P  G           Y  
Sbjct  652   VSAFVFGSPRVGNSDFQKAFDS-AEDLRLLRVRNSPDVVPNWPKLG-----------YSD  699

Query  1097  VGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
              G E   D  +S Y+   G   +WH +  Y+HGV G QGS GGF+L  D D+AL+NK+ D
Sbjct  700   AGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHED  759

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              LK  YS+  P  W+VV+N GMV+  DG W L DHE DD
Sbjct  760   ALKKEYSI--PPSWWVVQNKGMVKGKDGRWHLADHEDDD  796



>ref|NP_172115.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
 sp|Q9LNC2.1|PLA18_ARATH RecName: Full=Phospholipase A1-IIalpha [Arabidopsis thaliana]
 gb|AAF80222.1|AC025290_11 Contains similarity to petal abundant lipase-like protein Pn47p 
mRNA from Ipomoea nil gb|U55867 and contains a lipase PF|01764 
domain [Arabidopsis thaliana]
 gb|AEE27968.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
Length=423

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 171/401 (43%), Positives = 240/401 (60%), Gaps = 27/401 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG   W+GLLDPLD DLRRY+IHYG M    YD+F  +  S+  G C Y++  L
Sbjct  7     KRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKNRL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L  +G    NPF+Y+VTKY Y+ ++I+   +++++S   D    Q+NWMGY+AVATD GK
Sbjct  67    LARTGFLKANPFRYKVTKYIYATASIKLPISFIVKSLSKDASRVQTNWMGYIAVATDQGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF---GQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F    A  +F       NP +  G+ D+YTA + 
Sbjct  127   AMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVTDPKDNPRIGSGWLDIYTASDS  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLV---TNPIN-  898
                    SA++Q++ E++RL+E YKDEE+SIT  GHSLG+ ++ L+A DLV    N IN 
Sbjct  187   RSPYDTTSAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSAADLVYGKKNNINI  246

Query  899   --KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
               +   +P+T F F SP++G+ NFKN V  L   L ILR+ +  D+ P            
Sbjct  247   NLQKKQVPITVFAFGSPRIGDHNFKNVVDSLQP-LNILRIVNVPDVAPH-----------  294

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  +G     +   S YL     F+ ++H L  YLHG+ G Q + G FKL    D
Sbjct  295   YPLLLYSEIGEVLEINTLNSTYLKRSLNFR-NYHNLEIYLHGMAGMQDTDGVFKLEIGRD  353

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWIL  1366
             ++L+NK +D LK  Y  + P+ W  + N GM+Q DDGTW L
Sbjct  354   ISLVNKGLDALKDEY--LVPSTWRCLANKGMLQMDDGTWKL  392



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score =   335 bits (858),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 174/400 (44%), Positives = 248/400 (62%), Gaps = 22/400 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW++L+G+  W+GLLDPLD DLR+ +I+YG +  A Y     E  S+  G C + R++ 
Sbjct  609   KRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRREDF  668

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L  S  D  NP  YE+TK+ Y+  T+     ++I+S       KQSNWMG+VAVATD+GK
Sbjct  669   L--SRVDVSNPNLYEITKFIYAMCTVSLPDGFMIKSLSKAAWSKQSNWMGFVAVATDEGK  726

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF--GQDSNPLVHKGFYDMYTAVNPD  733
               LGRRD++VAWRGT+R  EW+ +     V A  I   G   +P VH G+  +YT+ +P 
Sbjct  727   EVLGRRDVVVAWRGTIRILEWMDDLDISLVPASEIVRPGSADDPCVHGGWLSVYTSTDPG  786

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
                   SAR Q+ +E++RL + YK EE SIT+ GHSLG++LAT++A D+V+N  N+    
Sbjct  787   SRYNKQSARYQVLDEIKRLQDVYKQEETSITITGHSLGAALATISATDIVSNGYNQS--C  844

Query  914   PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYE  1093
             PV+AF+F SP+VG  +F+ A    AD+L++LR+ ++ D+VPK P  G           Y 
Sbjct  845   PVSAFVFGSPRVGNSDFQKAFDS-ADDLRLLRVENSPDVVPKWPKLG-----------YS  892

Query  1094  HVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNI  1267
               G E   D  +S Y+   G   +WH +  Y+HG+ G QGS GGF+L  D D+AL+NK+ 
Sbjct  893   EAGTELMIDTGESPYIKTPGNPLTWHDMECYMHGIAGTQGSNGGFELEVDRDIALVNKHE  952

Query  1268  DQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             D LK  YS+  P+ W+V++N GMV+  DG W L DHE DD
Sbjct  953   DALKNEYSI--PSSWWVMQNKGMVKGKDGRWHLADHEDDD  990



>gb|ABK96341.1| unknown [Populus trichocarpa x Populus deltoides]
Length=396

 Score =   318 bits (816),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 177/399 (44%), Positives = 244/399 (61%), Gaps = 30/399 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPI--SKNVGLCRYARK  373
             +RW++LSG ++W GLL+PLD DLRR +I+YG   +A  ++F    +  +   G  RYA +
Sbjct  14    DRWRELSGEESWNGLLNPLDIDLRRSIINYGDRATANGNAFNKTSLRSANCCGFSRYAPR  73

Query  374   NLLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDD  553
             +   ++G    NP+KY+VT + Y     +     L+          +S W  YVAVAT++
Sbjct  74    DFFSKTGIQTRNPYKYQVTDFIYGKVDAKV---LLLDDS-------ESTWSAYVAVATNE  123

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPD  733
             GKA LGRRDI+V+WRGT  + EW+K+F    +  P IFG D   + HKGF+ +YTA +  
Sbjct  124   GKALLGRRDIVVSWRGTSLSVEWLKDFDAELISVPEIFGNDVAKM-HKGFHSLYTAKDDK  182

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
                   SARDQ    V +LV+QYKDEE+SIT+ GHSLG+++ATLNA+D+V    NK    
Sbjct  183   STYSKTSARDQALAAVSKLVDQYKDEEISITVTGHSLGAAIATLNALDIVVKGYNKTTGE  242

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              +   PVTA +FASP+VG+ NFK     L D L +LR+T+ KDIVP L PF +      P
Sbjct  243   QNKAFPVTAIVFASPRVGDTNFKKLCEGLED-LHVLRVTNEKDIVPNL-PFDIP-----P  295

Query  1079  IISYEHVGMEFRFDASKSNYLDGFK--ASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
               S++HVG E R D  KS Y+        +H L  Y+HGV G QGS+GGF L  D D+AL
Sbjct  296   SFSFKHVGEELRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSEGGFNLEVDRDIAL  355

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVK-NSGMVQQDDGTWIL  1366
             +NK++D LK  Y++  PA W+ ++ N GMV  DDG W L
Sbjct  356   VNKDLDGLKDEYNI--PAGWWGIEDNKGMVLGDDGRWKL  392



>sp|A2WT96.2|PLA2_ORYSI RecName: Full=Phospholipase A1-II 2 [Oryza sativa Indica Group]
Length=403

 Score =   318 bits (816),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 176/405 (43%), Positives = 237/405 (59%), Gaps = 29/405 (7%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L GS +W+GLLDPLD DLRR LI YG M+ A Y++FI E  S N G+CRY R +L 
Sbjct  4     RWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRRADLF  63

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
             R    D  +P  Y  T+Y Y+ +        L++    +    + NWMGYVAVATD+G A
Sbjct  64    RRV--DVSHPGWYAATRYIYATANADVHGKVLLRPLCREGRATECNWMGYVAVATDEGAA  121

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD----SNPLVHKGFYDMYTAVNP  730
             ALGRRDI+VAWRGT RA EW+ + +     A  I G +    ++P VH+G+  +YT+ + 
Sbjct  122   ALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLYTSEDQ  181

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS-  907
                L   SAR Q+  E+ RL+++YKDEE SIT+ GHSLG++LATLNA D+  N  N  S 
Sbjct  182   CSELNKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAADIAANSYNTSSL  241

Query  908   ------PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNT  1069
                     PVTA +F SP+ G+R F++A  +L D L++LR+ +  D +P  PP G     
Sbjct  242   SPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRD-LRMLRVRNRPDRIPHYPPVG-----  295

Query  1070  TLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
                   Y  VG+E   D   S +L   G ++  H L  +LHGV G+ G   GF+L  D D
Sbjct  296   ------YADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDHRGFELVVDRD  349

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             VAL+NK  D L   Y +  P  W V  N  MV+  DG W+L DHE
Sbjct  350   VALVNKFDDCLADEYPV--PVRWKVHHNKSMVKGPDGRWVLQDHE  392



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score =   319 bits (818),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 179/411 (44%), Positives = 231/411 (56%), Gaps = 32/411 (8%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             W +LSG  NW+GLLDPLD+DLRR +I YG +  A  D+FI +P S   G  RYA    L 
Sbjct  36    WAELSGRDNWDGLLDPLDADLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLH  95

Query  386   ESGHDNG-NPFKYEVTKYFYSPSTIRTAT--NYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
              +    G +P  Y VT++ Y+ S+ R      ++ +   P     +SNWMGYVAVATD G
Sbjct  96    RTQAPGGSDPDAYAVTRFLYATSSARVPVPDTFITRPAPPGAWSAESNWMGYVAVATDAG  155

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD---SNPLVHKGFYDMYTAVN  727
              A LGRRDI+VAWRGT RA EW  +     V A  + G     S P VH+GF  +Y + N
Sbjct  156   AARLGRRDIVVAWRGTKRAVEWADDLDITLVPATGVVGPGPGWSQPAVHRGFLSVYASRN  215

Query  728   PDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPI----  895
                     SAR+Q+  EVRRL++ YK E  SITL GHSLG++LATL A+D+V N +    
Sbjct  216   STSRFNKQSAREQVLSEVRRLLDAYKGENCSITLTGHSLGAALATLTAIDIVANGLNVRG  275

Query  896   --NKDSPIPVTAFLFASPKVGERNFKNAV---SKLADNLKILRLTDAKDIVPKLPPFGVK  1060
               N +  +PV A +F SP+VG+  FK A    S      ++LR+ +A DIVP        
Sbjct  276   GSNSNDTVPVAAIVFGSPRVGDDQFKKAFESPSTPGGGARLLRVRNAPDIVP--------  327

Query  1061  VNTTLPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGS--QGGFK  1225
               T LP   Y  VG+E   D  KS +L       A+WH L  YLHGV G QG+    GF+
Sbjct  328   --TILPAAFYRDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDGAGFR  385

Query  1226  LHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             L  D DVAL+NK +D L   Y +  PA W+V  N GM +   G W+L DHE
Sbjct  386   LEVDRDVALVNKEVDALSDEYPV--PAAWWVEGNKGMTRDKSGRWVLQDHE  434



>gb|AAM61647.1| lipase-like protein [Arabidopsis thaliana]
Length=423

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 170/401 (42%), Positives = 239/401 (60%), Gaps = 27/401 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG   W+GLLDPLD DLRRY+IHYG M    YD+F  +  S+  G C Y++  L
Sbjct  7     KRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKNRL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G    NPF+Y+VTKY Y+ ++I+   +++++S   D    Q+NWMGY+AVATD GK
Sbjct  67    FARTGFLKANPFRYKVTKYIYATASIKLPISFIVKSLSKDASHVQTNWMGYIAVATDQGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF---GQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F    A  +F       NP +  G+ D+YTA + 
Sbjct  127   AMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVTDPKDNPRIGSGWLDIYTASDS  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLV---TNPIN-  898
                    SA++Q++ E++RL+E YKDEE+SIT  GHSLG+ ++ L+A DLV    N IN 
Sbjct  187   RSPYDTTSAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSAADLVYGKKNNINI  246

Query  899   --KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
               +   +P+T F F SP++G+ NFKN V  L   L ILR+ +  D+ P            
Sbjct  247   NLQKKQVPITVFAFGSPRIGDHNFKNVVDSLQP-LNILRIVNVPDVAPH-----------  294

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  +G     +   S YL     F+ ++H L  YLHG+ G Q + G FKL    D
Sbjct  295   YPLLLYSEIGEVLEINTLNSTYLKRSLNFR-NYHNLEIYLHGMAGMQDTDGVFKLEIGRD  353

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWIL  1366
             ++L+NK +D LK  Y  + P+ W  + N GM+Q DDGTW L
Sbjct  354   ISLVNKGLDALKDEY--LVPSTWRCLANKGMLQMDDGTWKL  392



>ref|XP_006417941.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
 gb|ESQ36294.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
Length=411

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/405 (42%), Positives = 239/405 (59%), Gaps = 27/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+LSG   W+GLL+PLD DLRRY+IHYG M    YD+F  +  S+  G C Y+++ +
Sbjct  7     KRWKELSGVNKWQGLLEPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSRYAGDCYYSKRQI  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G    NPF+Y VTKY Y+ ++++    ++++S   D    Q+NWMGY+AVATD+GK
Sbjct  67    FARTGFLKANPFRYNVTKYIYATASLKLPICFIVKSLSKDASRVQTNWMGYIAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN---PLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F    A  +F        P V  G+ D+YTA + 
Sbjct  127   AMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVTDPKVVPRVGSGWLDVYTASDS  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
             +      SAR+Q++ E++RL+E YK+EE+SIT  GHSLG  ++TL A DLV    NK++ 
Sbjct  187   NSPYDTTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGGVMSTLAAADLVHARKNKNNT  246

Query  911   ------IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                   +P+T F F  P++G+++FK  V  L   L ILR+ +  D+ P            
Sbjct  247   SLQRNQVPITVFAFGCPRIGDQDFKKIVDSLQP-LNILRIVNVPDVAPH-----------  294

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  VG     +   S YL     F+ ++H L  YLHG+ G Q   G FKL    D
Sbjct  295   YPLLLYAEVGEVLEINTLNSTYLKRSLNFR-NYHNLEIYLHGIAGMQDRAGVFKLEVGRD  353

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             V+L+NK +D LK  Y  + P+ W  + N GMVQ DDGTW LD H 
Sbjct  354   VSLVNKGLDALKDEY--LVPSTWRCLANKGMVQMDDGTWKLDVHR  396



>ref|XP_006306316.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
 gb|EOA39214.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
Length=423

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/402 (41%), Positives = 240/402 (60%), Gaps = 27/402 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+LSG   W+GLLDPLD DLRRY+IHYG M    YD+F  +  S+  G C Y++K +
Sbjct  7     KRWKELSGQNKWQGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKKQI  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+Y VTKY Y+ ++I+    ++++S   D    Q+NWMGY+AVATD GK
Sbjct  67    FARTGYLKANPFRYNVTKYIYATASIKLPICFIVKSLSKDASRVQTNWMGYIAVATDQGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF---GQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F    A  +F      +NP +  G+ D+YTA + 
Sbjct  127   AMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVKDAKANPRIGSGWLDIYTASDS  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS-  907
                    SAR+Q++ E++RL+E YK+EE+SIT  GHSLG+ ++ L+A D V    NK + 
Sbjct  187   RSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAADFVYGKNNKTNI  246

Query  908   -----PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                   +P+T F F SP++G+++FK  V  L   + ILR+ +  D+ P            
Sbjct  247   SLPKKQVPITVFAFGSPRIGDQDFKKIVDSL-QQINILRIVNVPDVAPH-----------  294

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  +G     +   S YL     F+ ++H L  YLHG+ G + + G FKL    D
Sbjct  295   YPLLLYAEIGEVLEINTLNSTYLKRSLNFR-NYHNLEIYLHGMAGMKDTAGVFKLEIGRD  353

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
             ++L+NK +D LK  Y  + P+ W  + N GMVQ DDGTW L+
Sbjct  354   ISLVNKGLDALKDEY--LVPSTWRCLANKGMVQMDDGTWKLN  393



>emb|CDX86530.1| BnaC08g01730D [Brassica napus]
Length=408

 Score =   317 bits (812),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 171/407 (42%), Positives = 236/407 (58%), Gaps = 25/407 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG   W+GLLDPLDSDLRRYLIHYG M    YD+F  +  S+  G C Y++  +
Sbjct  7     KRWKVLSGQNKWKGLLDPLDSDLRRYLIHYGEMAQVGYDAFNWDRKSEYCGDCYYSKSQI  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NP +Y VTKY Y+ ++I+    ++++S        Q+NWMGY+AVATD+GK
Sbjct  67    HARTGYLKANPIRYNVTKYIYATASIKMPLCFIVKSLSKKASRVQTNWMGYIAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLF---VKAPLIFGQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F     VK   +  +   P +  G+ D+YTA + 
Sbjct  127   AMLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVSDRKHVPRIGSGWLDVYTASDA  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK---  901
                    SAR+Q++ E++RL+E YK+EE+SIT  GHSLG  ++TL A DLV +  NK   
Sbjct  187   KSPYDTTSAREQVQAELKRLLEVYKNEEVSITFTGHSLGGVMSTLAAADLVHSSQNKIHT  246

Query  902   ---DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                   +P+T F F  P++G+++FK  VS     L ILR+ +  D+ P  P F       
Sbjct  247   GIQSKQVPITVFAFGCPRIGDQDFKKVVSS-HKQLNILRIVNVPDVAPNYPLF-------  298

Query  1073  LPIISYEHVGMEFRFDASKSNYLDGFK--ASWHTLVTYLHGVDGFQGSQGGFKLHGDFDV  1246
                  Y  VG   + +   S YL       ++H L  YLHG+ G Q   G FKL    DV
Sbjct  299   ----MYAEVGEVLQINTLNSTYLKRSLNWRNYHNLEIYLHGIAGMQDKSGVFKLEIGRDV  354

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             +L+NK +D LK  Y  + P+ W  + N GMVQ DDGTW LD H  +D
Sbjct  355   SLVNKGLDALKDKY--LVPSVWRCLANRGMVQMDDGTWKLDVHRYED  399



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score =   317 bits (812),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/404 (43%), Positives = 230/404 (57%), Gaps = 26/404 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+++SGS  W GLLDPLD D+RR +I YG +  A  D+FI +P S   G CRY+  + 
Sbjct  22    QRWREISGSNQWSGLLDPLDIDVRREVIRYGELAQATSDAFITDPASPYAGACRYSPASF  81

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               +      +P  Y VT++ Y+ S+ R    ++ +          SNWMGYVAVATD G 
Sbjct  82    FNKV--QASDPGAYRVTRFIYATSSARLPDGFMARPLPAGAWSTDSNWMGYVAVATDRGA  139

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD---SNPLVHKGFYDMYTAVNP  730
             AALGRRDI+VAWR T RA EW  +  F  V A  I G     S P VH+GF  +YT+ N 
Sbjct  140   AALGRRDIVVAWRATKRATEWASDLDFALVPAAGIVGPGRGWSQPYVHRGFLSVYTSKNS  199

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN----  898
                    SAR+ +  EVR L++ YK+E+ SI++ GHSLG +L TLNA+DLV N  N    
Sbjct  200   TSRFNRRSARELVLTEVRGLLDTYKNEDCSISITGHSLGGALTTLNAIDLVANGFNVRGP  259

Query  899   KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
               SP+PVTA  F +P+VG+  FK A   +A  L +LR+ +  DIVP          T LP
Sbjct  260   SRSPVPVTAIHFGAPRVGDEQFKKAFHSMA-GLSLLRVRNVPDIVP----------TILP  308

Query  1079  IISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFDV  1246
              + Y  VG+E   D  KS YL      A WH L  YLHGV G  G++   GF +  D D+
Sbjct  309   PVIYADVGVELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAGTHGARDSAGFGMEVDRDL  368

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             AL+NK  D L+  Y +  PA W+   N GMV+   G W+L DHE
Sbjct  369   ALINKEEDALRDEYPV--PAMWWAENNKGMVKNATGHWVLHDHE  410



>ref|XP_010475356.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
 ref|XP_010475357.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=423

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/405 (41%), Positives = 242/405 (60%), Gaps = 27/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+L+G K W+GLLDPLD DLRRYLIHYG M    YD+F  +  S+  G C Y++K L
Sbjct  7     KRWKELNGQKKWQGLLDPLDPDLRRYLIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKKQL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G    NPF+YEVTKY Y+ +++     ++++S   D    Q+NWMGY+AVATD GK
Sbjct  67    FARTGFIKANPFRYEVTKYIYATASLNLPICFIVKSLSKDASRVQTNWMGYIAVATDQGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF---GQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F    A  +F       +P +  G+ D+YTA + 
Sbjct  127   AMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVKDPKDSPRIGSGWLDIYTASDS  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLV---TNPIN-  898
                    SAR+Q++ E++RL+E YK+EE+SIT  GHSLG+ ++ L+A D+V    + IN 
Sbjct  187   RSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAADIVYGKNSIINI  246

Query  899   --KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
               +   +P+T F F SP++G+++FK  V  L   L ILR+ +  D+ P            
Sbjct  247   SLQKKQVPITVFAFGSPRIGDQDFKKIVDSLKP-LNILRIVNVPDVAPH-----------  294

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  +G     +   S YL     F+ ++H L  YLHG+ G Q + G FKL    D
Sbjct  295   YPLLLYAEIGEVLEINTLNSTYLKRSLNFR-NYHNLEIYLHGIAGMQDTAGVFKLEIGRD  353

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK +D LK  Y  + P+ W  + N GMVQ +DGTW L+ H 
Sbjct  354   ISLVNKGLDALKDEY--LVPSTWRCLANKGMVQMNDGTWKLNVHR  396



>ref|XP_009110999.1| PREDICTED: phospholipase A1-IIalpha-like [Brassica rapa]
 emb|CDY15570.1| BnaA08g28540D [Brassica napus]
Length=408

 Score =   317 bits (811),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 171/408 (42%), Positives = 236/408 (58%), Gaps = 27/408 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG   W+GLLDPLDSDLRRYLIHYG M    YD+F  +  S+  G C Y++  +
Sbjct  7     KRWKVLSGQNKWKGLLDPLDSDLRRYLIHYGEMAQVGYDAFNWDRKSEYCGDCYYSKSQI  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NP +Y VTKY Y+ ++I+    ++++S        Q+NWMGY+AVATD+GK
Sbjct  67    HARTGYLKANPIRYNVTKYIYATASIKMPLCFIVKSLSKKASRVQTNWMGYIAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLF---VKAPLIFGQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F     VK   +  +   P +  G+ D+YTA + 
Sbjct  127   AMLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVTDRKHVPRIGSGWLDVYTASDA  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK---  901
                    SAR+Q++ E++RL+E YK+EE+SIT  GHSLG  ++TL A DLV +  NK   
Sbjct  187   KSPYDTTSAREQVQAELKRLLEVYKNEEVSITFTGHSLGGVMSTLAAADLVHSSQNKIHT  246

Query  902   ---DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                   +P+T F F  P++G+++FK  VS     L ILR+ +  D+ P  P F       
Sbjct  247   GLQSKQVPITVFAFGCPRIGDQDFKKVVSS-HKQLNILRIVNVPDVAPNYPLF-------  298

Query  1073  LPIISYEHVGMEFRFDASKSNYLDGFKASW---HTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
                  Y  VG   + +   S YL     +W   H L  YLHG+ G Q   G F+L    D
Sbjct  299   ----MYAEVGEVLQINTLNSTYLKR-SLNWRNYHNLEIYLHGIAGMQDKTGVFRLEIGRD  353

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             V+L+NK +D LK  Y  + P+ W  + N GMVQ DDGTW LD H  +D
Sbjct  354   VSLVNKGLDALKDKY--LVPSVWRCLANRGMVQMDDGTWKLDVHRYED  399



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score =   316 bits (810),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 183/411 (45%), Positives = 245/411 (60%), Gaps = 37/411 (9%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW++L G  +W+GL+DPLD DLR+ +I YG +  A YD F  E  S + G C Y   +L
Sbjct  15    KRWRELHGDNSWKGLMDPLDLDLRKTIISYGELAEATYDGFNTERRSPHAGACIYGYSDL  74

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLK-----QSNWMGYVAVA  544
             L  SG        YEVT++ Y+ S       +L+   RP   LK     +SN+MGYVAVA
Sbjct  75    LASSGVAAAG--HYEVTRFIYATSGQPLPDAFLV---RPLAALKDVWSRESNFMGYVAVA  129

Query  545   TDDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS--NPL--VHKGFYDM  712
             TD+G AALGRRDI+VAWRGTV++ EW+ +  F  V A  + G+ +  NPL  VH GF  +
Sbjct  130   TDEGAAALGRRDIVVAWRGTVQSLEWVNDLTFTPVPAAPVLGKKAAANPLAMVHMGFLSL  189

Query  713   YTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNP  892
             YT+ +        SARDQ+ EEVRRLVE YKDEE+SIT+ GHSLG++++ LNAVD+V+N 
Sbjct  190   YTSSHAGSKFNKTSARDQVFEEVRRLVELYKDEELSITITGHSLGAAISILNAVDIVSNG  249

Query  893   IN------KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFG  1054
             +N        +  PVTAF+FA P VG+R F+ A     D L+ L + +A D+VP  PP  
Sbjct  250   VNVPAGGGGSAACPVTAFVFACPHVGDRFFRAAFHSFRD-LRALHVKNAGDVVPMYPP--  306

Query  1055  VKVNTTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKL  1228
                      ++Y  V +    +  +S YL   G   + H L  YLHGV G QGS GGFKL
Sbjct  307   ---------LAYVDVAVTLNINTGRSPYLKWPGTVLTLHNLECYLHGVAGEQGSAGGFKL  357

Query  1229  HGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQD-DGTWILDDHE  1378
                 DVAL+NK  D LK  Y +  PA W+ ++N GMV+ D DG   L+D +
Sbjct  358   EVKRDVALVNKGADALKDEYPV--PASWWALENKGMVKDDADGLLKLNDFQ  406



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score =   317 bits (811),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 172/403 (43%), Positives = 231/403 (57%), Gaps = 25/403 (6%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             W +LSG  NW+GLLDPLD+DLRR +I YG +  A  D+FI++P S + G  RYA    LR
Sbjct  29    WAELSGRDNWDGLLDPLDADLRRVVIRYGELAQATSDAFISDPASPHAGASRYAPGAFLR  88

Query  386   ESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKAA  565
              +      P  Y VT++ Y+ S  R     +++   P     +SNWMGYVAVATD G A 
Sbjct  89    RAQAGADVPDLYRVTRFLYATSGARVPDGIIMRPAPPGAWSLESNWMGYVAVATDAGAAR  148

Query  566   LGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD---SNPLVHKGFYDMYTAVNPDP  736
             LGRRD++VAWRGT RA EW  +     V A  + G     S P VH+GF  +Y + N   
Sbjct  149   LGRRDVVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYASSNSTS  208

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN----KD  904
                  SAR+Q+  E++RL++ YK E  SIT+ GHSLG++L+TL A+D+V+N +N     +
Sbjct  209   RFNKQSAREQVLAEIKRLLDAYKGENCSITITGHSLGAALSTLTAIDIVSNGVNVRGSTN  268

Query  905   SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
               +PV A +F SP+VG+   K A        ++LR+ +A DIVP          T LP  
Sbjct  269   DTVPVAAIVFGSPRVGDEQLKKAFDS-TPGARLLRVRNAPDIVP----------TILPAA  317

Query  1085  SYEHVGMEFRFDASKSNYLDG---FKASWHTLVTYLHGVDGFQGS--QGGFKLHGDFDVA  1249
              Y+ VG+E   D  KS +L       A+WH L  YLHGV G QG+    GF L  D D+A
Sbjct  318   FYKDVGVELLVDTRKSPHLKQPGPGPAAWHNLECYLHGVAGTQGAGDGAGFGLVVDRDLA  377

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             L+NK +D L   Y +  PA W+V  N GMV+   G W+L DHE
Sbjct  378   LVNKEVDALDDEYPV--PAGWWVEGNKGMVKDGSGRWVLQDHE  418



>ref|XP_010501341.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=424

 Score =   317 bits (811),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 167/405 (41%), Positives = 239/405 (59%), Gaps = 27/405 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+L+G K W+GLLDPLD DLRRYLIHYG M    YD+F  +  S+  G C Y++K L
Sbjct  7     KRWKELNGQKKWQGLLDPLDPDLRRYLIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKKQL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G    NPF+YEVTKY Y+ ++I     ++++    D    Q+NWMGY+AVATD GK
Sbjct  67    FARTGFIKANPFRYEVTKYIYATASINLPICFIVKPLSKDASRVQTNWMGYIAVATDQGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF---GQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F    A  +F       +P +  G+ D+YTA + 
Sbjct  127   AMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVKDPKDSPRIGSGWLDIYTASDS  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK---  901
                    SAR+Q++ E++RL+E YK+EE+SIT  GHSLG+ ++ L+A D+V    +K   
Sbjct  187   RSPYAKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSAADIVYGKNSKIDI  246

Query  902   ---DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                   +P+T F F SP++G+++FK  V  L   L ILR+ +  D+ P            
Sbjct  247   SLQKKQVPITVFAFGSPRIGDQDFKKIVDSLKP-LNILRIVNVPDVAPH-----------  294

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  +G     +   S YL     F+ ++H L  YLHG+ G Q + G FKL    D
Sbjct  295   YPLLLYAEIGEVLEINTLNSTYLKRSLNFR-NYHNLEIYLHGIAGMQDAAGVFKLEIGRD  353

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             ++L+NK +D LK  Y  + P+ W  + N GMVQ +DGTW L+ H 
Sbjct  354   ISLVNKGLDALKDEY--LVPSTWRCLANKGMVQMNDGTWKLNVHR  396



>ref|NP_001043730.2| Os01g0651200 [Oryza sativa Japonica Group]
 sp|Q0JKT4.1|PLA2_ORYSJ RecName: Full=Phospholipase A1-II 2 [Oryza sativa Japonica Group]
 dbj|BAF05644.2| Os01g0651200 [Oryza sativa Japonica Group]
Length=408

 Score =   316 bits (810),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 175/405 (43%), Positives = 236/405 (58%), Gaps = 29/405 (7%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L GS +W+GLLDPLD DLRR LI YG M+ A Y++FI E  S N G+CRY   +L 
Sbjct  9     RWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRHADLF  68

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
             R    D  +P  Y  T+Y Y+ +        L++    +    + NWMGYVAVATD+G A
Sbjct  69    RRV--DVSHPGWYAATRYIYATANADVHGKVLLRPLCREGRATECNWMGYVAVATDEGAA  126

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD----SNPLVHKGFYDMYTAVNP  730
             ALGRRDI+VAWRGT RA EW+ + +     A  I G +    ++P VH+G+  +YT+ + 
Sbjct  127   ALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLYTSEDQ  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS-  907
                L   SAR Q+  E+ RL+++YKDEE SIT+ GHSLG++LATLNA D+  N  N  S 
Sbjct  187   CSELNKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAADIAANSYNTSSL  246

Query  908   ------PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNT  1069
                     PVTA +F SP+ G+R F++A  +L D L++LR+ +  D +P  PP G     
Sbjct  247   SPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRD-LRMLRVRNRPDRIPHYPPVG-----  300

Query  1070  TLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
                   Y  VG+E   D   S +L   G ++  H L  +LHGV G+ G   GF+L  D D
Sbjct  301   ------YADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDHRGFELVVDRD  354

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             VAL+NK  D L   Y +  P  W V  N  MV+  DG W+L DHE
Sbjct  355   VALVNKFDDCLADEYPV--PVRWKVHHNKSMVKGPDGRWVLQDHE  397



>ref|XP_008238422.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=390

 Score =   315 bits (808),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 179/399 (45%), Positives = 240/399 (60%), Gaps = 36/399 (9%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEP--ISKNVGLCRYARKN  376
             RW+ LSG   WEGLLDPLD DLRRY+IHYG    A+   FI++P  ISKN+GL RYA++N
Sbjct  7     RWRVLSGEDEWEGLLDPLDIDLRRYIIHYGERAGAIGYGFIDKPTSISKNIGLPRYAKRN  66

Query  377   LLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
             L  + G + GNP+KYEV KY Y+ +      + L               +G+VAV+TD+G
Sbjct  67    LFSKVGLETGNPYKYEVKKYLYAATRFAPGKSIL---------------LGFVAVSTDEG  111

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDP  736
                LGRRDIL++WRGT+   E   +   LF  A  I G++ NP VH G++  YT ++ + 
Sbjct  112   SKVLGRRDILISWRGTMLDQEVEVDATILFFSASDILGKEHNPQVHLGWHGYYTNLDSES  171

Query  737   IL-KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTN----PINK  901
                K  S RDQ+   VR LV+Q KDEE+SIT+ GHS+GS++A LNA D+V N    P N 
Sbjct  172   AHNKTASCRDQVLAAVRELVDQNKDEEISITVTGHSMGSAIAVLNATDIVYNGYNKPTNS  231

Query  902   DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
             ++   VTA +FA P VG++ FK   S L +NL++LR+T+  D VPK           LPI
Sbjct  232   NNVSLVTAIVFACPNVGDQGFKKVFSSL-ENLRVLRITNEWDPVPK-----------LPI  279

Query  1082  ISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNK  1261
             + Y  VG E   D  KS YL     S H L  YLHGV G QG    FKL  + D+AL+NK
Sbjct  280   LPYVPVGKELVIDTLKSPYLKNAIDSVHQLEVYLHGVAGTQGRNNDFKLEINRDLALVNK  339

Query  1262  NIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
              +D L   Y ++   +W++ +N+ MVQ +DG+W L DHE
Sbjct  340   ILDGLDDKYHII--PKWWIERNNSMVQMEDGSWELMDHE  376



>ref|XP_008238421.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=376

 Score =   315 bits (806),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 180/399 (45%), Positives = 242/399 (61%), Gaps = 32/399 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ LSG   WEGLL+PLD DLRRY++HYG   +A  D+FI+E  S N GL RYA++ L
Sbjct  6     KRWRRLSGETEWEGLLNPLDLDLRRYILHYGERTAATADAFIDETKSDNCGLPRYAKRYL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G +N NP+KY+V KY Y+ +T+                  +S W+GYVAV TD+GK
Sbjct  66    FSKVGLENSNPYKYKVKKYLYAATTLSPG---------------KSIWLGYVAVTTDEGK  110

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
               LGRRDILV+WRGT    EW  +  F  V A  I G+  +P VH GF+  YT V+P   
Sbjct  111   KVLGRRDILVSWRGTELVEEWGIDIVFDLVSASDILGEKHDPKVHHGFHSYYTHVDPQSP  170

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK--DSPI  913
                 S R Q    ++ +V +YK+E +SIT+ GHS+G+++  LNA D+V N  NK    P+
Sbjct  171   HNKTSCRAQALAAIKEVVNRYKNETISITVTGHSMGAAMGILNATDIVNNGYNKPPGHPV  230

Query  914   -PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISY  1090
              PVTA +FA+P++G++ F N    L  NL +LR+T+  D++P LPPF           +Y
Sbjct  231   CPVTAIVFAAPRLGDQGFSNVFYGLK-NLHVLRVTNDYDLIPSLPPFA----------NY  279

Query  1091  EHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
              HVG E RFD  KS YL   K S H+L  YLHGV G QG +  FKL    D+AL+NK +D
Sbjct  280   LHVGKELRFDTFKSPYLKDPKQSLHSLEVYLHGVAGTQG-ENDFKLAVKRDLALVNKYLD  338

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              LK  Y  +  A+W+  KN  M+Q  DG+W+L DHE DD
Sbjct  339   GLKDKY--LVVAKWWTEKNKSMLQVGDGSWVLMDHESDD  375



>sp|Q6F358.1|PLA6_ORYSJ RecName: Full=Phospholipase A1-II 6 [Oryza sativa Japonica Group]
 gb|AAT69580.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44110.1| putative lipase [Oryza sativa Japonica Group]
Length=411

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 175/407 (43%), Positives = 244/407 (60%), Gaps = 25/407 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+GLLDP D DLRR +I YG M  A YD+F +E +S + GL R+A +   
Sbjct  14    RWRELHGESDWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFAARRFF  73

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              E     G+   Y V ++ Y+ S +      +++S       ++SNW+GYVAVATD+GKA
Sbjct  74    -ERAQLPGHSAAYRVARFVYATSCVAVPEPLILRSASRARRCRESNWIGYVAVATDEGKA  132

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAP-LIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             ALGRRDI+VAWRGTV++ EWIK+  F+ V    L+  + S+ +VH+G+  MYT+ + +  
Sbjct  133   ALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRDKASDAMVHRGWLSMYTSRDSESS  192

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP---  910
                 SARDQ+  EV +LV  Y+DEE+SIT+ GHSLG++LATLNA D+V N  N+      
Sbjct  193   HNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDIVENGYNRAPRAAA  252

Query  911   ----IPVTAFLFASPKVGERNFKNAVSKLAD-NLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
                  PVTAF+FASP+VG   FK          L++LR+ +A+D+VP+ P          
Sbjct  253   AAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVPRYP----------  302

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG-FKLHGDFDV  1246
             P   Y  VG E   D  +S YL   G +  WH L  YLHGV G +G + G FKL  + DV
Sbjct  303   PAPPYHGVGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARGGEAGRFKLAVERDV  362

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             AL NK+   L+  +++  PA W++  N GMV+  DG W L D E D+
Sbjct  363   ALANKSYGALRDEHAV--PAGWWIPSNRGMVRGADGRWTLMDREEDE  407



>ref|XP_003566945.1| PREDICTED: phospholipase A1-II 2-like [Brachypodium distachyon]
Length=410

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/400 (43%), Positives = 237/400 (59%), Gaps = 28/400 (7%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L GS +W GLLDPLD+DLRR LI YG M  A +++FI E  S N G+CRY R +L 
Sbjct  10    RWRELHGSDSWAGLLDPLDADLRRSLITYGEMAMATHEAFIGERRSPNAGMCRYRRADLF  69

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRT-ATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             R    +  +P  Y VT+Y Y+ +         L++    D   ++ NWMGYVA ATD+G 
Sbjct  70    RRV--EVSHPGWYAVTRYVYATACADVLHGETLLRPLCRDGRARECNWMGYVAAATDEGA  127

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD----SNPLVHKGFYDMYTAVN  727
             A LGRRDI+VAWRGT RA EW+ + +  F  A  I G +    S+P VH+G+  +YT+ +
Sbjct  128   ARLGRRDIVVAWRGTQRALEWVADLKLAFASAAGILGPEGADGSDPSVHRGYLSLYTSAD  187

Query  728   PDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK--  901
             P   L   SAR Q+  E+ RL+++YKDEE SIT+ GHSLG++LATLNAVD+  N  N+  
Sbjct  188   PGSELSKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAVDIAANSYNRFA  247

Query  902   ---DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                    PVTA +F SP+ G+R+F++A  ++   L++LR+ +  D +P  PP G      
Sbjct  248   LNGRRATPVTAVVFGSPRTGDRDFRDAFHRVP-GLRMLRVRNRPDRIPLYPPVG------  300

Query  1073  LPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDV  1246
                  Y  VG+E   D  +S +L   G ++  H L  +LHG+ G+ G  G F+L  D DV
Sbjct  301   -----YADVGVELLIDTRRSPFLKPHGSESQSHDLECHLHGIAGWHGEHGAFELVVDRDV  355

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWIL  1366
             AL+NK  D L   Y +  P  W V  N  MV+  DG W+L
Sbjct  356   ALVNKFDDCLADEYPV--PVGWKVNHNKNMVKGRDGRWVL  393



>dbj|BAJ95995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   313 bits (802),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 240/404 (59%), Gaps = 31/404 (8%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+GLLDPLD  LR  +I YG MV A YD F  E  S + G C YA ++LL
Sbjct  44    RWRELHGENSWDGLLDPLDPHLRSSIISYGEMVQAAYDGFNTERRSPHCGACFYAYEDLL  103

Query  383   RESG--HDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRP--DTVLKQSNWMGYVAVATD  550
                G  H   N   Y+VTK+ Y+ S++   +++L+       D   ++SNWMGYVAVATD
Sbjct  104   AGVGVPHHGNN---YQVTKFIYATSSLPLPSSFLLLPLPSLPDVWSRESNWMGYVAVATD  160

Query  551   DGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG----QDSNPLVHKGFYDMYT  718
             +G A LGRRDI+VAWRGTV+  EW+ +  F+ V A  + G    Q+   +VH GF  MYT
Sbjct  161   EGAAKLGRRDIVVAWRGTVQNMEWVNDLDFVPVPAAPVLGSAASQNRLAVVHHGFLSMYT  220

Query  719   AVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN  898
             + N        SARDQ+ +EV+RLVE YKDEE+SIT+ GHSLG+S+ATLNAVD+V++ IN
Sbjct  221   SSNKSSEFTKTSARDQVVKEVKRLVELYKDEEVSITVCGHSLGASIATLNAVDMVSSGIN  280

Query  899   K----DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVN  1066
             K        PVTA +FASP VG R F++A     D LK L + +  D+VP  PP G    
Sbjct  281   KPEGATKSFPVTAIVFASPHVGCRFFRSAFHSFPD-LKALHVQNVGDVVPLYPPLG----  335

Query  1067  TTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDF  1240
                    Y  V ++      +S YL       + H L  YLHGV G QGS GGFKL  D 
Sbjct  336   -------YVDVAVQLTITTIRSPYLRVPATVGTLHNLECYLHGVAGEQGSAGGFKLEVDR  388

Query  1241  DVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDD  1372
             D+AL+NK  D L   + +  PA W+V K+  MV+  DG W L D
Sbjct  389   DIALVNKGADALADEHPV--PASWWVPKHKFMVKGGDGRWTLQD  430



>ref|NP_001149813.1| triacylglycerol lipase [Zea mays]
 gb|ACG36877.1| triacylglycerol lipase [Zea mays]
Length=400

 Score =   310 bits (795),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 172/398 (43%), Positives = 238/398 (60%), Gaps = 28/398 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
              RW++L G   W G LDPLD DLRR ++ YG M  A YD+F NE  S + GL R+AR   
Sbjct  12    RRWRELHGDGGWAGTLDPLDLDLRRTVLRYGEMAQATYDAFNNERASPHAGLSRFARARF  71

Query  380   ---LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATD  550
                +R   H       Y VT++ Y+ S++     ++++S       ++SNW+GYVAVATD
Sbjct  72    FDRVRLPAH----AAAYRVTRFLYATSSVAVPDAFILRSVSRSRRCRESNWIGYVAVATD  127

Query  551   DGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNP  730
             +GKAALGRRD++VAWRGT+RA EW  + +F  V    + G D + +VH+G+  MYT+ +P
Sbjct  128   EGKAALGRRDVVVAWRGTMRALEWADDLEFPMVPTGGLLG-DGDAMVHRGWLSMYTSSDP  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN----  898
                    SAR Q   EVRRLV+ Y+ EE+SIT+ GHSLG++LATLNA D+  N  N    
Sbjct  187   ASSHNQDSARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFDIAANGYNVTAT  246

Query  899   KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
               +  PVT+F FASP+VG   FK     +   L++LR+ +A+D+VPK            P
Sbjct  247   GAAACPVTSFAFASPRVGGGGFKKRFDAVP-GLRLLRVRNARDVVPK-----------YP  294

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
             ++ Y  VG E   D  +S YL   G + +WH L  YLHGV G +G++GGF+L    DVAL
Sbjct  295   VVFYHDVGAELAIDTGESPYLRSPGGEQTWHNLEVYLHGVAGTRGARGGFELAVARDVAL  354

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWIL  1366
             +NK  D L+ ++ +  P  W+V  N GMV+  DG W L
Sbjct  355   VNKAYDALRDHHGV--PPGWWVPLNRGMVEGADGRWSL  390



>gb|KDP46903.1| hypothetical protein JCGZ_24112 [Jatropha curcas]
Length=402

 Score =   310 bits (794),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 175/394 (44%), Positives = 237/394 (60%), Gaps = 22/394 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW++LSG  NWEGLLDPLD DLR  +++YG   +A+ D++ N+      G  R     L
Sbjct  14    DRWRELSGENNWEGLLDPLDFDLRCSILNYGDRAAAIGDAYNNKKYEDLHGFSRVPPNEL  73

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLK-QSNWMGYVAVATDDG  556
               + G    N F Y VT + YS           ++ Q  DTV++ +S W  YVA ATDDG
Sbjct  74    FTKVGVRARNEFDYTVTDFIYS----------RLEVQWFDTVIEDESTWCAYVAGATDDG  123

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN-PLVHKGFYDMYTAVNPD  733
             K  LGRRDI+V+WRGT+   E + + +F+ + A  IF  ++N PL+H GF+ +YT  N +
Sbjct  124   KKKLGRRDIVVSWRGTILPGEKLNDLEFIPIPASDIFPNNNNDPLIHFGFHRIYTTENDN  183

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
              I    SARDQ+   V +LV+QYKDEE+SIT+ GHSLGS+LATLNA+D+V   INK    
Sbjct  184   SIYNKKSARDQVLNAVSKLVDQYKDEEVSITVTGHSLGSALATLNAMDIVYKGINKPTGT  243

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              +   PVTA +FASP VG   FK    +L+D + +LR+ +A D VPKLPP  +     +P
Sbjct  244   ANKSFPVTAIVFASPMVGNEGFKKVFDELSD-IHVLRVENANDPVPKLPPNDI----LIP  298

Query  1079  IISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
                Y HVG     D + S +L     + H L  YLHGV G QGS+GGF L    D AL+N
Sbjct  299   QHRYYHVGESLPIDTTLSPFLKTSDVNPHDLNVYLHGVAGTQGSKGGFNLDYPLDTALIN  358

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTW  1360
             K +D L   ++   P  W+V +N+GMV QDDGT+
Sbjct  359   KTVDGLNEKHNYNIPPNWWVEENNGMVLQDDGTY  392



>gb|AFW79273.1| hypothetical protein ZEAMMB73_515320 [Zea mays]
Length=400

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 171/398 (43%), Positives = 239/398 (60%), Gaps = 28/398 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
              RW++L G   W G+LDPLD DLRR ++ YG M  A YD+F  E  S + GL R+AR + 
Sbjct  12    RRWRELHGDGGWAGMLDPLDLDLRRTVLRYGEMAQATYDAFNRERASPHAGLSRFARAHF  71

Query  380   ---LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATD  550
                +R   H       Y VT++ Y+ S++     ++++S       ++SNW+GYVAVATD
Sbjct  72    FDRVRLPAH----AAAYRVTRFLYATSSVAVPDAFILRSVSRSRRCRESNWIGYVAVATD  127

Query  551   DGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNP  730
             +GKAALGRRD++VAWRGT+RA EW  + +F  V    + G D + +VH+G+  MYT+ +P
Sbjct  128   EGKAALGRRDVVVAWRGTMRALEWADDLEFPMVPTGGLLG-DGDAMVHRGWLSMYTSSDP  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN----  898
                    SAR Q   EVRRLV+ Y+ EE+SIT+ GHSLG++LATLNA D+  N  N    
Sbjct  187   ASSHNQDSARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFDIAANGYNVAAT  246

Query  899   KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
               +  PVT+F FASP+VG   FK     +   L++LR+ +A+D+VPK            P
Sbjct  247   GAAACPVTSFAFASPRVGGGGFKKRFDAV-PGLRLLRVRNARDVVPK-----------YP  294

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
             ++ Y  VG E   D  +S YL   G + +WH L  YLHGV G +G++GGF+L    DVAL
Sbjct  295   VVFYHDVGAELAIDTGESPYLRSPGGEQTWHNLEVYLHGVAGTRGARGGFELAVARDVAL  354

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWIL  1366
             +NK  D L+ ++ +  P  W+V  N GMV+  DG W L
Sbjct  355   VNKAYDALRDHHGV--PPGWWVPLNRGMVEGADGRWSL  390



>ref|XP_007014120.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY31739.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=428

 Score =   310 bits (795),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 182/398 (46%), Positives = 239/398 (60%), Gaps = 38/398 (10%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+DLSG  +W+ LL PLD DLRRY+IHYG    AV D F +   S+  G   Y      
Sbjct  53    RWRDLSGESDWKDLLHPLDLDLRRYIIHYGERCGAVGDLFNDTKASRGFGHSLYPADEFF  112

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               +G + GNPFKY VT +FY+ S I                  QS W GYVAV TDDGKA
Sbjct  113   SRAGLEIGNPFKYSVTNFFYAASDI-----------------VQSAWFGYVAVTTDDGKA  155

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
              LGRRDILVAWRGT+  +E I + QF    A  +FG+D++P VH GF  +YT  + +   
Sbjct  156   VLGRRDILVAWRGTMTDSESINDVQFFPTSASELFGEDNDPQVHSGFLSLYTGRSSNSPY  215

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----DS  907
                SARDQ+RE VR+LV++Y+DE++SIT+ G+SLG++LATL+A+D+V +  NK     + 
Sbjct  216   SQTSARDQVREAVRKLVDKYQDEDISITVTGYSLGAALATLSAMDIVASGYNKPTGNSEK  275

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPP-FGVKVNTTLPII  1084
                VT F +A P+VG   FK     L+D L +LR+T++ DIVPK+P  FG+         
Sbjct  276   SCMVTTFTYAGPRVGNEGFKKVFEGLSD-LHLLRITNSTDIVPKIPILFGI---------  325

Query  1085  SYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
              Y HVG E   D +KS+YL    A  H L  YLHGV G Q + G F L  D D+AL+NK+
Sbjct  326   -YTHVGEELEIDTTKSDYLKS-NADAHNLDVYLHGVAGVQETNGDFTLEVDHDIALINKH  383

Query  1265  IDQLKGNYSLMAPAEWYVVKN-SGMVQQDDGTWILDDH  1375
             +D LK +Y +  P EW+  +N   MVQ DDG W L D+
Sbjct  384   LDGLKDDYKI--PPEWWNNENFKNMVQMDDGHWKLVDN  419



>gb|EMT05578.1| hypothetical protein F775_13080 [Aegilops tauschii]
Length=414

 Score =   309 bits (791),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 178/416 (43%), Positives = 240/416 (58%), Gaps = 39/416 (9%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G+ +W+GLLDPLD DLR  +I YG +  A YD F ++  S + G C Y   +LL
Sbjct  12    RWRELQGAGSWKGLLDPLDRDLRASIIAYGELAEATYDGFNSQRRSPHAGACFYGHADLL  71

Query  383   RESGHDNG-----NPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTV----LKQSNWMGYV  535
               +G           F Y  + +F +P+T  +  +       P  +     ++S+WMGYV
Sbjct  72    AAAGVSRAGYYSVTKFIYATSGFFLAPTTGTSVPDAFFVLPLPSLLEEPWCRESHWMGYV  131

Query  536   AVATDDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS----NPLVHKGF  703
             AVATD+G AALGRRDI+VAWRGTV + EW+ +  F    A  + G  +    + +VH GF
Sbjct  132   AVATDEGVAALGRRDIVVAWRGTVESLEWVNDLDFTPASAEPVLGPAAGDFDSAVVHHGF  191

Query  704   YDMYTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLV  883
               +YT+ + D      SARDQ+ EEVRRL+E +K+E  SIT+ GHSLG+SLATLNAVD+V
Sbjct  192   LSVYTSSDEDSKFNQQSARDQVTEEVRRLMEAHKEEATSITVTGHSLGASLATLNAVDMV  251

Query  884   TNPIN-------KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKL  1042
             ++ +N       +  P PVTA LFASP VG+ +FK+A +   D L+ L + +A D+VP  
Sbjct  252   SHGVNVPPSSPQQQPPCPVTAILFASPHVGDDSFKSAFASFPD-LRALHVRNAGDVVPLY  310

Query  1043  PPFGV--KVNTTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGS  1210
             PP G        LP+            D  +S YL   G   + H L  YLHGV GFQG+
Sbjct  311   PPLGYVDAATAVLPV------------DTGRSPYLKQPGTVQTRHNLECYLHGVAGFQGA  358

Query  1211  QGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
              GGFKL  D DVAL+NK  D LK  Y +  P  W+V+ N  MV+  DG W L D E
Sbjct  359   SGGFKLEVDRDVALVNKGADALKDKYPV--PPNWHVINNKSMVRDSDGHWKLRDFE  412



>ref|XP_004301746.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=392

 Score =   308 bits (789),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 174/410 (42%), Positives = 242/410 (59%), Gaps = 44/410 (11%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             WKDLSG   WEGLLDPLD +LRRY+IHYG    ++  + + E  SKN GL RYA+ +L +
Sbjct  8     WKDLSGENEWEGLLDPLDINLRRYIIHYGERSGSIA-TVVTEQKSKNYGLPRYAKGHLFQ  66

Query  386   ESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKAA  565
             + G +NGNP+KY V  YFY+                 +   K+SN++G+VAV TD+G   
Sbjct  67    KVGLENGNPYKYVVKNYFYAAHV--------------ELSPKKSNFVGFVAVTTDEGTKL  112

Query  566   LGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPILK  745
             LGRRD+L++WRGT    EW+   +   V A  I G+ ++P VH G+   YT ++P     
Sbjct  113   LGRRDVLISWRGTQLKHEWLVGIKINLVPAAHILGEQNDPKVHHGWLSYYTDIDPASSHN  172

Query  746   GVS-ARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN---KDSP-  910
              ++ +RDQ    ++ ++ +YK EE+SIT+ GHS+G+++ATL A D+V N  N   +D P 
Sbjct  173   RLTNSRDQALAALKEVLNEYKGEEISITVTGHSMGAAMATLKATDIVRNGYNILLEDQPN  232

Query  911   --IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
               IPVTAF+FA P+VG   F N  S L +NL +LR+T+ +DIVPK P             
Sbjct  233   KVIPVTAFVFACPRVGNEGFGNVFSGL-ENLHVLRVTNDQDIVPKQPETA----------  281

Query  1085  SYEHVGMEFRFDASKSNYLDGFK--------ASWHTLVTYLHGVDGFQG-SQGGFKLHGD  1237
              Y HVG E RFD+ KS ++               H L  YLHGV G  G +   FKL  D
Sbjct  282   DYVHVGKELRFDSVKSPFMKVIPDVVIKEKVGILHDLEVYLHGVAGTHGINSSDFKLEVD  341

Query  1238  FDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              D++L+NK ID +K  Y+++  AEW+  KN  M+Q  DG W+LDDHE D+
Sbjct  342   RDLSLVNKYIDGVKDEYNIV--AEWWTEKNKSMIQTSDGFWVLDDHEKDE  389



>ref|XP_009119078.1| PREDICTED: phospholipase A1-IIalpha [Brassica rapa]
Length=440

 Score =   309 bits (792),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 166/407 (41%), Positives = 237/407 (58%), Gaps = 27/407 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG   W+GLLDPLD DLRRY+IHYG M    YD+F  +  S   G C Y++  +
Sbjct  45    KRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSLYAGDCYYSKSQI  104

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+Y VTKY Y+ +++     ++++S   +    Q+NW+GYVAVATD+GK
Sbjct  105   FARTGYLKANPFRYNVTKYIYATASLNLPICFIVKSLSKEASRVQTNWIGYVAVATDEGK  164

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLF---VKAPLIFGQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F     VK   +F     P +  G+ D+YT+ + 
Sbjct  165   ALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVFDSKIVPRIGSGWLDVYTSSDA  224

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
                    SAR+Q++ E++RL++ YK+EE+SIT  GHSLG  ++TL A DLV    N  S 
Sbjct  225   KSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAAADLVNGKKNTISS  284

Query  911   ------IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                   +P+T F F  P++G+++F   V  L   L ILR+ +  D+ P            
Sbjct  285   GLERKQVPITVFAFGCPRIGDQDFVKIVDSLK-QLNILRIVNVPDVAPH-----------  332

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  VG E + +   S YL     F+ ++H L  YLHG+ G Q   G FKL    D
Sbjct  333   YPLLLYAEVGQELQINTLNSTYLKRSLNFR-NYHNLEIYLHGMAGMQDKAGLFKLVIGRD  391

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             ++L+NK +D LK  +  + P+ W  + N GMVQ+DDGTW LD H  D
Sbjct  392   ISLVNKGLDALKDEF--LVPSTWRCLANKGMVQKDDGTWQLDVHRKD  436



>gb|KDP46901.1| hypothetical protein JCGZ_24110 [Jatropha curcas]
Length=403

 Score =   308 bits (789),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 172/394 (44%), Positives = 238/394 (60%), Gaps = 21/394 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW++LSG  NW+GLLDPLD DLR  +++YG    A+ D++ N+      G  R+    L
Sbjct  14    DRWRELSGENNWKGLLDPLDFDLRSSILNYGDRAVAIGDAYNNKKYEDLHGFSRFPPNEL  73

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLK-QSNWMGYVAVATDDG  556
               + G    N F Y VT + YS           +++Q    V++ +S W  YVAVATDDG
Sbjct  74    FTKVGVRARNEFDYNVTDFIYS----------RLEAQLFGIVIEDESTWCAYVAVATDDG  123

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN-PLVHKGFYDMYTAVNPD  733
             K  LGRRDI+V+WRGT+   E +++ +F+ + A  +F  ++N PL+H GF+ +YT    +
Sbjct  124   KKKLGRRDIVVSWRGTILPGEKLEDVEFIPIPASDMFPNNNNDPLIHSGFHQIYTTEKDN  183

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----  901
              I    SARDQ+   V +LV+QYKDEE+SIT+ GHSLGS+LATLNA+D+V   INK    
Sbjct  184   SIYNKKSARDQVLNAVSKLVDQYKDEEVSITVTGHSLGSALATLNAMDIVYKGINKPTGT  243

Query  902   -DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
              +   PVTA +FASP VG   FK    +L+D + +LR+ +AKD VP LPP  + V   +P
Sbjct  244   ANKSFPVTAIVFASPMVGNEGFKKVFDELSD-IHVLRVENAKDPVPTLPPNKLIV---IP  299

Query  1079  IISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
                Y HVG     D + S +L     + H L  YLHGV G QGS+GGF L    D AL+N
Sbjct  300   QHRYYHVGESLPIDTTLSPFLKTSDVNPHDLNVYLHGVAGTQGSKGGFNLDYPLDTALIN  359

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTW  1360
             K +D L   ++   P  W+V +N+GMV QDDGT+
Sbjct  360   KTVDGLNEKHNYNIPPNWWVEENNGMVLQDDGTY  393



>gb|KDP31780.1| hypothetical protein JCGZ_12241 [Jatropha curcas]
Length=372

 Score =   307 bits (786),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 164/381 (43%), Positives = 227/381 (60%), Gaps = 18/381 (5%)
 Frame = +2

Query  263   DLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLRESGHDNGNPFKYEVTKYFY  442
             DLRRYLIHYG M  A YD+FI++  S   G  RY  K +      +  NPFKY   KY Y
Sbjct  2     DLRRYLIHYGEMAQATYDNFISDVRSDYAGDYRYPMKKMFSGVDLNIANPFKYRAVKYVY  61

Query  443   SPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKAALGRRDILVAWRGTVRAAEW  622
             + S +    +++++S        Q NW+GYVAVATD+GKA LGRRDI++AWRGT++  EW
Sbjct  62    ATSKVELPQSFMVKSLAKQPWSSQCNWIGYVAVATDEGKAMLGRRDIVIAWRGTIQPIEW  121

Query  623   IKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPILKGVSARDQIREEVRRLVEQY  802
             +K+FQ   + A  I   D +P VH+GF  +Y   +        SAR+Q+ EEV+RL++++
Sbjct  122   VKDFQAPLISASNILKWDKDPRVHQGFLSLYNTADFVSAYSKTSAREQVIEEVKRLMQEF  181

Query  803   KDEEMSITLAGHSLGSSLATLNAVDLVTNPIN----KDSPIPVTAFLFASPKVGERNFKN  970
             K EE S+T+ GHSLG++LATLNA+D+  N  N         PVTAF+FASP+VG+RNFK 
Sbjct  182   KHEETSLTVTGHSLGAALATLNAIDIAANGFNIGDESKERSPVTAFVFASPRVGDRNFKE  241

Query  971   AVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEHVGMEFRFDASKSNYLD--  1144
              +S+  +NL IL++ +  D+VP  PP             Y  VG E   +   S +++  
Sbjct  242   -LSESVENLHILKIKNLNDLVPLTPPKES---------GYADVGKELLLNTLISPFVNRP  291

Query  1145  GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVK  1324
             G   SWH L  YLHGV G QG +  F L    D+ALLNK I  L+ +Y  + P  W   +
Sbjct  292   GGPLSWHNLEAYLHGVAGTQGDKPVFHLEVKRDIALLNKEISNLQPDY--LIPPAWRCPR  349

Query  1325  NSGMVQQDDGTWILDDHEVDD  1387
             N+GMV+  DG+W L D E ++
Sbjct  350   NTGMVKMKDGSWELRDQENEE  370



>gb|EAY75192.1| hypothetical protein OsI_03084 [Oryza sativa Indica Group]
Length=418

 Score =   308 bits (790),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 177/420 (42%), Positives = 239/420 (57%), Gaps = 44/420 (10%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L GS +W+GLLDPLD DLRR LI YG M+ A Y++FI E  S N G+CRY R +L 
Sbjct  4     RWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRRADLF  63

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
             R    D  +P  Y  T+Y Y+ +        L++    +    + NWMGYVAVATD+G A
Sbjct  64    RRV--DVSHPGWYAATRYIYATANADVHGKVLLRPLCREGRATECNWMGYVAVATDEGAA  121

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD----SNPLVHKGFYDMYTAVNP  730
             ALGRRDI+VAWRGT RA EW+ + +     A  I G +    ++P VH+G+  +YT+ + 
Sbjct  122   ALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLYTSEDQ  181

Query  731   DPILKGVSAR--------DQIRE-------EVRRLVEQYKDEEMSITLAGHSLGSSLATL  865
                L   SAR        D +R+       E+ RL+++YKDEE SIT+ GHSLG++LATL
Sbjct  182   CSELNKQSARMQNKKLGFDPMRQTLKKVLTEIARLMDKYKDEETSITVIGHSLGATLATL  241

Query  866   NAVDLVTNPINKDS-------PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAK  1024
             NA D+  N  N  S         PVTA +F SP+ G+R F++A  +L D L++LR+ +  
Sbjct  242   NAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRD-LRMLRVRNRP  300

Query  1025  DIVPKLPPFGVKVNTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDG  1198
             D +P  PP G           Y  VG+E   D   S +L   G ++  H L  +LHGV G
Sbjct  301   DRIPHYPPVG-----------YADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAG  349

Query  1199  FQGSQGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             + G   GF+L  D DVAL+NK  D L   Y +  P  W V  N  MV+  DG W+L DHE
Sbjct  350   WHGDHRGFELVVDRDVALVNKFDDCLADEYPV--PVRWKVHHNKSMVKGPDGRWVLQDHE  407



>sp|O82274.2|PLA19_ARATH RecName: Full=Phospholipase A1-IIbeta [Arabidopsis thaliana]
Length=414

 Score =   308 bits (789),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 173/399 (43%), Positives = 250/399 (63%), Gaps = 24/399 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RWK+LSGS  W+ LLDPLD DLRRY++HYG M    Y +F ++  SK VG   Y ++ L 
Sbjct  8     RWKELSGSSKWKDLLDPLDLDLRRYILHYGDMAEVGYLAFNSDRRSKYVGDSCYTKEELF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               +G+   NPF+YEVTKY Y  S+IR    ++I+S   +   K+SNW+GY+AVATD+GK 
Sbjct  68    ARTGYLKANPFRYEVTKYIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKK  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF-GQDSN--PLVHKGFYDMYTAVNPD  733
              LGRR I+VAWRGT++  EW  +F F    A ++F G + N  P V  G+  +YT+ +P 
Sbjct  128   LLGRRGIVVAWRGTIQLYEWANDFDFPLESAVMVFPGANPNDEPRVANGWLSLYTSTDPR  187

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP-  910
                   SA++Q++EE++RL+E YK+E+++ITL GHSLG+ ++ L+A D + N   K +P 
Sbjct  188   SRFDKTSAQEQVQEELKRLLELYKNEDVTITLTGHSLGAVMSILSAADFLHNEWPKITPS  247

Query  911   ----IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
                 + VT F F SP++G+R+FK  V  L ++L ILR+T+  D++P+ P F         
Sbjct  248   LQHSLCVTVFAFGSPQIGDRSFKRLVESL-EHLHILRVTNVPDLIPRYPVF---------  297

Query  1079  IISYEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVAL  1252
                +  +G E + +  KS YL        +H L  YLHGV G Q +QG FKL  + D+AL
Sbjct  298   --RFTDIGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQGEFKLEINRDIAL  355

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
             +NK +D L+  Y  + P  W+V++N GMVQ DDGTW L+
Sbjct  356   VNKGLDALEDKY--LVPGHWWVLENKGMVQSDDGTWKLN  392



>ref|XP_008648636.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=446

 Score =   309 bits (791),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 182/416 (44%), Positives = 241/416 (58%), Gaps = 38/416 (9%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G+ +W GLLDPLD DLRR +I YG +V A YD F  E  S + G C Y R +LL
Sbjct  43    RWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACLYGRADLL  102

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTV---LKQSNWMGYVAVATDD  553
                G       +Y VT++ Y+ S +    +       P+T     ++SNW+GYVAVATD+
Sbjct  103   PGVGVAAAG--RYAVTRFVYATSALPVPGSDFPLLPLPETREAWSRESNWIGYVAVATDE  160

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS--NPL--VHKGFYDMY--  715
             G A LGRRD++VAWRGTV+  EW  +F F  V A  + G  +  NPL  VH+GF  +Y  
Sbjct  161   GAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAVPVLGSAAAANPLAVVHQGFLSVYQL  220

Query  716   ------TAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVD  877
                   T+ N D      SARDQ+ EEVRRL+E YK E  SIT+ GHSLG++LATLNAVD
Sbjct  221   SSLTLTTSCNADSRFNKASARDQVLEEVRRLMELYKGEATSITVVGHSLGAALATLNAVD  280

Query  878   LVTNPINKDS------PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPK  1039
             +  N +N+ S      P PVTA LFA P VG+R F+ A      +L+ L + +A D+VP 
Sbjct  281   IAANGLNEGSGSSQQLPCPVTAILFACPHVGDRFFRAAFVGSFRDLRALHVRNAGDVVPL  340

Query  1040  LPPFGVKVNTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGS-  1210
             +PP    V+  + ++           D S+S YL   G   + H L  YLHGV G Q S 
Sbjct  341   VPPLAY-VDVAVAVLP---------IDTSRSPYLRSPGPAGTLHNLECYLHGVAGKQSSA  390

Query  1211  QGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
              GGF+L  D DVAL+NK  D L+  Y +  PA W+V +N  MV+  +G W+L D E
Sbjct  391   AGGFRLEVDRDVALVNKGADALRDEYPV--PANWWVPENRWMVRGSEGHWMLKDFE  444



>emb|CDY10187.1| BnaC05g04300D [Brassica napus]
Length=402

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 165/407 (41%), Positives = 236/407 (58%), Gaps = 27/407 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG   W+GLLDPLD DLRRY+IHYG M    YD+F  +  S   G C Y++  +
Sbjct  7     KRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSLYAGDCYYSKSQI  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+Y VTKY Y+ +++     ++++S   +    Q+NW+GYVAVATD+GK
Sbjct  67    FARTGYLKANPFRYNVTKYIYATASLNLPICFIVKSLSKEASRVQTNWIGYVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLF---VKAPLIFGQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F     VK   +      P +  G+ D+YT+ + 
Sbjct  127   ALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVIDSKIVPRIGSGWLDVYTSSDA  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
                    SAR+Q++ E++RL++ YK+EE+SIT  GHSLG  ++TL A DLV    N  S 
Sbjct  187   KSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAAADLVNGKKNTISS  246

Query  911   ------IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                   +P+T F F  P++G+++F   V  L   L ILR+ +  D+ P            
Sbjct  247   GLERKQVPITVFAFGCPRIGDQDFVKIVDSLK-QLNILRIVNVPDVAPH-----------  294

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  VG E + +   S YL     F+ ++H L  YLHG+ G Q   G FKL    D
Sbjct  295   YPLLLYAEVGQELQINTLNSTYLKRSLNFR-NYHNLEIYLHGMAGMQDKAGLFKLVIGRD  353

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             ++L+NK +D LK  +  + P+ W  + N GMVQ+DDGTW LD H  D
Sbjct  354   ISLVNKGLDALKDEF--LVPSTWRCLANKGMVQKDDGTWQLDVHRKD  398



>ref|XP_010469763.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=411

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 173/400 (43%), Positives = 244/400 (61%), Gaps = 25/400 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RWK+LSG+  W+ LLDPLD DLRRY++HYG M    Y +F ++  SK VG   Y ++ L 
Sbjct  8     RWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKEELF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               +G+   NPF+YEVTK+ Y  S+IR    ++I+S   +   K+SNW+GY+AVATD+GK 
Sbjct  68    ARTGYLKANPFRYEVTKFIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKR  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ---DSNPLVHKGFYDMYTAVNPD  733
              LGRRDI+VAWRGT++  EW  +F F    A  +F +   +  P V  G+  +YT+ +P 
Sbjct  128   LLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRVANGWLSLYTSTDPR  187

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP-  910
                   SAR+Q++ E+ RL+E YKDEE++ITL GHSLG+ L+ L+A D + N + K +P 
Sbjct  188   SRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSAADFLHNELPKITPS  247

Query  911   -----IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
                    VT F F SP++G+R+FK  V     +L ILR+T+  D++P+ P F        
Sbjct  248   LQHRLTCVTVFAFGSPRIGDRSFKRLVESF-QHLHILRVTNVPDLIPRYPVF--------  298

Query  1076  PIISYEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
                 +  VG E + +  KS YL        +H L  YLHGV G Q +QG FKL    D+A
Sbjct  299   ---RFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQGEFKLEIKRDIA  355

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
             L+NK +D L+  Y  + P  W+V++N GMVQ DDGTW L+
Sbjct  356   LVNKGLDALEDKY--LVPGHWWVLENKGMVQSDDGTWKLN  393



>gb|ABK23399.1| unknown [Picea sitchensis]
Length=412

 Score =   307 bits (786),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 180/409 (44%), Positives = 242/409 (59%), Gaps = 34/409 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ L GS+ WEGL DPLDSDLR+ ++ YG    A YD+FI++  SK  G  RY   + 
Sbjct  8     KRWRLLQGSQLWEGLTDPLDSDLRKSILIYGDHCQATYDTFISDRGSKYAGSSRYGGPHF  67

Query  380   LRESG-HDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G       + Y ++K+ Y+ STI+    ++  S   +   ++SNWMGYVA  TD G
Sbjct  68    FDDLGLTKRPTEWGYSLSKFIYATSTIKVPEAFITTSLSREGGSRESNWMGYVAHVTDTG  127

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQ----FLFVKAPLIFGQD--------SNPLVHKG  700
             K   GRRDI VAWRGT+++ EW+ +F      L    P   G D        ++  V +G
Sbjct  128   KTQYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQTGLDRETDKVLRNDVRVQRG  187

Query  701   FYDMYTAVNPDPILKGVSARDQIREEVRRLVEQYKD-EEMSITLAGHSLGSSLATLNAVD  877
             ++D+YT+ +        SAR+Q+  EV+RL+E+YKD EE+SIT  GHSLG++LATL A D
Sbjct  188   WFDIYTSEDSRSPFNKSSAREQVLREVKRLLEKYKDEEEISITTTGHSLGATLATLCAFD  247

Query  878   LVTNPINKDS----PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLP  1045
             +V N +NK S    PIPVTA +FASP+VG   FK  V KL D L++LR+T+  D+VP L 
Sbjct  248   IVINGLNKPSGRAIPIPVTAIVFASPRVGNDAFKKVVDKLPD-LRVLRVTNNPDLVP-LH  305

Query  1046  PFGVKVNTTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG  1219
             PF          + Y  VG+E R D  KS YL   G  + WH L  YLH V G QG  G 
Sbjct  306   PF----------LGYVEVGVELRVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQGKNGA  355

Query  1220  FKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWIL  1366
             FKL  D D+AL+NK+ D LK  Y  + P  W+V KN GMVQ +DG W +
Sbjct  356   FKLEVDRDIALVNKSTDWLKDEY--LVPVSWWVEKNKGMVQGNDGHWFM  402



>ref|XP_008655140.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
Length=1067

 Score =   323 bits (827),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 176/403 (44%), Positives = 230/403 (57%), Gaps = 27/403 (7%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             W +LSG  NW+GLLDPLD DLRR +I YG +  A  D+FI +P S   G  RYA    LR
Sbjct  674   WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  733

Query  386   ESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKAA  565
              +     +P  Y VT++ Y+ S+ R    ++ +   P     +SNWMGYVAVATD G A 
Sbjct  734   RA--QAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAVATDAGVAR  791

Query  566   LGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD---SNPLVHKGFYDMYTAVNPDP  736
             LGRRDI+VAWRGT RA EW  +     V A  + G     S P VH+GF  +Y + N   
Sbjct  792   LGRRDIVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAVHRGFLSVYASRNSTS  851

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP--  910
                  SAR+Q+  E+RRL++ YK E  SITL GHSLG++L+TL A+D+V N +N   P  
Sbjct  852   RFNKQSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTAIDIVANGLNVRGPNN  911

Query  911   --IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
               +PV A +F SP+VG+  FK A        ++LR+ +A D+VP          T LP  
Sbjct  912   DTVPVAAIVFGSPRVGDDQFKKAFDS-TPGARLLRVRNAPDVVP----------TVLPNA  960

Query  1085  SYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGS--QGGFKLHGDFDVA  1249
              Y+ VG+E   D  KS +L       A+WH L  YLHGV G QG+    GF L  D DVA
Sbjct  961   FYKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSLEVDRDVA  1020

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             L+NK +D L  +Y +  PA W+V  N GM +   G W+L DHE
Sbjct  1021  LVNKEVDALSDDYPV--PAAWWVEGNKGMTRDASGRWVLQDHE  1061



>gb|ABR18391.1| unknown [Picea sitchensis]
Length=412

 Score =   306 bits (784),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 179/409 (44%), Positives = 242/409 (59%), Gaps = 34/409 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ L GS+ WEGL DPLDSDLR+ ++ YG    A YD+FI++  SK  G  RY   + 
Sbjct  8     KRWRLLQGSQRWEGLTDPLDSDLRKSILIYGDHCQATYDTFISDRGSKYAGSSRYGGPHF  67

Query  380   LRESG-HDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G       + Y ++K+ Y+ STI+    ++  S   +   ++SNWMGYVA  TD G
Sbjct  68    FEDLGLTKRPTEWGYSLSKFIYATSTIKVPEAFIRTSLSREGGSRESNWMGYVAHVTDTG  127

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQ----FLFVKAPLIFGQD--------SNPLVHKG  700
             K   GRRDI VAWRGT+++ EW+ +F      L    P   G D        ++  V +G
Sbjct  128   KTQYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQTGLDRETDKVLRNDARVQRG  187

Query  701   FYDMYTAVNPDPILKGVSARDQIREEVRRLVEQYKD-EEMSITLAGHSLGSSLATLNAVD  877
             ++D+YT+ +        SAR+Q+  EV+RL+E+YKD EE+SIT  GHSLG++LATL A D
Sbjct  188   WFDIYTSEDSRSPFNKSSAREQVLREVKRLLEKYKDEEEISITTTGHSLGATLATLCAFD  247

Query  878   LVTNPINKDS----PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLP  1045
             +V N +NK S    PIPVTA +FASP+VG   FK  V KL D L++LR+T+  D+VP L 
Sbjct  248   IVINGLNKPSGRAIPIPVTAIVFASPRVGNDAFKKVVDKLPD-LRVLRVTNNPDLVP-LH  305

Query  1046  PFGVKVNTTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG  1219
             PF          + Y  VG+E   D  KS YL   G  + WH L  YLH V G QG  G 
Sbjct  306   PF----------LGYVEVGVELPVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQGKNGA  355

Query  1220  FKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWIL  1366
             FKL  D D+AL+NK+ D LK  Y  + P  W+V KN GMVQ +DG W++
Sbjct  356   FKLEVDRDIALVNKSTDWLKDEY--LVPVSWWVEKNKGMVQGNDGHWLM  402



>ref|XP_004505133.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Cicer arietinum]
Length=364

 Score =   305 bits (780),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 178/399 (45%), Positives = 237/399 (59%), Gaps = 59/399 (15%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W++LSG   W+GLLDPL  DLR+YL+HYG +  + YD+F +E  SK  G C Y++K+L 
Sbjct  7     KWRELSGESKWKGLLDPLKIDLRKYLLHYGQLAQSTYDAFNSEKASKYAGNCLYSKKDLF  66

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQS-QRPDTVLKQSNWMGYVAVATDDGK  559
              +   + GNPFKY +TK+ Y+ S    + ++L++S    D    +SNW+GYVAVATD+GK
Sbjct  67    SKVNLEKGNPFKYSITKFIYATSKASDSESFLLRSILSKDAWSMESNWIGYVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
              +LGRRDI+VAWRGT+                     QD NP    GF    +       
Sbjct  127   VSLGRRDIVVAWRGTI---------------------QD-NP----GFQSANS-------  153

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP-  910
                 SAR+Q+  E+ RLVEQYK+EE+SIT+ GHSLG++LA +N+VD+V N  N  K+ P 
Sbjct  154   ----SARNQVLSEISRLVEQYKNEEISITITGHSLGAALAVINSVDIVANKFNISKEQPQ  209

Query  911   --IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPII  1084
                PVT F FASP+VG  +F N  S   D L  L + +  DIVP +  F          +
Sbjct  210   KSCPVTTFAFASPRVGNSSFGNIFSNYKD-LNALLIRNQTDIVP-ISLF----------L  257

Query  1085  SYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
              Y  VG E   D  KS YL    +S H L  YLHGV G QGS+GGF L  + D+AL+NK+
Sbjct  258   GYSEVGEELLIDTKKSKYLKSGVSS-HNLEVYLHGVAGTQGSKGGFNLEVNRDIALVNKS  316

Query  1265  IDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTW-ILDDHE  1378
              D LK  Y +  P  W VV+N GMVQQ DGTW ++DD+E
Sbjct  317   NDGLKDEYRV--PNAWRVVENKGMVQQFDGTWKLMDDNE  353



>dbj|BAD68802.1| lipase-like protein [Oryza sativa Japonica Group]
Length=418

 Score =   306 bits (784),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 176/420 (42%), Positives = 238/420 (57%), Gaps = 44/420 (10%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L GS +W+GLLDPLD DLRR LI YG M+ A Y++FI E  S N G+CRY   +L 
Sbjct  4     RWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRHADLF  63

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
             R    D  +P  Y  T+Y Y+ +        L++    +    + NWMGYVAVATD+G A
Sbjct  64    RRV--DVSHPGWYAATRYIYATANADVHGKVLLRPLCREGRATECNWMGYVAVATDEGAA  121

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD----SNPLVHKGFYDMYTAVNP  730
             ALGRRDI+VAWRGT RA EW+ + +     A  I G +    ++P VH+G+  +YT+ + 
Sbjct  122   ALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPSVHRGYLSLYTSEDQ  181

Query  731   DPILKGVSAR--------DQIRE-------EVRRLVEQYKDEEMSITLAGHSLGSSLATL  865
                L   SAR        D +R+       E+ RL+++YKDEE SIT+ GHSLG++LATL
Sbjct  182   CSELNKQSARMQNKKLGFDPMRQTLKKVLTEIARLMDKYKDEETSITVIGHSLGATLATL  241

Query  866   NAVDLVTNPINKDS-------PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAK  1024
             NA D+  N  N  S         PVTA +F SP+ G+R F++A  +L D L++LR+ +  
Sbjct  242   NAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRD-LRMLRVRNRP  300

Query  1025  DIVPKLPPFGVKVNTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDG  1198
             D +P  PP G           Y  VG+E   D   S +L   G ++  H L  +LHGV G
Sbjct  301   DRIPHYPPVG-----------YADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAG  349

Query  1199  FQGSQGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             + G   GF+L  D DVAL+NK  D L   Y +  P  W V  N  MV+  DG W+L DHE
Sbjct  350   WHGDHRGFELVVDRDVALVNKFDDCLADEYPV--PVRWKVHHNKSMVKGPDGRWVLQDHE  407



>emb|CDY57813.1| BnaA10g28020D [Brassica napus]
Length=545

 Score =   310 bits (794),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 166/407 (41%), Positives = 237/407 (58%), Gaps = 27/407 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG   W+GLLDPLD DLRRY+IHYG M    YD+F  +  S   G C Y++  +
Sbjct  150   KRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSLYAGDCYYSKSQI  209

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+Y VTKY Y+ +++     ++++S   +    Q+NW+GYVAVATD+GK
Sbjct  210   FARTGYLKANPFRYNVTKYIYATASLNLPICFIVKSLSKEASRVQTNWIGYVAVATDEGK  269

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLF---VKAPLIFGQDSNPLVHKGFYDMYTAVNP  730
             A LGRRDI+VAWRGT++  EW  +F F     VK   +F     P +  G+ D+YT+ + 
Sbjct  270   ALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVFDSKIVPRIGSGWLDVYTSSDA  329

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
                    SAR+Q++ E++RL++ YK+EE+SIT  GHSLG  ++TL A DLV    N  S 
Sbjct  330   KSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAAADLVNGKKNTISA  389

Query  911   ------IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                   +P+T F F  P++G+++F   V  L   L ILR+ +  D+ P            
Sbjct  390   GLERKQVPITVFAFGCPRIGDQDFVKIVDSL-KQLNILRIVNVPDVAPH-----------  437

Query  1073  LPIISYEHVGMEFRFDASKSNYLD---GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
              P++ Y  VG E + +   S YL     F+ ++H L  YLHG+ G Q   G FKL    D
Sbjct  438   YPLLLYAEVGQELQINTLNSTYLKRSLNFR-NYHNLEIYLHGMAGMQDKAGLFKLVIGRD  496

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             ++L+NK +D LK  +  + P+ W  + N GMVQ+DDGTW LD H  D
Sbjct  497   ISLVNKGLDALKDEF--LVPSTWRCLANKGMVQKDDGTWQLDVHRKD  541



>ref|XP_007210039.1| hypothetical protein PRUPE_ppa017270mg [Prunus persica]
 gb|EMJ11238.1| hypothetical protein PRUPE_ppa017270mg [Prunus persica]
Length=376

 Score =   304 bits (779),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 181/399 (45%), Positives = 245/399 (61%), Gaps = 32/399 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+ LSG   WEGLL+PLD DLRRY++HYG   +A+ D+FI+E  S N GL RYA++ L
Sbjct  6     KRWRLLSGETEWEGLLNPLDLDLRRYILHYGERAAAIADAFIDETKSDNCGLPRYAKRYL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G +N NP+KY+V KY Y+ +T+                  +S W+GYVAVATD+GK
Sbjct  66    FSKVGLENSNPYKYKVKKYLYAATTLSPG---------------KSIWLGYVAVATDEGK  110

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
               LGRRDILV+WRGT   AEW  +  F  V A  I G+  +P VH GF+  YT ++P   
Sbjct  111   KVLGRRDILVSWRGTELVAEWGIDVVFDLVSASDILGEKHDPKVHHGFHSYYTHIDPQSP  170

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK--DSPI  913
                 S R Q    ++ +V +YK+E +SIT+ GHS+G+++  LNA D+V N  NK    P+
Sbjct  171   HNKTSCRAQALAAIKEVVNRYKNETISITVTGHSMGAAMGILNATDIVYNGYNKPPGHPV  230

Query  914   -PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISY  1090
              PVTA +FA+P++G++   N    L  NL +LR+T+  D++P LPPF           +Y
Sbjct  231   CPVTAIVFAAPRLGDQGLSNVFYGLK-NLHVLRVTNDYDLIPSLPPFA----------NY  279

Query  1091  EHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNID  1270
              HVG E RFD  KS YL   K S H+L  YLHGV G QG +  FKL    D+AL+NK +D
Sbjct  280   LHVGKELRFDTFKSPYLKDPKQSLHSLEVYLHGVAGTQG-ENDFKLAVKRDLALVNKYLD  338

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              LK  Y  +  A+W+  KN  M+Q DDG+W+L DHE DD
Sbjct  339   GLKDKY--LVVAKWWTEKNKSMLQIDDGSWVLMDHESDD  375



>ref|XP_010414181.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=423

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 173/400 (43%), Positives = 243/400 (61%), Gaps = 25/400 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RWK+LSG+  W+ LLDPLD DLRRY++HYG M    Y +F ++  SK VG   Y ++ L 
Sbjct  17    RWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKEELF  76

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               +G+   NPF+YEVTK+ Y  S+IR    ++I+S   +   K+SNW+GY+AVATD+GK 
Sbjct  77    ARTGYLKANPFRYEVTKFIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKR  136

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ---DSNPLVHKGFYDMYTAVNPD  733
              LGRRDI+VAWRGT++  EW  +F F    A  +F +   +  P V  G+  +YT+ +P 
Sbjct  137   LLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRVANGWLSLYTSTDPR  196

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP-  910
                   SAR+Q++ E+ RL+E YKDEE++ITL GHSLG+ L+ L+A D + N + K  P 
Sbjct  197   SRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSAADFLHNELPKIRPS  256

Query  911   -----IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
                    VT F   SP++G+R+FK  V  L  +L ILR+T+  D++P+ P F        
Sbjct  257   LQHRLTCVTVFALGSPRIGDRSFKRLVESL-QHLHILRVTNVPDLIPRYPVF--------  307

Query  1076  PIISYEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVA  1249
                 +  VG E + +  KS YL        +H L  YLHGV G Q +QG FKL    D+A
Sbjct  308   ---RFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQGEFKLEIKRDIA  364

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
             L+NK +D L+  Y  + P  W+V++N GMVQ DDGTW L+
Sbjct  365   LVNKGLDALEDKY--LVPGHWWVLENKGMVQSDDGTWKLN  402



>ref|XP_003528483.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31004.1| Phospholipase A1-IIgamma [Glycine soja]
Length=366

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 219/344 (64%), Gaps = 29/344 (8%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W+DLSG  NW+GLLD LD DLRRY++HYG +  A YD+F +E      G CRY   +  
Sbjct  7     KWRDLSGQSNWQGLLDSLDIDLRRYILHYGQLAQATYDAFNSEN-----GNCRYPMSDFF  61

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G +NGNPFKY VTK+ Y+ S        ++          ++NW+GYVAVATD+GK 
Sbjct  62    SKVGLENGNPFKYVVTKFLYATSQTSAPRACILNLFSKKEWNTRTNWIGYVAVATDEGKE  121

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI+V WRGT++A+EW+ N  F    AP +F  DS   VH GFY MYT+ NP+ + 
Sbjct  122   ALGRRDIVVTWRGTIQASEWVDNLNFDLDPAPEMFAVDSPFQVHDGFYSMYTSNNPEDVQ  181

Query  743   KGV-SARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNP--INKDS--  907
              G+ S R+Q++EEV+RLVE+YK+EE+SIT+ GHSLG++LATL+A+D+V     I+KD   
Sbjct  182   FGLTSVRNQVQEEVKRLVEEYKNEEISITVTGHSLGAALATLSALDIVAQKWNISKDQQP  241

Query  908   --PIPVTAFLFASPKVGERNFKNAVSKLAD-NLKILRLTDAKDIVPKLP----PFGVKVN  1066
                 PVTAFLFASP+VG  +F    ++  D NL+ LR+ + KD VPK+P    P+G    
Sbjct  242   SKACPVTAFLFASPRVGNSHFGKIFNEYKDKNLRALRIRNKKDNVPKVPFRLFPWG----  297

Query  1067  TTLPIISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDG  1198
                    + HVG E   D  KS +L    AS H+L  YLHG+ G
Sbjct  298   -------FTHVGEELVIDTRKSEFLKS-DASSHSLEVYLHGIAG  333



>gb|KDP46905.1| hypothetical protein JCGZ_24114 [Jatropha curcas]
Length=403

 Score =   303 bits (777),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 174/394 (44%), Positives = 235/394 (60%), Gaps = 21/394 (5%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNV-GLCRYARKN  376
             +RW++LSG  NWEGLLDPLD DLR  +++YG    A+ D++ +    K++ G  RY    
Sbjct  14    DRWRELSGENNWEGLLDPLDFDLRSSILNYGDRAVAIGDAYNSYRKFKDLHGFSRYPPNE  73

Query  377   LLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
             +  + G    N F Y VT + YS           +++Q  D V+ +S W  YVAVATDDG
Sbjct  74    VFTKVGIRARNEFDYTVTDFIYS----------RLEAQWFDNVINESTWCAYVAVATDDG  123

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSN-PLVHKGFYDMYTAVNPD  733
             K  LGRRDI+V+WR T    E +++++F+ V A  IF  ++N PL+H GF  +YT  +  
Sbjct  124   KKKLGRRDIVVSWRETALDGEKLEDYEFIPVSASDIFPNNNNDPLIHFGFRSIYTTKDDK  183

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPI  913
              I    SARDQ+ + V +LV+QYKDEE+SITL GHSLGS+LATLNAVD+    INK + I
Sbjct  184   SIYNKKSARDQVLDAVSKLVDQYKDEEVSITLTGHSLGSALATLNAVDIAYKGINKPTGI  243

Query  914   -----PVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
                  PVTA +F  P VG   FK    +L+D +++LR+ +A D VPKLPP  + +   +P
Sbjct  244   SNKSFPVTAIVFGCPMVGNEGFKKVFDELSD-VRVLRVENANDPVPKLPPNELIL---MP  299

Query  1079  IISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
                Y HVG     D + S +L     + H L  YLHGV G QGS+GGF L    D AL+N
Sbjct  300   QHRYYHVGESLPIDTTLSPFLKTSDVNPHDLNVYLHGVAGTQGSKGGFNLEYPLDTALIN  359

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTW  1360
             K  D L    +   P  W+V +N GMV QDDGT+
Sbjct  360   KRGDDLNAENNYNIPPIWWVEENKGMVLQDDGTY  393



>ref|XP_002522552.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39852.1| triacylglycerol lipase, putative [Ricinus communis]
Length=403

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 181/406 (45%), Positives = 241/406 (59%), Gaps = 31/406 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             + WK LSG  NW+GLLDP+D +LRRYLI+YG+   A  DSF +  +S    LCRY  + L
Sbjct  6     KNWKVLSGENNWKGLLDPIDDNLRRYLINYGAFTRAPADSFNDVKVSDGFALCRYPPEVL  65

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                 G  +GNPFKY VT YFY+ S       YL     P T    S ++G+VAV+TD+GK
Sbjct  66    FTRVGLQSGNPFKYLVTDYFYARSEADAFREYL-----PAT----STFVGFVAVSTDEGK  116

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
               LGRRDI+V WRGT    EW ++     V A  IF  DS  LVH GFY+MYTA +    
Sbjct  117   LVLGRRDIIVCWRGTTLPIEWFQDILCDQVPATDIF-PDSEALVHNGFYNMYTAKDSTST  175

Query  740   LKGVSARDQIREEVRRLVEQY----KDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDS  907
                +S R+Q+   VRRLV+++     +E +SIT+ GHSLG++LATLNAVD+V N  N+ +
Sbjct  176   YNKMSVREQVLAAVRRLVDKHYEAGSNEVVSITVIGHSLGAALATLNAVDIVANEYNRPT  235

Query  908   ----PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
                  +PV +F+F SP+VG++ F +  S L  NL +LR+ +A+D +P+LPP        +
Sbjct  236   GSTVELPVASFVFGSPRVGDKGFLDVFSGLK-NLHLLRIRNAQDFIPELPP------KKI  288

Query  1076  PIISYEHVGMEFRFDASKSNYLDGFKASW---HTLVTYLHGVDGFQGSQGGFKLHGDFDV  1246
                SY  VG E   D S S Y+   KA++   H L  Y HG+ G+QG    FKL  DFD+
Sbjct  289   LGYSYADVGAELDIDTSLSPYIK--KATFMEPHDLNLYCHGISGYQGKDRKFKLAVDFDL  346

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             AL+NK  D L  +Y  + P  W  V N GM Q DDG+W L D+  D
Sbjct  347   ALVNKYNDLLLEDYK-VPPKWWSNVMNKGMAQMDDGSWKLHDYVPD  391



>emb|CDX76515.1| BnaA08g08850D [Brassica napus]
Length=398

 Score =   303 bits (775),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 170/406 (42%), Positives = 234/406 (58%), Gaps = 59/406 (15%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+GLL PLD DLR+YLIHYG M  A YD+F     SK  G   Y+RK+ 
Sbjct  36    KRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSKFAGSSIYSRKDF  95

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ ++ S I    ++L+     +   K+SNW+GYVAV  D G
Sbjct  96    FAKVGLEKAHPYTKYKVTKFLFATSQIHVPESFLLFPVSREGCTKESNWIGYVAVTDDQG  155

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDP  736
              AALGRRDI                                   VH+G+Y +Y + +   
Sbjct  156   TAALGRRDI-----------------------------------VHQGWYSIYMSKDERS  180

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----  901
                  +ARDQ+  E+ RL+E+YKDE++SI++ GHSLG+++ATLNA D+V N  N+     
Sbjct  181   PFNKANARDQVLREIGRLLEKYKDEKISISICGHSLGAAIATLNAADIVANGYNRPKSRP  240

Query  902   DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
             D   PVTAF+FASP+VG+ +FK   S L D L++LR+ +  D+VP  PP G         
Sbjct  241   DKSCPVTAFVFASPRVGDSDFKKLFSGLKD-LRVLRVRNLPDVVPIYPPLG---------  290

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDVA  1249
               Y  VG E   D  KS YL   G  A++H L  YLHG+ G QG+     F+L    D+ 
Sbjct  291   --YAEVGDELPIDTRKSPYLKSPGDLATFHCLEVYLHGLAGTQGTSKADLFRLDVKRDIG  348

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             L+NK++D LK  Y  M P  W ++KN GMVQQ+DG+W L DHE+DD
Sbjct  349   LVNKSVDGLKDEY--MVPGHWRILKNKGMVQQNDGSWKLMDHEIDD  392



>ref|XP_004960509.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=420

 Score =   303 bits (777),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 183/402 (46%), Positives = 239/402 (59%), Gaps = 28/402 (7%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G+ +W GLLDPLD DLR+ +I YG +  A  D F +E  S + G C Y R +LL
Sbjct  31    RWRELHGNNSWNGLLDPLDIDLRKSVIAYGELAQAAQDGFNHERRSPHAGACLYGRSDLL  90

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQS--QRPDTV-LKQSNWMGYVAVATDD  553
               +G        Y VTK+FY+ S +    + L+    +  D    ++SNW+GYVAVATD+
Sbjct  91    --AGVGVAAAGSYAVTKFFYATSAVPVPESVLLLPLPELGDAAWCRESNWIGYVAVATDE  148

Query  554   GKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS--NPL--VHKGFYDMYTA  721
             G A LGRRDI+VAWRGTV   EW  +F F  V A  + G  +  NPL  VH+GF  +YT+
Sbjct  149   GVAELGRRDIVVAWRGTVTDLEWANDFSFTPVSAAPVLGSSAAANPLAMVHQGFLSVYTS  208

Query  722   VNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
              N +      SARDQ+ EEVRRL++ YKDEE SIT+ GHSLG++LA LNAVD+  N +N 
Sbjct  209   SNANSKYNKASARDQVFEEVRRLMQLYKDEETSITITGHSLGAALAVLNAVDIAANGLNA  268

Query  902   DS---PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
              S   P PVTA +FA P VG+R+FK A     ++L+ L + +A D+VP +PP        
Sbjct  269   ASSQPPCPVTAVVFACPHVGDRSFKAAFDSF-EHLRALHVKNAGDVVPIVPPVVYVDVGV  327

Query  1073  LPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDV  1246
             L  I           D  +S YL   G   + H L  YLHGV G QG  GGFKL  D DV
Sbjct  328   LLAI-----------DTGRSPYLKKPGTVQTLHNLECYLHGVAGEQGRAGGFKLEVDRDV  376

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDD  1372
             AL+NK +D L+  Y +  PA W+V KN  MV+  DG W L+D
Sbjct  377   ALVNKGVDALEDEYPV--PANWWVPKNKWMVRGADGHWKLED  416



>gb|EMS52156.1| Phospholipase A1-II 2 [Triticum urartu]
Length=386

 Score =   301 bits (771),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/403 (42%), Positives = 235/403 (58%), Gaps = 35/403 (9%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW++L GS +W+ LLDPLD DLRR LI+YG M+ A Y++FI E  S N G+CRY R +L
Sbjct  3     ERWRELHGSDHWDSLLDPLDVDLRRCLINYGEMIMATYEAFIAERRSPNAGMCRYRRADL  62

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
              R    +  +P  Y VT+Y Y+ ++       L++    +   ++ NWMGYVAVATD+G 
Sbjct  63    FRRV--EVSHPGWYAVTRYIYATASADVHGKVLLRPLCRNGRARECNWMGYVAVATDEGA  120

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             AALGRRDI+VAWRGT RA EW+ + +  F  A  + G  + P          TAV     
Sbjct  121   AALGRRDIVVAWRGTQRALEWVADLKLAFASAARVLGAATGP------NRRCTAVQYRSK  174

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD-----  904
             L      +Q+  E+ RL+++YKDE+ SIT+ GHSLG++LATLNAVD+  N  NK      
Sbjct  175   LA-----EQVLTEIARLMDKYKDEQTSITVVGHSLGATLATLNAVDIAANYYNKSALCTA  229

Query  905   -SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
              S  PVTA +F SP+ G+ +F++   +L   L++LR+ +  D +P  PP G         
Sbjct  230   GSRAPVTAVVFGSPRTGDHDFRDIFHRLP-GLRMLRVRNRPDRIPLYPPVG---------  279

Query  1082  ISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALL  1255
               Y  VG+E   D  +S +L   G ++  H L  +LHGV G+QG  G F+L  D D+AL+
Sbjct  280   --YADVGVELLIDTRRSPFLKPHGNESQSHDLECHLHGVAGWQGEHGEFELVVDRDIALV  337

Query  1256  NKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             NK  D L   + +  P  W V  N  MV+  DG W+L+DHE D
Sbjct  338   NKFDDCLTDEHPV--PVGWKVHHNKNMVKGPDGRWVLEDHESD  378



>ref|XP_008238420.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=379

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 175/411 (43%), Positives = 238/411 (58%), Gaps = 56/411 (14%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ LSG   WEGLL PLD DLRRY+IHYG   SA+ D+FI+EP SKN GL RYA++NL 
Sbjct  7     RWRLLSGETEWEGLLYPLDIDLRRYIIHYGERASAIADAFIDEPKSKNSGLPRYAKRNLF  66

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G ++ +P+KY V  Y Y+ + +               V  +S W+GYVAV TD+GK 
Sbjct  67    SKVGLESYSPYKYVVKTYLYAATKL---------------VPGKSIWLGYVAVTTDEGKR  111

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD--SNPLVHKGFYDMYTAVNPDP  736
              LGRRDIL++WRGT    E+  + +   V A  + G+D  + P VH G+ + YT      
Sbjct  112   VLGRRDILISWRGTKLEKEFDIDRETTLVPASDVLGKDNVNKPKVHSGWLNYYT------  165

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  S R+Q    V+ L+++YK EE+SIT+ GHS+G+++  LNA D+V N  NK S  P
Sbjct  166   -----SCRNQALVAVKELLKKYKGEEISITVTGHSMGAAIGILNATDIVYNGYNKLSDKP  220

Query  917   -----VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                  VTA +FA P +G+  F    + L  NL +LR+ +  D+ P L P G         
Sbjct  221   GKASLVTAIVFACPGLGDSGFNKVFASLK-NLHVLRVANTNDLAPILSPEG---------  270

Query  1082  ISYEHVGMEFRFDASKSNYLD---------GFKASWHTLVTYLHGVDGFQGSQGGFKLHG  1234
               Y HVG E RF++  S YL          G    +H L  YLHGV G QG + GFKL  
Sbjct  271   -KYVHVGKELRFNSLMSPYLKALSDYDDWIGIVEMFHDLEVYLHGVAGTQG-ENGFKLAV  328

Query  1235  DFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             D D+AL+NK +D +K  Y ++   +W++ KN  MVQQDDG+W+L DHE DD
Sbjct  329   DRDIALVNKLLDAVKDEYRIV--VKWWIEKNKSMVQQDDGSWVLMDHEKDD  377



>gb|EMT15520.1| Feruloyl esterase A [Aegilops tauschii]
Length=663

 Score =   309 bits (792),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 167/399 (42%), Positives = 239/399 (60%), Gaps = 28/399 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW++L GS +W+GLL+PLD DLRR LI+YG M+ A Y++FI E  S N G+CRY R +L
Sbjct  212   ERWRELHGSDHWDGLLNPLDIDLRRCLINYGEMIMATYEAFIAERRSPNAGMCRYRRADL  271

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
              R    +  +P    V +Y Y+ ++       L++    +   ++ NWMGYVAVATD+G 
Sbjct  272   FRRV--EVSHPGWSAVPRYIYAAASADVHGKVLLRPLCRNGRARECNWMGYVAVATDEGA  329

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD----SNPLVHKGFYDMYTAVN  727
             AALGRRDI+VAWRGT RA EW+ + +  F  A  I G +    S P VH+G+  +YT+ +
Sbjct  330   AALGRRDIVVAWRGTQRALEWVADLKLAFASAAGILGAEGADGSEPSVHRGYLSLYTSAD  389

Query  728   PDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD-  904
                 +   SAR Q+  E+ R++++YKDE+ SIT+ GHSLG++LATLNAVD+  N  NK  
Sbjct  390   EGSEISKQSARMQVLTEIARMMDKYKDEQTSITVVGHSLGATLATLNAVDIAANYYNKSA  449

Query  905   -----SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNT  1069
                  S  PVTA +F SP+ G+R+F++   +L   L++LR+ +  D +P  PP G     
Sbjct  450   LCTAGSRAPVTAVVFGSPRTGDRDFRDIFHRLP-GLRMLRVRNRPDRIPLYPPVG-----  503

Query  1070  TLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
                   Y  VG+E   D  +S +L   G ++  H L  +LHG+ G+QG  G F+L  D D
Sbjct  504   ------YADVGVELLIDTRRSLFLKPHGNESQSHDLECHLHGIAGWQGEHGEFELVVDRD  557

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTW  1360
             +AL+NK  D L   + +  P  W V  N  MV+  DG+W
Sbjct  558   IALVNKFDDCLTDEHPV--PVGWKVHHNKNMVKGTDGSW  594



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 171/408 (42%), Positives = 237/408 (58%), Gaps = 26/408 (6%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  NW+GLLDP D DLRR +I YG M  A YD+F +E +S + GL R+ R+   
Sbjct  11    RWRELHGQNNWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFGRRRFF  70

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
                   + +   Y VTK+ Y+ S++     ++++S       ++SNW+GYVAVATDDGK 
Sbjct  71    ERVQLPD-HAAAYRVTKFLYATSSVAVPEPFILRSVSLGRRCRESNWIGYVAVATDDGKT  129

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD-SNPLVHKGFYDMYTAVNPDPI  739
             ALGRRDI+VAWRGT +A EWI + +F+      + G + S   VH+G+  MYT+ +P+  
Sbjct  130   ALGRRDIVVAWRGTTQALEWINDMEFVMAPPRSLLGDEASEATVHRGWLSMYTSSDPESS  189

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD-----  904
                 SARDQ+  EV RLV  Y  EE+SIT+ GHSLG++L TLNA D+  N  N+      
Sbjct  190   HNKDSARDQVLSEVARLVSMYDGEELSITVTGHSLGAALGTLNAFDIAANGYNRSPRAAA  249

Query  905   ---SPIPVTAFLFASPKVGERNFKNAV-SKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                +  PVTAF FASP+VG   F+          L++LR+ +A+DIVP+ P         
Sbjct  250   ATATGCPVTAFAFASPRVGGHGFRRRFDGARGAGLRLLRVRNARDIVPRYP---------  300

Query  1073  LPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG-FKLHGDFD  1243
                + Y  VG E   D  +S YL   G +  WH L +YLHGV G +G + G F+L  + D
Sbjct  301   -TALLYHDVGAELAIDTGESPYLRNPGNELLWHNLESYLHGVAGARGGEAGRFELAVERD  359

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             VAL NK    L+  + +  PA W++  N GMV+  DG W L D E D+
Sbjct  360   VALTNKFYGALRDEHPV--PAGWWIPSNRGMVRGADGRWTLMDCEEDE  405



>gb|EEE64775.1| hypothetical protein OsJ_19631 [Oryza sativa Japonica Group]
Length=387

 Score =   300 bits (768),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 172/407 (42%), Positives = 235/407 (58%), Gaps = 49/407 (12%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+GLLDP D DLRR +I YG M  A YD+F +E +S + GL R+A +   
Sbjct  14    RWRELHGESDWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFAARRFF  73

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              E     G+   Y V +                         ++SNW+GYVAVATD+GKA
Sbjct  74    -ERAQLPGHSAAYRVAR------------------------CRESNWIGYVAVATDEGKA  108

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAP-LIFGQDSNPLVHKGFYDMYTAVNPDPI  739
             ALGRRDI+VAWRGTV++ EWIK+  F+ V    L+  + S+ +VH+G+  MYT+ + +  
Sbjct  109   ALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRDKASDAMVHRGWLSMYTSRDSESS  168

Query  740   LKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP---  910
                 SARDQ+  EV +LV  Y+DEE+SIT+ GHSLG++LATLNA D+V N  N+      
Sbjct  169   HNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDIVENGYNRAPRAAA  228

Query  911   ----IPVTAFLFASPKVGERNFKNAVSKLAD-NLKILRLTDAKDIVPKLPPFGVKVNTTL  1075
                  PVTAF+FASP+VG   FK          L++LR+ +A+D+VP+ P          
Sbjct  229   AAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVPRYP----------  278

Query  1076  PIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG-FKLHGDFDV  1246
             P   Y  VG E   D  +S YL   G +  WH L  YLHGV G +G + G FKL  + DV
Sbjct  279   PAPPYHGVGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARGGEAGRFKLAVERDV  338

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             AL NK+   L+  +++  PA W++  N GMV+  DG W L D E D+
Sbjct  339   ALANKSYGALRDEHAV--PAGWWIPSNRGMVRGADGRWTLMDREEDE  383



>ref|XP_010510242.1| PREDICTED: phospholipase A1-IIbeta [Camelina sativa]
Length=415

 Score =   301 bits (771),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 172/401 (43%), Positives = 243/401 (61%), Gaps = 25/401 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+LSG+  W+ LLDPLD DLRRY++HYG M    Y +F ++  SK VG   Y ++ L
Sbjct  7     KRWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKEEL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+YEVTK+ Y  S+IR    ++I+S   +   K+SNW+GY+AVATD+GK
Sbjct  67    FARTGYLKANPFRYEVTKFIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ---DSNPLVHKGFYDMYTAVNP  730
               LGRRDI+VAWRGT++  EW  +F F    A  +F +   +  P V  G+  +YT+ +P
Sbjct  127   RLLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRVANGWLSLYTSTDP  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
                    SAR+Q++ E+ RL+E YKDEE++ITL GHSLG+ L+ L+A D + N   K +P
Sbjct  187   RSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSAADFLHNEFPKITP  246

Query  911   ------IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                     VT F F SP++G+R+FK  V     +L ILR+T+  D++P+ P F       
Sbjct  247   SLQQRLSCVTVFAFGSPRIGDRSFKRLVESF-QHLHILRVTNVPDLIPRYPVF-------  298

Query  1073  LPIISYEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGDFDV  1246
                  +  VG E + +  KS YL        +H L  YLHGV G Q +QG FKL    D+
Sbjct  299   ----RFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQGEFKLEIKRDI  354

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
             AL+NK +D L+  Y  + P   +V++N GMVQ DDGTW L+
Sbjct  355   ALVNKGLDALEDKY--LVPGHGWVLENKGMVQSDDGTWKLN  393



>ref|XP_008655897.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=424

 Score =   301 bits (770),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 184/430 (43%), Positives = 240/430 (56%), Gaps = 53/430 (12%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+GLLDPLD DLR  +I YG +  A YD F  E  S + G C Y   +LL
Sbjct  8     RWRELHGKDSWKGLLDPLDMDLRASVIAYGELAQATYDGFNTEARSPHAGACLYGHADLL  67

Query  383   RESGHDNGNPF----KYEVTKYFYSPSTIRTATNYLIQSQ----RPDTVLKQSNWMGYVA  538
               S    G       +Y VTK+ Y+ S +     +L+  Q    + +   ++SNWMGYVA
Sbjct  68    AASDSAGGGAGGISDRYRVTKFVYATSGLHVPDAFLLLPQPALGQQEPWCRESNWMGYVA  127

Query  539   VATDDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS----NPLVHKGFY  706
             VATD+G AALGRRD++VAWRGTVR+ EW+ +  F  V A  + G  +      +VH GF 
Sbjct  128   VATDEGAAALGRRDVVVAWRGTVRSLEWVNDLDFTPVPAAPVLGSAAAAHPRAMVHGGFL  187

Query  707   DMYTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVT  886
              +YT+ N       +SARDQ+ EEVRRL+E YKDEE SI++ GHSLG+SLATLNAVD+V 
Sbjct  188   SLYTSSNASSKYNKLSARDQVLEEVRRLMELYKDEETSISVTGHSLGASLATLNAVDMVA  247

Query  887   NPIN-----------------------KDSPIPVTAFLFASPKVGERNFKNAVSKLADNL  997
             N +N                       + +  PVTA +FASP+VG   FK A +  AD L
Sbjct  248   NGVNAPGAATATGTSGGSSSSPAQPQPQRAGCPVTAIVFASPRVGGPFFKAAFASFAD-L  306

Query  998   KILRLTDAKDIVPKLPPFG-VKVNTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHT  1168
             + L + +  D+VP  PP G V V   LPI              ++S +L   G   + H 
Sbjct  307   RALHVRNKGDVVPLYPPLGYVDVAVPLPI------------HTARSPWLRRPGTPQTLHN  354

Query  1169  LVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQD  1348
             L  YLHGV G QG+ GGF+L    DVAL+NK  D L+  Y +  PA W V  N GMV+  
Sbjct  355   LECYLHGVAGEQGAAGGFRLEVGRDVALVNKGADALRDEYPV--PARWRVALNKGMVRGA  412

Query  1349  DGTWILDDHE  1378
             DG W L D E
Sbjct  413   DGRWALKDFE  422



>ref|XP_007208858.1| hypothetical protein PRUPE_ppa025833mg [Prunus persica]
 gb|EMJ10057.1| hypothetical protein PRUPE_ppa025833mg [Prunus persica]
Length=379

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 175/411 (43%), Positives = 236/411 (57%), Gaps = 56/411 (14%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+ LSG   WEGLL PLD DLRRY+IHYG   SA+ D+FI+EP SKN GL RYA++NL 
Sbjct  7     RWRLLSGQTEWEGLLYPLDIDLRRYIIHYGERASAIADAFIDEPKSKNSGLPRYAKRNLF  66

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              + G ++ +P+KY V  Y Y+ + +               V  +S W+GYVAV TD+GK 
Sbjct  67    SKVGLESYSPYKYVVKTYLYAATKL---------------VPGKSIWLGYVAVTTDEGKR  111

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD--SNPLVHKGFYDMYTAVNPDP  736
              LGRRDIL++WRGT    E+  + +   V A  I G+D  + P VH G+ + YT      
Sbjct  112   VLGRRDILISWRGTKLEKEFDIDRETTLVPASDILGKDNVNEPKVHSGWLNYYT------  165

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIP  916
                  S R+Q    V+ L+++YK EE+SIT+ GHS+G+++  LNA D+  N  NK S  P
Sbjct  166   -----SCRNQALAAVKELLKKYKGEEISITVTGHSMGAAIGILNATDIAYNGYNKLSDNP  220

Query  917   -----VTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
                  VTA +FA P +G+  F    S L  NL +LR+ +  D+ P L   G         
Sbjct  221   GKASLVTAIVFACPGLGDSGFNKVFSSLK-NLHVLRVANTNDLAPILSAEG---------  270

Query  1082  ISYEHVGMEFRFDASKSNYLD---------GFKASWHTLVTYLHGVDGFQGSQGGFKLHG  1234
               Y HVG E RF++  S YL          G    +H L  YLHGV G QG + GFKL  
Sbjct  271   -KYVHVGKELRFNSLMSPYLKALSDYDDWIGIVEMFHDLEVYLHGVAGTQG-ENGFKLEV  328

Query  1235  DFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             D D+AL+NK +D +K  Y ++   +W++ KN  MVQQDDG+W+L DHE DD
Sbjct  329   DRDIALVNKLLDAVKDEYRIV--VKWWIEKNKSMVQQDDGSWVLMDHEKDD  377



>ref|XP_006295721.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
 gb|EOA28619.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
Length=411

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 170/401 (42%), Positives = 241/401 (60%), Gaps = 25/401 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+LSG+  W+ LLDPLD DLRRY++HYG M    Y +F ++  SK VG   Y ++ L
Sbjct  7     KRWKELSGTSKWKDLLDPLDLDLRRYILHYGDMAEVGYLAFNSDRRSKYVGDSCYTKEEL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+YE TK+ Y  S+IR    ++I+S   + + K+SNW+GYVAVATD+GK
Sbjct  67    FARTGYLKANPFRYEATKFIYGTSSIRLPECFIIKSLSREALYKESNWLGYVAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ---DSNPLVHKGFYDMYTAVNP  730
               LGRRDI+VAWRGT++  EW  +F F    A  +F Q   +  P +  G+  +YT+ + 
Sbjct  127   RLLGRRDIVVAWRGTIQLYEWANDFDFPLETAETVFPQANPNDTPRIANGWLSLYTSTDQ  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
                    SAR+Q++ E+ RL+E YKDEE++IT+ GHSLG+ L+ L+A D + N   K  P
Sbjct  187   RSRFDKTSAREQVQGELNRLLELYKDEEVTITITGHSLGAVLSILSAADFLYNESLKIRP  246

Query  911   ------IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTT  1072
                     VT F F SP++G+R+FK  V  L ++L ILR+T+  D++P  P F       
Sbjct  247   SLQHRLSCVTVFAFGSPRIGDRSFKRLVESL-EHLHILRVTNVPDLIPHYPVF-------  298

Query  1073  LPIISYEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGDFDV  1246
                  +  VG + + +  KS YL        +H L  YLHGV G Q  QG FKL  + D+
Sbjct  299   ----RFTDVGEDLQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHDQGEFKLEINRDI  354

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
             AL+NK +D L   Y  + P  W+V++N  MVQ DDGTW L+
Sbjct  355   ALVNKGLDALDDKY--LVPGHWWVLENKRMVQSDDGTWKLN  393



>ref|XP_006410236.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
 gb|ESQ51689.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
Length=414

 Score =   298 bits (764),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 173/404 (43%), Positives = 244/404 (60%), Gaps = 28/404 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+LSG+  W+ LLDPLD DLRRY++HYG M    Y +F ++  SK VG   Y ++ L
Sbjct  7     KRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVAFNSDRRSKYVGDSCYTKEEL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+YEVTKY Y  S+IR    ++I S   +   K+SNW+GY+AVATD GK
Sbjct  67    FARTGYLKANPFRYEVTKYIYGTSSIRLPECFIINSLSREAWNKESNWLGYIAVATDQGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ-DSN-----PLVHKGFYDMYTA  721
               LGRRDI+VAWRGT++  EW  +F F    A  +F + D N     P +  G+  +YT 
Sbjct  127   ELLGRRDIVVAWRGTIQLYEWANDFDFPLEPAISVFPKTDPNDPSDPPRIANGWLSLYTT  186

Query  722   VNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
              +P       SA++Q++ E++RL+E YKDEE++ITL GHSLG+ L+ L+A D + N   K
Sbjct  187   ADPRSRFDKTSAQEQVQGELKRLLELYKDEEVTITLTGHSLGAVLSILSATDFLHNEWPK  246

Query  902   ------DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKV  1063
                   D    VT F F SP++G+ NFK  V  L   L ILR+++  D++P+ P F    
Sbjct  247   TTTSLQDRLSCVTVFAFGSPRIGDLNFKRLVESLK-KLNILRISNVPDLIPRYPVF----  301

Query  1064  NTTLPIISYEHVGMEFRFDASKSNYLDGFK--ASWHTLVTYLHGVDGFQGSQGGFKLHGD  1237
                     +  +G E + +  KS YL        +H L  YLHGV G Q +QG FKL  +
Sbjct  302   -------RFADIGEELQINTLKSEYLKRSLNIKHFHNLEAYLHGVAGTQQNQGEFKLEIN  354

Query  1238  FDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
              D+AL+NK +D L+  Y  + P  W+V++N GMVQ+DDGTW+L+
Sbjct  355   RDIALVNKGLDALEDKY--LVPDHWWVLENKGMVQRDDGTWMLN  396



>ref|XP_010655496.1| PREDICTED: phospholipase A1-IIgamma isoform X2 [Vitis vinifera]
Length=321

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 211/331 (64%), Gaps = 28/331 (8%)
 Frame = +2

Query  431   KYFYSPSTIRTATNYL--------IQSQRPDTVLKQSNWMGYVAVATDDGKAALGRRDIL  586
             K   +PS +R   + L        I S R +   K+SNWMGYVAVATD+GKA LGRRDI+
Sbjct  6     KQLMTPSILRRPLDLLEVAAMRRRISSPR-EAWSKESNWMGYVAVATDEGKAVLGRRDIV  64

Query  587   VAWRGTVRAAEWIKNFQFLFVKAPLIFGQ-DSNPLVHKGFYDMYTAVNPDPILKGVSARD  763
             +AWRGTV+  EW+ +F+F  V A  I G+    P VH+G+Y +YT+ +P       SARD
Sbjct  65    IAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQGWYSIYTSDDPLSSFSKTSARD  124

Query  764   QIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIPVTAFLFASP  943
             Q+  EVRRLVE++K+EE+SI+L GHSLG+++ATLNAVD+V N +N+    PVTA +FASP
Sbjct  125   QVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVDIVANGLNQG--CPVTAVVFASP  182

Query  944   KVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEHVGMEFRFDA  1123
             +VG+ NF    S L  NL++LR+ +A DI+P  P  G           Y  VG E   D 
Sbjct  183   RVGDSNFLKLFSAL-KNLRVLRVRNASDIIPNYPLLG-----------YSDVGEELGVDT  230

Query  1124  SKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQLKGNYSLM  1297
              KS YL   G  ++WH L  +LHGV G QGS+GGF+L  + D+AL+NK+ID L   Y  +
Sbjct  231   RKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIALVNKSIDALNDEY--L  288

Query  1298  APAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
              P  W   KN GMVQQ DG+W L DHE DD+
Sbjct  289   VPVSWRCEKNKGMVQQVDGSWKLMDHEEDDL  319



>ref|XP_003565876.1| PREDICTED: phospholipase A1-II 6-like [Brachypodium distachyon]
Length=446

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 177/423 (42%), Positives = 239/423 (57%), Gaps = 50/423 (12%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDP-LDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             RWK++ G ++WEGLL P LD DLRR +I YG M  A YD+F +E +S N GL R+ R   
Sbjct  21    RWKEMHGERSWEGLLRPALDVDLRRTVIWYGEMAQATYDAFNHERVSPNAGLSRFRRGRF  80

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTV--------------LKQS  517
                +   + +   Y+VT++ Y+ S+        +   R   V               ++S
Sbjct  81    FHGAMLPD-HAGAYKVTRFLYATSSAPGHAAAFMVRGRGGHVSWRAAAGGHVSGGGCRES  139

Query  518   NWMGYVAVATDDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS--NPLV  691
             NW+GYVAVAT+ GKAALGRRDI+VAWRGTV + EW+ + +F  V AP    +D   + LV
Sbjct  140   NWIGYVAVATEAGKAALGRRDIVVAWRGTVESLEWVDDLEFAMV-APRGIVKDGCEDALV  198

Query  692   HKGFYDMYTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNA  871
             H+G+  MYT+ +P       SARDQ+  EVRRLVE YK+EE+SIT+ GHSLG++LATLNA
Sbjct  199   HRGWLSMYTSTHPASSHNKDSARDQVLGEVRRLVEMYKEEEVSITVTGHSLGAALATLNA  258

Query  872   VDLVTNPIN-----------KDSPIPVTAFLFASPKVGERNFKN--AVSKLADNLKILRL  1012
              D+  N  N           + +  PV  F FASP++G   FK   A + +A  L++LR+
Sbjct  259   FDIAENGYNTAIRAGAAPGPRATTFPVAVFAFASPRIGGAGFKKRFAAAAIASPLRVLRI  318

Query  1013  TDAKDIVPKLPPFGVKVNTTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLH  1186
              +A+DIVPK            P + Y  VG E   D   S YL   G +  WH L +YLH
Sbjct  319   RNARDIVPK-----------YPALLYHDVGCELTIDTGASPYLKAPGNERVWHNLESYLH  367

Query  1187  GVDGFQGS---QGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGT  1357
             GV G   S     GF+L    DVAL+NK  D L+  + +  PA W+V +N GM + DDG 
Sbjct  368   GVAGVPASGAPSSGFELVVARDVALVNKAYDALREEHGV--PAGWWVPQNKGMAKGDDGR  425

Query  1358  WIL  1366
             W L
Sbjct  426   WRL  428



>ref|XP_007025431.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28053.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=383

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 175/397 (44%), Positives = 225/397 (57%), Gaps = 41/397 (10%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW+DLSG KNW+ LL P+D DLRRY+IHYG    A  D F +   S+  G C Y      
Sbjct  8     RWRDLSGEKNWKDLLHPVDPDLRRYVIHYGERAGAAGDLFNDTMASRGFGYCLYPPDEFF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
               +G +NGNPF YEVT +FY  +                     SNW GYVAVATD+GK 
Sbjct  68    SRAGLENGNPFMYEVTNFFYGAADS-----------------NDSNWFGYVAVATDEGKT  110

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDILV+WRGT    EWI + +F    A  +FG D +  VH GF  +YT    +   
Sbjct  111   ALGRRDILVSWRGTGTEPEWIDDARFFTTPAKELFGTD-HAKVHSGFLAIYTGKVSNSPY  169

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----DS  907
                SARDQ+ + VR+LV++Y++E++SIT+ GHSLG++LATLNA D+     NK     + 
Sbjct  170   NQTSARDQVLKAVRKLVDKYQNEDISITVVGHSLGAALATLNATDIAAKGYNKPTDNSNK  229

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIIS  1087
                VTAF +ASP VG + FK  +  L + L ILR+T++ DI+PKLP           ++ 
Sbjct  230   TCMVTAFAYASPHVGNQEFKEVIDGLIE-LHILRITNSTDIIPKLP----------VLLG  278

Query  1088  YEHVGMEFRFDASKSNYL-DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKN  1264
             Y  VG     D +KS+YL  G  A  H L  +LHGV G Q S G FKL  D D+AL+NK 
Sbjct  279   YTDVGENLAIDTTKSSYLRQGINA--HNLEVHLHGVAGVQES-GEFKLEVDRDIALINKK  335

Query  1265  IDQLKGNYSLMAPAEWY-VVKNSGMVQQDDGTWILDD  1372
             ID L+  Y +  P EW+   K   MVQ   G W   D
Sbjct  336   IDGLQNKYKI--PPEWWNHEKFKNMVQMYTGRWQFVD  370



>gb|EAY99121.1| hypothetical protein OsI_21080 [Oryza sativa Indica Group]
Length=399

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 173/406 (43%), Positives = 236/406 (58%), Gaps = 35/406 (9%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+GLLDP D DLRR +I YG M  A YD+F +E +S + GL R+A     
Sbjct  14    RWRELHGESDWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFAACRFF  73

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              E     G+   Y V ++ Y+ S +      +++S       ++SNW+GYVAVATD+GKA
Sbjct  74    -ERAQLPGHAAAYRVARFVYATSCVAVPEPLILRSASRARRCRESNWIGYVAVATDEGKA  132

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPIL  742
             ALGRRDI+VAWRGTV++ EWIK+  F+ V  P    +D  P      +D  ++ N D   
Sbjct  133   ALGRRDIVVAWRGTVQSLEWIKDMDFVMVP-PKGLLRDKLPTP----WDSESSHNKD---  184

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP----  910
                SARDQ+  EV +LV  Y+DEE+SIT+ GHSLG++LATLNA D+V N  N+       
Sbjct  185   ---SARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDIVENGYNRAPRAAAA  241

Query  911   ---IPVTAFLFASPKVGERNFKNAVSKLAD-NLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
                 PVTAF+FASP+VG   FK          L++LR+ +A+D+VP+ P          P
Sbjct  242   AAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVPRYP----------P  291

Query  1079  IISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGG-FKLHGDFDVA  1249
                Y  VG E   D  +S YL   G +  WH L  YLHGV G +G + G FKL  + DVA
Sbjct  292   APPYHGVGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARGGEAGRFKLAVERDVA  351

Query  1250  LLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             L NK+   L+  +++  PA W++  N GMV+  DG W L D E D+
Sbjct  352   LANKSYGALRDEHAV--PAGWWIPSNRGMVRGADGRWTLMDREEDE  395



>gb|EMS63790.1| Phospholipase A1-II 7 [Triticum urartu]
Length=515

 Score =   299 bits (765),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 224/372 (60%), Gaps = 29/372 (8%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+GLLDPLD  LR  +I YG MV A YD+F  E  S + G C Y  ++LL
Sbjct  44    RWRELHGENSWKGLLDPLDPHLRSSIISYGEMVQAAYDAFNTERRSPHCGACFYGYEDLL  103

Query  383   RESG--HDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRP--DTVLKQSNWMGYVAVATD  550
                G  H   N   YEVTK+ Y+ S++   +++L+       D   ++SNWMGYVAVATD
Sbjct  104   AGVGVPHHGNN---YEVTKFIYATSSLPLPSSFLLLPLPSLPDVWSRESNWMGYVAVATD  160

Query  551   DGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG----QDSNPLVHKGFYDMYT  718
             +G AALGRRDI+VAWRGTV+  EW+ +  F  V A  + G    Q    +VH GF  MYT
Sbjct  161   EGAAALGRRDIVVAWRGTVQNMEWVNDLDFAPVPAAPVLGSAASQHRLAVVHHGFLSMYT  220

Query  719   AVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN  898
             + N        SARDQ+ +EVRRLVE YKDEE+SIT+ GHSLG+S+ATLNAVDLV++ IN
Sbjct  221   SSNKSSEFTKTSARDQVVKEVRRLVELYKDEEVSITICGHSLGASVATLNAVDLVSSGIN  280

Query  899   KDS----PIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVN  1066
             K        PVTA +FASP VG R F++A +   D LK L + +A D+VP  PP G    
Sbjct  281   KPEGSTKSFPVTAIVFASPHVGCRFFRSAFNSFPD-LKTLHVQNAGDVVPMYPPLG----  335

Query  1067  TTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDF  1240
                    Y  V +E      +S Y+       + H L  YLHGV G QGS GGFKL  D 
Sbjct  336   -------YVDVAVELTIRTIRSPYMRKPATVGTLHNLECYLHGVAGEQGSAGGFKLEVDR  388

Query  1241  DVALLNKNIDQL  1276
             D+AL+NK  D L
Sbjct  389   DIALVNKGADAL  400



>emb|CDY23963.1| BnaC03g17280D [Brassica napus]
Length=414

 Score =   295 bits (755),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 176/404 (44%), Positives = 235/404 (58%), Gaps = 28/404 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK LSG   W+ LLDPLD DLRRY++HYG M    Y +F ++  SK VG   Y ++ L
Sbjct  7     KRWKQLSGDSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSCYTKEEL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+YEVTKY Y  S+IR    +LI S   +   K SNW+GY AVATD+GK
Sbjct  67    FARTGYLKANPFRYEVTKYIYGTSSIRLPECFLINSLSREAWNKDSNWLGYTAVATDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF-GQDSN-----PLVHKGFYDMYTA  721
               LGRRDI+VAWRGT++  EW  +F F    A  +F   D N     P +  G+  +YT 
Sbjct  127   ELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPSTDPNDPNDPPRIANGWLSLYTT  186

Query  722   VNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
              N        SA++Q++ E++RL+E YK EE+SIT  GHSLG+ L+ L+A D + N   K
Sbjct  187   SNTHSRFDKTSAQEQVQGELKRLLELYKHEEVSITFTGHSLGAVLSILSATDFLHNEWPK  246

Query  902   ------DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKV  1063
                   D    VT F F SP++G+ NF+  V  L   L ILR+T+  D++P  P F    
Sbjct  247   TTTSLGDRLSCVTVFAFGSPRIGDLNFRRLVESLK-KLNILRITNVPDLIPHYPVF----  301

Query  1064  NTTLPIISYEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGD  1237
                     +  VG E   +  KS YL      A +H L  YLHGV G Q +Q  FKL  +
Sbjct  302   -------RFRDVGEELEINTLKSEYLKRSLNLAHFHNLEAYLHGVAGTQHNQAEFKLEIN  354

Query  1238  FDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
              D+AL+NK +D L+  Y  + P+ W+VV+N GMVQ DDGTWIL+
Sbjct  355   RDIALVNKELDALQDKY--LVPSHWWVVENRGMVQADDGTWILN  396



>ref|XP_002465238.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
 gb|EER92236.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
Length=423

 Score =   295 bits (756),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 183/429 (43%), Positives = 239/429 (56%), Gaps = 52/429 (12%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+GLLDPLD DLR  +I YG +  A YD F  EP S + G C Y   +LL
Sbjct  8     RWRELHGKDSWKGLLDPLDIDLRASVISYGELAQATYDGFNTEPRSPHAGACVYGLADLL  67

Query  383   RESGHDNGNPF-----KYEVTKYFYSPSTIRTATNYLI------QSQRPDTVLKQSNWMG  529
               SG   G        +Y VTK+ Y+ S ++    +L+      Q Q P    ++SNWMG
Sbjct  68    TASGGAGGAAAAGGSNRYRVTKFVYATSGLQVPDAFLLLPQPGLQGQEP-AWCRESNWMG  126

Query  530   YVAVATDDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ--DSNP--LVHK  697
             YVAVATD+G A LGRRD++VAWRGTVR+ EW+ +  F  V A  + G   D++P  +VH+
Sbjct  127   YVAVATDEGAAELGRRDVVVAWRGTVRSLEWVNDLDFTPVPAAPVLGAAADTHPRAMVHR  186

Query  698   GFYDMYTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVD  877
             GF  +YT+ N       +SARDQ+ EE+RRL+E YK EE SIT+ GHSLG+SLATLNAVD
Sbjct  187   GFLSLYTSSNASSKYNKLSARDQVLEEIRRLMELYKHEETSITITGHSLGASLATLNAVD  246

Query  878   LVTNPINKD--------------SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLT  1015
             +V N +N                 P PVTA +FASP VG   FK A +   + L+ L + 
Sbjct  247   IVANGLNSPAAAAGGHSSSSSSAQPAPVTAIVFASPHVGGPFFKAAFASFGEQLRALHVK  306

Query  1016  DAKDIVPKLPPFG-VKVNTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLH  1186
             +  D+VP  PP G V V   LPI              ++S +L   G   + H L  YLH
Sbjct  307   NQGDVVPLYPPLGYVDVAVPLPI------------HTARSPWLRQPGTPQTLHNLECYLH  354

Query  1187  -----GVDGFQGSQGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDD  1351
                     G     GGF+L  D DVAL+NK  D L+  Y +  P +W V  N GMV+  D
Sbjct  355   GVAGEQGGGGADDGGGFRLEVDRDVALVNKAADALRDEYPV--PVKWRVALNKGMVRGAD  412

Query  1352  GTWILDDHE  1378
             G W+L D E
Sbjct  413   GRWVLKDFE  421



>ref|XP_010686472.1| PREDICTED: phospholipase A1-II 1-like [Beta vulgaris subsp. vulgaris]
Length=411

 Score =   295 bits (755),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 164/387 (42%), Positives = 230/387 (59%), Gaps = 26/387 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ++W+ L G  +WEG LDPLD DLRR +IHYG M  A YD+FI E  SK+ G  R+ + N 
Sbjct  39    DKWELLMGRNHWEGQLDPLDIDLRRNIIHYGEMAQATYDTFIREKYSKHAGASRFNKNNF  98

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
               + G + G+P+KY VTK+ Y+ S +     Y+ +S   +   + SN+MG+VAVA D+  
Sbjct  99    FAKLGLELGHPYKYCVTKFIYATSGLEMPDAYIFKSLSIEPWCEDSNFMGFVAVADDESV  158

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD----SNPLVHKGFYDMYTAVN  727
               LGRR+I+VAWRGTV+  EW+ + QF+ V A  I   +    S P VH+G++ +YT  N
Sbjct  159   ELLGRREIVVAWRGTVQFLEWLNDLQFMQVSASEILAHEGDHGSEPEVHQGWHSVYTTDN  218

Query  728   PDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKD-  904
                  +  +    +  E+ +LV+QYK+E +SIT+ GHSLG++LATLNA D+V N IN+  
Sbjct  219   LSSSFQKTNDTISVLTELTKLVDQYKNEVISITVTGHSLGAALATLNAADIVANKINQPK  278

Query  905   -----SPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNT  1069
                   P  VTA LFASP+VG+ NF+  +SK  D+L+ILR+ ++ D VP  P  G     
Sbjct  279   SSSNAKPYMVTAILFASPRVGDANFQKLLSK-CDDLRILRVRNSHDFVPNYPLLG-----  332

Query  1070  TLPIISYEHVGMEFRFDASKSNYLDG--FKASWHTLVTYLHGVDGFQGSQGGFKLHGDFD  1243
                   Y  VG E   D ++S YL      +  H L  Y+HGV G QG   GFKL    D
Sbjct  333   ------YSDVGEELIIDVAQSVYLKNPTLPSVSHNLEVYMHGVAGSQGCAKGFKLVVKRD  386

Query  1244  VALLNKNIDQLKGNYSLMAPAEWYVVK  1324
             +ALLNK  D LK  Y +  P +W+V++
Sbjct  387   IALLNKFFDFLKDEYDV--PVDWWVLQ  411



>gb|EMT11182.1| hypothetical protein F775_27795 [Aegilops tauschii]
Length=474

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 186/444 (42%), Positives = 242/444 (55%), Gaps = 71/444 (16%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+GLLDPLD  LR  +I YG MV A YD+F  E  S + G C Y  ++LL
Sbjct  44    RWRELHGENSWKGLLDPLDPHLRSSIISYGEMVQAAYDAFNTERRSPHCGACFYGYEDLL  103

Query  383   RESG--HDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRP--DTVLKQSNWMGYVAVATD  550
                G  H   N   YEVTK+ Y+ S++   +++L+       D   ++SNWMGYVAVATD
Sbjct  104   AGVGVPHHGNN---YEVTKFIYATSSLPLPSSFLLLPLPSLPDVWSRESNWMGYVAVATD  160

Query  551   DGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFG----QDSNPLVHKGFYDMYT  718
             +G AALGRRDI+VAWRGTV+  EW+ +  F  V A  + G    Q    +VH GF  MYT
Sbjct  161   EGAAALGRRDIVVAWRGTVQNMEWVNDLDFAPVPAGPVLGSAASQHRLAVVHHGFLSMYT  220

Query  719   AVNPDPILKGVSARDQ----------------------------------------IREE  778
             + N        SARDQ                                        + +E
Sbjct  221   SSNKSSEFTKTSARDQRGLVCGRLSLRPYARLLAHTQSWQLPCVSAGYMVTAIALLVVKE  280

Query  779   VRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK----DSPIPVTAFLFASPK  946
             VRRLVE YK+EE+SIT+ GHSLG+S+ATLNAVDLV++ INK        PVTA +FASP 
Sbjct  281   VRRLVELYKNEEVSITVCGHSLGASVATLNAVDLVSSGINKPEGSTKSFPVTAIVFASPH  340

Query  947   VGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEHVGMEFRFDAS  1126
             VG R F++A +   D LK L + +A D+VP  PP G           Y  V +E      
Sbjct  341   VGCRFFRSAFNSFPD-LKALHVQNAGDVVPMYPPLG-----------YVDVAVELTIRTI  388

Query  1127  KSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQLKGNYSLMA  1300
             +S Y+       + H L  YLHGV G QGS GGFKL  D D+AL+NK  D L   + +  
Sbjct  389   RSPYIRKPATVGTLHNLECYLHGVAGEQGSAGGFKLEVDRDIALVNKGADALTDEHPV--  446

Query  1301  PAEWYVVKNSGMVQQDDGTWILDD  1372
             PA W+V ++  MV+ +DG W L D
Sbjct  447   PACWWVPRHKFMVKGEDGRWTLQD  470



>emb|CDX84801.1| BnaA03g14290D [Brassica napus]
Length=414

 Score =   294 bits (752),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 174/404 (43%), Positives = 237/404 (59%), Gaps = 28/404 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+LSG+  W+ LLDPLD DLRRY++HYG M    Y +F ++  SK VG   Y ++ L
Sbjct  7     KRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSCYTKEEL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+YEVTKY Y  S+IR    +LI S   +   K SNW+GY AV+TD+GK
Sbjct  67    FARTGYLKANPFRYEVTKYIYGTSSIRLPECFLINSLSREAWNKDSNWLGYTAVSTDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF----GQDSN--PLVHKGFYDMYTA  721
               LGRRDI+VAWRGT++  EW  +F F    A  +F      D N  P +  G+  +YT 
Sbjct  127   ELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPPTDPNDPNDPPRIANGWLSLYTT  186

Query  722   VNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
              N        SA++Q++ E++RL+E YK EE+SIT  GHSLG+ L+ L+A D + N   K
Sbjct  187   SNTHSRFDKTSAKEQVQGELKRLLELYKHEEISITFTGHSLGAVLSILSATDFLHNEWPK  246

Query  902   ------DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKV  1063
                   D+   VT F F SP++G+ NF+  V  L   L ILR+T+  D++P  P F    
Sbjct  247   TTTSLGDTLSCVTVFAFGSPRIGDLNFRRLVESLK-KLNILRITNVPDLIPHYPVF----  301

Query  1064  NTTLPIISYEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGD  1237
                     +  VG E   +  KS YL      A +H L  YLHGV G Q +Q  FKL  +
Sbjct  302   -------RFTDVGEELEINTLKSEYLKRSLNLAHFHNLEAYLHGVAGTQHNQAEFKLEIN  354

Query  1238  FDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
              D+AL+NK +D L+  Y  + P  W+V++N GMVQ DDGTWIL+
Sbjct  355   RDIALVNKELDALQDKY--LVPGHWWVLENRGMVQADDGTWILN  396



>ref|XP_009132769.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=414

 Score =   293 bits (751),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 174/404 (43%), Positives = 237/404 (59%), Gaps = 28/404 (7%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RWK+LSG+  W+ LLDPLD DLRRY++HYG M    Y +F ++  SK VG   Y ++ L
Sbjct  7     KRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSCYTKEEL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
                +G+   NPF+YEVTKY Y  S+IR    +LI S   +   K SNW+GY AV+TD+GK
Sbjct  67    FARTGYLKANPFRYEVTKYIYGTSSIRLPECFLINSLSREAWNKDSNWLGYTAVSTDEGK  126

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIF----GQDSN--PLVHKGFYDMYTA  721
               LGRRDI+VAWRGT++  EW  +F F    A  +F      D N  P +  G+  +YT 
Sbjct  127   ELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPPTDPNDPNDPPRIANGWLSLYTT  186

Query  722   VNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK  901
              N        SA++Q++ E++RL+E YK EE+SIT  GHSLG+ L+ L+A D + N   K
Sbjct  187   SNTHSRFDKTSAQEQVQGELKRLLELYKQEEISITFTGHSLGAVLSILSATDFLHNEWPK  246

Query  902   ------DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKV  1063
                   D+   VT F F SP++G+ NF+  V  L   L ILR+T+  D++P  P F    
Sbjct  247   TTTSLGDTLSCVTVFAFGSPRIGDLNFRRLVESLK-KLNILRITNVPDLIPHYPVF----  301

Query  1064  NTTLPIISYEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGD  1237
                     +  VG E   +  KS YL      A +H L  YLHGV G Q +Q  FKL  +
Sbjct  302   -------RFTDVGEELEINTLKSEYLKRSLNLAHFHNLEAYLHGVAGTQHNQAEFKLEIN  354

Query  1238  FDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
              D+AL+NK +D L+  Y  + P  W+V++N GMVQ DDGTWIL+
Sbjct  355   RDIALVNKELDALQDKY--LVPGHWWVLENRGMVQADDGTWILN  396



>gb|KFK31237.1| hypothetical protein AALP_AA6G086300 [Arabis alpina]
Length=414

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 174/403 (43%), Positives = 240/403 (60%), Gaps = 30/403 (7%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RWK+LSG+  W+ LLDPLD DLRRY++HYG M    Y +F ++  SK VG   +  K L 
Sbjct  8     RWKELSGAGKWKNLLDPLDLDLRRYILHYGDMAEVGYVAFNSDRQSKYVGDSCFTMKELF  67

Query  383   RESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKA  562
              +SG+   NPF+YEVTK+ Y  S+IR    +++ S   +   ++SNW+GY+AVATD+GK 
Sbjct  68    AQSGYLRANPFRYEVTKFIYGTSSIRLPECFIVNSWSREAWNRESNWLGYIAVATDEGKK  127

Query  563   ALGRRDILVAWRGTVRAAEWIKNFQFLFVKA----PLIFGQDSN--PLVHKGFYDMYTAV  724
              LGRRDI+VAWRGT++  EW  +F F    A    P I   D N  P V  G+  +YT+ 
Sbjct  128   LLGRRDIVVAWRGTIQLYEWANDFDFPLELAVSVFPRIDPNDPNDPPRVANGWLSLYTST  187

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTN-----  889
             +P       SAR+Q++ E++RL+  YKDEE+SITL GHSLG+ L+ L+A D + N     
Sbjct  188   DPRSRFDKTSAREQVQGELKRLLALYKDEEVSITLTGHSLGAVLSILSAADFLQNEWPKI  247

Query  890   -PINKDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVN  1066
              P NK S   VT F F SP++G+ NFK  V      L ILR+ +  D++P+ P F     
Sbjct  248   PPQNKVS--CVTVFAFGSPRIGDLNFKRLVESFKP-LNILRIANVPDLIPRYPVF-----  299

Query  1067  TTLPIISYEHVGMEFRFDASKSNYLDGF--KASWHTLVTYLHGVDGFQGSQGGFKLHGDF  1240
                    +  VG E + +  KS YL        +H L  YLHGV G Q +Q  FKL  + 
Sbjct  300   ------RFTDVGEELQINTLKSEYLKRSLNLKHFHNLEAYLHGVAGTQHNQTEFKLEINR  353

Query  1241  DVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILD  1369
             D+AL+NK +D L+  Y  + P  W+V++N GM+Q+ DGTW LD
Sbjct  354   DIALVNKGLDALQDKY--LVPGNWWVLENKGMIQKADGTWKLD  394



>emb|CDX99456.1| BnaC01g10960D [Brassica napus]
Length=402

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 169/407 (42%), Positives = 232/407 (57%), Gaps = 58/407 (14%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+GLL PLD DLR+Y+IHYG M  A YD+F     SK  G   Y+RK+ 
Sbjct  37    KRWRDLSGQNHWKGLLQPLDQDLRQYIIHYGEMAQAGYDTFNINTESKYAGASIYSRKDF  96

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ Y+ S I     +L+     +   K+SNWMGYVAV  D G
Sbjct  97    FAKVGLEKAHPYTKYKVTKFLYATSEIHVPEAFLLFPVSREGWSKESNWMGYVAVTDDQG  156

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPL-VHKGFYDMYTAVNPD  733
              A                                 IFG+  N + +H+G++ +Y + +  
Sbjct  157   TA---------------------------------IFGEKYNQVQIHQGWHSIYMSEDER  183

Query  734   PILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDS  907
                   +ARDQ+ +E+ RL+E+YKDEE+SI++ GHSLG++LATLNA D+V N  N  K  
Sbjct  184   SHFNKANARDQVLQELGRLLEKYKDEEVSISICGHSLGAALATLNATDIVANGYNRPKSR  243

Query  908   P---IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
             P    PVTAF+FASP+VG   +K   S+L D +++LR+ +  D+VP  PP G        
Sbjct  244   PGKSCPVTAFVFASPRVGNSEYKKLFSRLED-IRVLRVRNLPDVVPIYPPLG--------  294

Query  1079  IISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDFDV  1246
                Y  VG E   D  KS Y+   G  A++H L +YLHGV G QG+  G  F+L     +
Sbjct  295   ---YAEVGDELPIDTRKSQYMKTPGNFATFHCLESYLHGVAGTQGTSSGDLFRLDVKRAI  351

Query  1247  ALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
              L+NK++D LK  Y  M P  W V+KN GMVQQDDG+WIL DHE  D
Sbjct  352   GLVNKSVDGLKDEY--MVPGHWRVLKNKGMVQQDDGSWILLDHETGD  396



>gb|EYU24809.1| hypothetical protein MIMGU_mgv1a007765mg [Erythranthe guttata]
Length=396

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/401 (38%), Positives = 242/401 (60%), Gaps = 26/401 (6%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW++LSG   W  LL+PLD+D++ YL+HYG M    YD+F  + +S+  G  RYAR NL
Sbjct  7     KRWRELSGQHGWRNLLNPLDADMQTYLLHYGGMAQVTYDTFNKQQMSRYAGSSRYARNNL  66

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRT-ATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
                +G   G+P++Y+  KY Y+ ++I      ++++S   +  + +SNWMGYVAV+T++G
Sbjct  67    FHATGSAKGSPYRYDAVKYIYATASIGGLPQGFMVKSMADNPWMDESNWMGYVAVSTNEG  126

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD--SNPLVHKGFYDMYTAVNP  730
               ALGRRDILVAWRGTV   EW+K+     + A  I G    S   +H+GF+ +YTA + 
Sbjct  127   SKALGRRDILVAWRGTVLPVEWMKDADAQLIPATDIMGGGGASGAKLHQGFHSIYTAKSA  186

Query  731   DPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSP  910
                    SARDQ+  EV++ ++++K E++SIT+ GHSLG +LAT+NA D+  N +NK   
Sbjct  187   SSSFNKTSARDQVLSEVKKQLDKHKGEDVSITITGHSLGGALATINATDIAYNGLNKSR-  245

Query  911   IPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISY  1090
              PVTA  FA+P+VG+R +K  +    D  ++L + +  DIVP++P              Y
Sbjct  246   -PVTAITFAAPQVGDRRYKEVLDSTKD-CRVLSVRNVPDIVPRVPGAAA---------GY  294

Query  1091  EHVGMEFRFDASKS--NYLDGFKASWHTLVT-YLHGVDGFQGSQGGFKLHGDFDVALLNK  1261
             ++VG+E++ +++++      G   + H L + YLH +   +  +         D+ L+NK
Sbjct  295   KNVGVEYKINSTRAPDTRAPGDPLTGHLLESAYLHTIATARPGK------NKRDINLVNK  348

Query  1262  NIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVD  1384
             + D LK  + +  P  W+  KN G VQ++DG+W +DDH++D
Sbjct  349   DSDMLKPEFKV--PGFWWGEKNGGFVQRNDGSWAMDDHQMD  387



>ref|XP_003608142.1| Lipase [Medicago truncatula]
Length=349

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 162/337 (48%), Positives = 208/337 (62%), Gaps = 21/337 (6%)
 Frame = +2

Query  398   DNGNPFKYEVTKYFYSPSTIRTATNYLIQSQ-RPDTVLKQSNWMGYVAVATDDGKAALGR  574
             + GNPFKY VTKY Y+ S  R +  +L+ S    D    ++NWMGYVAVATD+ K ALGR
Sbjct  22    EKGNPFKYSVTKYLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAVATDEAKEALGR  81

Query  575   RDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPILKGVS  754
             RDI+VAWRGT++ AEW++NF      APLIFG  S+  +H GFY +YT+ N    L   S
Sbjct  82    RDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNGFYSLYTSDNSSLPLADSS  141

Query  755   ARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN--KDSP---IPV  919
             AR Q+  E+ RLVE YK+EE+SIT+ GHSLG +LAT++++D+V N  N  K  P    PV
Sbjct  142   ARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDIVANKFNIPKGQPQKTCPV  201

Query  920   TAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEHV  1099
             T F F SP+VG  NF+   S   D L+ L + +  DIVP          ++L  ++Y  V
Sbjct  202   TLFAFGSPRVGNSNFEKIFSDNND-LRALFIRNNNDIVP----------SSLR-LAYSKV  249

Query  1100  GMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQLK  1279
             G E   D  KS YL     S H +  YLHG+ G QGS+GGF L  + D+ALLNK+ D LK
Sbjct  250   GEELEIDTEKSKYLKS-GVSAHNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSNDGLK  308

Query  1280  GNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
               Y +  P  W VV+N GMVQQ DGTW L D   DD+
Sbjct  309   DEYHI--PENWRVVENKGMVQQSDGTWKLMDDHNDDV  343



>ref|NP_001056387.1| Os05g0574100 [Oryza sativa Japonica Group]
 sp|Q6F357.1|PLA7_ORYSJ RecName: Full=Phospholipase A1-II 7 [Oryza sativa Japonica Group]
 sp|A2Y7R2.1|PLA7_ORYSI RecName: Full=Phospholipase A1-II 7 [Oryza sativa Indica Group]
 gb|AAT69581.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44111.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF18301.1| Os05g0574100 [Oryza sativa Japonica Group]
 gb|EAY99122.1| hypothetical protein OsI_21081 [Oryza sativa Indica Group]
Length=407

 Score =   288 bits (736),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 190/410 (46%), Positives = 238/410 (58%), Gaps = 33/410 (8%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW++L G  +W GLLDPLD DLR  ++ YG +V A YDSF  E  S + G C Y   +L
Sbjct  12    DRWRELHGQDSWNGLLDPLDLDLRSSILSYGELVQATYDSFNRERRSPHAGACVYGHGDL  71

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVL---KQSNWMGYVAVATD  550
             L  +G        Y VTK+ Y+ S +     +L+            ++SNWMGYVAVATD
Sbjct  72    LAAAGASAAG--SYAVTKFVYATSGLPVPEAFLLLPLPSLLPPAWSRESNWMGYVAVATD  129

Query  551   DGKAALGRRDILVAWRGTVRAAEWIKNFQFLFV--KAPLIFGQDSNP--LVHKGFYDMYT  718
             +G AALGRRDI+VAWRGTV + EW+ +F F  V     L     +NP  +VH+GF  +YT
Sbjct  130   EGVAALGRRDIVVAWRGTVESLEWVNDFDFTPVPAAPVLGAAAAANPRAIVHRGFLSVYT  189

Query  719   AVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN  898
             + N D      SARDQ+ EEVRRL+E YKDE  SIT+ GHSLG+SLATLNAVD+V N  N
Sbjct  190   SSNKDSKYNKASARDQVLEEVRRLMELYKDEVTSITVVGHSLGASLATLNAVDIVANGAN  249

Query  899   --------KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFG  1054
                        P PVTA +FASP+VG+  FK A +   D L+ L + +A D+VP  PP G
Sbjct  250   CPPASSSSSQPPCPVTAIVFASPRVGDGFFKAAFASFPD-LRALHVKNAGDVVPMYPPLG  308

Query  1055  VKVNTTLPIISYEHVGMEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKL  1228
                        Y  V ++ R   S+S YL   G   + H L  YLHGV G QGS GGFKL
Sbjct  309   -----------YVDVAVKLRISTSRSPYLRSPGTIETLHNLECYLHGVAGEQGSAGGFKL  357

Query  1229  HGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
               D DVAL NK +D LK  Y +  P  W+V KN  MV+  DG W L D E
Sbjct  358   EVDRDVALANKGVDALKDKYPV--PPRWWVSKNRCMVKDADGHWALHDFE  405



>ref|XP_006644445.1| PREDICTED: phospholipase A1-II 3-like [Oryza brachyantha]
Length=426

 Score =   288 bits (737),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 177/407 (43%), Positives = 229/407 (56%), Gaps = 29/407 (7%)
 Frame = +2

Query  200   ERWKDLS-GSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKN  376
             +RW++ S G   W GLLDPLD+ LRR LI YG +  A  D+ I +P S   G  RYA   
Sbjct  29    QRWREASVGRDKWNGLLDPLDAGLRRDLIRYGELAQATSDALIGDPASPLAGASRYAPDA  88

Query  377   LLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVL--KQSNWMGYVAVATD  550
              LR+      +P  Y VT++ Y+ S+IR    ++ +   P       +SNWMGYVAVA D
Sbjct  89    FLRKV--RASDPDAYRVTRFVYATSSIRLPDAFMARPAPPLGAAWSGESNWMGYVAVAAD  146

Query  551   DGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD---SNPLVHKGFYDMYTA  721
                AA GRRDI+VAWRGT RA EW  +     V A  I G     S P VH+GF  +YT+
Sbjct  147   GVAAAAGRRDIVVAWRGTKRAVEWANDLDITLVPADGIIGPGPGWSQPSVHRGFLSVYTS  206

Query  722   VNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN-  898
              +       +SAR+Q+  E+ RL+  YK+E  SIT+ GHSLG++L+TLNAVD+V N  N 
Sbjct  207   KSFSSRFNKLSAREQVLAEIARLLRAYKNENCSITITGHSLGAALSTLNAVDIVANGYNV  266

Query  899   ---KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNT  1069
                   P+PVTA   ASP+VG+  FK A   +A  + +LR+ +A DIVP          T
Sbjct  267   RGPSRVPVPVTAIALASPRVGDDQFKRAFDSMA-GVSLLRVRNAPDIVP----------T  315

Query  1070  TLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGS--QGGFKLHGD  1237
              LP   ++ VG E   D  +S YL      A WH L  YLH V G QG+    GF L  D
Sbjct  316   ILPSAFFKDVGAELLVDTRRSPYLKSPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLAVD  375

Query  1238  FDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
              DVAL+NK +D L+  Y +  PA W+  KN GMVQ   G W+L DHE
Sbjct  376   RDVALVNKEVDALRDEYQV--PAAWWGEKNKGMVQNASGRWVLQDHE  420



>gb|KDP21072.1| hypothetical protein JCGZ_21543 [Jatropha curcas]
Length=407

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 172/399 (43%), Positives = 230/399 (58%), Gaps = 28/399 (7%)
 Frame = +2

Query  206   WKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLR  385
             WK LSG  NW+GLLDP+D +LR YLI+YG + +A   +      S    L RY  +N   
Sbjct  8     WKVLSGENNWDGLLDPIDDNLRHYLINYGFLTAAAPAALNGVKKSPGYALSRYPPENYFS  67

Query  386   ESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKAA  565
             E G + GNPFKY+VT +FY  S I           R   +  QS + G+VAV TD+GK  
Sbjct  68    EVGIEKGNPFKYQVTDFFYGRSEI---------DFRDWMIAGQSAYFGFVAVTTDEGKIV  118

Query  566   LGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDPILK  745
              GRRDI+V WRGT    EW ++F   F     +F  D++  VHKGF+ +YT    D    
Sbjct  119   TGRRDIVVCWRGTTFTIEWFEDFDATFTSGSDLF-PDTDAKVHKGFHSVYTTSKSDSTYN  177

Query  746   GVSARDQIREEVRRLVEQYK--DEEMSITLAGHSLGSSLATLNAVDLVTNPINK----DS  907
               SAR+Q+   VRR  ++Y    E++SIT+ GHSLGS+LATLNA+D+  N  NK    D+
Sbjct  178   KRSAREQVLAAVRRNADKYAALKEDVSITITGHSLGSALATLNAMDIAFNGYNKPSGSDT  237

Query  908   PIPVTAFLFASPKVGERNFKNAVSKLAD--NLKILRLTDAKDIVPKLPPFGVKVNTTLPI  1081
               PVTAF+FASP+VG + F++  S L D   L +LR+ + KDIVP+LPP        +  
Sbjct  238   GYPVTAFVFASPRVGNKEFQDVFSGLQDAGTLHLLRIRNHKDIVPELPP-------KIFD  290

Query  1082  ISYEHVGMEFRFDASKSNYLDGFK-ASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLN  1258
               YE VG+E   D +KS  + G      H L  Y+HGV G+QG++  FKL  + D ALLN
Sbjct  291   FIYEDVGVELYLDTTKSPNIKGESIPEAHDLNLYMHGVAGYQGNE-DFKLVINLDFALLN  349

Query  1259  KNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDH  1375
             K  D L+ +  +  P  W  V   GM+Q DDGTW L+D+
Sbjct  350   KYNDLLQDSCGV-PPKWWSNVFRQGMIQLDDGTWKLNDY  387



>tpg|DAA45463.1| TPA: hypothetical protein ZEAMMB73_472202 [Zea mays]
Length=448

 Score =   287 bits (735),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 184/454 (41%), Positives = 240/454 (53%), Gaps = 77/454 (17%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L G  +W+GLLDPLD DLR  +I YG +  A YD F  E  S + G C Y   +LL
Sbjct  8     RWRELHGKDSWKGLLDPLDMDLRASVIAYGELAQATYDGFNTEARSPHAGACLYGHADLL  67

Query  383   RESGHDNGNPF----KYEVTKYFYSPSTIRTATNYLIQSQ----RPDTVLKQSNWMGYVA  538
               S    G       +Y VTK+ Y+ S +     +L+  Q    + +   ++SNWMGYVA
Sbjct  68    AASDSAGGGAGGISDRYRVTKFVYATSGLHVPDAFLLLPQPALGQQEPWCRESNWMGYVA  127

Query  539   VATDDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS----NPLVHKGFY  706
             VATD+G AALGRRD++VAWRGTVR+ EW+ +  F  V A  + G  +      +VH GF 
Sbjct  128   VATDEGAAALGRRDVVVAWRGTVRSLEWVNDLDFTPVPAAPVLGSAAAAHPRAMVHGGFL  187

Query  707   DMYTAVNPDPILKGVSARDQ------------------------IREEVRRLVEQYKDEE  814
              +YT+ N       +SARDQ                        + EEVRRL+E YKDEE
Sbjct  188   SLYTSSNASSKYNKLSARDQASGSMSMTQFLPSLLLRRNHRFFEVLEEVRRLMELYKDEE  247

Query  815   MSITLAGHSLGSSLATLNAVDLVTNPIN-----------------------KDSPIPVTA  925
              SI++ GHSLG+SLATLNAVD+V N +N                       + +  PVTA
Sbjct  248   TSISVTGHSLGASLATLNAVDMVANGVNAPGAATATGTSGGSSSSPAQPQPQRAGCPVTA  307

Query  926   FLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFG-VKVNTTLPIISYEHVG  1102
              +FASP+VG   FK A +  AD L+ L + +  D+VP  PP G V V   LPI       
Sbjct  308   IVFASPRVGGPFFKAAFASFAD-LRALHVRNKGDVVPLYPPLGYVDVAVPLPI-------  359

Query  1103  MEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGSQGGFKLHGDFDVALLNKNIDQL  1276
                    ++S +L   G   + H L  YLHGV G QG+ GGF+L    DVAL+NK  D L
Sbjct  360   -----HTARSPWLRRPGTPQTLHNLECYLHGVAGEQGAAGGFRLEVGRDVALVNKGADAL  414

Query  1277  KGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             +  Y +  PA W V  N GMV+  DG W L D E
Sbjct  415   RDEYPV--PARWRVALNKGMVRGADGRWALKDFE  446



>ref|XP_002438517.1| hypothetical protein SORBIDRAFT_10g021250 [Sorghum bicolor]
 gb|EER89884.1| hypothetical protein SORBIDRAFT_10g021250 [Sorghum bicolor]
Length=396

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 241/402 (60%), Gaps = 39/402 (10%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             ERW++L GS++W+GLLDPLD DLR+ LI YG +VSA    F NE  S + GLCRY   +L
Sbjct  21    ERWRELQGSRSWDGLLDPLDLDLRKSLISYGELVSATGAGFNNEKRSPHYGLCRYCPDDL  80

Query  380   LRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             L +SG  +G  + Y VTK+ Y+ + +               + KQ+ WMGYVAVATD+G 
Sbjct  81    LVKSGVVDGARY-YRVTKFVYATAELLFG------------LYKQTTWMGYVAVATDEGV  127

Query  560   AALGRRDILVAWRGTVRAAEWIKN-FQFLFVKAPLIFG----QDSNPLVHKGFYDMYTAV  724
             AALGRRDI+VAWRG+   AEW K+  +F+   A  + G       +  VH GF  +YT  
Sbjct  128   AALGRRDIVVAWRGSATDAEWAKDIIEFVPAPAESVLGSAAAAYPSAYVHSGFLSLYTTS  187

Query  725   NPDPILKGVSARDQIREEVRRLVEQYKDE--EMSITLAGHSLGSSLATLNAVDLVTNPIN  898
             N D  L   SARDQ+ +EV RLVE YKDE  EMSIT+ GHSLG++L+ LNAVDLV+N +N
Sbjct  188   NADSELGKTSARDQVLQEVSRLVELYKDEDQEMSITVVGHSLGAALSILNAVDLVSNGVN  247

Query  899   KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLP  1078
               +  PV A +FA P VG  +FK+A     D+LK L + +  D+VP+L  +   +  TLP
Sbjct  248   --NSCPVAAVVFACPHVGNNSFKDAFDSF-DDLKALHVKNKIDLVPQLMDWLPDLGVTLP  304

Query  1079  IISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQ--GGFKLHGDFDVAL  1252
             I            D S S YL   K + H L  YLHGV G QGS   GGF L  D DVAL
Sbjct  305   I------------DTSLSPYLKDPKNTAHELECYLHGVAGVQGSDAGGGFDLVVDRDVAL  352

Query  1253  LNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             LN+++D LK  + +  PA W+V ++  MV+   G W L D E
Sbjct  353   LNRSVDALKDEHPV--PASWWVAEHKSMVKNAKGKWELKDFE  392



>dbj|BAJ85084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   286 bits (731),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 171/414 (41%), Positives = 236/414 (57%), Gaps = 33/414 (8%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             RW++L GS +W+GLLDPLD DLRR +I YG + SA +D F  E  S + GLC Y+R  LL
Sbjct  33    RWRELHGSDSWKGLLDPLDVDLRRSIIAYGELASAAHDGFNLEKRSPHAGLCLYSRDRLL  92

Query  383   RESGHDNGNPFKYEVTKYFYS----------PSTIRTATNYL-IQSQRPDTVLKQSNWMG  529
               S     +P  Y+VTK+ Y+           +++ T T+ L +Q          SNWMG
Sbjct  93    --SASTVTHPEYYKVTKFLYATCGGSTVSRLATSVPTVTSALFVQPLGKAEGTPTSNWMG  150

Query  530   YVAVATDDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDS-----NPLVH  694
             YVAVAT++G AALGRRDI+V WRGT    EW ++     V A  + G+ +     N  VH
Sbjct  151   YVAVATEEGVAALGRRDIVVVWRGTENDLEWEQDKDCRQVSAAPVLGRYAHDEYRNAEVH  210

Query  695   KGFYDMYTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAV  874
             +GF  +YT+ + + +    SAR+Q+ EEV RL+++YK+E  SIT+ GHSLG+SLATL A+
Sbjct  211   RGFLSVYTSSDNNSMYNKTSAREQVLEEVGRLMKEYKEEVTSITVTGHSLGASLATLTAI  270

Query  875   DLVTN-----PINKDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPK  1039
             D+V N     P +   P PVTA L ASP+VG   FK+A     D+L+ L + +AKDIVP 
Sbjct  271   DMVANDVNVPPASNQPPCPVTAILLASPRVGNDAFKSAFGSF-DHLRALHVANAKDIVPM  329

Query  1040  LPPFGVKVNTTLPIISY-EHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVDGFQGSQG  1216
              PP      + L ++ Y +        D  +S Y+     + H L  YLHGV G  G + 
Sbjct  330   NPP------SVLLLMQYVDSATATIVIDTDRSPYVVHKMLTHHVLELYLHGVAGDHGDKA  383

Query  1217  GFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
              F+L    D+AL+NK  D L   + +  PA W+V+    M +  DG W LDD E
Sbjct  384   DFQLVVPRDLALVNKTTDLLNDEHQV--PACWWVIHRKCMAKGTDGQWKLDDFE  435



>ref|NP_001043734.1| Os01g0651800 [Oryza sativa Japonica Group]
 sp|Q8RZ40.1|PLA3_ORYSJ RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAB89211.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05648.1| Os01g0651800 [Oryza sativa Japonica Group]
Length=420

 Score =   285 bits (729),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 172/408 (42%), Positives = 229/408 (56%), Gaps = 30/408 (7%)
 Frame = +2

Query  200   ERWKDLSGS--KNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARK  373
             +RW+  SG     W+GLLDPLD+DLRR +I YG +  A  D+ I +P S   G  RYA  
Sbjct  22    QRWRQTSGGGKDRWDGLLDPLDADLRRDIIRYGELAQATSDALIGDPASPFAGASRYAPD  81

Query  374   NLLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVL--KQSNWMGYVAVAT  547
               LR+      +P  Y VT++ Y+ S++R    ++ +           +SNWMGYVAVA 
Sbjct  82    AFLRKV--RASDPDAYRVTRFVYATSSVRLPDAFMPRPAPSAGAAWSGESNWMGYVAVAA  139

Query  548   DDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD---SNPLVHKGFYDMYT  718
             D   A  GRRDI+VAWRGT RA EW  +     V A  + G     + P VH+GF  +YT
Sbjct  140   DGVAAKAGRRDIVVAWRGTKRAVEWANDLDITLVPADGVVGPGPGWTQPSVHRGFLSVYT  199

Query  719   AVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN  898
             + +       +SAR+Q+  E+ RL+  YK+E  SIT+ GHSLG++L+TLNA+D+V N  N
Sbjct  200   SKSFSSPFNKLSAREQVLAEITRLLRAYKNENCSITITGHSLGAALSTLNAIDIVANGYN  259

Query  899   ----KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVN  1066
                    P+PVTA   ASP+VG+  FK A    + NL +LR+ +A DIVP          
Sbjct  260   VRGSSRVPVPVTAIALASPRVGDDQFKRAFDSTS-NLSLLRVRNAPDIVP----------  308

Query  1067  TTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGS--QGGFKLHG  1234
             T LP   ++ VG E   D  +S YL      A WH L  YLH V G QG+    GF L  
Sbjct  309   TILPSAFFKDVGAELLVDTRRSPYLKNPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLVV  368

Query  1235  DFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             D D+AL+NK +D L+  Y +  PA W+V KN GMVQ   G W+L DHE
Sbjct  369   DRDLALVNKEVDALRDEYQV--PAAWWVEKNKGMVQNASGRWVLQDHE  414



>ref|XP_011047800.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=448

 Score =   286 bits (731),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 160/363 (44%), Positives = 224/363 (62%), Gaps = 24/363 (7%)
 Frame = +2

Query  314   DSFINEPISKNVGLCRYARKNLLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQR  493
             D+F     S +  L RY  +         NGNPFKY+VTKYFY  S      + + +   
Sbjct  82    DAFNYVKASDSYALSRYPPEEFFMNVNLQNGNPFKYQVTKYFYLKS------DDIAEVLE  135

Query  494   PDTVLKQSNWMGYVAVATDDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ  673
              D  L+ S W+GYVAV TD+G+  LGRRDILV WRGT+ A+EW ++FQF    A  IFG 
Sbjct  136   LD--LEGSAWIGYVAVTTDEGQRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGA  193

Query  674   DSNPLVHKGFYDMYTAVNPDPILKGVSARDQIREEVRRLVEQY--KDEEMSITLAGHSLG  847
              +NP VH GF+++Y A +        SAR+Q+  EVRRLV+ Y    EE+SIT+AGHSLG
Sbjct  194   TNNPKVHHGFHNVYVAKSSKSKYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLG  253

Query  848   SSLATLNAVDLVTNPINK----DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLT  1015
             ++LATLN +D+V N  NK    D   PVT F +ASP+VG++ F++  + L  +L +LR+ 
Sbjct  254   AALATLNGMDMVANGFNKPSGSDIGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIK  313

Query  1016  DAKDIVPKLPPFGVKVNTTLPIISYEHVGMEFRFDASKSNYLDGFKASWHTLVTYLHGVD  1195
             ++KDI+P+LPP        + ++ Y+ VG +   D+ KS YL   KA  H L  YLH + 
Sbjct  314   NSKDIIPRLPP--------VFLLGYQDVGEKLEIDSIKSPYLKDPKAQPHNLELYLHTIA  365

Query  1196  GFQGSQGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDH  1375
             G+QG +  FKL  D D+ALLNK++D +   Y++  P  W+ VKN+GM+Q D+G W L+D+
Sbjct  366   GYQGQEEEFKLVVDRDIALLNKSLDLVLDKYNI--PPTWWNVKNNGMIQIDNGFWKLNDY  423

Query  1376  EVD  1384
               D
Sbjct  424   VPD  426



>emb|CDY34061.1| BnaC03g62710D [Brassica napus]
Length=402

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 229/409 (56%), Gaps = 61/409 (15%)
 Frame = +2

Query  200   ERWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNL  379
             +RW+DLSG  +W+GLL PLD DLR+YLIHYG M  A YD+F     S+  G   Y+RK+ 
Sbjct  36    KRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSEFAGSSIYSRKDF  95

Query  380   LRESGHDNGNPF-KYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDG  556
               + G +  +P+ KY+VTK+ ++ S I    ++L+     +   K+SNW+GYVAV  D G
Sbjct  96    FAKVGLEKAHPYTKYKVTKFLFATSQIHVPESFLLFPVSREGCTKESNWIGYVAVTDDQG  155

Query  557   KAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQDSNPLVHKGFYDMYTAVNPDP  736
              AALGRRDI                                   +H+G+Y +Y + +   
Sbjct  156   TAALGRRDI-----------------------------------IHQGWYSIYMSKDERS  180

Query  737   ILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINK-----  901
                  +ARDQ+  E+ RL+E+YKDE++SI++ GHSLG+++ATLNA D+V N  N+     
Sbjct  181   PFNKANARDQVLREIGRLLEKYKDEKISISICGHSLGAAIATLNAADIVANGYNRPKSRP  240

Query  902   DSPIPVTAFLFASPKVGERNFKNAVSK-LADNLKILR--LTDAKDIVPKLPPFGVKVNTT  1072
             D   PVTAF+FASP VG+ +FK   S  +  N+ I    + +  D+VP  PP G      
Sbjct  241   DKSCPVTAFVFASPHVGDSDFKKLFSGYVLLNIYIYNSFILNLPDVVPIYPPLG------  294

Query  1073  LPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGSQGG--FKLHGDF  1240
                  Y  VG E   D  KS YL   G  A++H L  YLHG+ G QG+     F+L    
Sbjct  295   -----YAEVGDELPIDTRKSPYLKSPGDLATFHCLEAYLHGLAGTQGTSKADLFRLVVKR  349

Query  1241  DVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDD  1387
             D+ L+NK++D LK  Y  M P  W ++KN GMVQQ DG+W L DHE+DD
Sbjct  350   DIGLVNKSVDGLKDEY--MVPGHWRILKNKGMVQQKDGSWKLMDHEIDD  396



>gb|ABK24664.1| unknown [Picea sitchensis]
Length=426

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 162/423 (38%), Positives = 231/423 (55%), Gaps = 39/423 (9%)
 Frame = +2

Query  203   RWKDLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLL  382
             +W+ + GS NWEGLL+PLD+DLR  ++ YG +  A YD+F ++P SK  G  RY +K+  
Sbjct  10    KWRAVQGSDNWEGLLEPLDNDLREAILLYGDLTQATYDAFNSDPHSKFCGSSRYGKKDFF  69

Query  383   RESGHDNGN-PFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGK  559
             ++     G+  + YEVT++ Y+ S +     ++++S   +   ++SNW+GYVAVATD GK
Sbjct  70    QKVSLATGDDEWNYEVTRFLYATSRLELPQAFMLKSLSREAWSRESNWIGYVAVATDRGK  129

Query  560   AALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQ---------------------D  676
               LGRR+I+VAWRGT+R  EW   F  + V    I  Q                     +
Sbjct  130   QRLGRREIVVAWRGTIRDLEWSDVFNPIPVSIAPILSQEQRHDHDHDHHWYDRVLHLVDE  189

Query  677   SNPLVHKGFYDMYTAVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSL  856
               P V  G++ +YT+ +P       SAR+Q   E++RLVE YKDEE+SITL GHSLG++L
Sbjct  190   EEPKVMNGWFVIYTSTDPKSPFTKSSAREQFLAEIKRLVELYKDEELSITLVGHSLGAAL  249

Query  857   ATLNAVDLVTNPINK---DSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKD  1027
             A L+  D+V + +        IPVTAF+   P VG   FK     L   L++LR+ +  D
Sbjct  250   AILSGFDIVQSGLTSVPGKPNIPVTAFVVGCPGVGNAAFKKRFEALP-GLRVLRIVNLPD  308

Query  1028  IVPKLPPFGVKVNTTLPIISYEHVGMEFRFDASKSNYLDGFK--ASWHTLVTYLHGVDGF  1201
             ++P  P           ++  EHVG     D  KS +L   K  + WH L   LH V G+
Sbjct  309   LIPHYPG---------KLLMSEHVGSHLEIDTRKSPFLKDSKNPSDWHNLQAQLHIVAGW  359

Query  1202  QGSQGGFKLHGDFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEV  1381
             QG +   K  G+  VAL+NK+ D LK     + PA W+V KN GM+Q   G W L D   
Sbjct  360   QGPKNPLKFEGNRSVALVNKSCDFLK--EECLIPASWWVEKNKGMIQDLKGMWALADPPE  417

Query  1382  DDI  1390
             DD+
Sbjct  418   DDL  420



>gb|EMS51987.1| Phospholipase A1-II 3 [Triticum urartu]
Length=423

 Score =   285 bits (728),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 165/400 (41%), Positives = 215/400 (54%), Gaps = 43/400 (11%)
 Frame = +2

Query  212   DLSGSKNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARKNLLRES  391
             ++SGS  W GLLDPL+ D+RR +I YG +  A  D FI +P S   G CRY+  +   + 
Sbjct  5     EISGSNQWSGLLDPLNIDVRREVIRYGELAQATSDGFITDPASPYAGACRYSPASFFTKV  64

Query  392   GHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVLKQSNWMGYVAVATDDGKAALG  571
                  +P  Y VT++ Y+ S+ R    ++ +         +SNWMGYVAVATD G AALG
Sbjct  65    --QASDPGAYRVTRFIYATSSARLPEGFMARPLPVGAWSTESNWMGYVAVATDRGAAALG  122

Query  572   RRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD---SNPLVHKGFYDMYTAVNPDPIL  742
             RRDI+VAWR T RA EW  +  F  V A  I G     S P VH+GF  +YT+ N     
Sbjct  123   RRDIVVAWRATKRATEWASDLDFALVPAAGIVGPGRGWSQPYVHRGFLSVYTSKNSTSRF  182

Query  743   KGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPINKDSPIPVT  922
                SAR+Q+  EVR L++ YK+E+ SI++ GHSLG +L+TLNA+DLV N           
Sbjct  183   NRRSAREQVLTEVRALLDTYKNEDCSISITGHSLGGALSTLNAIDLVANGF---------  233

Query  923   AFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVNTTLPIISYEHVG  1102
                         NFK A   +A  L +LR+ +  DIVP          T LP + Y  VG
Sbjct  234   ------------NFKKAFHAMA-GLSLLRVRNVPDIVP----------TILPPVIYADVG  270

Query  1103  MEFRFDASKSNYL--DGFKASWHTLVTYLHGVDGFQGS--QGGFKLHGDFDVALLNKNID  1270
             +E   D  KS YL      A WH L  YLHGV G  G+    GF L  D D+AL+NK  D
Sbjct  271   VELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAGTHGAGDSAGFGLEVDRDLALINKEED  330

Query  1271  QLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHEVDDI  1390
              L+  Y +  PA W+   N GMV+   G W+L DHE D+ 
Sbjct  331   ALRDEYPV--PAMWWAENNKGMVKNATGHWVLHDHEQDEC  368



>sp|A2WTA0.1|PLA3_ORYSI RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Indica Group]
 gb|EAY75196.1| hypothetical protein OsI_03088 [Oryza sativa Indica Group]
Length=420

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 172/408 (42%), Positives = 228/408 (56%), Gaps = 30/408 (7%)
 Frame = +2

Query  200   ERWKDLSGS--KNWEGLLDPLDSDLRRYLIHYGSMVSAVYDSFINEPISKNVGLCRYARK  373
             +RW+  SG     W+GLLDPLD+DLRR +I YG +  A  D+ I +P S   G  RYA  
Sbjct  22    QRWRQTSGGGKDRWDGLLDPLDADLRRDIIRYGELAQATSDALIGDPASPFAGASRYAPD  81

Query  374   NLLRESGHDNGNPFKYEVTKYFYSPSTIRTATNYLIQSQRPDTVL--KQSNWMGYVAVAT  547
               LR+      +P  Y VT++ Y+ S++R    ++ +           +SNWMGYVAVA 
Sbjct  82    AFLRKV--RASDPDAYRVTRFVYATSSVRLPDAFMPRPAPSAGAAWSGESNWMGYVAVAA  139

Query  548   DDGKAALGRRDILVAWRGTVRAAEWIKNFQFLFVKAPLIFGQD---SNPLVHKGFYDMYT  718
             D   A  GRRDI+VAWRGT RA EW  +     V A  + G     + P VH+GF  +YT
Sbjct  140   DGVAANAGRRDIVVAWRGTKRAVEWANDLDITLVPADGVVGPGPGWTQPSVHRGFLSVYT  199

Query  719   AVNPDPILKGVSARDQIREEVRRLVEQYKDEEMSITLAGHSLGSSLATLNAVDLVTNPIN  898
             + +       +SAR+Q+  E+ RL+  YK+E  SIT+ GHSLG++L+TLNA+D+V N  N
Sbjct  200   SKSFSSPFNKLSAREQVLAEITRLLRAYKNENCSITITGHSLGAALSTLNAIDIVANGYN  259

Query  899   ----KDSPIPVTAFLFASPKVGERNFKNAVSKLADNLKILRLTDAKDIVPKLPPFGVKVN  1066
                    P+PVTA   ASP+VG+  FK A      NL +LR+ +A DIVP          
Sbjct  260   VRGSSRVPVPVTAIALASPRVGDDQFKRAFDS-TPNLSLLRVRNAPDIVP----------  308

Query  1067  TTLPIISYEHVGMEFRFDASKSNYLD--GFKASWHTLVTYLHGVDGFQGS--QGGFKLHG  1234
             T LP   ++ VG E   D  +S YL      A WH L  YLH V G QG+    GF L  
Sbjct  309   TILPSAFFKDVGAELLVDTRRSPYLKNPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLVV  368

Query  1235  DFDVALLNKNIDQLKGNYSLMAPAEWYVVKNSGMVQQDDGTWILDDHE  1378
             D D+AL+NK +D L+  Y +  PA W+V KN GMVQ   G W+L DHE
Sbjct  369   DRDLALVNKEVDALRDEYQV--PAAWWVEKNKGMVQNASGRWVLQDHE  414



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4140831024400