BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8200_g1_i1 len=1849 path=[2019:0-1456 4452:1457-1848]

Length=1849
                                                                      Score     E

emb|CAI11457.1|  putative glycosyltransferase                           740   0.0      Solanum tuberosum [potatoes]
ref|XP_009617169.1|  PREDICTED: putative glycosyltransferase 5          737   0.0      
ref|XP_006365321.1|  PREDICTED: putative glycosyltransferase 5-li...    736   0.0      
ref|XP_009764347.1|  PREDICTED: putative glycosyltransferase 5          733   0.0      
ref|XP_011087267.1|  PREDICTED: putative glycosyltransferase 5          728   0.0      
ref|XP_010318819.1|  PREDICTED: putative glycosyltransferase 5          725   0.0      
emb|CAI11458.1|  putative glycosyltransferase                           719   0.0      Nicotiana benthamiana
ref|XP_008239899.1|  PREDICTED: putative glycosyltransferase 5          716   0.0      
ref|XP_009761185.1|  PREDICTED: putative glycosyltransferase 5          715   0.0      
ref|XP_009338860.1|  PREDICTED: putative glycosyltransferase 5          712   0.0      
gb|EYU35800.1|  hypothetical protein MIMGU_mgv1a006038mg                712   0.0      
ref|XP_007209124.1|  hypothetical protein PRUPE_ppa005479mg             712   0.0      
ref|XP_002514720.1|  Xyloglucan 6-xylosyltransferase, putative          711   0.0      Ricinus communis
ref|XP_007037433.1|  Galactosyl transferase GMA12/MNN10 family pr...    711   0.0      
ref|XP_011047184.1|  PREDICTED: putative glycosyltransferase 5          709   0.0      
ref|XP_006374450.1|  hypothetical protein POPTR_0015s07290g             709   0.0      
gb|EPS66800.1|  hypothetical protein M569_07974                         707   0.0      
ref|XP_010089891.1|  Putative glycosyltransferase 5                     707   0.0      
ref|XP_008393187.1|  PREDICTED: putative glycosyltransferase 5          706   0.0      
ref|XP_009339134.1|  PREDICTED: putative glycosyltransferase 5          703   0.0      
ref|XP_008374566.1|  PREDICTED: putative glycosyltransferase 5          701   0.0      
ref|XP_004301136.1|  PREDICTED: putative glycosyltransferase 5-like     698   0.0      
gb|EYU23497.1|  hypothetical protein MIMGU_mgv1a006132mg                697   0.0      
ref|XP_004138178.1|  PREDICTED: putative glycosyltransferase 5-like     695   0.0      
ref|XP_010537379.1|  PREDICTED: putative glycosyltransferase 5          694   0.0      
ref|XP_004154959.1|  PREDICTED: putative glycosyltransferase 3-like     694   0.0      
ref|XP_004154960.1|  PREDICTED: putative glycosyltransferase 5-like     694   0.0      
ref|XP_004138179.1|  PREDICTED: putative glycosyltransferase 3-like     694   0.0      
gb|KDP31286.1|  hypothetical protein JCGZ_11662                         691   0.0      
ref|XP_007155288.1|  hypothetical protein PHAVU_003G188200g             688   0.0      
ref|XP_010108713.1|  Putative glycosyltransferase 3                     688   0.0      
ref|XP_002318600.2|  hypothetical protein POPTR_0012s07020g             687   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010258249.1|  PREDICTED: putative glycosyltransferase 5          685   0.0      
ref|XP_010258549.1|  PREDICTED: putative glycosyltransferase 5 is...    684   0.0      
ref|XP_010258542.1|  PREDICTED: putative glycosyltransferase 5 is...    684   0.0      
ref|XP_010030248.1|  PREDICTED: putative glycosyltransferase 5          683   0.0      
ref|XP_002887538.1|  galactosyl transferase GMA12/MNN10 family pr...    682   0.0      
ref|XP_011072798.1|  PREDICTED: putative glycosyltransferase 5          682   0.0      
ref|XP_010428421.1|  PREDICTED: putative glycosyltransferase 5 is...    682   0.0      
gb|KEH31956.1|  xyloglucan xylosyltransferase                           681   0.0      
ref|XP_010416293.1|  PREDICTED: putative glycosyltransferase 5          681   0.0      
ref|XP_006300466.1|  hypothetical protein CARUB_v10020269mg             679   0.0      
ref|XP_010523024.1|  PREDICTED: putative glycosyltransferase 3          679   0.0      
emb|CAN80739.1|  hypothetical protein VITISV_027037                     679   0.0      Vitis vinifera
gb|KFK41883.1|  hypothetical protein AALP_AA2G184600                    679   0.0      
ref|XP_002284667.1|  PREDICTED: putative glycosyltransferase 5          678   0.0      Vitis vinifera
ref|XP_004500012.1|  PREDICTED: putative glycosyltransferase 5-like     678   0.0      
ref|NP_196389.1|  xyloglucan 6-xylosyltransferase                       677   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399253.1|  hypothetical protein EUTSA_v10013509mg             677   0.0      
ref|XP_010471529.1|  PREDICTED: putative glycosyltransferase 5          676   0.0      
ref|XP_006390433.1|  hypothetical protein EUTSA_v10018522mg             676   0.0      
emb|CAI11456.1|  putative glycosyltransferase                           673   0.0      Lotus japonicus
ref|XP_009106103.1|  PREDICTED: putative glycosyltransferase 5          673   0.0      
gb|KEH33442.1|  xyloglucan xylosyltransferase                           672   0.0      
ref|XP_003524717.1|  PREDICTED: putative glycosyltransferase 5-like     672   0.0      
ref|NP_177578.1|  xyloglucan xylosyltransferase 5                       671   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871288.1|  galactosyl transferase GMA12/MNN10 family pr...    670   0.0      
emb|CDX99024.1|  BnaC09g48110D                                          669   0.0      
ref|XP_006287623.1|  hypothetical protein CARUB_v10000835mg             670   0.0      
ref|XP_009104763.1|  PREDICTED: putative glycosyltransferase 5          669   0.0      
ref|XP_010491391.1|  PREDICTED: putative glycosyltransferase 3          668   0.0      
ref|XP_004508717.1|  PREDICTED: putative glycosyltransferase 5-like     666   0.0      
ref|XP_003549688.1|  PREDICTED: putative glycosyltransferase 5-like     667   0.0      
ref|XP_010423175.1|  PREDICTED: putative glycosyltransferase 3          665   0.0      
ref|XP_010452740.1|  PREDICTED: putative glycosyltransferase 3          660   0.0      
ref|XP_010678459.1|  PREDICTED: putative glycosyltransferase 5          654   0.0      
emb|CDX69995.1|  BnaA10g23440D                                          653   0.0      
ref|XP_009122397.1|  PREDICTED: putative glycosyltransferase 3          653   0.0      
gb|KFK25153.1|  hypothetical protein AALP_AA8G072800                    649   0.0      
ref|XP_009606203.1|  PREDICTED: putative glycosyltransferase 3          647   0.0      
emb|CDP21247.1|  unnamed protein product                                645   0.0      
ref|XP_006494985.1|  PREDICTED: putative glycosyltransferase 3-like     639   0.0      
ref|XP_006440652.1|  hypothetical protein CICLE_v10020086mg             639   0.0      
ref|XP_010683109.1|  PREDICTED: putative glycosyltransferase 5          638   0.0      
ref|XP_010912249.1|  PREDICTED: putative glycosyltransferase 5          632   0.0      
ref|XP_006307492.1|  hypothetical protein CARUB_v10009116mg             629   0.0      
ref|XP_010907157.1|  PREDICTED: putative glycosyltransferase 5          629   0.0      
ref|XP_010477058.1|  PREDICTED: putative glycosyltransferase 4          628   0.0      
ref|XP_009790055.1|  PREDICTED: putative glycosyltransferase 5          629   0.0      
ref|XP_008788330.1|  PREDICTED: putative glycosyltransferase 5          627   0.0      
ref|XP_009379786.1|  PREDICTED: putative glycosyltransferase 5          622   0.0      
ref|XP_008783986.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    621   0.0      
ref|XP_006841140.1|  hypothetical protein AMTR_s00086p00128700          617   0.0      
ref|XP_010498276.1|  PREDICTED: putative glycosyltransferase 5          617   0.0      
ref|XP_009393375.1|  PREDICTED: putative glycosyltransferase 5          616   0.0      
ref|XP_009385087.1|  PREDICTED: putative glycosyltransferase 5          614   0.0      
ref|XP_004239475.1|  PREDICTED: putative glycosyltransferase 3          612   0.0      
ref|XP_010943718.1|  PREDICTED: putative glycosyltransferase 5          612   0.0      
ref|XP_010459505.1|  PREDICTED: putative glycosyltransferase 4          612   0.0      
emb|CDY19235.1|  BnaC05g14360D                                          607   0.0      
ref|XP_002890293.1|  hypothetical protein ARALYDRAFT_312817             611   0.0      
dbj|BAK03947.1|  predicted protein                                      603   0.0      
ref|XP_010235491.1|  PREDICTED: putative glycosyltransferase 3          602   0.0      
emb|CDY26738.1|  BnaA06g12840D                                          601   0.0      
gb|AFW71661.1|  putative glycosyltransferase                            601   0.0      
ref|XP_011075649.1|  PREDICTED: putative glycosyltransferase 5          599   0.0      
ref|XP_006348817.1|  PREDICTED: putative glycosyltransferase 3-like     600   0.0      
ref|XP_002453927.1|  hypothetical protein SORBIDRAFT_04g021570          600   0.0      Sorghum bicolor [broomcorn]
ref|XP_009420521.1|  PREDICTED: putative glycosyltransferase 5          598   0.0      
ref|NP_001105849.1|  putative glycosyltransferase                       599   0.0      Zea mays [maize]
ref|XP_006416577.1|  hypothetical protein EUTSA_v10007657mg             596   0.0      
ref|XP_004952632.1|  PREDICTED: putative glycosyltransferase 5-like     596   0.0      
ref|XP_006647332.1|  PREDICTED: putative glycosyltransferase 5-like     596   0.0      
gb|AHC98117.1|  putative xyloglucan alpha-1,6-xylosyltransferase        593   0.0      
gb|ADE59448.1|  galactosyltransferase                                   591   0.0      
gb|AFK30383.1|  galactosyltransferase B1                                590   0.0      
gb|AFK30382.1|  galactosyltransferase A                                 588   0.0      
ref|NP_001047014.1|  Os02g0529600                                       588   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_173304.2|  putative glycosyltransferase 4                        588   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43079.1|  hypothetical protein                                   588   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU28806.1|  hypothetical protein MIMGU_mgv1a003740mg                586   0.0      
gb|EMT05890.1|  Putative glycosyltransferase 3                          586   0.0      
gb|EMT32465.1|  Putative glycosyltransferase 3                          572   0.0      
dbj|BAK00169.1|  predicted protein                                      566   0.0      
emb|CBX25402.1|  hypothetical_protein                                   558   0.0      
gb|EAY82266.1|  hypothetical protein OsI_37474                          557   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_009149356.1|  PREDICTED: putative glycosyltransferase 4          556   0.0      
ref|NP_001066160.1|  Os12g0149300                                       554   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977544.1|  PREDICTED: putative glycosyltransferase 5-like     552   0.0      
ref|XP_010238722.1|  PREDICTED: putative glycosyltransferase 5          550   0.0      
ref|XP_006489090.1|  PREDICTED: putative glycosyltransferase 2-like     549   0.0      
ref|XP_006419581.1|  hypothetical protein CICLE_v10004948mg             549   0.0      
ref|XP_006663818.1|  PREDICTED: putative glycosyltransferase 3-like     549   0.0      
ref|XP_004980167.1|  PREDICTED: putative glycosyltransferase 5-like     548   0.0      
ref|XP_008662460.1|  PREDICTED: putative glycosyltransferase 3          541   0.0      
emb|CBX24469.1|  hypothetical_protein                                   539   0.0      
ref|XP_008662468.1|  PREDICTED: putative glycosyltransferase 3          537   0.0      
ref|XP_002442801.1|  hypothetical protein SORBIDRAFT_08g003090          537   0.0      Sorghum bicolor [broomcorn]
gb|ABK24302.1|  unknown                                                 531   1e-180   Picea sitchensis
ref|XP_010269507.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       530   5e-180   
ref|XP_002967572.1|  glycosyltransferase, CAZy family GT34-like p...    529   5e-180   
ref|XP_001776727.1|  predicted protein                                  530   6e-180   
emb|CAJ57380.1|  alpha-1,6-xylosyltransferase                           528   2e-179   Physcomitrella patens
ref|XP_004134208.1|  PREDICTED: putative glycosyltransferase 2-like     526   2e-178   
ref|XP_008438884.1|  PREDICTED: putative glycosyltransferase 2          525   4e-178   
gb|KEH24376.1|  xyloglucan xylosyltransferase                           525   6e-178   
ref|XP_006838788.1|  hypothetical protein AMTR_s00002p00259350          524   7e-178   
emb|CBI26079.3|  unnamed protein product                                523   9e-178   
ref|XP_008795804.1|  PREDICTED: putative glycosyltransferase 2          524   1e-177   
emb|CAI11450.1|  alpha-1,6-xylosyltransferase                           523   2e-177   Pinus taeda
ref|NP_001288054.1|  calmodulin binding transcription activator 1       523   3e-177   
ref|XP_009352257.1|  PREDICTED: putative glycosyltransferase 2          522   7e-177   
ref|XP_010259619.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       521   2e-176   
ref|XP_010652172.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       520   3e-176   
ref|XP_003609672.1|  Xyloglucan 6-xylosyltransferase                    520   4e-176   
emb|CAN77730.1|  hypothetical protein VITISV_027412                     520   4e-176   Vitis vinifera
ref|XP_010938345.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    519   5e-176   
ref|XP_009414141.1|  PREDICTED: putative glycosyltransferase 2          519   5e-176   
ref|XP_002516919.1|  Xyloglucan 6-xylosyltransferase, putative          519   1e-175   Ricinus communis
ref|XP_008367147.1|  PREDICTED: putative glycosyltransferase 2          518   2e-175   
ref|XP_010098280.1|  Xyloglucan 6-xylosyltransferase                    518   2e-175   
ref|XP_009144556.1|  PREDICTED: putative glycosyltransferase 2          518   2e-175   
ref|XP_010922270.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    518   2e-175   
ref|XP_003554517.1|  PREDICTED: putative glycosyltransferase 2-like     518   3e-175   
ref|XP_007050873.1|  Alpha-1,6-xylosyltransferase isoform 1             518   3e-175   
ref|XP_008360279.1|  PREDICTED: putative glycosyltransferase 2          518   3e-175   
ref|XP_004508217.1|  PREDICTED: putative glycosyltransferase 2-like     517   3e-175   
ref|XP_008790864.1|  PREDICTED: putative glycosyltransferase 2          517   4e-175   
ref|XP_007050874.1|  Alpha-1,6-xylosyltransferase isoform 2             518   5e-175   
ref|XP_004296837.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    517   6e-175   
ref|XP_006389383.1|  glycosyltransferase 2 family protein               517   8e-175   
ref|XP_011006778.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    516   8e-175   
ref|XP_009416128.1|  PREDICTED: putative glycosyltransferase 2          515   2e-174   
gb|KDO71643.1|  hypothetical protein CISIN_1g047753mg                   515   2e-174   
ref|XP_007138911.1|  hypothetical protein PHAVU_009G248100g             515   2e-174   
ref|XP_003533377.1|  PREDICTED: putative glycosyltransferase 2-li...    514   4e-174   
ref|XP_007163097.1|  hypothetical protein PHAVU_001G206000g             514   5e-174   
ref|NP_001268156.1|  alpha-1,6-xylosyltransferase                       514   7e-174   
ref|XP_002315554.2|  glycosyltransferase 2 family protein               514   8e-174   Populus trichocarpa [western balsam poplar]
ref|XP_003628458.1|  Alpha-1 6-xylosyltransferase                       525   9e-174   
emb|CDO98874.1|  unnamed protein product                                513   2e-173   
ref|XP_011071657.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    513   2e-173   
ref|XP_007035584.1|  CAMTA domain class transcription factor            512   3e-173   
ref|XP_010037455.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    513   4e-173   
ref|NP_191831.1|  xyloglucan 6-xylosyltransferase                       512   5e-173   Arabidopsis thaliana [mouse-ear cress]
gb|ACE95677.1|  putative xylosyl transferase                            512   8e-173   Coffea canephora [robusta coffee]
ref|XP_011000518.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    511   9e-173   
ref|XP_006291070.1|  hypothetical protein CARUB_v10017185mg             511   1e-172   
ref|XP_010512668.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    511   1e-172   
ref|XP_010523942.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    511   1e-172   
gb|KDP27794.1|  hypothetical protein JCGZ_18874                         510   4e-172   
ref|XP_004290777.1|  PREDICTED: putative glycosyltransferase 2-like     508   1e-171   
ref|XP_002876686.1|  hypothetical protein ARALYDRAFT_907847             508   1e-171   
ref|XP_011090963.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    508   1e-171   
ref|XP_004980166.1|  PREDICTED: putative glycosyltransferase 5-like     509   2e-171   
ref|XP_007201035.1|  hypothetical protein PRUPE_ppa005690mg             506   9e-171   
ref|XP_004494368.1|  PREDICTED: putative glycosyltransferase 2-like     506   1e-170   
ref|XP_010468926.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1       505   5e-170   
ref|XP_010413252.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    504   5e-170   
ref|XP_008386651.1|  PREDICTED: putative glycosyltransferase 2          503   2e-169   
ref|XP_006287708.1|  hypothetical protein CARUB_v10000915mg             503   2e-169   
ref|XP_008235042.1|  PREDICTED: putative glycosyltransferase 2          502   3e-169   
emb|CDY22055.1|  BnaA09g00840D                                          502   3e-169   
ref|XP_008368989.1|  PREDICTED: putative glycosyltransferase 2          502   3e-169   
gb|AAC78266.1|  putative glycosyltransferase                            502   4e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429788.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    502   4e-169   
ref|XP_010422579.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    502   4e-169   
ref|XP_008235045.1|  PREDICTED: putative glycosyltransferase 2          501   5e-169   
ref|NP_567241.1|  UDP-xylosyltransferase 2                              502   5e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456020.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       502   5e-169   
emb|CDY50378.1|  BnaCnng19100D                                          502   7e-169   
gb|KHG26935.1|  Putative glycosyltransferase 2 -like protein            501   1e-168   
emb|CDX90935.1|  BnaA03g26150D                                          500   1e-168   
ref|XP_002874911.1|  hypothetical protein ARALYDRAFT_490316             501   1e-168   
ref|XP_006396461.1|  hypothetical protein EUTSA_v10028641mg             501   2e-168   
ref|XP_009342118.1|  PREDICTED: putative glycosyltransferase 2          499   3e-168   
ref|XP_009111280.1|  PREDICTED: putative glycosyltransferase 2          500   3e-168   
ref|XP_001777149.1|  predicted protein                                  499   4e-168   
ref|XP_001755467.1|  predicted protein                                  498   5e-168   
ref|XP_010522780.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       499   1e-167   
ref|XP_009134428.1|  PREDICTED: putative glycosyltransferase 2          498   2e-167   
ref|XP_004978367.1|  PREDICTED: putative glycosyltransferase 5-like     499   2e-167   
ref|XP_010666578.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       496   4e-167   
ref|XP_009780568.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    497   5e-167   
emb|CDX93965.1|  BnaC04g21240D                                          496   8e-167   
ref|XP_002974473.1|  xyloglucan xylosyltransferase-like protein         495   1e-166   
ref|XP_001772519.1|  predicted protein                                  494   2e-166   
ref|XP_002990826.1|  xyloglucan xylosyltransferase-like protein         494   2e-166   
emb|CAI11451.1|  alpha-1,6-xylosyltransferase                           491   1e-165   Gossypium raimondii
gb|EYU45549.1|  hypothetical protein MIMGU_mgv1a027105mg                492   3e-165   
ref|XP_009116931.1|  PREDICTED: xyloglucan 6-xylosyltransferase         491   1e-164   
gb|EYU43946.1|  hypothetical protein MIMGU_mgv1a027073mg                490   2e-164   
ref|XP_011000519.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    487   1e-163   
ref|XP_009138722.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    487   3e-163   
ref|XP_004984900.1|  PREDICTED: putative glycosyltransferase 2-like     486   5e-163   
gb|AFW88652.1|  glycosyltransferase 5                                   486   8e-163   
ref|NP_001150077.1|  glycosyltransferase 5                              485   2e-162   Zea mays [maize]
gb|KEH19400.1|  xyloglucan xylosyltransferase                           488   2e-162   
ref|XP_006402349.1|  hypothetical protein EUTSA_v10005949mg             484   6e-162   
ref|XP_006356974.1|  PREDICTED: putative glycosyltransferase 2-like     483   1e-161   
ref|XP_002314448.2|  glycosyltransferase 2 family protein               482   1e-161   Populus trichocarpa [western balsam poplar]
emb|CDY70418.1|  BnaA04g27220D                                          483   1e-161   
gb|EPS71488.1|  hypothetical protein M569_03267                         482   2e-161   
dbj|BAK06777.1|  predicted protein                                      482   2e-161   
ref|XP_007224307.1|  hypothetical protein PRUPE_ppa019851mg             481   5e-161   
ref|NP_001151451.1|  glycosyltransferase 5                              480   1e-160   Zea mays [maize]
ref|XP_004229187.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       481   1e-160   
gb|EMT04084.1|  Xyloglucan 6-xylosyltransferase                         480   1e-160   
gb|ACN29046.1|  unknown                                                 479   2e-160   Zea mays [maize]
gb|KFK30846.1|  hypothetical protein AALP_AA6G033100                    508   1e-159   
ref|XP_009600562.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       475   1e-158   
ref|XP_001771886.1|  predicted protein                                  471   1e-157   
ref|XP_004136173.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    469   7e-157   
emb|CAJ57381.1|  alpha-1,6-xylosyltransferase                           468   1e-156   Physcomitrella patens
ref|XP_006479922.1|  PREDICTED: putative glycosyltransferase 2-li...    469   3e-156   
ref|XP_006479923.1|  PREDICTED: putative glycosyltransferase 2-li...    469   4e-156   
gb|ABF95475.1|  Glycosyltransferase 5, putative, expressed              468   6e-156   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89653.1|  hypothetical protein OsI_11184                          467   8e-156   Oryza sativa Indica Group [Indian rice]
ref|XP_006444290.1|  hypothetical protein CICLE_v10020012mg             468   8e-156   
ref|XP_006479921.1|  PREDICTED: putative glycosyltransferase 2-li...    469   1e-155   
ref|XP_006649941.1|  PREDICTED: putative glycosyltransferase 2-like     467   2e-155   
ref|XP_002465400.1|  hypothetical protein SORBIDRAFT_01g038000          466   4e-155   Sorghum bicolor [broomcorn]
ref|XP_001769838.1|  predicted protein                                  463   1e-154   
ref|NP_001049853.1|  Os03g0300000                                       460   3e-154   Oryza sativa Japonica Group [Japonica rice]
gb|EPS64541.1|  hypothetical protein M569_10236                         460   1e-153   
ref|XP_008451599.1|  PREDICTED: xyloglucan 6-xylosyltransferase         459   3e-153   
gb|KHN14624.1|  Putative glycosyltransferase 2                          453   6e-152   
gb|KHN26556.1|  Putative glycosyltransferase 2                          452   8e-152   
ref|XP_001767750.1|  predicted protein                                  456   9e-152   
ref|XP_003558113.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    456   3e-151   
gb|KHN43518.1|  Xyloglucan 6-xylosyltransferase                         452   3e-150   
ref|XP_001773763.1|  predicted protein                                  452   1e-149   
ref|XP_001755939.1|  predicted protein                                  452   2e-149   
ref|XP_001768129.1|  predicted protein                                  449   2e-148   
ref|XP_001759108.1|  predicted protein                                  447   4e-148   
ref|XP_002441834.1|  hypothetical protein SORBIDRAFT_08g003080          450   7e-148   Sorghum bicolor [broomcorn]
gb|EMS58373.1|  Putative glycosyltransferase 2                          444   1e-147   
ref|XP_001755245.1|  predicted protein                                  447   1e-147   
ref|XP_001764909.1|  predicted protein                                  447   2e-147   
ref|XP_001775066.1|  predicted protein                                  445   3e-147   
ref|XP_008678871.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    441   5e-146   
ref|XP_002992573.1|  glycosyltransferase CAZy family GT34-like pr...    439   5e-145   
ref|XP_002972516.1|  glycosyltransferase CAZy family GT34-like pr...    438   8e-145   
ref|XP_001756042.1|  predicted protein                                  438   2e-144   
gb|KHN18571.1|  Putative glycosyltransferase 3                          429   8e-144   
gb|KHN48702.1|  Putative glycosyltransferase 3                          427   4e-143   
gb|AFW56047.1|  hypothetical protein ZEAMMB73_697365                    447   2e-140   
gb|EAY89696.1|  hypothetical protein OsI_11232                          419   1e-136   Oryza sativa Indica Group [Indian rice]
ref|NP_001173389.1|  Os03g0306100                                       417   3e-136   
gb|ABF95527.1|  Glycosyltransferase 3, putative                         417   4e-136   
gb|AFW63176.1|  hypothetical protein ZEAMMB73_999507                    414   7e-136   
dbj|BAO02547.1|  (1-6)-alpha-D-xylosyltransferase ortholog              407   2e-134   
ref|XP_008663804.1|  PREDICTED: putative glycosyltransferase 3          414   7e-134   
ref|XP_004987030.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    410   1e-133   
gb|EMS45714.1|  Putative glycosyltransferase 3                          417   6e-133   
ref|NP_001049886.1|  Os03g0305800                                       407   7e-132   
ref|XP_010230173.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    405   2e-131   
dbj|BAK08324.1|  predicted protein                                      404   8e-131   
ref|XP_002455150.1|  hypothetical protein SORBIDRAFT_03g005110          402   2e-130   
gb|ACF82576.1|  unknown                                                 394   1e-129   
ref|XP_009609259.1|  PREDICTED: putative glycosyltransferase 3          391   2e-129   
ref|XP_003558085.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    397   4e-128   
dbj|BAK06850.1|  predicted protein                                      390   7e-126   
emb|CDY70090.1|  BnaCnng66640D                                          385   4e-125   
emb|CBI15187.3|  unnamed protein product                                383   6e-125   
ref|XP_006651307.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    385   4e-124   
gb|ABC87290.1|  putative galactosyl transferase                         382   1e-123   
gb|ACN27080.1|  unknown                                                 377   1e-123   
ref|XP_004987031.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    375   7e-120   
gb|AFW88602.1|  hypothetical protein ZEAMMB73_854435                    374   7e-120   
ref|XP_002990216.1|  glycosyltransferase CAZy family GT34-like pr...    375   1e-119   
ref|XP_008660215.1|  PREDICTED: xyloglucan 6-xylosyltransferase-l...    374   2e-119   
ref|XP_002465378.1|  hypothetical protein SORBIDRAFT_01g037530          374   3e-119   
ref|XP_008663454.1|  PREDICTED: putative glycosyltransferase 2          365   1e-118   
gb|AFW59084.1|  hypothetical protein ZEAMMB73_119802                    375   2e-118   
ref|XP_006651308.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    369   2e-118   
ref|XP_002980080.1|  glycosyltransferase CAZy family GT34-like pr...    365   2e-117   
gb|AFU82535.1|  alpha-1,6-xylosyltransferase                            360   4e-117   
ref|XP_001765298.1|  predicted protein                                  361   2e-116   
ref|XP_004987032.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    365   5e-116   
ref|XP_001761988.1|  predicted protein                                  360   4e-115   
ref|XP_001781241.1|  predicted protein                                  356   2e-114   
ref|XP_008654833.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    358   2e-113   
emb|CDX96540.1|  BnaA07g31510D                                          348   8e-113   
ref|XP_008466919.1|  PREDICTED: putative glycosyltransferase 5          349   1e-112   
ref|XP_001767288.1|  predicted protein                                  352   2e-112   
emb|CDX85826.1|  BnaC06g23080D                                          347   4e-112   
ref|XP_002465379.1|  hypothetical protein SORBIDRAFT_01g037540          355   4e-112   
ref|XP_002980077.1|  glycosyltransferase-like protein                   347   6e-111   
ref|XP_002987473.1|  glycosyltransferase-like protein                   344   1e-109   
gb|EPS63631.1|  hypothetical protein M569_11153                         344   2e-109   
gb|ADE76992.1|  unknown                                                 343   3e-107   
emb|CAN80825.1|  hypothetical protein VITISV_015452                     339   6e-106   
emb|CBI36830.3|  unnamed protein product                                332   3e-104   
ref|XP_008453680.1|  PREDICTED: putative glycosyltransferase 3          325   4e-104   
ref|XP_010274411.1|  PREDICTED: galactomannan galactosyltransfera...    335   4e-104   
ref|XP_008453679.1|  PREDICTED: putative glycosyltransferase 3          324   8e-104   
emb|CAI79403.1|  galactomannan galactosyltransferase                    333   8e-104   
ref|XP_009345079.1|  PREDICTED: putative glycosyltransferase 7          333   1e-103   
emb|CDP02617.1|  unnamed protein product                                332   2e-103   
gb|ACH58908.1|  galactosyl transferase                                  332   5e-103   
emb|CAI11454.1|  alpha-6-galactosyltransferase                          331   6e-103   
ref|XP_003608541.1|  Alpha-6-galactosyltransferase                      332   9e-103   
ref|XP_008363062.1|  PREDICTED: glycosyltransferase 6-like              330   1e-102   
ref|XP_007208181.1|  hypothetical protein PRUPE_ppa017391mg             327   2e-102   
ref|NP_001281283.1|  putative glycosyltransferase 7                     329   5e-102   
ref|XP_003611556.1|  Galactomannan galactosyltransferase                329   5e-102   
ref|XP_006857127.1|  hypothetical protein AMTR_s00065p00144450          329   1e-101   
ref|XP_008392336.1|  PREDICTED: putative glycosyltransferase 7          327   3e-101   
ref|XP_009361779.1|  PREDICTED: glycosyltransferase 6-like              327   4e-101   
ref|XP_008440417.1|  PREDICTED: galactomannan galactosyltransfera...    327   4e-101   
ref|XP_010273069.1|  PREDICTED: putative glycosyltransferase 7          327   5e-101   
ref|XP_004511818.1|  PREDICTED: galactomannan galactosyltransfera...    327   6e-101   
emb|CDP02619.1|  unnamed protein product                                327   7e-101   
ref|XP_010497538.1|  PREDICTED: putative glycosyltransferase 5          316   1e-100   
emb|CDY18017.1|  BnaC03g30890D                                          321   2e-100   
ref|XP_006363812.1|  PREDICTED: putative glycosyltransferase 7-li...    325   2e-100   
ref|XP_007156700.1|  hypothetical protein PHAVU_002G009900g             325   2e-100   
ref|XP_009624871.1|  PREDICTED: putative glycosyltransferase 7          325   3e-100   
ref|XP_006363813.1|  PREDICTED: putative glycosyltransferase 7-li...    323   4e-100   
ref|XP_008238162.1|  PREDICTED: glycosyltransferase 6-like              323   4e-100   
ref|XP_011099400.1|  PREDICTED: glycosyltransferase 6-like              323   4e-100   
ref|XP_009761597.1|  PREDICTED: putative glycosyltransferase 7          324   6e-100   
ref|XP_009394361.1|  PREDICTED: galactomannan galactosyltransfera...    323   9e-100   
gb|KDO78929.1|  hypothetical protein CISIN_1g045999mg                   323   9e-100   
ref|XP_004231937.1|  PREDICTED: putative glycosyltransferase 7          323   1e-99    
emb|CAB52246.1|  alpha galactosyltransferase                            322   3e-99    
emb|CDP02618.1|  unnamed protein product                                322   3e-99    
ref|XP_010028081.1|  PREDICTED: putative glycosyltransferase 7          322   4e-99    
ref|NP_001105164.1|  alpha-6-galactosyltransferase                      321   4e-99    
gb|EYU41378.1|  hypothetical protein MIMGU_mgv1a006348mg                322   4e-99    
ref|XP_004141854.1|  PREDICTED: galactomannan galactosyltransfera...    321   6e-99    
ref|XP_006426098.1|  hypothetical protein CICLE_v10025585mg             321   8e-99    
ref|XP_004234713.2|  PREDICTED: glycosyltransferase 6-like              320   9e-99    
ref|XP_006466460.1|  PREDICTED: putative glycosyltransferase 7-like     320   1e-98    
emb|CAD98924.1|  galactomannan galactosyltransferase                    320   1e-98    
gb|ADL36663.1|  CAMTA domain class transcription factor                 319   2e-98    
ref|XP_007211970.1|  hypothetical protein PRUPE_ppa006622mg             318   3e-98    
ref|XP_010109205.1|  Galactomannan galactosyltransferase 1              318   4e-98    
ref|XP_010106924.1|  Galactomannan galactosyltransferase 1              319   4e-98    
ref|XP_003525869.1|  PREDICTED: galactomannan galactosyltransfera...    318   5e-98    
ref|XP_003539263.1|  PREDICTED: galactomannan galactosyltransfera...    318   5e-98    
ref|XP_008226081.1|  PREDICTED: putative glycosyltransferase 7          318   6e-98    
ref|XP_008362135.1|  PREDICTED: galactomannan galactosyltransfera...    320   7e-98    
gb|ACF33173.1|  putative galactomannan galactosyl transferase           318   7e-98    
ref|XP_006350640.1|  PREDICTED: putative glycosyltransferase 7-like     317   8e-98    
ref|XP_004288265.1|  PREDICTED: galactomannan galactosyltransfera...    318   8e-98    
ref|XP_008237711.1|  PREDICTED: galactomannan galactosyltransfera...    317   1e-97    
ref|XP_011073681.1|  PREDICTED: glycosyltransferase 6                   318   1e-97    
ref|XP_008806204.1|  PREDICTED: galactomannan galactosyltransfera...    318   2e-97    
ref|XP_009362594.1|  PREDICTED: glycosyltransferase 6-like              315   4e-97    
ref|XP_009618872.1|  PREDICTED: putative glycosyltransferase 7          315   7e-97    
gb|KFK30380.1|  hypothetical protein AALP_AA7G253700                    315   8e-97    
ref|XP_007205195.1|  hypothetical protein PRUPE_ppa005681mg             315   1e-96    
ref|XP_006363811.1|  PREDICTED: putative glycosyltransferase 7-like     315   1e-96    
ref|XP_009362595.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    315   3e-96    
gb|KDP32091.1|  hypothetical protein JCGZ_12552                         314   3e-96    
ref|XP_009777953.1|  PREDICTED: putative glycosyltransferase 7 is...    313   4e-96    
ref|XP_009394626.1|  PREDICTED: galactomannan galactosyltransfera...    313   4e-96    
tpg|DAA64590.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    315   4e-96    
sp|Q564G7.1|GMGT1_CYATE  RecName: Full=Galactomannan galactosyltr...    313   4e-96    
ref|XP_010939020.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    314   5e-96    
ref|XP_003608540.1|  Galactomannan galactosyltransferase                312   7e-96    
ref|XP_009138524.1|  PREDICTED: glycosyltransferase 6                   312   8e-96    
emb|CDP02616.1|  unnamed protein product                                312   1e-95    
gb|ADL36661.1|  CAMTA domain class transcription factor                 312   1e-95    
ref|XP_002513422.1|  transferase, putative                              311   1e-95    
ref|XP_008784727.1|  PREDICTED: putative glycosyltransferase 7          311   1e-95    
dbj|BAK05879.1|  predicted protein                                      311   2e-95    
ref|XP_011099399.1|  PREDICTED: glycosyltransferase 6-like              312   2e-95    
gb|KHG22229.1|  Putative glycosyltransferase 7 -like protein            312   2e-95    
emb|CDX72649.1|  BnaC07g46710D                                          311   2e-95    
ref|XP_010531308.1|  PREDICTED: putative glycosyltransferase 7          311   3e-95    
emb|CDY29577.1|  BnaA03g54220D                                          311   4e-95    
ref|XP_004953741.1|  PREDICTED: galactomannan galactosyltransfera...    310   4e-95    
gb|AHC98115.1|  putative galacto(gluco)mannan alpha-1,6-galactosy...    311   6e-95    
ref|XP_009607432.1|  PREDICTED: glycosyltransferase 6-like              310   6e-95    
emb|CAI11453.1|  alpha-6-galactosyltransferase                          310   7e-95    
ref|XP_004980588.1|  PREDICTED: galactomannan galactosyltransfera...    308   7e-95    
ref|XP_006411860.1|  hypothetical protein EUTSA_v10027092mg             310   8e-95    
ref|XP_002454367.1|  hypothetical protein SORBIDRAFT_04g029500          310   1e-94    
ref|XP_007047569.1|  Galactosyl transferase GMA12/MNN10 family pr...    310   1e-94    
ref|XP_004231939.1|  PREDICTED: glycosyltransferase 6-like              310   1e-94    
emb|CAI11452.1|  alpha-6-galactosyltransferase                          310   1e-94    
gb|ABK25085.1|  unknown                                                 310   1e-94    
ref|XP_008347885.1|  PREDICTED: galactomannan galactosyltransfera...    310   2e-94    
ref|XP_003517354.1|  PREDICTED: galactomannan galactosyltransfera...    308   4e-94    
gb|KHG22205.1|  Putative glycosyltransferase 7 -like protein            308   4e-94    
gb|EPS69883.1|  hypothetical protein M569_04879                         307   7e-94    
ref|XP_010679659.1|  PREDICTED: putative glycosyltransferase 7          307   7e-94    
gb|ACE60602.1|  putative galactomannan galactosyl transferase           308   7e-94    
ref|XP_002868971.1|  galactosyl transferase GMA12/MNN10 family pr...    307   8e-94    
ref|XP_011031309.1|  PREDICTED: putative glycosyltransferase 7          307   1e-93    
ref|XP_009761596.1|  PREDICTED: glycosyltransferase 6-like              307   1e-93    
ref|XP_004294205.1|  PREDICTED: galactomannan galactosyltransfera...    306   3e-93    
ref|XP_003570475.1|  PREDICTED: galactomannan galactosyltransfera...    305   3e-93    
ref|XP_002310890.2|  alpha galactosyltransferase family protein         306   6e-93    
gb|EAY87343.1|  hypothetical protein OsI_08746                          304   1e-92    
ref|XP_011007841.1|  PREDICTED: putative glycosyltransferase 7          305   1e-92    
ref|XP_002320005.2|  alpha galactosyltransferase family protein         305   2e-92    
ref|NP_001047970.1|  Os02g0723200                                       304   2e-92    
ref|XP_002525290.1|  transferase, putative                              304   2e-92    
ref|XP_010432039.1|  PREDICTED: glycosyltransferase 6                   303   4e-92    
gb|KDP25125.1|  hypothetical protein JCGZ_22660                         303   4e-92    
gb|AFW64907.1|  glycosyltransferase 6                                   304   6e-92    
ref|XP_010437192.1|  PREDICTED: glycosyltransferase 6-like              302   7e-92    
ref|NP_680773.1|  glycosyltransferase 6                                 301   1e-91    
ref|XP_010919073.1|  PREDICTED: galactomannan galactosyltransfera...    301   2e-91    
ref|XP_003575986.2|  PREDICTED: galactomannan galactosyltransfera...    302   2e-91    
ref|NP_001152534.1|  glycosyltransferase 6                              301   6e-91    
ref|XP_008795673.1|  PREDICTED: glycosyltransferase 6-like              301   2e-90    
gb|EAY81250.1|  hypothetical protein OsI_36429                          300   2e-90    
emb|CDX76887.1|  BnaC08g34730D                                          298   2e-90    
ref|XP_008679453.1|  PREDICTED: galactomannan galactosyltransfera...    298   3e-90    
emb|CDY49440.1|  BnaA09g42270D                                          298   4e-90    
ref|XP_009117319.1|  PREDICTED: putative glycosyltransferase 7          298   4e-90    
ref|NP_001068066.1|  Os11g0546500                                       299   4e-90    
ref|XP_009406736.1|  PREDICTED: galactomannan galactosyltransfera...    299   4e-90    
ref|XP_010446636.1|  PREDICTED: LOW QUALITY PROTEIN: glycosyltran...    297   4e-90    
ref|XP_006404757.1|  hypothetical protein EUTSA_v10000162mg             297   7e-90    
ref|XP_006294199.1|  hypothetical protein CARUB_v10023195mg             297   1e-89    
ref|XP_010472288.1|  PREDICTED: putative glycosyltransferase 7          295   5e-89    
ref|XP_010943187.1|  PREDICTED: galactomannan galactosyltransfera...    297   7e-89    
ref|NP_565544.1|  putative glycosyltransferase 7                        294   1e-88    
ref|XP_010429224.1|  PREDICTED: putative glycosyltransferase 7          293   5e-88    
ref|XP_010417049.1|  PREDICTED: putative glycosyltransferase 7          293   6e-88    
gb|EMS48021.1|  Putative glycosyltransferase 3                          289   1e-87    
dbj|BAJ96459.1|  predicted protein                                      291   2e-87    
gb|KHN20409.1|  Putative glycosyltransferase 2                          280   1e-86    
gb|EYU44510.1|  hypothetical protein MIMGU_mgv1a018855mg                288   1e-86    
ref|XP_002449648.1|  hypothetical protein SORBIDRAFT_05g020910          288   2e-86    
ref|XP_002880469.1|  galactosyl transferase GMA12/MNN10 family pr...    287   3e-86    
ref|XP_006665210.1|  PREDICTED: putative glycosyltransferase 3-like     274   3e-84    
ref|XP_008363070.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    275   2e-82    
ref|XP_009777954.1|  PREDICTED: putative glycosyltransferase 7 is...    276   2e-82    
ref|XP_008679454.1|  PREDICTED: galactomannan galactosyltransfera...    272   3e-80    
ref|XP_002450906.1|  hypothetical protein SORBIDRAFT_05g020930          270   1e-79    
ref|XP_006663513.1|  PREDICTED: putative glycosyltransferase 7-like     265   7e-79    
tpg|DAA57044.1|  TPA: hypothetical protein ZEAMMB73_619966              270   9e-79    
ref|XP_004980586.1|  PREDICTED: galactomannan galactosyltransfera...    263   9e-77    
gb|AEN82384.1|  AT4G02500-like protein                                  249   4e-75    
gb|ADG38703.1|  AT4G02500-like protein                                  247   2e-74    
ref|XP_004980587.1|  PREDICTED: galactomannan galactosyltransfera...    256   3e-74    
gb|ADG38709.1|  AT4G02500-like protein                                  246   4e-74    
ref|XP_010040898.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       244   4e-73    
gb|KHN36310.1|  Galactomannan galactosyltransferase 1                   249   7e-72    
gb|AEN82275.1|  AT3G62720-like protein                                  230   2e-68    
gb|KHN20359.1|  Galactomannan galactosyltransferase 1                   233   8e-68    
gb|AEN82277.1|  AT3G62720-like protein                                  229   9e-68    
gb|AEN82274.1|  AT3G62720-like protein                                  228   1e-67    
tpg|DAA53369.1|  TPA: hypothetical protein ZEAMMB73_022473              236   2e-67    
gb|KCW44805.1|  hypothetical protein EUGRSUZ_L01630                     227   7e-67    
ref|XP_002978152.1|  glycosyltransferase CAZy family GT34-like pr...    230   3e-65    
ref|XP_002966412.1|  glycosyltransferase CAZy family GT34-like pr...    229   4e-65    
ref|XP_010646814.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    226   1e-63    
gb|EMT25995.1|  hypothetical protein F775_42861                         221   4e-63    
emb|CDX97271.1|  BnaA02g20620D                                          211   1e-59    
emb|CDY65940.1|  BnaUnng01300D                                          209   8e-59    
ref|XP_006840585.1|  hypothetical protein AMTR_s00045p00232030          212   1e-57    
gb|EMT11268.1|  Putative glycosyltransferase 7                          202   3e-56    
gb|ACF06190.1|  xylosyl transferase                                     194   1e-54    
gb|AIA92435.1|  Glyco_transf_34                                         188   7e-53    
gb|ACF33172.1|  putative galactosyl transferase                         190   4e-52    
emb|CDY49114.1|  BnaA02g16920D                                          183   8e-51    
gb|EMT32015.1|  Xyloglucan 6-xylosyltransferase                         183   1e-50    
tpg|DAA64593.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    183   1e-49    
emb|CDX76657.1|  BnaC08g32430D                                          174   8e-47    
gb|AFW88603.1|  hypothetical protein ZEAMMB73_745866                    174   9e-46    
gb|AEW08173.1|  hypothetical protein 2_1874_01                          167   3e-45    
emb|CDY49115.1|  BnaA02g16910D                                          154   2e-40    



>emb|CAI11457.1| putative glycosyltransferase [Solanum tuberosum]
Length=474

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/453 (76%), Positives = 391/453 (86%), Gaps = 2/453 (0%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MGQ+   +AQKR GALPTT T   NG  R R+   +PRGRQI+RTFNN+KITILCGFVTI
Sbjct  1     MGQESTFTAQKRAGALPTTVT--ANGGVRGRSPNVLPRGRQINRTFNNVKITILCGFVTI  58

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             LVLRGTIG+GN++SS+AE EN  LI+ETNRIL +IRSDKDPDDP G   + F+S N+T+S
Sbjct  59    LVLRGTIGIGNVSSSEAEAENQNLIEETNRILSDIRSDKDPDDPVGDQPETFMSLNDTYS  118

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             LGPKI  WD+ RK+W  ++P FP+ V GKPR+LLVTGSPP PC+N +GDHYLLK +KNKI
Sbjct  119   LGPKIANWDKDRKMWLQKNPEFPNFVNGKPRILLVTGSPPNPCDNAIGDHYLLKAIKNKI  178

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCRIHGIEI+YN A++++EM G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM FE+
Sbjct  179   DYCRIHGIEILYNLAHLEKEMAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVFEM  238

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             PLSKY+ HNLVIHGY DLLFDQKSW AL+TGSFL RNCQW LDLLD WAPMGPKGPIREE
Sbjct  239   PLSKYNRHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWFLDLLDAWAPMGPKGPIREE  298

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
             +GK LTA LKGRP FEADDQSALIYLL S+KD+WM KV +ENSYYLHGYWAGLVDRYEE+
Sbjct  299   AGKILTAYLKGRPAFEADDQSALIYLLTSQKDKWMHKVSIENSYYLHGYWAGLVDRYEEM  358

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             ++KYHPG GDERWPFVTHFVGCK CGS GD+P E+C+K+MERAFNFADNQVLNLYGFKH+
Sbjct  359   IQKYHPGLGDERWPFVTHFVGCKPCGSYGDYPAERCLKNMERAFNFADNQVLNLYGFKHK  418

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GLLSPNIKRIRNET  PL  VD+ D RHAKHES
Sbjct  419   GLLSPNIKRIRNETDNPLQYVDQLDVRHAKHES  451



>ref|XP_009617169.1| PREDICTED: putative glycosyltransferase 5 [Nicotiana tomentosiformis]
Length=453

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/454 (78%), Positives = 392/454 (86%), Gaps = 7/454 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPG-ALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MG D   +AQKR G ALPTTAT   NG    RA+  +PRGRQI RTFNNIKITILCGFVT
Sbjct  1     MGPDSSFAAQKRGGGALPTTATP--NGG---RASSVLPRGRQIQRTFNNIKITILCGFVT  55

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILVLRGTIG GNLASS ++ EN+ LI+ETNRILDEIRSDKDPDDP  QS D F   N T+
Sbjct  56    ILVLRGTIGFGNLASSGSDAENANLIEETNRILDEIRSDKDPDDPVDQS-DSFFRLNSTY  114

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             SLGPKIT WD  RK W  ++P FP+ + GKPRVLLVTGSPP PC+NP+GDHYLLK +KNK
Sbjct  115   SLGPKITTWDADRKFWLQKNPDFPNFIHGKPRVLLVTGSPPNPCDNPIGDHYLLKVIKNK  174

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCRIHGIEIVYN A++++EM G WAKLPLIR+LMLSHPE+EWIWWMDSDA FTDM FE
Sbjct  175   IDYCRIHGIEIVYNLAHLEKEMAGYWAKLPLIRKLMLSHPEVEWIWWMDSDALFTDMVFE  234

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             IP SKY+ HNLVIHGY DLLFDQKSW AL+TGSFLIRNCQW+LDLLD WAPMGPKGP+RE
Sbjct  235   IPFSKYNDHNLVIHGYPDLLFDQKSWIALNTGSFLIRNCQWSLDLLDAWAPMGPKGPVRE  294

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTANLKGRP FEADDQSALIYLLMS+KDQWMD+VF+ENSYYLHGYWAGLVDRYEE
Sbjct  295   EAGKVLTANLKGRPAFEADDQSALIYLLMSQKDQWMDQVFIENSYYLHGYWAGLVDRYEE  354

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GDERWPFVTHFVGCK CG  GD+PVE+C+KS+ERAFNFADNQVL LYGF+H
Sbjct  355   MIEKYHPGLGDERWPFVTHFVGCKPCGIYGDYPVERCMKSIERAFNFADNQVLKLYGFRH  414

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             +GLLSPNIKRIRNET  PL  VD+ D RHAKHES
Sbjct  415   KGLLSPNIKRIRNETDNPLQYVDQLDVRHAKHES  448



>ref|XP_006365321.1| PREDICTED: putative glycosyltransferase 5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365322.1| PREDICTED: putative glycosyltransferase 5-like isoform X2 [Solanum 
tuberosum]
Length=454

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/450 (76%), Positives = 390/450 (87%), Gaps = 2/450 (0%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MGQ+   +AQKR GALPTT T   NG  R R+   +PRGRQI RTFNN+KITILCGFVTI
Sbjct  1     MGQESTFTAQKRAGALPTTVT--ANGGVRGRSPNVLPRGRQIDRTFNNVKITILCGFVTI  58

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             LVLRGTIG+GN++SS+AE EN  LI+ETNRIL +IRSDKDPDDP G   + F+S N+T+S
Sbjct  59    LVLRGTIGIGNVSSSEAEAENQNLIEETNRILSDIRSDKDPDDPAGDQPETFMSLNDTYS  118

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             LGPKI  WD+ RK+W  ++P FP+ V GKPR+LLVTGSPP PC+N +GDHYLLK +KNKI
Sbjct  119   LGPKIANWDKDRKMWLQKNPEFPNFVNGKPRILLVTGSPPNPCDNAIGDHYLLKAIKNKI  178

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCRIHGIEI+YN A +++EM G W+KLPLIRRLMLSHPE+EWIWWMDSDA FTDM FE+
Sbjct  179   DYCRIHGIEILYNLAYLEKEMAGYWSKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVFEM  238

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             PLSKY+ HNLVIHGY DLLFDQKSW AL+TGSFL RNCQW LDLLD WAPMGPKGPIREE
Sbjct  239   PLSKYNRHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWFLDLLDAWAPMGPKGPIREE  298

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
             +GK LTA LKGRP+FEADDQSALIYLL+S+KD+WM KVF+ENSYYLHGYWAGLVDRYEE+
Sbjct  299   AGKILTAYLKGRPDFEADDQSALIYLLVSQKDKWMPKVFVENSYYLHGYWAGLVDRYEEM  358

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             +EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVL+LYGFKH+
Sbjct  359   IEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLDLYGFKHK  418

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRHAK  1411
             GLLSPNIKRIRNET  PL  VD+ D RHAK
Sbjct  419   GLLSPNIKRIRNETDHPLQYVDQLDVRHAK  448



>ref|XP_009764347.1| PREDICTED: putative glycosyltransferase 5 [Nicotiana sylvestris]
Length=455

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/455 (75%), Positives = 390/455 (86%), Gaps = 3/455 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRA--NPQVPRGRQISRTFNNIKITILCGFV  235
             MGQ+   +AQKR GALP T T A  G     A  +  +PRGRQI RTFNN+KITILCGFV
Sbjct  1     MGQESTFTAQKRAGALPVTTTTANGGVCSRSATNSSALPRGRQIQRTFNNVKITILCGFV  60

Query  236   TILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNET  415
             TILVLRGTIG+GNL+SSDA+ E   LI+ETNRIL E+RSDKDPDDP  Q  + F+S NET
Sbjct  61    TILVLRGTIGIGNLSSSDADAETQNLIEETNRILAEMRSDKDPDDPVDQP-ETFMSLNET  119

Query  416   FSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKN  595
             +SLGPKI  WD+ RK+W +++P FP+ V GKPR+LLVTGSPP PC+N +GDHYLLK +KN
Sbjct  120   YSLGPKIVNWDKDRKMWLEKNPEFPNLVNGKPRILLVTGSPPNPCDNAIGDHYLLKAIKN  179

Query  596   KIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAF  775
             KIDYCRIHGIEI+YN A++D+EM G W+KLPLIRRLMLSHPE+EWIWWMDSDA FTDM  
Sbjct  180   KIDYCRIHGIEILYNLAHLDKEMAGYWSKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVL  239

Query  776   EIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIR  955
             EIPLSKY+ HNLVIHGY DLLFDQKSW A++TGSFL RNCQW+LDLLD WAPMGPKGPIR
Sbjct  240   EIPLSKYNRHNLVIHGYPDLLFDQKSWIAVNTGSFLFRNCQWSLDLLDAWAPMGPKGPIR  299

Query  956   EESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYE  1135
             +E+GK LTANLK RP FEADDQSALIYL +S+KD+WM KVF+ENSYYLHGYWAGLVDRYE
Sbjct  300   DEAGKILTANLKDRPAFEADDQSALIYLFVSQKDKWMQKVFVENSYYLHGYWAGLVDRYE  359

Query  1136  EVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFK  1315
             E++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVLNLYGF+
Sbjct  360   EMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLNLYGFR  419

Query  1316  HRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             H+GLLSPNIKRIRNE+  PL  VD+ D RHAKH+S
Sbjct  420   HKGLLSPNIKRIRNESDHPLQYVDQLDVRHAKHKS  454



>ref|XP_011087267.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum]
 ref|XP_011087268.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum]
Length=453

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/453 (76%), Positives = 390/453 (86%), Gaps = 3/453 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKR-PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MG +   SAQKR    LPTT   A  G     A+  +PRGRQI +TFNNIKITILCGFVT
Sbjct  1     MGSESTFSAQKRGSSGLPTTGATANGGARARAAS-LLPRGRQIHKTFNNIKITILCGFVT  59

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILVLRGTIG+GNL SS+AE EN  L++ETNRIL EIRSDKDP+DP+ Q  + F +PN TF
Sbjct  60    ILVLRGTIGLGNLVSSEAEAENQHLVEETNRILAEIRSDKDPNDPDDQP-EEFFNPNMTF  118

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             SLGPKIT WDE RKVW  ++P+FP  V G+PR+LLVTGSPP PC+N +GDHYLLK VKNK
Sbjct  119   SLGPKITTWDEDRKVWLQKNPQFPQYVNGRPRILLVTGSPPNPCDNAIGDHYLLKAVKNK  178

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCRIHGIEIVYN A++D+EM G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM FE
Sbjct  179   IDYCRIHGIEIVYNMAHLDKEMAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVFE  238

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             +P+SKY  +N+VIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLDVWAPMGPKGP+RE
Sbjct  239   LPVSKYKDYNMVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPKGPVRE  298

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTANLKGRP FEADDQSALIYLL+S+KDQWMDKVF+ENS+YLHG+W GLVDRYEE
Sbjct  299   EAGKILTANLKGRPAFEADDQSALIYLLISQKDQWMDKVFVENSFYLHGFWEGLVDRYEE  358

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVLNLYGF+H
Sbjct  359   MIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLNLYGFRH  418

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHE  1417
             RGL+SPNIKRIRNET  PL NVD++D RH+ H+
Sbjct  419   RGLVSPNIKRIRNETATPLVNVDQFDIRHSVHQ  451



>ref|XP_010318819.1| PREDICTED: putative glycosyltransferase 5 [Solanum lycopersicum]
Length=450

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/454 (76%), Positives = 383/454 (84%), Gaps = 10/454 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPG-ALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MG D   +AQKR G ALPTTAT         RA+  +PRGRQI RTFNNIKITILCGFVT
Sbjct  1     MGPDNSFTAQKRAGGALPTTATPNGG-AGGGRASSILPRGRQIQRTFNNIKITILCGFVT  59

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILVLRGTIG GNLASS  +VEN  LI+ETNRI+ EIRSDKDPDD        F + N T+
Sbjct  60    ILVLRGTIGFGNLASSGPDVENLNLIEETNRIIAEIRSDKDPDD--------FFTLNATY  111

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
              LGPKIT WDE RK+W  ++P FP+ V+GKPRV+LVTGSPP PC+NP+GDHYLLK +KNK
Sbjct  112   RLGPKITAWDEDRKLWLQKNPEFPNFVQGKPRVMLVTGSPPNPCDNPIGDHYLLKAIKNK  171

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCRIHGIEIVYN A ++ EM G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM FE
Sbjct  172   IDYCRIHGIEIVYNLAQLEMEMAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVFE  231

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             IP +KY+ HNL+IHGY DLLFDQKSW A++TGSFL+RNCQW+LDLLD WAPMGPKGP+RE
Sbjct  232   IPFNKYEDHNLIIHGYPDLLFDQKSWVAVNTGSFLVRNCQWSLDLLDAWAPMGPKGPVRE  291

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTANLKGRP FEADDQSALIYLL S+KDQWMDKVF+ENSYYLHGYWAGLVDRYEE
Sbjct  292   EAGKVLTANLKGRPAFEADDQSALIYLLTSQKDQWMDKVFIENSYYLHGYWAGLVDRYEE  351

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GD RWPFVTHFVGCK CGS GD+P E+C+K+MERAFNFADNQVLNLYGF+H
Sbjct  352   MIEKYHPGLGDARWPFVTHFVGCKPCGSYGDYPAERCLKNMERAFNFADNQVLNLYGFRH  411

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
              GLLSPNIKRIRNET  PL  VD+ D RHAKHES
Sbjct  412   EGLLSPNIKRIRNETDNPLQYVDQLDVRHAKHES  445



>emb|CAI11458.1| putative glycosyltransferase [Nicotiana benthamiana]
Length=450

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/454 (76%), Positives = 384/454 (85%), Gaps = 10/454 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPG-ALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MG D   +AQKR G ALPTTAT   NG    R +  +PRGRQI RTFNNIKITILCGFVT
Sbjct  1     MGPDSSFAAQKRGGGALPTTATP--NGG---RTSSVLPRGRQIQRTFNNIKITILCGFVT  55

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILVLRGTIG G+LASS ++ EN+ LI+ETNRILDEIRSD D DDP     D F   N T+
Sbjct  56    ILVLRGTIGFGSLASSGSDAENANLIEETNRILDEIRSDTDLDDPS----DTFSHLNSTY  111

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             SLGPKIT WD  RK W  ++P FP+ + GKPRVLLVTGSPP PC+NP GDHYLLK +KNK
Sbjct  112   SLGPKITTWDADRKFWLQKNPDFPNFIHGKPRVLLVTGSPPNPCDNPTGDHYLLKVMKNK  171

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCRIHGIEIVYN A++++EM G WAKLPLIR+LMLSHPE+EWIWWMDSDA FTDM FE
Sbjct  172   IDYCRIHGIEIVYNLAHLEKEMAGYWAKLPLIRKLMLSHPEVEWIWWMDSDALFTDMVFE  231

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             IP SKY+ HNLVIHGY DLLF+QKSW AL+TGSFLIRNCQW+LDLLD WAPMGPKGP+RE
Sbjct  232   IPFSKYNDHNLVIHGYPDLLFEQKSWIALNTGSFLIRNCQWSLDLLDAWAPMGPKGPVRE  291

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTANLK RP FEADDQSALIYLLMS+KDQWMD+VF+ENSYYLHGYWAGLVDRYEE
Sbjct  292   EAGKVLTANLKSRPAFEADDQSALIYLLMSQKDQWMDQVFIENSYYLHGYWAGLVDRYEE  351

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GDERW FVTHF GCK CGS GD+PVE+C+KSMERAFNFADNQVL LYGF+H
Sbjct  352   MVEKYHPGLGDERWAFVTHFAGCKPCGSYGDYPVERCMKSMERAFNFADNQVLKLYGFRH  411

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             +GLLSPNIKRIRNET  PL  VD+ D RHAKHES
Sbjct  412   KGLLSPNIKRIRNETDNPLLYVDQLDLRHAKHES  445



>ref|XP_008239899.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
 ref|XP_008239903.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
Length=459

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/453 (74%), Positives = 384/453 (85%), Gaps = 3/453 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKR-PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MGQD   +AQKR  G LPT+ T         RA   +PRGRQI +TFNNIKITILCGFVT
Sbjct  1     MGQDSSFTAQKRGAGGLPTSTTGTSANGRAGRAYGSLPRGRQIQKTFNNIKITILCGFVT  60

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILVLRGTIGVGNL +S+A+  N  +I+ETNRIL EIRSD DP+DP+  +    ++PN T+
Sbjct  61    ILVLRGTIGVGNLGNSEADAINQNIIEETNRILAEIRSDSDPNDPDELTQTE-INPNITY  119

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             +LGPKI  WD++RK W   +P FPS V GKPRVLLVTGSPP PC+NP+GDHYLLK +KNK
Sbjct  120   TLGPKIANWDKERKAWLQSNPEFPSLVNGKPRVLLVTGSPPKPCDNPIGDHYLLKVIKNK  179

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCR+HGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM FE
Sbjct  180   IDYCRLHGIEIVYNLAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVFE  239

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             +PLSKY+SHNLVIHGY DLLF+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPIRE
Sbjct  240   LPLSKYNSHNLVIHGYPDLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRE  299

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTANLKGRP FEADDQSALIYLL+S+KDQWMDKV++ENSYYLHGYWAGLVDRYEE
Sbjct  300   EAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYVENSYYLHGYWAGLVDRYEE  359

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF+H
Sbjct  360   MIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLGSMERAFNFADNQVLKLYGFRH  419

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDF-RHAKH  1414
             RGLLSP IKRIRNET  PL +VD++D  RH  H
Sbjct  420   RGLLSPKIKRIRNETATPLESVDQFDIRRHLVH  452



>ref|XP_009761185.1| PREDICTED: putative glycosyltransferase 5 [Nicotiana sylvestris]
Length=453

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/454 (77%), Positives = 388/454 (85%), Gaps = 7/454 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPG-ALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MG D   +AQKR G ALPTTAT   NG    R +  +PRGRQI RTFNNIKITILCGFVT
Sbjct  1     MGPDSSFTAQKRGGGALPTTATP--NGG---RPSSVLPRGRQIQRTFNNIKITILCGFVT  55

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILVLRGTIG GNLASS ++ EN+ LI+ETNRILDEIRSD D DD      D F   N T+
Sbjct  56    ILVLRGTIGFGNLASSGSDAENANLIEETNRILDEIRSDADLDD-PDDPSDTFFHHNSTY  114

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             SLGPKIT WD  RK W  ++P FP+ + GKPRVLLVTGSPP PC+NP+GDHYLLK +KNK
Sbjct  115   SLGPKITTWDADRKFWLQKNPDFPNFIHGKPRVLLVTGSPPNPCDNPIGDHYLLKVIKNK  174

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCRIHGIEIVYN A++++EM G WAKLPLIR+LMLSHPE+EWIWWMDSDA FTDM FE
Sbjct  175   IDYCRIHGIEIVYNLAHLEKEMAGYWAKLPLIRKLMLSHPEVEWIWWMDSDALFTDMVFE  234

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             IP SKY+ HNLVIHGY DLLFDQKSW AL+TGSFLIRNCQW+LDLLDVWAPMGPKGP+RE
Sbjct  235   IPFSKYNDHNLVIHGYPDLLFDQKSWIALNTGSFLIRNCQWSLDLLDVWAPMGPKGPVRE  294

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTANLKGRP FEADDQSALIYLLMS+KDQWMD+VF+ENSYYLHGYWAGLVDRYEE
Sbjct  295   EAGKVLTANLKGRPAFEADDQSALIYLLMSQKDQWMDQVFIENSYYLHGYWAGLVDRYEE  354

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVL LYGF+H
Sbjct  355   MIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCMKSMERAFNFADNQVLKLYGFRH  414

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             +GLLSPNIKRIRNET  PL  VD+ D RHAKHES
Sbjct  415   KGLLSPNIKRIRNETDNPLQYVDQLDLRHAKHES  448



>ref|XP_009338860.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/450 (76%), Positives = 384/450 (85%), Gaps = 5/450 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATD---AMNGDARIRANPQVPRGRQISRTFNNIKITILCGF  232
             MGQD   +AQKR  +     T    + NG A  RA   +PRGRQI +TFNNIKITILCGF
Sbjct  1     MGQDSPFAAQKRTSSGGLPTTTTGTSANGRAG-RAYGALPRGRQIQKTFNNIKITILCGF  59

Query  233   VTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNE  412
             VTILVLRGTIGVGNL SS+A+  N  LI+ETNRIL EIRSD DP+DP+ +  +  ++PN 
Sbjct  60    VTILVLRGTIGVGNLGSSEADAVNQNLIEETNRILAEIRSDSDPNDPD-ELTETEMNPNI  118

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             T++LGPKI  WD++RK W   +P FPSSV GKPRVLLVTGSPP PC+NP+GDHYLLK +K
Sbjct  119   TYTLGPKIANWDKERKDWLRLNPDFPSSVNGKPRVLLVTGSPPKPCDNPIGDHYLLKVIK  178

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKIDYCR+HGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM 
Sbjct  179   NKIDYCRLHGIEIVYNLAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMV  238

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FEIPLSKYDSHNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLDVWAPMGPKGPI
Sbjct  239   FEIPLSKYDSHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPKGPI  298

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             REE+GK LTANLKGRP FEADDQSALIYLL+S+KDQWM+KV++ENSYYLHGYWAGLVDRY
Sbjct  299   REEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRY  358

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF
Sbjct  359   EEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGF  418

Query  1313  KHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             +HRGLLSP IKRIRNET  PL  VDR+D R
Sbjct  419   RHRGLLSPKIKRIRNETAAPLEFVDRFDIR  448



>gb|EYU35800.1| hypothetical protein MIMGU_mgv1a006038mg [Erythranthe guttata]
Length=460

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/457 (73%), Positives = 391/457 (86%), Gaps = 5/457 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKR-PGALPTTATDA--MNGDARIRANPQVPRGRQISRTFNNIKITILCGF  232
             MG +   SAQKR  G LPTT + A   +   R  +   +PRGRQ+++TFNNIKITI+CGF
Sbjct  1     MGSESTFSAQKRTSGTLPTTVSTANGGSRGGRSSSASLIPRGRQMNKTFNNIKITIICGF  60

Query  233   VTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNE  412
             VTILVLRGTIG+GNL S+++E E+  LI+ETNRIL EIRSDKDP DP+    ++FL  N 
Sbjct  61    VTILVLRGTIGLGNLVSTESEAESLHLIEETNRILAEIRSDKDPTDPD-DGPEKFLELNA  119

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             TFSLGP+I+ WDE RK W  ++P+FP+ V+GKPR++LVTGSPP PC+N +GDHYLLKG+K
Sbjct  120   TFSLGPRISTWDEDRKAWLQQNPQFPNYVRGKPRIMLVTGSPPNPCDNAIGDHYLLKGIK  179

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKIDYCRIHGIEIVYN A++D+EM G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM 
Sbjct  180   NKIDYCRIHGIEIVYNMAHLDKEMAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMV  239

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FE+P+SKY  +N+VIHGY DLLF+QKSW AL+TGSFL RNCQW+LDLLDVWAPMGPKGPI
Sbjct  240   FELPVSKYKDYNMVIHGYPDLLFEQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPKGPI  299

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             REE+G+ LTANLKGRP FEADDQSALIYLL+S+K++WM+KVF+ENS+YLHG+W GLVDRY
Sbjct  300   REETGRILTANLKGRPAFEADDQSALIYLLISQKERWMNKVFVENSFYLHGFWEGLVDRY  359

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVLNLYGF
Sbjct  360   EEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLNLYGF  419

Query  1313  KHRGLLSPNIKRIRNETTLPLPNVDRYDFRH-AKHES  1420
             +HRGL+SPNIKRIRNET  P  NVD +D RH A H S
Sbjct  420   RHRGLVSPNIKRIRNETVTPFVNVDHFDIRHSASHTS  456



>ref|XP_007209124.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
 gb|EMJ10323.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
Length=459

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/453 (74%), Positives = 382/453 (84%), Gaps = 3/453 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKR-PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MGQD   +AQKR  G LPT+ T         RA   +PRGRQI +TFNNIKITILCGFVT
Sbjct  1     MGQDSSFTAQKRSAGGLPTSTTGTSANGRAGRAYGSLPRGRQIQKTFNNIKITILCGFVT  60

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILVLRGTIGVGNL SS+A+  N  +I+ETNRIL EIRSD DP+DP+  +    ++PN T+
Sbjct  61    ILVLRGTIGVGNLGSSEADAVNQNIIEETNRILAEIRSDSDPNDPDELTQTE-INPNITY  119

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             +LGPKI  WD++R  W   +P FPS V GKPRVLLVTGSPP PC+NP+GDHYLLK +KNK
Sbjct  120   TLGPKIANWDKERNAWLQSNPEFPSLVNGKPRVLLVTGSPPKPCDNPIGDHYLLKVIKNK  179

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCR+HGIEIVYN A++D+E+ G WAKLPLIR+LMLSHPE+EWIWWMDSDA FTDM FE
Sbjct  180   IDYCRLHGIEIVYNLAHLDKELAGYWAKLPLIRKLMLSHPEVEWIWWMDSDALFTDMVFE  239

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             +PL KY+SHNLVIHGY DLLF+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPIRE
Sbjct  240   LPLFKYNSHNLVIHGYPDLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRE  299

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTANLKGRP FEADDQSALIYLL+S+KDQWM+KV++ENSYYLHGYWAGLVDRYEE
Sbjct  300   EAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEE  359

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF+H
Sbjct  360   MIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGFRH  419

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDF-RHAKH  1414
             RGLLSP IKRIRNET  PL +VD++D  RH  H
Sbjct  420   RGLLSPKIKRIRNETATPLESVDQFDIRRHPVH  452



>ref|XP_002514720.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
 gb|EEF47826.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
Length=454

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/438 (76%), Positives = 377/438 (86%), Gaps = 5/438 (1%)
 Frame = +2

Query  107   LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASS  286
             LPTTA   + G  R      +PRGRQI +TFNNIKITILCGFVTILVLRGTIG+G+L SS
Sbjct  20    LPTTANGRVVGGGR----SAMPRGRQIHKTFNNIKITILCGFVTILVLRGTIGIGSLTSS  75

Query  287   DAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVW  466
             DAE  N  LI+ETNRIL EIRSD DP DP+ +  +  ++PN T++LGPKI  WD++RKVW
Sbjct  76    DAEAINQNLIEETNRILAEIRSDNDPTDPD-EPPELEINPNVTYTLGPKIENWDQERKVW  134

Query  467   FDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSA  646
              +++P FPS V GKPR+LL+TGSPP+PC+NP+GDHYLLK +KNKIDYCRIHGIEIVYN A
Sbjct  135   RNQNPEFPSFVNGKPRILLLTGSPPSPCDNPIGDHYLLKAIKNKIDYCRIHGIEIVYNMA  194

Query  647   NMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGY  826
             ++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTDM FEIPLSKYD HNLVIHGY
Sbjct  195   HLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDAMFTDMVFEIPLSKYDKHNLVIHGY  254

Query  827   QDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEF  1006
              DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMGPKG IREE+GK LTANLKGRP F
Sbjct  255   PDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGTIREEAGKILTANLKGRPAF  314

Query  1007  EADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPF  1186
             EADDQSALIYLL+S+KDQWMDKV++EN YYLHGYWAGLVDRYEE+MEKYHPG GDERWPF
Sbjct  315   EADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMMEKYHPGLGDERWPF  374

Query  1187  VTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETT  1366
             VTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVL LYGF HRGLLSP IKRIRNET 
Sbjct  375   VTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETV  434

Query  1367  LPLPNVDRYDFRHAKHES  1420
              PL  VD++D RH+ H S
Sbjct  435   TPLEYVDQFDIRHSVHGS  452



>ref|XP_007037433.1| Galactosyl transferase GMA12/MNN10 family protein [Theobroma 
cacao]
 gb|EOY21934.1| Galactosyl transferase GMA12/MNN10 family protein [Theobroma 
cacao]
Length=460

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/456 (74%), Positives = 383/456 (84%), Gaps = 8/456 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA-----LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILC  226
             MGQD   + QKR        LPTT  +A  G  R R  P +PRGRQI +TFNNIKITILC
Sbjct  1     MGQDN-FTPQKRSSTGGGGGLPTT-NNAAAGGGRNRGFPAMPRGRQIHKTFNNIKITILC  58

Query  227   GFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSP  406
             GFVTILVLRGTIGVGNL SS+AE  N  LI+ETNRIL EIRSD DP DP+ +  +  ++P
Sbjct  59    GFVTILVLRGTIGVGNLGSSEAEAVNQNLIEETNRILAEIRSDSDPTDPD-EPPETEINP  117

Query  407   NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKG  586
             N TF+LGPKI+ WD+QRKVW  ++P FP+ V GK R+LLVTGSPP PC+N +GDHYLLK 
Sbjct  118   NITFTLGPKISDWDQQRKVWISQNPEFPNFVNGKARILLVTGSPPNPCDNAIGDHYLLKS  177

Query  587   VKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTD  766
             +KNKIDYCR+HGIEIVYN A++DRE+ G WAKLPLIRRLMLSHPE+EWIWWMDSDAFFTD
Sbjct  178   IKNKIDYCRLHGIEIVYNMAHLDRELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDAFFTD  237

Query  767   MAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKG  946
             M FEIPLSKYD +NLV+HGY DL+F+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKG
Sbjct  238   MVFEIPLSKYDKYNLVVHGYPDLMFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKG  297

Query  947   PIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVD  1126
              IREE+GK LTANLKGRP FEADDQSALIYLL+S+KDQWMDKVFLEN YYLHGYWAGLVD
Sbjct  298   VIREEAGKVLTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFLENQYYLHGYWAGLVD  357

Query  1127  RYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLY  1306
             RYEE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C++SM+RAFNFADNQVL LY
Sbjct  358   RYEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLRSMQRAFNFADNQVLKLY  417

Query  1307  GFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKH  1414
             GF+HRGLL PNIKRIRNET  PL  VD+ D R + H
Sbjct  418   GFRHRGLLGPNIKRIRNETVTPLEIVDQLDIRRSVH  453



>ref|XP_011047184.1| PREDICTED: putative glycosyltransferase 5 [Populus euphratica]
Length=453

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/451 (73%), Positives = 379/451 (84%), Gaps = 5/451 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MGQD   +AQKR               A  RA   +PRGRQI++TFNNIKITILCGFVTI
Sbjct  1     MGQDN-FAAQKRASGGGGAGGLPTTPPANGRARTMLPRGRQINKTFNNIKITILCGFVTI  59

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             LVLRGT+G+G+L+SSDA+  N  LI+ETNRIL EIRSD +PDDP     +  ++PN T+S
Sbjct  60    LVLRGTVGIGSLSSSDADAVNQNLIEETNRILKEIRSDSEPDDP----AESEINPNATYS  115

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             LGPKI+ W+++RKVW  ++P FP+ V GKPR+LL+TGSPP+PC+NP+GDHYLLK +KNKI
Sbjct  116   LGPKISNWNQERKVWLSQNPEFPNFVNGKPRILLLTGSPPSPCDNPIGDHYLLKAIKNKI  175

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCRIHGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPEIEWIWWMDSDA FTDM FEI
Sbjct  176   DYCRIHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEIEWIWWMDSDAMFTDMVFEI  235

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             PLSKYD HNLVIHGY DLLF+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKG IREE
Sbjct  236   PLSKYDKHNLVIHGYPDLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGAIREE  295

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
             +GK LTANLKGRP FEADDQSALIYLL+S+KDQWMDKV++EN YYLHGYWAGLVDRYEE+
Sbjct  296   AGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEM  355

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             MEKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C++SMERAFNFADNQVL LYGF HR
Sbjct  356   MEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVEQCMRSMERAFNFADNQVLKLYGFGHR  415

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRHAKH  1414
             GLLSP IKRIRNET  PL  VD++D R   H
Sbjct  416   GLLSPKIKRIRNETVTPLEYVDQFDIRRPVH  446



>ref|XP_006374450.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
 gb|ERP52247.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
Length=453

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/453 (73%), Positives = 380/453 (84%), Gaps = 5/453 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MGQD   +AQKR               A  RA   +PRGRQI++TFNNIKITILCGFVTI
Sbjct  1     MGQDN-FAAQKRASGGGGAGGLPTTTTANGRARTMLPRGRQINKTFNNIKITILCGFVTI  59

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             LVLRGT+G+G+L+SSDA+  N  LI+ETNRIL EIRSD +PDDP     +  ++PN T+S
Sbjct  60    LVLRGTVGIGSLSSSDADAVNQNLIEETNRILKEIRSDSEPDDP----AESEINPNVTYS  115

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             LGPKI+ W+++RKVW  ++P FP+ V GKPR+LL+TGSPP+PC+NP+GDHYLLK +KNKI
Sbjct  116   LGPKISNWNQERKVWLSQNPEFPNFVNGKPRILLLTGSPPSPCDNPIGDHYLLKAIKNKI  175

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCRIHGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPEIEWIWWMDSDA FTDM FEI
Sbjct  176   DYCRIHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEIEWIWWMDSDAMFTDMVFEI  235

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             PLSKYD HNLVIHGY DLLF+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKG IREE
Sbjct  236   PLSKYDKHNLVIHGYPDLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGAIREE  295

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
             +GK LTANLKGRP FEADDQSALIYLL+S+K QWMDKV++EN YYLHGYWAGLVDRYEE+
Sbjct  296   AGKILTANLKGRPAFEADDQSALIYLLLSQKAQWMDKVYIENQYYLHGYWAGLVDRYEEM  355

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             MEKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C++SMERAFNFADNQVL LYGF HR
Sbjct  356   MEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVEQCMRSMERAFNFADNQVLKLYGFGHR  415

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GLLSP IKRIRNET  PL  VD++D R   H++
Sbjct  416   GLLSPKIKRIRNETVTPLEYVDQFDIRRPVHDN  448



>gb|EPS66800.1| hypothetical protein M569_07974, partial [Genlisea aurea]
Length=449

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/450 (73%), Positives = 378/450 (84%), Gaps = 1/450 (0%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MG +G  SAQKR   +  T++ A  G  R R    +PRGRQI +TFNN+KIT+LCGFVTI
Sbjct  1     MGSEGAFSAQKRTSTVLPTSSAAAKGGNRGRTASVLPRGRQIHKTFNNVKITLLCGFVTI  60

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             LVLRGTIG+ NL SS AE EN  LI+ETNRIL EIRS KDP DP+    + F +PN TFS
Sbjct  61    LVLRGTIGL-NLVSSGAEAENRHLIEETNRILAEIRSGKDPSDPDDGQEEVFFNPNMTFS  119

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             LGPKI  WDE RKVWF ++P+FPS V G+PR LLVTGSPP PC+NP+GDHYLLK  KNKI
Sbjct  120   LGPKIASWDEDRKVWFRKNPQFPSHVNGRPRTLLVTGSPPNPCDNPIGDHYLLKSTKNKI  179

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCRIHGIEIVYN A++D+EM G WAKLPLIRRLML HPE+EWIWWMDSDA FTDM+F I
Sbjct  180   DYCRIHGIEIVYNMAHLDKEMAGYWAKLPLIRRLMLFHPEVEWIWWMDSDALFTDMSFRI  239

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             P+SKY+ +NLVIHGY DLLFDQ SW AL+TGSFL RNCQW+LDLLD WAPMGPKGP+REE
Sbjct  240   PVSKYEGYNLVIHGYPDLLFDQHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPVREE  299

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
              GK LTANLKGRP FEADDQSALIYLL++EKD+WMDKV++ENSYYLHG+W GLVDRYEE+
Sbjct  300   MGKILTANLKGRPAFEADDQSALIYLLLTEKDKWMDKVYVENSYYLHGFWEGLVDRYEEM  359

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
              E   PG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVL+LYGFKH+
Sbjct  360   AENNRPGSGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLDLYGFKHK  419

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRHAK  1411
             GL+SPN+KR+RN+T  PL NV+++D RH+K
Sbjct  420   GLVSPNVKRVRNDTVEPLENVEKFDIRHSK  449



>ref|XP_010089891.1| Putative glycosyltransferase 5 [Morus notabilis]
 gb|EXB38551.1| Putative glycosyltransferase 5 [Morus notabilis]
Length=459

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/456 (73%), Positives = 385/456 (84%), Gaps = 5/456 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKRPG--ALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFV  235
             MGQ+   SAQKR G  ALPTT T+A +     R    +PRGRQI +TFNNIKITILCGFV
Sbjct  1     MGQES-FSAQKRTGGIALPTTTTNASSAPNGRRFGAALPRGRQIQKTFNNIKITILCGFV  59

Query  236   TILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNET  415
             TILVLRGTIGVG+L  +D +  N  +I+ETNRIL EIRSD DP+DP+  + +  ++PN T
Sbjct  60    TILVLRGTIGVGSLGGADNDAANREIIEETNRILAEIRSDGDPNDPDDLA-ESEINPNAT  118

Query  416   FSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKN  595
             ++LGPKI  WD++R+ W D +P FP+ V GKPR+LLVTGSPP PC+NP+GDHYLLK +KN
Sbjct  119   YTLGPKIAHWDQERRNWLDSNPEFPNFVNGKPRILLVTGSPPKPCDNPIGDHYLLKAIKN  178

Query  596   KIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAF  775
             KIDYCR+HGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM F
Sbjct  179   KIDYCRLHGIEIVYNIAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVF  238

Query  776   EIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIR  955
             EIPL KYDS+NLV+HGY DL+F+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPIR
Sbjct  239   EIPLKKYDSYNLVVHGYPDLMFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIR  298

Query  956   EESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYE  1135
             EE+G+ LTANLKGRP FEADDQSALIYLL+S+KDQWM K FLENSYYLHGYWAGLVDRYE
Sbjct  299   EEAGRILTANLKGRPAFEADDQSALIYLLLSQKDQWMGKGFLENSYYLHGYWAGLVDRYE  358

Query  1136  EVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFK  1315
             E++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF+
Sbjct  359   EMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLQLYGFR  418

Query  1316  HRGLLSPNIKRIRNETTLPLPNVDRYDF-RHAKHES  1420
             HRGLLSP IKRIRNET  PL  VD++D  RH  HES
Sbjct  419   HRGLLSPKIKRIRNETVNPLEFVDKFDIRRHPVHES  454



>ref|XP_008393187.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=460

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/450 (75%), Positives = 382/450 (85%), Gaps = 5/450 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATD---AMNGDARIRANPQVPRGRQISRTFNNIKITILCGF  232
             MGQD   +AQKR  +     T    + NG A  RA   +PRGRQI +TFNNIKITILCGF
Sbjct  1     MGQDSPFAAQKRTSSGGLPTTTTGTSANGRAG-RAYGALPRGRQIQKTFNNIKITILCGF  59

Query  233   VTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNE  412
             VTILVLRGTIGVGNL SS+A+  N  LI+ETNRIL EIRSD DP+DP+ +  +  ++PN 
Sbjct  60    VTILVLRGTIGVGNLGSSEADAVNQNLIEETNRILAEIRSDSDPNDPD-ELTETEINPNI  118

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             T++LGPKI  WD++RK W   +P FPS V GKPRVLLVTGSPP PC+NP+GDHYLLK +K
Sbjct  119   TYTLGPKIANWDKERKDWLRLNPDFPSLVNGKPRVLLVTGSPPKPCDNPIGDHYLLKVIK  178

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKIDYCR+HGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM 
Sbjct  179   NKIDYCRLHGIEIVYNLAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMV  238

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FEIPLSKYDSHNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLDVWAPMGPKGPI
Sbjct  239   FEIPLSKYDSHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPKGPI  298

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             REE+GK LTANLKGRP FEADDQSALIYLL+S+KD WM+KV++ENSYYLHGYWAGLVDRY
Sbjct  299   REEAGKILTANLKGRPAFEADDQSALIYLLLSQKDXWMEKVYVENSYYLHGYWAGLVDRY  358

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF
Sbjct  359   EEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGF  418

Query  1313  KHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             +HRGLLSP IKRIRNET  PL  VD++D R
Sbjct  419   RHRGLLSPKIKRIRNETAAPLEFVDQFDIR  448



>ref|XP_009339134.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/450 (75%), Positives = 379/450 (84%), Gaps = 5/450 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATD---AMNGDARIRANPQVPRGRQISRTFNNIKITILCGF  232
             MGQD   +AQKR  +     T    + NG A  R    +PRGRQI +TFNNIKITILCGF
Sbjct  1     MGQDSPFAAQKRTSSGGLPTTTTGTSANGRAG-RGYGALPRGRQIQKTFNNIKITILCGF  59

Query  233   VTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNE  412
             VTILVLRGTIGVG+L SS+A+  N  LI+ETNRIL EIRSD DP+DP+ +  +  ++PN 
Sbjct  60    VTILVLRGTIGVGSLGSSEADAVNQNLIEETNRILAEIRSDSDPNDPD-ELTETEINPNI  118

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             T++LGPKI  WD +RK W   +P FPS V GKPRVLLVTGSPP PC+NP+GDHYLLK +K
Sbjct  119   TYTLGPKIANWDSERKDWLGSNPDFPSLVNGKPRVLLVTGSPPKPCDNPIGDHYLLKVIK  178

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKIDYCR+HGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM 
Sbjct  179   NKIDYCRLHGIEIVYNLAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMV  238

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FEIPLSKY SHNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPI
Sbjct  239   FEIPLSKYASHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPI  298

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             REE+GK LTANLKGRP FEADDQSALIYLL+S+KDQWM+KV++ENSYYLHGYWAGLVDRY
Sbjct  299   REEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRY  358

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF
Sbjct  359   EEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGF  418

Query  1313  KHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             +HRGLLSP IKRIRNET  PL  VD+YD R
Sbjct  419   RHRGLLSPKIKRIRNETAAPLEFVDQYDIR  448



>ref|XP_008374566.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=458

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/450 (75%), Positives = 377/450 (84%), Gaps = 7/450 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATD---AMNGDARIRANPQVPRGRQISRTFNNIKITILCGF  232
             MGQD   +AQKR  +     T    + NG A  R    +PRGRQI +TFNNIKITILCGF
Sbjct  1     MGQDSPFAAQKRTSSGGLPTTTTGTSANGRAG-RGYGALPRGRQIQKTFNNIKITILCGF  59

Query  233   VTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNE  412
             VTILVLRGTIGVG+L SS+ +  N  LI+ETNRIL EIRSD DP+DP+  +     +PN 
Sbjct  60    VTILVLRGTIGVGSLGSSETDAVNQNLIEETNRILAEIRSDSDPNDPDELTET---NPNI  116

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             T++LGPKI  WD +RK W   +P FPS V GKPRVLLVTGSPP PC+NP+GDHYLLK +K
Sbjct  117   TYTLGPKIANWDAERKDWLRSNPDFPSLVNGKPRVLLVTGSPPKPCDNPIGDHYLLKVIK  176

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKIDYCR+HGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM 
Sbjct  177   NKIDYCRLHGIEIVYNLAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMV  236

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FEIPLSKYDSHNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPI
Sbjct  237   FEIPLSKYDSHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPI  296

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             REE+GK LTANLKGRP FEADDQSALIYLL+S+KDQWM+KV++ENSYYLHGYWAGLVDRY
Sbjct  297   REEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRY  356

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF
Sbjct  357   EEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGF  416

Query  1313  KHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             +HRGLLSP IKRIRNET  PL  VD+YD R
Sbjct  417   RHRGLLSPKIKRIRNETAAPLEFVDQYDIR  446



>ref|XP_004301136.1| PREDICTED: putative glycosyltransferase 5-like [Fragaria vesca 
subsp. vesca]
Length=456

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/449 (74%), Positives = 375/449 (84%), Gaps = 5/449 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MGQDG +SAQKR     +         A   + P +PRGRQI +TFNNIKITILCGFVTI
Sbjct  1     MGQDGFISAQKRTS---SGLPTTAAAAAGRASRPALPRGRQIQKTFNNIKITILCGFVTI  57

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDP-EGQSGDRFLS-PNET  415
             LVLRGTIGVGNL +SDA+  N  LI+ETNRIL EIRSD DP+DP E  +G +  S PN T
Sbjct  58    LVLRGTIGVGNLGTSDADAVNQNLIEETNRILAEIRSDADPNDPDEFLNGTQITSNPNVT  117

Query  416   FSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKN  595
             ++LGPKI  WD +R  W   +P FP+ V GKPRVLLVTGSPP PC+NP+GDHYLLK +KN
Sbjct  118   YTLGPKIGNWDSERAQWLQSNPEFPNLVNGKPRVLLVTGSPPKPCDNPIGDHYLLKAIKN  177

Query  596   KIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAF  775
             KIDYCR+HGIEIVYN A++D E+ G WAKLPLIR+LMLSHPE+EWIWWMDSDA FTDM F
Sbjct  178   KIDYCRLHGIEIVYNLAHLDMELAGYWAKLPLIRKLMLSHPEVEWIWWMDSDAMFTDMVF  237

Query  776   EIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIR  955
             EIPL+KYD HNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPIR
Sbjct  238   EIPLAKYDEHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIR  297

Query  956   EESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYE  1135
             EE+GK LTANLKGRP FEADDQSALIYLL+S+KD WM+KVF+ENSYYLHGYWAGLVDRYE
Sbjct  298   EEAGKVLTANLKGRPAFEADDQSALIYLLLSQKDLWMEKVFVENSYYLHGYWAGLVDRYE  357

Query  1136  EVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFK  1315
             E++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF+
Sbjct  358   EMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGFR  417

Query  1316  HRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             HRGLLSP IKRIRNE+  PL  VD++D R
Sbjct  418   HRGLLSPKIKRIRNESATPLEAVDKFDIR  446



>gb|EYU23497.1| hypothetical protein MIMGU_mgv1a006132mg [Erythranthe guttata]
Length=456

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/454 (72%), Positives = 385/454 (85%), Gaps = 5/454 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKRPG-ALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MG +   S QKR   ALPTT + A        A+    RG+Q+S+T NNIKIT+LCGFVT
Sbjct  2     MGTESTFSPQKRTSTALPTTTSAAAGVARGRAAS----RGKQLSKTLNNIKITVLCGFVT  57

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILVLRGTIG+G+L+SS+A+ EN  + +ETNRIL EIRSDKDP DP+    ++F +PN TF
Sbjct  58    ILVLRGTIGLGSLSSSEADAENQHMAEETNRILAEIRSDKDPTDPDDDQPEQFFNPNMTF  117

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             +LGPKIT WD+ RKVW  ++P+FP  V GKPR+LLVTGSPP PC+N +GDHYLLKG+KNK
Sbjct  118   ALGPKITTWDQDRKVWLQQNPQFPQHVNGKPRILLVTGSPPGPCDNAIGDHYLLKGIKNK  177

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCRIHGIEIVYN A++D+EM G W+KLPL+RRLMLSHPE+EWIWWMDSDA FTDM FE
Sbjct  178   IDYCRIHGIEIVYNMAHLDKEMAGYWSKLPLLRRLMLSHPEVEWIWWMDSDALFTDMVFE  237

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             IP+ KY+ HN+VIHGY DLLFDQKSW AL+TGSFL RNCQW+LDL D WAPMGPKGP+R+
Sbjct  238   IPVKKYEDHNMVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLFDAWAPMGPKGPVRD  297

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTA LKGRP FEADDQSALIYLL+S+KD+WM+KVF+ENSYYLHG+W GLVDRYEE
Sbjct  298   EAGKVLTAYLKGRPAFEADDQSALIYLLISQKDRWMEKVFVENSYYLHGFWEGLVDRYEE  357

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVLNLYGF+H
Sbjct  358   MIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLNLYGFRH  417

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             RGL+SPNIKRIRNET  PL NVDR+D RH+ H S
Sbjct  418   RGLVSPNIKRIRNETVAPLVNVDRFDIRHSAHHS  451



>ref|XP_004138178.1| PREDICTED: putative glycosyltransferase 5-like [Cucumis sativus]
 gb|KGN63689.1| hypothetical protein Csa_1G009930 [Cucumis sativus]
Length=460

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/458 (73%), Positives = 391/458 (85%), Gaps = 9/458 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA----LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MG D + SAQKR G+    LPTTA  A NG  R R  P +PRGRQI +TFNNIKITILCG
Sbjct  1     MGIDNI-SAQKRTGSGGNGLPTTAATA-NG-RRSRGFPGIPRGRQIQKTFNNIKITILCG  57

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPN  409
             FVTILVLRGTIG+GNL SS+A+  N  +I+ETNRIL EIRSD DP+DP+  +  + ++PN
Sbjct  58    FVTILVLRGTIGIGNLGSSEADAVNQNIIEETNRILAEIRSDSDPNDPDDPAETQ-INPN  116

Query  410   ETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
              T++LGPKI  W+++RKVW D++P FP+ V  + R+LLVTGSPP PC+NP+GDHYLLK +
Sbjct  117   VTYTLGPKIVNWNQERKVWLDQNPEFPNYVNKRARILLVTGSPPKPCDNPIGDHYLLKAI  176

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCR+HGIEI+YN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM
Sbjct  177   KNKIDYCRLHGIEIIYNIAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDM  236

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
              FEIPL KYD++NLV+HGY DL+F+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGP
Sbjct  237   VFEIPLEKYDNYNLVVHGYPDLMFNQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGP  296

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
             IREE+GK LTANLKGRP FEADDQSALIYLL+S+KDQWMDKVFLENSYYLHGYWAGLVDR
Sbjct  297   IREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDR  356

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             YEE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYG
Sbjct  357   YEEMVEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYG  416

Query  1310  FKHRGLLSPNIKRIRNETTLPLPNVDRYDF-RHAKHES  1420
             F+HRGLLSP IKRIRNET  PL +VD+ D  RH  H++
Sbjct  417   FRHRGLLSPKIKRIRNETATPLESVDQNDIRRHVLHQT  454



>ref|XP_010537379.1| PREDICTED: putative glycosyltransferase 5 [Tarenaya hassleriana]
Length=455

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/455 (73%), Positives = 380/455 (84%), Gaps = 10/455 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP-----GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILC  226
             MGQ+G   A KRP     G LPTT T         R    +PRGRQI +TFNNIKITILC
Sbjct  1     MGQEGS-PAHKRPSGVGGGGLPTTVT---ANGDGGRGRGLLPRGRQIQKTFNNIKITILC  56

Query  227   GFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSP  406
             GFVTILVLRGTIGVGNL SS+A+  N  LI+ETNRIL EIRSD DP D + ++ +  + P
Sbjct  57    GFVTILVLRGTIGVGNLGSSNADAVNQNLIEETNRILAEIRSDSDPTDLD-EALEAGIDP  115

Query  407   NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKG  586
             N T++LGPKIT WD QRKVW D++P FP+SV GK R+LL+TGSPP PC+NP+GDHYLLK 
Sbjct  116   NVTYTLGPKITNWDSQRKVWLDQNPEFPNSVNGKARILLLTGSPPKPCDNPIGDHYLLKS  175

Query  587   VKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTD  766
             VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTD
Sbjct  176   VKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTD  235

Query  767   MAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKG  946
             + FEIPLSKY +HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW+LDLLD WAPMGPKG
Sbjct  236   ILFEIPLSKYANHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKG  295

Query  947   PIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVD  1126
             PIR+E+GK LTANLKGRP FEADDQSALIY+L+S+KD+WM+KVF+EN YYLHG+W GLVD
Sbjct  296   PIRDEAGKILTANLKGRPAFEADDQSALIYILLSQKDKWMEKVFVENQYYLHGFWEGLVD  355

Query  1127  RYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLY  1306
             RYEE++EKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL LY
Sbjct  356   RYEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLY  415

Query  1307  GFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAK  1411
             GF HRGLLSP IKRIRNET  PL  VD++D R A+
Sbjct  416   GFGHRGLLSPKIKRIRNETVTPLEYVDKFDIRRAE  450



>ref|XP_004154959.1| PREDICTED: putative glycosyltransferase 3-like [Cucumis sativus]
Length=460

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/451 (74%), Positives = 386/451 (86%), Gaps = 8/451 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPG----ALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MG D + SAQKR G    +LPTTA  A     R R  P +PRGRQI +TFNNIKITILCG
Sbjct  1     MGLDNI-SAQKRAGGGGNSLPTTAATA--NARRSRGFPGIPRGRQIQKTFNNIKITILCG  57

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPN  409
             FVTILVLRGTIG+GNL SS+A+  N  +I+ETNRIL EIRSD DP+DP+  +  + ++PN
Sbjct  58    FVTILVLRGTIGIGNLGSSEADAVNQNIIEETNRILAEIRSDGDPNDPDDPAETQ-INPN  116

Query  410   ETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
              T++LGPKI  W+++RKVW D++P FP+ V  + R+LLVTGSPP PC+NP+GDHYLLK +
Sbjct  117   VTYTLGPKIVNWNQERKVWLDQNPEFPNYVNKRARILLVTGSPPKPCDNPIGDHYLLKAI  176

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCR+HGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM
Sbjct  177   KNKIDYCRLHGIEIVYNIAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDM  236

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
              FEIPL KYD++NLV+HGY DL+F+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGP
Sbjct  237   VFEIPLEKYDNYNLVVHGYPDLMFNQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGP  296

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
             IREE+GK LTANLKGRP FEADDQSALIYLL+S+KDQWMDKVFLENSYYLHGYWAGLVDR
Sbjct  297   IREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDR  356

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             YEE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYG
Sbjct  357   YEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYG  416

Query  1310  FKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             F+HRGLLSP IKRIRNETT PL +VD+ + R
Sbjct  417   FRHRGLLSPKIKRIRNETTTPLDSVDQNNIR  447



>ref|XP_004154960.1| PREDICTED: putative glycosyltransferase 5-like [Cucumis sativus]
Length=460

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/458 (73%), Positives = 390/458 (85%), Gaps = 9/458 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA----LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MG D + SAQKR G+    LPTTA  A NG  R R  P +PRGRQI +TFNNIKITILCG
Sbjct  1     MGIDNI-SAQKRTGSGGNGLPTTAATA-NG-RRSRGFPGIPRGRQIQKTFNNIKITILCG  57

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPN  409
             FVTILVLRGTIG+GNL SS+A+  N  +I+ETNRIL EIRSD DP+DP+  +  + ++PN
Sbjct  58    FVTILVLRGTIGIGNLGSSEADAVNQNIIEETNRILAEIRSDSDPNDPDDPAETQ-INPN  116

Query  410   ETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
              T+ LGPKI  W+++RKVW D++P FP+ V  + R+LLVTGSPP PC+NP+GDHYLLK +
Sbjct  117   VTYKLGPKIVNWNQERKVWLDQNPEFPNYVNKRARILLVTGSPPKPCDNPIGDHYLLKAI  176

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCR+HGIEI+YN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM
Sbjct  177   KNKIDYCRLHGIEIIYNIAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDM  236

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
              FEIPL KYD++NLV+HGY DL+F+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGP
Sbjct  237   VFEIPLEKYDNYNLVVHGYPDLMFNQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGP  296

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
             IREE+GK LTANLKGRP FEADDQSALIYLL+S+KDQWMDKVFLENSYYLHGYWAGLVDR
Sbjct  297   IREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDR  356

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             YEE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYG
Sbjct  357   YEEMVEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYG  416

Query  1310  FKHRGLLSPNIKRIRNETTLPLPNVDRYDF-RHAKHES  1420
             F+HRGLLSP IKRIRNET  PL +VD+ D  RH  H++
Sbjct  417   FRHRGLLSPKIKRIRNETATPLESVDQNDIRRHVLHQT  454



>ref|XP_004138179.1| PREDICTED: putative glycosyltransferase 3-like [Cucumis sativus]
 gb|KGN63690.1| hypothetical protein Csa_1G010930 [Cucumis sativus]
Length=460

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/451 (74%), Positives = 386/451 (86%), Gaps = 8/451 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPG----ALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MG D + SAQKR G    +LPTTA  A     R R  P +PRGRQI +TFNNIKITILCG
Sbjct  1     MGLDNI-SAQKRAGGGGNSLPTTAATA--NARRSRGFPGIPRGRQIQKTFNNIKITILCG  57

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPN  409
             FVTILVLRGTIG+GNL SS+A+  N  +I+ETNRIL EIRSD DP+DP+  +  + ++PN
Sbjct  58    FVTILVLRGTIGIGNLGSSEADAVNQNIIEETNRILAEIRSDGDPNDPDDPAETQ-INPN  116

Query  410   ETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
              T++LGPKI  W+++RKVW D++P FP+ V  + R+LLVTGSPP PC+NP+GDHYLLK +
Sbjct  117   VTYTLGPKIVNWNQERKVWLDQNPEFPNYVNKRARILLVTGSPPKPCDNPIGDHYLLKAI  176

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCR+HGIEI+YN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM
Sbjct  177   KNKIDYCRLHGIEIIYNIAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDM  236

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
              FEIPL KYD++NLV+HGY DL+F+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGP
Sbjct  237   VFEIPLEKYDNYNLVVHGYPDLMFNQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGP  296

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
             IREE+GK LTANLKGRP FEADDQSALIYLL+S+KDQWMDKVFLENSYYLHGYWAGLVDR
Sbjct  297   IREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDR  356

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             YEE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYG
Sbjct  357   YEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYG  416

Query  1310  FKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             F+HRGLLSP IKRIRNETT PL +VD+ + R
Sbjct  417   FRHRGLLSPKIKRIRNETTTPLDSVDQNNIR  447



>gb|KDP31286.1| hypothetical protein JCGZ_11662 [Jatropha curcas]
Length=422

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/418 (76%), Positives = 364/418 (87%), Gaps = 1/418 (0%)
 Frame = +2

Query  167   VPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEI  346
             +PRGRQI +TFNNIKITILCGFVTILVLRGTIG+GNL SSDAE  N  LI+ETNRIL EI
Sbjct  1     MPRGRQIHKTFNNIKITILCGFVTILVLRGTIGIGNLTSSDAEAINQNLIEETNRILAEI  60

Query  347   RSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLV  526
             RSD DP DP  +  +  ++PN T++LGPKI  WD++RKVW  ++  FP+ V GK R+LL+
Sbjct  61    RSDDDPTDP-NELPEPEINPNVTYTLGPKIANWDQERKVWLTQNAEFPNFVNGKARILLL  119

Query  527   TGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLM  706
             TGSPP PC+NP+GDHYLLK +KNKIDYCRIHGIEIVYN A++D+E+ G WAKLP+IRRLM
Sbjct  120   TGSPPKPCDNPIGDHYLLKAIKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMIRRLM  179

Query  707   LSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLI  886
             LSHPE+EWIWWMDSDA FTDM FEIPLSKY+ HNLVIHGY DLLF+QKSW AL+TGSFL 
Sbjct  180   LSHPEVEWIWWMDSDAMFTDMVFEIPLSKYNKHNLVIHGYPDLLFEQKSWIALNTGSFLF  239

Query  887   RNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWM  1066
             RNCQW+LDLLD WAPMGPKGPIREE+G+ LTANLKGRP FEADDQSALIYLL+S+KDQWM
Sbjct  240   RNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFEADDQSALIYLLLSQKDQWM  299

Query  1067  DKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEK  1246
             DKV++EN YYLHGYWAGLVDRYEE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+
Sbjct  300   DKVYIENQYYLHGYWAGLVDRYEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVEQ  359

Query  1247  CVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             C++SMERAFNFADNQVL LYGF HRGLLSP IKRIRNET  PL  VD++D R   H++
Sbjct  360   CLRSMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETATPLEYVDQFDVRRPVHQN  417



>ref|XP_007155288.1| hypothetical protein PHAVU_003G188200g [Phaseolus vulgaris]
 gb|ESW27282.1| hypothetical protein PHAVU_003G188200g [Phaseolus vulgaris]
Length=445

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/453 (72%), Positives = 380/453 (84%), Gaps = 13/453 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MGQD         G LPT+       +AR RA   +PRGRQI +TFNNIKITILCGFVTI
Sbjct  1     MGQDNHHKRSTSAG-LPTS-------NARGRAT-ALPRGRQIQKTFNNIKITILCGFVTI  51

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             LVLRGTIGV NL SSDAE  N  L++ETNRIL EIRSD DP+DP+ Q      +PN TF+
Sbjct  52    LVLRGTIGV-NLGSSDAEAVNQNLVEETNRILAEIRSDADPNDPDDQQP---FNPNATFT  107

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             LGPKI  WD++R+ W  ++P +P+S++GKPR+LL+TGSPP PC+NP+GDHYLLK +KNKI
Sbjct  108   LGPKIDNWDQERQNWLSQNPEYPNSIRGKPRILLLTGSPPKPCDNPIGDHYLLKSIKNKI  167

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCR+HGIEIVYN A++D E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDAFFTDM FE+
Sbjct  168   DYCRLHGIEIVYNLAHLDVELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDAFFTDMVFEL  227

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             P+ KYD++NLV+HGY DLLFDQKSW A++TGSFL RNCQW+LDLLD WAPMGPKGP+REE
Sbjct  228   PMPKYDAYNLVLHGYPDLLFDQKSWIAVNTGSFLFRNCQWSLDLLDDWAPMGPKGPVREE  287

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
             +GK LTANLKGRP FEADDQSALIYLL+S+K++WMDKVFLENS+YLHGYWAGLVDRYEE+
Sbjct  288   AGKILTANLKGRPAFEADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEM  347

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             +EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERA+NFADNQVL LYGF+HR
Sbjct  348   IEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAYNFADNQVLKLYGFRHR  407

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GLLSP IKRIRNET  PL  VD++D R    ES
Sbjct  408   GLLSPKIKRIRNETVTPLEFVDQFDIRRHSTES  440



>ref|XP_010108713.1| Putative glycosyltransferase 3 [Morus notabilis]
 gb|EXC20024.1| Putative glycosyltransferase 3 [Morus notabilis]
Length=449

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/457 (72%), Positives = 388/457 (85%), Gaps = 20/457 (4%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MG DG  +A KR G+ P +A  A++  AR RA   +PRGRQI +TFNN+KIT+LCGFVTI
Sbjct  1     MGHDGS-TALKR-GSSPFSAA-ALSTTARSRA---LPRGRQIKKTFNNVKITLLCGFVTI  54

Query  242   LVLRGTIGVGNL---ASSDAEVENSFLIDETNRILDEIRSDKDPDD----PEGQSGDRFL  400
             LVLRGTIG+G+L   +S DAEV    + +ETNRIL EIRSD DP D    PE ++     
Sbjct  55    LVLRGTIGIGSLTGSSSDDAEVRR--IAEETNRILAEIRSDSDPTDADEPPESET-----  107

Query  401   SPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLL  580
             +PN T+SLGPKI+ WD++RK+W  ++P+FP+ + GK RVLLVTGSPP PC+NP+GDHYLL
Sbjct  108   NPNATYSLGPKISNWDQERKLWLGQNPQFPNYINGKARVLLVTGSPPKPCDNPIGDHYLL  167

Query  581   KGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFF  760
             K +KNKIDYCRIHGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA F
Sbjct  168   KSIKNKIDYCRIHGIEIVYNLAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALF  227

Query  761   TDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGP  940
             TDM FEIPLSKY+ +N+VIHGY DLLF+QKSW AL+TGSFL RNCQW+LDLLD WAPMGP
Sbjct  228   TDMVFEIPLSKYNDYNMVIHGYPDLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGP  287

Query  941   KGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGL  1120
             KGPIREE+GK LTANLKGRP FEADDQSALIYLL+S+KDQWM+KV++ENSY+LHGYWAGL
Sbjct  288   KGPIREEAGKILTANLKGRPAFEADDQSALIYLLISKKDQWMNKVYVENSYFLHGYWAGL  347

Query  1121  VDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLN  1300
             VDRYEE+MEKYHPG GDERWPFVTHFVGCK CGS GD+ V++C+KSMERAFNFADNQVLN
Sbjct  348   VDRYEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYGDYAVDRCLKSMERAFNFADNQVLN  407

Query  1301  LYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAK  1411
             LYGF HRGLLSP I+RIRNETT PL  VD++D RH++
Sbjct  408   LYGFSHRGLLSPKIRRIRNETTTPLEFVDQFDIRHSQ  444



>ref|XP_002318600.2| hypothetical protein POPTR_0012s07020g [Populus trichocarpa]
 gb|EEE96820.2| hypothetical protein POPTR_0012s07020g [Populus trichocarpa]
Length=452

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/457 (73%), Positives = 379/457 (83%), Gaps = 18/457 (4%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA------LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITIL  223
             MG D   +AQKR         LPTT  +        RA     +GRQI++TFNN+KITIL
Sbjct  1     MGLDN-FTAQKRASGGGAAGGLPTTTANG-------RARTMFSQGRQINKTFNNVKITIL  52

Query  224   CGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLS  403
             CGFVTILVLRGTIG+GNL SSDA+  N  LI+ETNR+L EIRSD DPDDP        ++
Sbjct  53    CGFVTILVLRGTIGIGNLGSSDADAVNKNLIEETNRVLKEIRSDSDPDDPADLE----IN  108

Query  404   PNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLK  583
             PN T++LGPKI+ WD++RKVW  ++P FP+ V GKPR+LL+TGSPP PC+N +GDHYLLK
Sbjct  109   PNATYTLGPKISNWDQERKVWLSQNPEFPNFVNGKPRILLLTGSPPNPCDNSIGDHYLLK  168

Query  584   GVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFT  763
             G+KNKIDYCRIHGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPEIEWIWW+DSDA FT
Sbjct  169   GIKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEIEWIWWLDSDAMFT  228

Query  764   DMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPK  943
             DM F+IPLSKYD HNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMGPK
Sbjct  229   DMVFQIPLSKYDKHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPK  288

Query  944   GPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLV  1123
             GPIREE+GK LTANLKGRP FEADDQSALIYLL+S+KDQWMDKV++EN YYLHGYWAGLV
Sbjct  289   GPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLV  348

Query  1124  DRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNL  1303
             DRYEE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C++SMERAFNFADNQVLNL
Sbjct  349   DRYEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLRSMERAFNFADNQVLNL  408

Query  1304  YGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKH  1414
             YGF HRGLLSP IKRIRNET  PL  VD++D R   H
Sbjct  409   YGFGHRGLLSPKIKRIRNETVTPLEYVDQFDIRRPVH  445



>ref|XP_010258249.1| PREDICTED: putative glycosyltransferase 5 [Nelumbo nucifera]
Length=455

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/453 (74%), Positives = 387/453 (85%), Gaps = 12/453 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA----LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQ+G  +A KR GA    +PTT  + ++G    RA P +PRGRQI +TFNN+KITILCG
Sbjct  1     MGQEG-FTAIKRGGAGGGSIPTT--NRLSGG---RAFPGIPRGRQIHKTFNNLKITILCG  54

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPN  409
             FVTILVLRGTIGVGNL  SDAE EN  LI+ETNRIL EIRSD DP DP+  + +  ++PN
Sbjct  55    FVTILVLRGTIGVGNLGGSDAEAENQNLIEETNRILAEIRSDGDPSDPD-DTAEVEINPN  113

Query  410   ETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
              T++LGPKI+ WDE+RK W DR+P FP+ + GK R+LLVTGSPP PC+NP+GDHYLLK +
Sbjct  114   VTYTLGPKISNWDEERKAWLDRNPEFPNYINGKARILLVTGSPPNPCDNPIGDHYLLKAI  173

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCRIHGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM
Sbjct  174   KNKIDYCRIHGIEIVYNLAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDM  233

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
              FEIPLSKY+ +N V+HGY DL+F+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGP
Sbjct  234   VFEIPLSKYNDYNFVVHGYPDLMFEQKSWIALNTGSFLFRNCQWSLDLLDDWAPMGPKGP  293

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
             IR+E+GK LTANLKGRP FEADDQSALIYLL+S+K +WM+KVFLENSYYLHGYWAGLVDR
Sbjct  294   IRDEAGKILTANLKGRPAFEADDQSALIYLLISKK-EWMNKVFLENSYYLHGYWAGLVDR  352

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             YEE+MEKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVL LYG
Sbjct  353   YEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLKLYG  412

Query  1310  FKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHA  1408
             F+HRGLLSP IKRIRNET  PL  VD++D R +
Sbjct  413   FRHRGLLSPKIKRIRNETATPLEFVDQFDIRRS  445



>ref|XP_010258549.1| PREDICTED: putative glycosyltransferase 5 isoform X2 [Nelumbo 
nucifera]
Length=457

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/450 (73%), Positives = 384/450 (85%), Gaps = 9/450 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP---GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGF  232
             MGQDG ++ ++     GALPTT  + ++G    R    +PRGRQI +TFNN+KIT+LCG 
Sbjct  1     MGQDGFMAFKRSGAGGGALPTT--NRLSGG---RPPSGIPRGRQIQKTFNNLKITVLCGL  55

Query  233   VTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNE  412
             VTILVLRGTIGVGNL  SDAE EN  LI+ETNRIL EIRSD DP DP+  + +  ++PN 
Sbjct  56    VTILVLRGTIGVGNLGGSDAEAENQNLIEETNRILAEIRSDGDPSDPDDPA-ETEINPNI  114

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             T++LGPKI+ W+E+RK W + +P FP+ + GK R+LLVTGSPP PC+NP+GDHYLLK +K
Sbjct  115   TYTLGPKISNWNEERKAWLNNNPEFPNYISGKARILLVTGSPPNPCDNPIGDHYLLKAIK  174

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKIDYCRIHGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM 
Sbjct  175   NKIDYCRIHGIEIVYNLAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMV  234

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FEIPLSKY+ +NLVIHGY DLLF+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPI
Sbjct  235   FEIPLSKYNGYNLVIHGYPDLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPI  294

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             R+E+GK LTANLKGRP FEADDQSALIYLLMS+K++WM+KVF+ENSYYLHGYWAGLVDRY
Sbjct  295   RDEAGKILTANLKGRPAFEADDQSALIYLLMSKKEEWMNKVFIENSYYLHGYWAGLVDRY  354

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVL LYGF
Sbjct  355   EEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLKLYGF  414

Query  1313  KHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             +HRGLLSP IKRIRNET  PL  VD++D R
Sbjct  415   RHRGLLSPKIKRIRNETATPLEFVDQFDIR  444



>ref|XP_010258542.1| PREDICTED: putative glycosyltransferase 5 isoform X1 [Nelumbo 
nucifera]
Length=461

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/450 (73%), Positives = 384/450 (85%), Gaps = 9/450 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP---GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGF  232
             MGQDG ++ ++     GALPTT  + ++G    R    +PRGRQI +TFNN+KIT+LCG 
Sbjct  1     MGQDGFMAFKRSGAGGGALPTT--NRLSGG---RPPSGIPRGRQIQKTFNNLKITVLCGL  55

Query  233   VTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNE  412
             VTILVLRGTIGVGNL  SDAE EN  LI+ETNRIL EIRSD DP DP+  + +  ++PN 
Sbjct  56    VTILVLRGTIGVGNLGGSDAEAENQNLIEETNRILAEIRSDGDPSDPDDPA-ETEINPNI  114

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             T++LGPKI+ W+E+RK W + +P FP+ + GK R+LLVTGSPP PC+NP+GDHYLLK +K
Sbjct  115   TYTLGPKISNWNEERKAWLNNNPEFPNYISGKARILLVTGSPPNPCDNPIGDHYLLKAIK  174

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKIDYCRIHGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM 
Sbjct  175   NKIDYCRIHGIEIVYNLAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMV  234

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FEIPLSKY+ +NLVIHGY DLLF+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPI
Sbjct  235   FEIPLSKYNGYNLVIHGYPDLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPI  294

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             R+E+GK LTANLKGRP FEADDQSALIYLLMS+K++WM+KVF+ENSYYLHGYWAGLVDRY
Sbjct  295   RDEAGKILTANLKGRPAFEADDQSALIYLLMSKKEEWMNKVFIENSYYLHGYWAGLVDRY  354

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVL LYGF
Sbjct  355   EEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLKLYGF  414

Query  1313  KHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             +HRGLLSP IKRIRNET  PL  VD++D R
Sbjct  415   RHRGLLSPKIKRIRNETATPLEFVDQFDIR  444



>ref|XP_010030248.1| PREDICTED: putative glycosyltransferase 5 [Eucalyptus grandis]
 gb|KCW83656.1| hypothetical protein EUGRSUZ_B00540 [Eucalyptus grandis]
Length=449

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/451 (73%), Positives = 375/451 (83%), Gaps = 7/451 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MGQDG    ++   +LPTTA +  +  +RI     +PRGRQI +TFNNIKIT+LCGFVTI
Sbjct  1     MGQDGFTPQKRTSSSLPTTAANGRHA-SRI-----IPRGRQIQKTFNNIKITLLCGFVTI  54

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             LVLRGTIGVGNL SSDA+  N  LI+ETNRIL EIRSD DP D      +  ++ N T++
Sbjct  55    LVLRGTIGVGNLGSSDADAVNQNLIEETNRILAEIRSDSDPID-PDDPPEAEINLNVTYA  113

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             LGPKI+ WD  RK W + +P FPS V GKPR+LL+TGS P PC+N +GDHYLLK VKNKI
Sbjct  114   LGPKISTWDTDRKNWLESNPEFPSHVNGKPRILLLTGSQPNPCDNAIGDHYLLKAVKNKI  173

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCRIHGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTDM FEI
Sbjct  174   DYCRIHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTDMVFEI  233

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             PLSKYD HNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPIR+E
Sbjct  234   PLSKYDKHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRDE  293

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
             +GK LTANLKGRP FEADDQSALIYLL+S+KD+WMDKVF+ENSYYLHGYW GLV+RYEE+
Sbjct  294   AGKILTANLKGRPAFEADDQSALIYLLISQKDKWMDKVFVENSYYLHGYWLGLVERYEEM  353

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             +EKYHPG GDERWPFVTHFVGCK CGS GD+PVEKC+ SMERAFNFADNQVL LYGF+HR
Sbjct  354   IEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVEKCLGSMERAFNFADNQVLKLYGFRHR  413

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRHAKH  1414
             GLLSP I+RIRNET  PL  VD++D R   H
Sbjct  414   GLLSPKIRRIRNETVTPLEFVDQFDIRRPVH  444



>ref|XP_002887538.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH63797.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/458 (72%), Positives = 379/458 (83%), Gaps = 10/458 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP----GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQDG   A KRP    G LPTT     NG  R      +PRGRQ+ +TFNNIKITILCG
Sbjct  1     MGQDGS-PAHKRPSGSGGGLPTTT--VTNGGGRGGRGGLLPRGRQMQKTFNNIKITILCG  57

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDD-PEGQSGDRFLSP  406
             FVTILVLRGTIGVGNL SS A+  N  +I+ETNRIL EIRSD DP D  E Q GD  ++P
Sbjct  58    FVTILVLRGTIGVGNLGSSSADAVNQNIIEETNRILAEIRSDSDPTDLDEPQEGD--MNP  115

Query  407   NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKG  586
             N T+ LGPKIT WD QRKVW +++P FPS+V GK R+LL+TGSPP PC+NP+GDHYLLK 
Sbjct  116   NATYVLGPKITDWDSQRKVWLNQNPEFPSTVNGKARILLLTGSPPKPCDNPIGDHYLLKS  175

Query  587   VKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTD  766
             VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTD
Sbjct  176   VKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTD  235

Query  767   MAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKG  946
             + F+IPL++Y+ HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW+LDLLD WAPMGPKG
Sbjct  236   ILFQIPLARYEKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKG  295

Query  947   PIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVD  1126
             PIR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W GLVD
Sbjct  296   PIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVD  355

Query  1127  RYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLY  1306
             RYEE++EKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL LY
Sbjct  356   RYEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLY  415

Query  1307  GFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GF HRGLLSP IKRIRNET  PL  VD++D R  + E+
Sbjct  416   GFSHRGLLSPKIKRIRNETVTPLEFVDKFDIRRTQVET  453



>ref|XP_011072798.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum]
Length=475

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/457 (71%), Positives = 382/457 (84%), Gaps = 8/457 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKR-PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MG +   SAQKR  G LPTT   A    AR RA   +PRGRQ+++T+NN+KITILCGFVT
Sbjct  24    MGSESTFSAQKRNTGVLPTTTATA----ARGRAASTLPRGRQMNKTYNNVKITILCGFVT  79

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILV RGTIG+ NL S++AE EN  LI+ET RIL EIRSD  P DP  +  + +L  N TF
Sbjct  80    ILVFRGTIGISNLVSTEAEAENQHLIEETKRILAEIRSD--PTDP-NEGLEEYLELNATF  136

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
              LGP+I+ WD+ RKVW  ++P+FP+ V G+PR+LLVTGS P PC+N VGDHYLLK +KNK
Sbjct  137   RLGPRISTWDKDRKVWLRKNPKFPNYVNGRPRILLVTGSRPNPCDNAVGDHYLLKALKNK  196

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCRIHGIEIVYN A++D+EM G WAKLPL+RRLMLSHPE+EWIWWMDSDAFFTDM F 
Sbjct  197   IDYCRIHGIEIVYNMAHLDKEMAGYWAKLPLLRRLMLSHPEVEWIWWMDSDAFFTDMVFR  256

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             IP+ KY  +N+VIHGYQDLLF+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPIR+
Sbjct  257   IPVMKYRDYNMVIHGYQDLLFNQKSWIALNTGSFLFRNCQWSLDLLDSWAPMGPKGPIRD  316

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTANLKGRP FEADDQSALIYLL+++KDQWM+KVF+ENS+YLHG+W GLVDRYEE
Sbjct  317   EAGKILTANLKGRPTFEADDQSALIYLLITQKDQWMNKVFVENSFYLHGFWEGLVDRYEE  376

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSM+RAFN ADNQVLNLYGF+H
Sbjct  377   MIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMQRAFNLADNQVLNLYGFRH  436

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES*DY  1429
             RGL+SPNIKRIRNET  PL NVD++D RH  ++   Y
Sbjct  437   RGLVSPNIKRIRNETVPPLVNVDQFDIRHMVNQGSGY  473



>ref|XP_010428421.1| PREDICTED: putative glycosyltransferase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010428422.1| PREDICTED: putative glycosyltransferase 5 isoform X2 [Camelina 
sativa]
Length=459

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/458 (72%), Positives = 377/458 (82%), Gaps = 8/458 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP----GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQDG   A KRP    G LPTT      G         +PRGRQ+ +TFNNIKITILCG
Sbjct  1     MGQDGS-PAHKRPSGSGGGLPTTTVANGGGRGGGGRGGLLPRGRQMQKTFNNIKITILCG  59

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDD-PEGQSGDRFLSP  406
             FVTILVLRGTIGVGNL SS A+  N  +I+ETNRIL EIRSD DP D  E Q GD  +SP
Sbjct  60    FVTILVLRGTIGVGNLGSSSADAVNQNIIEETNRILAEIRSDSDPTDLDEPQEGD--MSP  117

Query  407   NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKG  586
             N T+ LGPKIT WD QRKVW +++P FPS+V G+ R+LL+TGSPP PC+NP+GDHYLLK 
Sbjct  118   NATYVLGPKITDWDSQRKVWLNQNPEFPSTVNGRARILLLTGSPPKPCDNPIGDHYLLKS  177

Query  587   VKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTD  766
             VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTD
Sbjct  178   VKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTD  237

Query  767   MAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKG  946
             + F+IPL++Y+ HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW+LDLLD WAPMGPKG
Sbjct  238   ILFQIPLARYEKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKG  297

Query  947   PIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVD  1126
             PIR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W GLVD
Sbjct  298   PIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVD  357

Query  1127  RYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLY  1306
             RYEE++EKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL LY
Sbjct  358   RYEEMVEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLY  417

Query  1307  GFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GF HRGLLSP IKRIRNET  PL  VD++D R  + E+
Sbjct  418   GFGHRGLLSPKIKRIRNETVTPLEFVDKFDIRRTQVET  455



>gb|KEH31956.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=448

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/451 (72%), Positives = 377/451 (84%), Gaps = 11/451 (2%)
 Frame = +2

Query  68    QDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILV  247
             ++G L  +     LPTTAT++         N +  RGRQIS+TFNN+KITILCGFVTILV
Sbjct  4     ENGSLHNRSSSAVLPTTATNS---------NSKNRRGRQISKTFNNVKITILCGFVTILV  54

Query  248   LRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFSLG  427
             LRGTIGV NL SSD++  N  +I+ETNRI+ EIRSD DP D      + F +PN TF+LG
Sbjct  55    LRGTIGV-NLISSDSDAVNQNMIEETNRIIAEIRSDADPSD-PDDKDNTFFNPNATFTLG  112

Query  428   PKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDY  607
             PKI+ WD  RK W +++P +PS V+GK R+LL+TGSPP PC+NP+GDHYLLK +KNKIDY
Sbjct  113   PKISDWDSDRKAWLNQNPEYPSFVRGKARILLLTGSPPKPCDNPIGDHYLLKSIKNKIDY  172

Query  608   CRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPL  787
             CR+HGIEIVYN A++D E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDAFFTDM FE+PL
Sbjct  173   CRLHGIEIVYNMAHLDMELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDAFFTDMVFELPL  232

Query  788   SKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESG  967
             SKYD +NLVIHGY DLLF+QKSW A++TGSFL RNCQW+LDLLDVWAPMGPKGP+REE+G
Sbjct  233   SKYDDYNLVIHGYPDLLFEQKSWIAINTGSFLFRNCQWSLDLLDVWAPMGPKGPVREEAG  292

Query  968   KTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVME  1147
             K LTANLKGRP FEADDQSALIYLL+S+K++WMDKVFLENSYYLHGYWAGLVDRYEE++E
Sbjct  293   KILTANLKGRPAFEADDQSALIYLLLSKKEKWMDKVFLENSYYLHGYWAGLVDRYEEMIE  352

Query  1148  KYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGL  1327
             KYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF+HRGL
Sbjct  353   KYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGFRHRGL  412

Query  1328  LSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             LSP IKRIRNET  PL  VD++D R    ES
Sbjct  413   LSPKIKRIRNETVTPLEFVDQFDIRRHSTES  443



>ref|XP_010416293.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=457

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/458 (72%), Positives = 379/458 (83%), Gaps = 10/458 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP----GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQDG   A KRP    G LPTT   A NG  R      +PRGRQ+ +TFNNIKITILCG
Sbjct  1     MGQDGS-PAHKRPSGSGGGLPTTT--AANGGGRGGRGGLLPRGRQMQKTFNNIKITILCG  57

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDD-PEGQSGDRFLSP  406
             FVTILVLRGTIGVGNL SS A   N  +I+ETNRIL EIRSD DP D  E Q GD  ++P
Sbjct  58    FVTILVLRGTIGVGNLGSSSANAVNQNIIEETNRILAEIRSDSDPTDLDEPQEGD--MNP  115

Query  407   NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKG  586
             N T+ LGPKIT WD QRKVW +++P FPS+V G+ R+LL+TGSPP PC+NP+GDHYLLK 
Sbjct  116   NATYVLGPKITDWDSQRKVWLNQNPEFPSTVNGRARILLLTGSPPKPCDNPIGDHYLLKS  175

Query  587   VKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTD  766
             VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTD
Sbjct  176   VKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTD  235

Query  767   MAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKG  946
             + F+IPL++Y+ HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW+LDLLD WAPMGPKG
Sbjct  236   ILFQIPLARYEKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKG  295

Query  947   PIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVD  1126
             PIR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W GLVD
Sbjct  296   PIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVD  355

Query  1127  RYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLY  1306
             RYEE++EKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL LY
Sbjct  356   RYEEMVEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLY  415

Query  1307  GFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GF HRGLLSP IKRIRNET  PL  VD++D R  + E+
Sbjct  416   GFGHRGLLSPKIKRIRNETVTPLEFVDKFDIRRTQVET  453



>ref|XP_006300466.1| hypothetical protein CARUB_v10020269mg [Capsella rubella]
 gb|EOA33364.1| hypothetical protein CARUB_v10020269mg [Capsella rubella]
Length=457

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/458 (72%), Positives = 379/458 (83%), Gaps = 10/458 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP----GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQDG   A KRP    G LPTT     NG  R      +PRGRQ+ +TFNNIKITILCG
Sbjct  1     MGQDGS-PAHKRPSGSGGGLPTTTV--ANGGGRGGRGGLLPRGRQMQKTFNNIKITILCG  57

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDD-PEGQSGDRFLSP  406
             FVTILVLRGTIGVGNL SS A+  N  +I+ETNRIL EIRSD DP D  E Q GD  ++P
Sbjct  58    FVTILVLRGTIGVGNLGSSSADAVNQNIIEETNRILAEIRSDSDPTDLDEPQEGD--MNP  115

Query  407   NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKG  586
             N T+ LGPKIT WD QRKVW +++P FPS++ G+ R+LL+TGSPP PC+NP+GDHYLLK 
Sbjct  116   NATYVLGPKITDWDSQRKVWLNQNPEFPSTLNGRARILLLTGSPPKPCDNPIGDHYLLKS  175

Query  587   VKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTD  766
             VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTD
Sbjct  176   VKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTD  235

Query  767   MAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKG  946
             + F+IPL++Y+ HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW+LDLLD WAPMGPKG
Sbjct  236   ILFQIPLARYEKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKG  295

Query  947   PIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVD  1126
             PIR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W GLVD
Sbjct  296   PIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVD  355

Query  1127  RYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLY  1306
             RYEE++EKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL LY
Sbjct  356   RYEEMVEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLY  415

Query  1307  GFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GF HRGLLSP IKRIRNET  PL  VD++D R  + ES
Sbjct  416   GFGHRGLLSPKIKRIRNETVTPLEFVDKFDIRRTQVES  453



>ref|XP_010523024.1| PREDICTED: putative glycosyltransferase 3 [Tarenaya hassleriana]
Length=454

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/453 (72%), Positives = 373/453 (82%), Gaps = 16/453 (4%)
 Frame = +2

Query  62    MGQDGVLSAQKR------PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITIL  223
             MGQDG  + QKR         LPTT        A      ++ RG+QI +TFNNIKITIL
Sbjct  1     MGQDG-FTTQKRTSSGAGAAGLPTTT-------ANGGGGRRLQRGKQIQKTFNNIKITIL  52

Query  224   CGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLS  403
             CGFVTILVLRGTIG+ NL S +A+  N  LI+ETNRIL EIRSD DP DP+ +  +  L+
Sbjct  53    CGFVTILVLRGTIGI-NLGSPEADAVNQNLIEETNRILSEIRSDSDPTDPD-EPTESDLN  110

Query  404   PNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLK  583
              N T++LGPKIT WDEQRKVW  ++P FP+ V GKPR+LL+TGSPP PC+NP+GDHYLLK
Sbjct  111   LNMTYTLGPKITNWDEQRKVWLSQNPEFPNVVNGKPRILLLTGSPPKPCDNPIGDHYLLK  170

Query  584   GVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFT  763
              VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP++RRLMLSHPE+EWIWWMDSDA FT
Sbjct  171   SVKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMLRRLMLSHPEVEWIWWMDSDALFT  230

Query  764   DMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPK  943
             DM FEIPLSKY+ HNLVIHGY DLLF+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPK
Sbjct  231   DMVFEIPLSKYEKHNLVIHGYPDLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPK  290

Query  944   GPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLV  1123
             GPIREE+G+ LTANLKGRP FEADDQSALIYLL+S+KDQWMDKVF+EN YYLHG+W GLV
Sbjct  291   GPIREEAGRILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFVENQYYLHGFWEGLV  350

Query  1124  DRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNL  1303
             DRYEE+MEKYHPG GD RWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL L
Sbjct  351   DRYEEMMEKYHPGLGDGRWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKL  410

Query  1304  YGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             YGF HRGLLSP IKRIRNETT PL  V+R+D R
Sbjct  411   YGFGHRGLLSPKIKRIRNETTAPLEYVNRFDIR  443



>emb|CAN80739.1| hypothetical protein VITISV_027037 [Vitis vinifera]
Length=450

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/452 (74%), Positives = 382/452 (85%), Gaps = 8/452 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA-LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MG D   + QKR GA +PTT      G  R+     +PRGRQI +TFNNIKITILCGFVT
Sbjct  1     MGLDN-FTTQKRTGAGIPTTNGRPAGG--RLSG---LPRGRQIHKTFNNIKITILCGFVT  54

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILVLRGTIGVGNL  S  EVEN  LI+ETNRIL EIRSD DP D      +  ++PN T+
Sbjct  55    ILVLRGTIGVGNLGGSGGEVENQNLIEETNRILAEIRSDGDPXD-PDDPAESXINPNVTY  113

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             +LGPKIT W+E+RKVW DR+P FP+ V GK R+LLVTGSPP PC+NP+GDHYLLK +KNK
Sbjct  114   TLGPKITNWNEERKVWLDRNPEFPNFVNGKARILLVTGSPPNPCDNPIGDHYLLKSIKNK  173

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCRIHGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM FE
Sbjct  174   IDYCRIHGIEIVYNMAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVFE  233

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             IPLSKYD++NLV+HGY DL+F+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPIR+
Sbjct  234   IPLSKYDNYNLVVHGYPDLMFNQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRD  293

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTANLKGRP FEADDQSALIYLL+S+KD+WMDKVFLENSYYLHGYWAGLVDRYEE
Sbjct  294   EAGKILTANLKGRPAFEADDQSALIYLLISKKDEWMDKVFLENSYYLHGYWAGLVDRYEE  353

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C++SMERAFNFADNQVL LYGF+H
Sbjct  354   MIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLRSMERAFNFADNQVLKLYGFRH  413

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRHAKH  1414
             RGLLSP IKRIRNET  PL  VD++D R  +H
Sbjct  414   RGLLSPKIKRIRNETATPLEFVDQFDIRRPEH  445



>gb|KFK41883.1| hypothetical protein AALP_AA2G184600 [Arabis alpina]
Length=460

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/451 (73%), Positives = 371/451 (82%), Gaps = 6/451 (1%)
 Frame = +2

Query  62    MGQDGVLSAQKRP----GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQDG   A KRP    G LPTT T    G         +PRGRQ+ +TFNNIKITILCG
Sbjct  1     MGQDGS-PAHKRPSGSGGGLPTT-TVTNGGGRGGGGRGLLPRGRQMQKTFNNIKITILCG  58

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPN  409
             FVTILVLRGTIGVGNL SS A+  N  +I+ETNRIL EIRSD DP D +       ++ N
Sbjct  59    FVTILVLRGTIGVGNLGSSSADAVNQNIIEETNRILAEIRSDSDPTDLDDPQEMVMMNLN  118

Query  410   ETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
             ET+ LGPKI  WD QRKVW D++P FPSSV GK R+LL+TGSPP PC+NP+GDHYLLK V
Sbjct  119   ETYVLGPKIMDWDSQRKVWLDQNPEFPSSVNGKARILLLTGSPPKPCDNPIGDHYLLKSV  178

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTD+
Sbjct  179   KNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTDI  238

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
              F+IPL +Y+ HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW+LDLLD WAPMGPKGP
Sbjct  239   LFQIPLVRYEKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGP  298

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
             IR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W GLVDR
Sbjct  299   IRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDR  358

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             YEE+MEKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL LYG
Sbjct  359   YEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLYG  418

Query  1310  FKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             F HRGLLSP IKRIRNET  PL NVD++D R
Sbjct  419   FSHRGLLSPKIKRIRNETVTPLENVDKFDIR  449



>ref|XP_002284667.1| PREDICTED: putative glycosyltransferase 5 [Vitis vinifera]
Length=450

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/452 (74%), Positives = 382/452 (85%), Gaps = 8/452 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA-LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVT  238
             MG D   + QKR GA +PTT      G  R+     +PRGRQI +TFNNIKITILCGFVT
Sbjct  1     MGLDN-FTTQKRTGAGIPTTNGRPAGG--RLSG---LPRGRQIHKTFNNIKITILCGFVT  54

Query  239   ILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             ILVLRGTIGVGNL  S  EVEN  LI+ETNRIL EIRSD DP D      +  ++PN T+
Sbjct  55    ILVLRGTIGVGNLGGSGGEVENQNLIEETNRILAEIRSDGDPTD-PDDPAESEINPNVTY  113

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             +LGPKIT W+E+RKVW DR+P FP+ V GK R+LLVTGSPP PC+NP+GDHYLLK +KNK
Sbjct  114   TLGPKITNWNEERKVWLDRNPEFPNFVNGKARILLVTGSPPNPCDNPIGDHYLLKSIKNK  173

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCRIHGIEIVYN A++D+E+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM FE
Sbjct  174   IDYCRIHGIEIVYNMAHLDKELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVFE  233

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             IPLSKYD++NLV+HGY DL+F+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPIR+
Sbjct  234   IPLSKYDNYNLVVHGYPDLMFNQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRD  293

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTANLKGRP FEADDQSALIYLL+S+KD+WMDKVFLENSYYLHGYWAGLVDRYEE
Sbjct  294   EAGKILTANLKGRPAFEADDQSALIYLLISKKDEWMDKVFLENSYYLHGYWAGLVDRYEE  353

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C++SMERAFNFADNQVL LYGF+H
Sbjct  354   MIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLRSMERAFNFADNQVLKLYGFRH  413

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRHAKH  1414
             RGLLSP IKRIRNET  PL  VD++D R  +H
Sbjct  414   RGLLSPKIKRIRNETATPLEFVDQFDIRRPEH  445



>ref|XP_004500012.1| PREDICTED: putative glycosyltransferase 5-like [Cicer arietinum]
Length=452

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/450 (73%), Positives = 373/450 (83%), Gaps = 12/450 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKRP---GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGF  232
             MGQ+  L AQKR    G LPTT +   +   R      +PRGRQI +TFNNIKITILCGF
Sbjct  1     MGQENHL-AQKRTSSTGGLPTTTSTTTSSRNR-----NLPRGRQIQKTFNNIKITILCGF  54

Query  233   VTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNE  412
             VTILVLRGTIGV NL +S  +  N  +I+ETNRIL EIRSD DP D      + FLS NE
Sbjct  55    VTILVLRGTIGV-NLGTSQNDAVNQNVIEETNRILAEIRSDVDPSD--RNQTETFLSLNE  111

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             T++LGPKI  WD +RK W D +P +P+ V+GKPR+LL+TGSPP PC+NP+GDHYLLK +K
Sbjct  112   TYALGPKIRNWDSERKNWLDSNPEYPNFVRGKPRILLLTGSPPKPCDNPIGDHYLLKSIK  171

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKIDYCR+HGIEIVYN A++D E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDAFFTDM 
Sbjct  172   NKIDYCRLHGIEIVYNMAHLDMELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDAFFTDMV  231

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FE+P+SKY+ +N+VIHGY DLLF Q SW A++TGSFL RNCQW+LDLLD WAPMGPKGPI
Sbjct  232   FELPMSKYNDYNMVIHGYPDLLFQQNSWIAINTGSFLFRNCQWSLDLLDEWAPMGPKGPI  291

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             REE+GK LTANLKGRP FEADDQSALIYLL+S+KD+WMDKVFLENSYYLHGYWAGLVDRY
Sbjct  292   REEAGKILTANLKGRPAFEADDQSALIYLLLSKKDKWMDKVFLENSYYLHGYWAGLVDRY  351

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE+MEKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF
Sbjct  352   EEMMEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGF  411

Query  1313  KHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             +HRGLLSP IKRIRNET  PL  VD+ D R
Sbjct  412   RHRGLLSPKIKRIRNETVTPLEFVDQLDIR  441



>ref|NP_196389.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 sp|Q9LF80.1|GT3_ARATH RecName: Full=Putative glycosyltransferase 3; Short=AtGT3 [Arabidopsis 
thaliana]
 emb|CAC01676.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 dbj|BAB11451.1| alpha galactosyltransferase protein [Arabidopsis thaliana]
 gb|AAQ56808.1| At5g07720 [Arabidopsis thaliana]
 dbj|BAE99734.1| alpha galactosyltransferase protein [Arabidopsis thaliana]
 gb|AED91197.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AHL38639.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=457

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/455 (71%), Positives = 371/455 (82%), Gaps = 17/455 (4%)
 Frame = +2

Query  62    MGQDGVLSAQKR--------PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKIT  217
             MG++     QKR         G LPTT          +R  P  PRGRQI +TFNN+K+T
Sbjct  1     MGKEDGFRTQKRVSTASSAAAGVLPTTM-----ASGGVRRPP--PRGRQIQKTFNNVKMT  53

Query  218   ILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRF  397
             ILCGFVTILVLRGTIG+ N  +SDA+V N  +I+ETNR+L EIRSD DP D   +  D  
Sbjct  54    ILCGFVTILVLRGTIGI-NFGTSDADVVNQNIIEETNRLLAEIRSDSDPTD-SNEPPDSD  111

Query  398   LSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYL  577
             L  N T++LGPKIT WD++RK+W  ++P FPS + GK +VLL+TGSPP PC+NP+GDHYL
Sbjct  112   LDLNMTYTLGPKITNWDQKRKLWLTQNPDFPSFINGKAKVLLLTGSPPKPCDNPIGDHYL  171

Query  578   LKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAF  757
             LK VKNKIDYCRIHGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPEIEWIWWMDSDA 
Sbjct  172   LKSVKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEIEWIWWMDSDAL  231

Query  758   FTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMG  937
             FTDM FEIPLS+Y++HNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMG
Sbjct  232   FTDMVFEIPLSRYENHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMG  291

Query  938   PKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAG  1117
             PKGPIREE+GK LTANLKGRP FEADDQSALIYLL+S+K+ WM+KVF+EN YYLHG+W G
Sbjct  292   PKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKETWMEKVFVENQYYLHGFWEG  351

Query  1118  LVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVL  1297
             LVD+YEE+MEKYHPG GDERWPF+THFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL
Sbjct  352   LVDKYEEMMEKYHPGLGDERWPFITHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVL  411

Query  1298  NLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
              LYGF HRGLLSP IKRIRNETT PL  VDR+D R
Sbjct  412   KLYGFGHRGLLSPKIKRIRNETTFPLKFVDRFDIR  446



>ref|XP_006399253.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
 gb|ESQ40706.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
Length=454

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/453 (71%), Positives = 374/453 (83%), Gaps = 16/453 (4%)
 Frame = +2

Query  62    MGQDGVLSAQKR------PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITIL  223
             MG++     QKR       G LPTT   A +G  R       PRGRQI +TFNN+K+TIL
Sbjct  1     MGKEDGFKTQKRVSTASAAGVLPTTM--ASSGGRR------QPRGRQIQKTFNNVKMTIL  52

Query  224   CGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLS  403
             CGFVTILVLRGTIGV NL +SDA+  N  LI+ETNR+L EIRSD DP DP  +  D  L 
Sbjct  53    CGFVTILVLRGTIGV-NLRASDADTVNQNLIEETNRLLAEIRSDSDPTDP-NEPPDSDLE  110

Query  404   PNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLK  583
              N T++LGPKIT WD+QR++W  ++P FPS V GK RVLL+TGSPP PC+NP+GDHYLLK
Sbjct  111   LNMTYTLGPKITNWDQQREMWLTQNPDFPSFVNGKARVLLLTGSPPKPCDNPIGDHYLLK  170

Query  584   GVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFT  763
              VKNKIDYCRIHGIEIVYN A++D+E+ G WAKLP++RRLMLSHPEIEWIWWMDSDA FT
Sbjct  171   SVKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMLRRLMLSHPEIEWIWWMDSDALFT  230

Query  764   DMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPK  943
             DM FEIPLSKY++HNLVIHGY DLLF+QKSW AL+TGSFL RNCQW+LDLLD WAPMGPK
Sbjct  231   DMVFEIPLSKYENHNLVIHGYPDLLFEQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPK  290

Query  944   GPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLV  1123
             GPIREE+GK LTANLKGRP FEADDQSALIYLL+S+K++WM+KV++EN YYLHG+W GLV
Sbjct  291   GPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLV  350

Query  1124  DRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNL  1303
             D+YEE+++KYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERA+NFADNQVL L
Sbjct  351   DKYEEMIDKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAYNFADNQVLRL  410

Query  1304  YGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             YGF HRGLLSP IKRIRNETT PL  V+R+D R
Sbjct  411   YGFGHRGLLSPKIKRIRNETTFPLKYVNRFDIR  443



>ref|XP_010471529.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=460

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/459 (71%), Positives = 377/459 (82%), Gaps = 9/459 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP----GALPTTAT-DAMNGDARIRANPQVPRGRQISRTFNNIKITILC  226
             MGQDG   A KRP    G LPTT   +             +PRGRQ+ +TFNNIKITILC
Sbjct  1     MGQDGS-PAHKRPSGSGGGLPTTTVANGGGRGGGGGRGGLLPRGRQMQKTFNNIKITILC  59

Query  227   GFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDD-PEGQSGDRFLS  403
             GFVTILVLRGTIGVGNL S+ A+  N  +I+ETNRIL EIRSD DP D  E Q GD  ++
Sbjct  60    GFVTILVLRGTIGVGNLGSASADAVNQNIIEETNRILAEIRSDSDPTDLDEPQEGD--MN  117

Query  404   PNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLK  583
             PN T+ LGPKIT WD QRKVW +++P FPS+V G+ R+LL+TGSPP PC+NP+GDHYLLK
Sbjct  118   PNATYVLGPKITDWDSQRKVWLNQNPEFPSTVNGRARILLLTGSPPKPCDNPIGDHYLLK  177

Query  584   GVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFT  763
              VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FT
Sbjct  178   SVKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFT  237

Query  764   DMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPK  943
             D+ F+IPL++Y+ HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW+LDLLD WAPMGPK
Sbjct  238   DILFQIPLARYEKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPK  297

Query  944   GPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLV  1123
             GPIR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W GLV
Sbjct  298   GPIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLV  357

Query  1124  DRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNL  1303
             DRYEE++EKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL L
Sbjct  358   DRYEEMVEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKL  417

Query  1304  YGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             YGF HRGLLSP IKRIRNET  PL  VD++D R  + E+
Sbjct  418   YGFGHRGLLSPKIKRIRNETVTPLEFVDKFDIRRTQVET  456



>ref|XP_006390433.1| hypothetical protein EUTSA_v10018522mg [Eutrema salsugineum]
 gb|ESQ27719.1| hypothetical protein EUTSA_v10018522mg [Eutrema salsugineum]
Length=456

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/458 (71%), Positives = 377/458 (82%), Gaps = 11/458 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP----GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQDG   A KRP    G LPT+    +           +PRGRQ+ +TFNNIKITILCG
Sbjct  1     MGQDGS-PAHKRPSGSGGGLPTST---VANGGGRGGRGLLPRGRQMQKTFNNIKITILCG  56

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDD-PEGQSGDRFLSP  406
             FVTILVLRGTIGVGNL SS A+  N  +I+ETNRIL EIRSD DP D  E Q  D  ++P
Sbjct  57    FVTILVLRGTIGVGNLGSSSADAVNQNIIEETNRILAEIRSDSDPTDLDEPQETD--MNP  114

Query  407   NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKG  586
             N T++LGPKIT WD QRKVW +++P FPS+V G+ R+LL+TGSPP PC+NP+GDHYLLK 
Sbjct  115   NATYALGPKITNWDSQRKVWLNQNPEFPSTVNGRARILLLTGSPPKPCDNPIGDHYLLKS  174

Query  587   VKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTD  766
             VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTD
Sbjct  175   VKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTD  234

Query  767   MAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKG  946
             + F+IPL++Y+ HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW+LDLLD WAPMGPKG
Sbjct  235   ILFQIPLARYEKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKG  294

Query  947   PIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVD  1126
             PIR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W GLVD
Sbjct  295   PIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVD  354

Query  1127  RYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLY  1306
             RYEE++EKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL LY
Sbjct  355   RYEEMVEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLY  414

Query  1307  GFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GF HRGLLSP IKRIRNET  PL  VD++D R  + E+
Sbjct  415   GFGHRGLLSPKIKRIRNETVTPLEFVDKFDIRRTQAET  452



>emb|CAI11456.1| putative glycosyltransferase [Lotus japonicus]
Length=443

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/417 (76%), Positives = 365/417 (88%), Gaps = 2/417 (0%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRS  352
             RGRQI +TFNN+KITILCGFVTILVLRGTIGV NL+SSDA+  N  +I+ETNRIL EIRS
Sbjct  23    RGRQIQKTFNNVKITILCGFVTILVLRGTIGV-NLSSSDADAVNQNVIEETNRILAEIRS  81

Query  353   DKDPDDPEGQSG-DRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVT  529
             D DP DP+  +  + F SPN TF+LGPKITGWD QRK W D++P +P+ V+GK R+LL+T
Sbjct  82    DADPSDPDDAAAAETFFSPNATFTLGPKITGWDLQRKAWLDQNPEYPNFVRGKARILLLT  141

Query  530   GSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLML  709
             GSPP PC+NP+GDHYLLK +KNKIDYCR+HGIEIVYN A++D E+ G WAKLP+IRRLML
Sbjct  142   GSPPKPCDNPIGDHYLLKSIKNKIDYCRLHGIEIVYNLAHLDVELAGYWAKLPMIRRLML  201

Query  710   SHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIR  889
             SHPE+EWIWWMDSDAFFTDM FE+PLSKYD +NLV+HGY DLLF+QKSW A++TGSFL R
Sbjct  202   SHPEVEWIWWMDSDAFFTDMVFELPLSKYDDYNLVLHGYPDLLFEQKSWIAVNTGSFLFR  261

Query  890   NCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMD  1069
             NCQW+LDLLD WAPMGPKGP+REE+GK LTANLKGRP FEADDQSALIYLL+S+KD+WMD
Sbjct  262   NCQWSLDLLDAWAPMGPKGPVREEAGKVLTANLKGRPAFEADDQSALIYLLLSKKDKWMD  321

Query  1070  KVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKC  1249
             K FLENS+YLHGYWAGLVDRYEE++EKYHPG GDERWPFVTHFVGCK CGS GD+PVEKC
Sbjct  322   KTFLENSFYLHGYWAGLVDRYEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVEKC  381

Query  1250  VKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             + SMERAFNFADNQVL LYGF+HRGLLSP IKRIRNET  PL  VD++D R    ES
Sbjct  382   LSSMERAFNFADNQVLKLYGFRHRGLLSPKIKRIRNETVTPLEFVDQFDIRRHSSES  438



>ref|XP_009106103.1| PREDICTED: putative glycosyltransferase 5 [Brassica rapa]
Length=456

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/457 (71%), Positives = 376/457 (82%), Gaps = 11/457 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP----GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQDG   A KRP    G LPT+    ++          +PRGRQ+ +TFNNIKITILCG
Sbjct  1     MGQDGS-PAHKRPSGSGGGLPTST---VSNGGGRGGRGVLPRGRQMQKTFNNIKITILCG  56

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEG-QSGDRFLSP  406
             FVTILVLRGTIGVGNL SS A+  N  +I+ETNRIL EIRSD DP D +  Q  D  ++ 
Sbjct  57    FVTILVLRGTIGVGNLGSSSADAVNQNIIEETNRILAEIRSDSDPTDLDSPQEID--MNT  114

Query  407   NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKG  586
             NET++LGPKIT WD QRKVW +++P FPS+V GK R+LL+TGSPP PC+NP+GDHYLLK 
Sbjct  115   NETYALGPKITDWDSQRKVWLEQNPEFPSTVNGKARILLLTGSPPKPCDNPIGDHYLLKS  174

Query  587   VKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTD  766
             VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTD
Sbjct  175   VKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTD  234

Query  767   MAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKG  946
             + F+IPL +Y+ HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW+LDLLD WAPMGPKG
Sbjct  235   ILFQIPLVRYEKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKG  294

Query  947   PIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVD  1126
             PIR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W GLVD
Sbjct  295   PIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVD  354

Query  1127  RYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLY  1306
             RYEE+MEKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL LY
Sbjct  355   RYEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLY  414

Query  1307  GFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHE  1417
             GF HRGLLSP IKRIRNET  PL  VD++D R  + E
Sbjct  415   GFGHRGLLSPKIKRIRNETVTPLEFVDKFDIRRTEVE  451



>gb|KEH33442.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=453

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/417 (75%), Positives = 360/417 (86%), Gaps = 4/417 (1%)
 Frame = +2

Query  167   VPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEI  346
             +PRGRQI +TFNNIKITILCGFVTILVLRGTIGV NL +S  +  N+ +I+ETNRIL EI
Sbjct  34    LPRGRQIQKTFNNIKITILCGFVTILVLRGTIGV-NLGTSQNDAVNAAVIEETNRILAEI  92

Query  347   RSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLV  526
             RSD DP D      + F+S NET++LGPKI  WD +R  W D++  +P+ VKGKPR+LL+
Sbjct  93    RSDSDPSD--RNQTETFMSLNETYALGPKILNWDTERTSWLDKNREYPNFVKGKPRILLL  150

Query  527   TGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLM  706
             TGSPP PC+NP+GDHYLLK +KNKIDYCR+HGIEIVYN A++D E+ G WAKLP+IRRLM
Sbjct  151   TGSPPKPCDNPIGDHYLLKSIKNKIDYCRLHGIEIVYNMAHLDMELAGYWAKLPMIRRLM  210

Query  707   LSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLI  886
             LSHPE+EWIWWMDSDAFFTDM FE+P+SKY  +N+VIHGY DLLF+Q SW A++TGSFL 
Sbjct  211   LSHPEVEWIWWMDSDAFFTDMVFELPMSKYKDYNMVIHGYPDLLFEQNSWIAINTGSFLF  270

Query  887   RNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWM  1066
             RNCQW+LDLLD WAPMGPKGPIREE+GK LTANLKGRP FEADDQSALIYLL+S+KD+WM
Sbjct  271   RNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSKKDKWM  330

Query  1067  DKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEK  1246
             +KVFLENS+YLHGYWAGLVDRYEE+MEKYHPG GDERWPFVTHFVGCK CGS GD+PVE+
Sbjct  331   EKVFLENSFYLHGYWAGLVDRYEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVER  390

Query  1247  CVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHE  1417
             C+ SMERAFNFADNQVL LYGF+HRGLLSP IKRIRNET  PL  VD++D R  +HE
Sbjct  391   CLSSMERAFNFADNQVLKLYGFRHRGLLSPKIKRIRNETITPLEFVDQFDIRR-QHE  446



>ref|XP_003524717.1| PREDICTED: putative glycosyltransferase 5-like [Glycine max]
Length=447

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/453 (72%), Positives = 378/453 (83%), Gaps = 11/453 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MGQ+     +     LPT+       +AR R    +PRGRQI +TFNNIKITILCGFVTI
Sbjct  1     MGQENHHHKRSTGVGLPTS-------NARSRGGNALPRGRQIQKTFNNIKITILCGFVTI  53

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             LVLRGTIGV NL SSD +  N  LI+ETNRIL EIRSD DP DP+ Q   +F +PN+TF+
Sbjct  54    LVLRGTIGV-NLGSSDNDAVNQNLIEETNRILAEIRSDADPSDPDDQ---QFFNPNDTFT  109

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             LGPKI  WD +RK W  ++P +P+ V+GKPR+LL+TGSPP PC+NP+GDHYLLK +KNKI
Sbjct  110   LGPKIASWDTERKNWLHQNPEYPNFVRGKPRILLLTGSPPKPCDNPIGDHYLLKSIKNKI  169

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCR+HGIEIVYN A++D E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDAFFTDM FE+
Sbjct  170   DYCRLHGIEIVYNLAHLDVELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDAFFTDMVFEL  229

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             P+SKYD +NLV+HGY DLLF+QKSW A++TGSFL RNCQW+LDLLD WAPMGPKGP+REE
Sbjct  230   PMSKYDEYNLVLHGYPDLLFEQKSWIAVNTGSFLFRNCQWSLDLLDDWAPMGPKGPVREE  289

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
             +GK LTANLKGRP FEADDQSALIYLL+S+K++WMDKVFLENS+YLHGYWAGLVDRYEE+
Sbjct  290   AGKILTANLKGRPAFEADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEM  349

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             +EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF+HR
Sbjct  350   IEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGFRHR  409

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GLLSP IKRIRNET  PL  VD++D R    E+
Sbjct  410   GLLSPKIKRIRNETVSPLEFVDQFDIRRHSTEN  442



>ref|NP_177578.1| xyloglucan xylosyltransferase 5 [Arabidopsis thaliana]
 sp|Q9CA75.1|GT5_ARATH RecName: Full=Putative glycosyltransferase 5; Short=AtGT5 [Arabidopsis 
thaliana]
 gb|AAG52374.1|AC011765_26 putative alpha galactosyltransferase; 16168-17541 [Arabidopsis 
thaliana]
 gb|AAM13174.1| putative alpha galactosyltransferase [Arabidopsis thaliana]
 gb|AAP81802.1| At1g74380 [Arabidopsis thaliana]
 gb|AEE35584.1| xyloglucan xylosyltransferase 5 [Arabidopsis thaliana]
 gb|AHL38876.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=457

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/458 (72%), Positives = 375/458 (82%), Gaps = 10/458 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRP----GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQDG   A KRP    G LPTT      G         +PRGRQ+ +TFNNIKITILCG
Sbjct  1     MGQDGS-PAHKRPSGSGGGLPTTTLTNGGGRGGRGG--LLPRGRQMQKTFNNIKITILCG  57

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDD-PEGQSGDRFLSP  406
             FVTILVLRGTIGVGNL SS A+  N  +I+ETNRIL EIRSD DP D  E Q GD  ++P
Sbjct  58    FVTILVLRGTIGVGNLGSSSADAVNQNIIEETNRILAEIRSDSDPTDLDEPQEGD--MNP  115

Query  407   NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKG  586
             N T+ LGPKIT WD QRKVW +++P FPS+V GK R+LL+TGSPP PC+NP+GDHYLLK 
Sbjct  116   NATYVLGPKITDWDSQRKVWLNQNPEFPSTVNGKARILLLTGSPPKPCDNPIGDHYLLKS  175

Query  587   VKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTD  766
             VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDA FTD
Sbjct  176   VKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDALFTD  235

Query  767   MAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKG  946
             + F+IPL++Y  HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW+LDLLD WAPMGPKG
Sbjct  236   ILFQIPLARYQKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKG  295

Query  947   PIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVD  1126
             PIR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W GLVD
Sbjct  296   PIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVD  355

Query  1127  RYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLY  1306
             RYEE++EKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL LY
Sbjct  356   RYEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLY  415

Query  1307  GFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GF HRGLLSP IKRIRNET  PL  VD++D R    E+
Sbjct  416   GFSHRGLLSPKIKRIRNETVSPLEFVDKFDIRRTPVET  453



>ref|XP_002871288.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH47547.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/436 (73%), Positives = 362/436 (83%), Gaps = 9/436 (2%)
 Frame = +2

Query  101   GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLA  280
             G LPTT           R  P  PRGRQI +TFNN+K+TILCGFVTILVLRGTIGV N  
Sbjct  22    GVLPTTMASGAG-----RRPP--PRGRQIQKTFNNVKMTILCGFVTILVLRGTIGV-NFG  73

Query  281   SSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRK  460
             +SDA+V N  +I+ETNR+L EIRSD D  D   +  D  L  N T++LGPKIT WD+QRK
Sbjct  74    TSDADVVNQNIIEETNRLLAEIRSDSDLSD-SNEPPDSDLDLNMTYTLGPKITNWDQQRK  132

Query  461   VWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYN  640
             +W  ++P FPS V GK +VLL+TGSPP PC+NP+GDHYLLK VKNKIDYCRIHGIEIVYN
Sbjct  133   LWLTQNPDFPSFVNGKAKVLLLTGSPPKPCDNPIGDHYLLKSVKNKIDYCRIHGIEIVYN  192

Query  641   SANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIH  820
              A++D+E+ G WAKLP+IRRLMLSHPEIEWIWWMDSDA FTDM FEIPLS+Y++HNLVIH
Sbjct  193   MAHLDKELAGYWAKLPMIRRLMLSHPEIEWIWWMDSDALFTDMVFEIPLSRYENHNLVIH  252

Query  821   GYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRP  1000
             GY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMGPKGPIREE+GK LTANLKGRP
Sbjct  253   GYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGPIREEAGKILTANLKGRP  312

Query  1001  EFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERW  1180
              FEADDQSALIYLL+S+K+ WM+KVF+EN YYLHG+W GLVDRYEE++EKYHPG GDERW
Sbjct  313   AFEADDQSALIYLLLSQKETWMEKVFVENQYYLHGFWEGLVDRYEEMIEKYHPGLGDERW  372

Query  1181  PFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNE  1360
             PF+THFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL LYGF HRGLLSP IKRIRNE
Sbjct  373   PFITHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNE  432

Query  1361  TTLPLPNVDRYDFRHA  1408
             TT PL  V+R+D R  
Sbjct  433   TTFPLKFVNRFDIRRT  448



>emb|CDX99024.1| BnaC09g48110D [Brassica napus]
Length=454

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/454 (71%), Positives = 366/454 (81%), Gaps = 14/454 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKR-----PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILC  226
             MG++     QKR      G LPTT           R  P  PRG+QI +TFNN+K+TILC
Sbjct  1     MGKEDGFKTQKRVSTAASGVLPTTIATPGG-----RKPP--PRGKQIKKTFNNLKMTILC  53

Query  227   GFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSP  406
             G VTILVLRGTIGV N   SDA+  N  LI+ETNR+L EIRSD DP DP  +  D  L  
Sbjct  54    GLVTILVLRGTIGV-NFGKSDADAVNKNLIEETNRLLAEIRSDSDPTDPN-EPPDSDLDL  111

Query  407   NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKG  586
             N T++LGPKIT WD+QR  W  ++P FPSS+ GKPRVLL+TGSPP PC+NP+GDHYLLK 
Sbjct  112   NATYTLGPKITNWDQQRATWLTQNPNFPSSLAGKPRVLLLTGSPPKPCDNPIGDHYLLKS  171

Query  587   VKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTD  766
             VKNKIDYCRIHGIEIVYN A++D+E+ G WAKLP++RRLMLSHPEIEWIWWMDSDA FTD
Sbjct  172   VKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMLRRLMLSHPEIEWIWWMDSDALFTD  231

Query  767   MAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKG  946
             M FE+PLSKY++HNLVIHGY DLL+DQKSW AL+TGSFL RNCQW+LDLLD WAPMGPKG
Sbjct  232   MVFEVPLSKYENHNLVIHGYPDLLYDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKG  291

Query  947   PIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVD  1126
              IREE+GK LTA LKGRP FEADDQSALIYLL+SEKD+WM KVF+EN YYLHG+W GLVD
Sbjct  292   QIREEAGKVLTAYLKGRPAFEADDQSALIYLLLSEKDRWMGKVFVENQYYLHGFWEGLVD  351

Query  1127  RYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLY  1306
             RYEE+M+KYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSMERA+NFADNQ+L LY
Sbjct  352   RYEEMMDKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSMERAYNFADNQMLKLY  411

Query  1307  GFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHA  1408
             GF HRGLLSP IKRIRNET  PL  V+R+D R A
Sbjct  412   GFGHRGLLSPKIKRIRNETISPLKFVNRFDIRRA  445



>ref|XP_006287623.1| hypothetical protein CARUB_v10000835mg, partial [Capsella rubella]
 gb|EOA20521.1| hypothetical protein CARUB_v10000835mg, partial [Capsella rubella]
Length=485

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/455 (70%), Positives = 366/455 (80%), Gaps = 17/455 (4%)
 Frame = +2

Query  62    MGQDGVLSAQKR--------PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKIT  217
             MG+      QKR         G LPTT T         R        RQI +TFNN+K+T
Sbjct  29    MGKKDGFKTQKRVSTASSAAAGVLPTTMTSGGGRRPPPRG-------RQIQKTFNNVKMT  81

Query  218   ILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRF  397
             ILCGFVTILVLRGTIGV N  +S+A+  N  LI+ETNR+L EIRSD DP DP  +  D  
Sbjct  82    ILCGFVTILVLRGTIGV-NFGTSNADAVNQNLIEETNRLLAEIRSDSDPTDP-NEPPDSD  139

Query  398   LSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYL  577
             L  N T++LGPKIT WD+QRK+W  ++P FPS V GK +VLL+TGSPP PC+NP+GDHYL
Sbjct  140   LDLNMTYTLGPKITNWDQQRKLWLTQNPDFPSVVNGKAKVLLLTGSPPKPCDNPIGDHYL  199

Query  578   LKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAF  757
             LK VKNKIDYCRIHGIEIVYN A++D+E+ G WAKLP++RRLMLSHPEIEWIWWMDSDA 
Sbjct  200   LKSVKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMLRRLMLSHPEIEWIWWMDSDAL  259

Query  758   FTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMG  937
             FTDM FEIPLS+Y++HNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMG
Sbjct  260   FTDMVFEIPLSRYENHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMG  319

Query  938   PKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAG  1117
             PKGPIREE+GK LTANLKGRP FEADDQSALIYLL+S+KD WM KV++EN YYLHG+W G
Sbjct  320   PKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDTWMKKVYVENQYYLHGFWEG  379

Query  1118  LVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVL  1297
             LVDRYEE++EKYHPG GDERWPF+THFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL
Sbjct  380   LVDRYEEMIEKYHPGLGDERWPFITHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVL  439

Query  1298  NLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
              LYGF HRGLLSP IKR+RNETTLPL  V+R+D R
Sbjct  440   KLYGFGHRGLLSPKIKRVRNETTLPLKYVNRFDIR  474



>ref|XP_009104763.1| PREDICTED: putative glycosyltransferase 5 [Brassica rapa]
Length=457

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/407 (75%), Positives = 351/407 (86%), Gaps = 1/407 (0%)
 Frame = +2

Query  182   QISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKD  361
             Q+ +TFNNIKITILCGFVTILVLRGTIGVGNL SS A+  N  +I+ETNRIL EIRSD D
Sbjct  41    QMQKTFNNIKITILCGFVTILVLRGTIGVGNLGSSSADAVNQNIIEETNRILAEIRSDSD  100

Query  362   PDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPP  541
             P D EG   +  +S NET++LGPKIT WD QRKVW D++P FPS+V GK R+LL+TGSPP
Sbjct  101   PTDLEGPQ-ETEMSTNETYALGPKITDWDSQRKVWLDKNPEFPSTVNGKARILLLTGSPP  159

Query  542   TPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPE  721
              PC+NP+GDHYLLK VKNKIDYCR+HGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPE
Sbjct  160   KPCDNPIGDHYLLKSVKNKIDYCRLHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPE  219

Query  722   IEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQW  901
             +EWIWWMDSDA FTD+ F+IPL +Y+ HNLVIHGY DLLFDQKSW AL+TGSFL+RNCQW
Sbjct  220   VEWIWWMDSDALFTDILFQIPLVRYEKHNLVIHGYPDLLFDQKSWIALNTGSFLLRNCQW  279

Query  902   ALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFL  1081
             +LDLLD WAPMGPKGPIR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+
Sbjct  280   SLDLLDAWAPMGPKGPIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFV  339

Query  1082  ENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSM  1261
             EN YYLHG+W GLVD+YEE+MEKYHPG GDERWPFVTHFVGCK CGS  D+ VE+C+KSM
Sbjct  340   ENQYYLHGFWEGLVDKYEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVERCLKSM  399

Query  1262  ERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             ER FNFA NQVL LYGF HRGLLSP IKRIRNET  PL  VD++D R
Sbjct  400   ERTFNFACNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEFVDKFDIR  446



>ref|XP_010491391.1| PREDICTED: putative glycosyltransferase 3 [Camelina sativa]
Length=459

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/455 (71%), Positives = 369/455 (81%), Gaps = 15/455 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKR--------PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKIT  217
             MG++     QKR         G LPTT T +  G           RGRQI +TFNN+K+T
Sbjct  1     MGKEDRFKTQKRISTASSAVAGVLPTTMTSSGGGRRPPPP-----RGRQIQKTFNNVKMT  55

Query  218   ILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRF  397
             ILCGFVTILVLRGTIGV N  +SDA+  N  LI+ETNR+L EIRSD DP DP  +  D  
Sbjct  56    ILCGFVTILVLRGTIGV-NFGTSDADAVNQNLIEETNRLLAEIRSDSDPTDP-NEPPDSD  113

Query  398   LSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYL  577
             L  N T++LGPKIT WD++RK+W  ++P FPS V GK +VLL+TGSPP PC+NP+GDHYL
Sbjct  114   LDLNMTYTLGPKITNWDQKRKLWLTQNPSFPSVVNGKAKVLLLTGSPPKPCDNPIGDHYL  173

Query  578   LKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAF  757
             LK VKNKIDYCRIHGIEIVYN A++D+E+ G WAKLP++RRLMLSHPEIEWIWWMDSDA 
Sbjct  174   LKSVKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMLRRLMLSHPEIEWIWWMDSDAL  233

Query  758   FTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMG  937
             FTDM FEIPLS+Y++HNLVIHGY DLLFDQKSW AL+TGSFL RNC+W+LDLLD WAPMG
Sbjct  234   FTDMVFEIPLSRYENHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCEWSLDLLDAWAPMG  293

Query  938   PKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAG  1117
             PKGPIREE+GK LTA LKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W G
Sbjct  294   PKGPIREEAGKILTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEG  353

Query  1118  LVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVL  1297
             LVDRYEE++EKYHPG GDERWPF+THFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL
Sbjct  354   LVDRYEEMIEKYHPGLGDERWPFITHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVL  413

Query  1298  NLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
              LYGF HRGLLSP IKRIRNETT PL  VDR+D R
Sbjct  414   KLYGFGHRGLLSPKIKRIRNETTFPLKFVDRFDIR  448



>ref|XP_004508717.1| PREDICTED: putative glycosyltransferase 5-like [Cicer arietinum]
Length=446

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/454 (71%), Positives = 378/454 (83%), Gaps = 16/454 (4%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA--LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFV  235
             MG++ V S  KR  +  LPTT ++  N            RGRQI +TFNN+KITILCGF+
Sbjct  1     MGRENV-SFHKRSSSVGLPTTNSNNKN-----------RRGRQIQKTFNNVKITILCGFI  48

Query  236   TILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNET  415
             TILVLRGTIG+ NL+SSD++  N  +I+ETNRIL EIRSD DP DP+ + G  F +PN T
Sbjct  49    TILVLRGTIGI-NLSSSDSDSVNQNVIEETNRILAEIRSDADPSDPDDKDGT-FFNPNAT  106

Query  416   FSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKN  595
             F+LGPKIT WD QRK W +++P +P+ + GK R+LL+TGSPP PC+NP+GDHYLLK +KN
Sbjct  107   FTLGPKITNWDSQRKSWLNQNPEYPNFIGGKARILLLTGSPPKPCDNPIGDHYLLKSIKN  166

Query  596   KIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAF  775
             KIDYCR+HGIEIVYN A++D E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDAFFTDM F
Sbjct  167   KIDYCRLHGIEIVYNLAHLDIELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDAFFTDMVF  226

Query  776   EIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIR  955
             E+PLSKYD +N+VIHGY DLLFDQKSW A++TGSFL RNCQW+LDLLD WAPMGPKGP+R
Sbjct  227   ELPLSKYDDYNMVIHGYPDLLFDQKSWIAINTGSFLFRNCQWSLDLLDEWAPMGPKGPVR  286

Query  956   EESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYE  1135
             EE+GK LTANLKGRP FEADDQSALIYLL+S+K++WM KVFLENSYYLHGYWAGLVDRYE
Sbjct  287   EEAGKVLTANLKGRPAFEADDQSALIYLLLSKKEKWMGKVFLENSYYLHGYWAGLVDRYE  346

Query  1136  EVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFK  1315
             E++EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF+
Sbjct  347   EMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGFR  406

Query  1316  HRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHE  1417
             HRGLLSP IKRIRNET  PL  VD++D R    E
Sbjct  407   HRGLLSPKIKRIRNETVTPLEFVDQFDIRRHSTE  440



>ref|XP_003549688.1| PREDICTED: putative glycosyltransferase 5-like [Glycine max]
Length=447

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/453 (71%), Positives = 374/453 (83%), Gaps = 11/453 (2%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MGQ+         G   +TA     G+A       +PRGRQI +TFNNIKITILCGFVTI
Sbjct  1     MGQENHHKRSTSAGLPTSTARSRGGGNA-------LPRGRQIQKTFNNIKITILCGFVTI  53

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             LVLRGTIGV NL SSD +  N  LI+ETNRIL EIRSD DP DP+ Q   +F +PN+TF+
Sbjct  54    LVLRGTIGV-NLGSSDNDAVNQNLIEETNRILAEIRSDADPSDPDDQ---QFFNPNDTFT  109

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             LGPKI  WD +RK W  ++P +P+ + GKPR+LL+TGSPP PC+NP+GDHYLLK +KNKI
Sbjct  110   LGPKIDNWDTERKNWLHQNPEYPNVIGGKPRILLLTGSPPKPCDNPIGDHYLLKSIKNKI  169

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCR+HGIEIVYN A++D E+ G WAKLP+IRRLMLSHPE+EWIWWMDSDAFFTDM FE+
Sbjct  170   DYCRLHGIEIVYNLAHLDVELAGYWAKLPMIRRLMLSHPEVEWIWWMDSDAFFTDMVFEL  229

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             P+SKYD +NLV+HGY DLLF+QKSW A++TGSFL RNCQW+LDLLD WAPMGPKGP+REE
Sbjct  230   PMSKYDEYNLVLHGYPDLLFEQKSWIAVNTGSFLFRNCQWSLDLLDAWAPMGPKGPVREE  289

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
             +GK LTANLKGRP FEADDQSALIYLL+S+K++WMDK FLENS+YLHGYWAGLVDRYEE+
Sbjct  290   AGKILTANLKGRPAFEADDQSALIYLLLSKKEKWMDKTFLENSFYLHGYWAGLVDRYEEM  349

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             +EKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL LYGF+HR
Sbjct  350   IEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVLKLYGFRHR  409

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GLLSP IKRIRNET  PL  VD++D R    E+
Sbjct  410   GLLSPKIKRIRNETVSPLEFVDQFDIRRHSTEN  442



>ref|XP_010423175.1| PREDICTED: putative glycosyltransferase 3 [Camelina sativa]
Length=459

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/455 (71%), Positives = 366/455 (80%), Gaps = 15/455 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKR--------PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKIT  217
             MG+      QKR         G LPTT T    G           RGRQI +TFNN+K+T
Sbjct  1     MGKKDGFKTQKRVSTASSAVAGVLPTTMTSCGGGRRPPPP-----RGRQIQKTFNNVKMT  55

Query  218   ILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRF  397
             ILCGFVTILVLRGTIGV N  +SDA+  N  LI+ETNR+L EIRSD DP D   +  D  
Sbjct  56    ILCGFVTILVLRGTIGV-NFGTSDADAVNQNLIEETNRLLAEIRSDSDPTD-TNEPPDSD  113

Query  398   LSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYL  577
             L  N T++LGPKIT WD++RK+W  ++P FPS V GK +VLL+TGSPP PC+N +GDHYL
Sbjct  114   LDLNMTYTLGPKITNWDQKRKLWLTQNPGFPSVVNGKAKVLLLTGSPPKPCDNSIGDHYL  173

Query  578   LKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAF  757
             LK VKNKIDYCRIHGIEIVYN A++D+E+ G WAKLP++RRLMLSHPEIEWIWWMDSDA 
Sbjct  174   LKSVKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMLRRLMLSHPEIEWIWWMDSDAL  233

Query  758   FTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMG  937
             FTDM FEIPLS+Y++HNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMG
Sbjct  234   FTDMVFEIPLSRYENHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMG  293

Query  938   PKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAG  1117
             PKGPIREE+GK LTANLKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W G
Sbjct  294   PKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEG  353

Query  1118  LVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVL  1297
             LVDRYEE++EKYHPG GDERWPF+THFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL
Sbjct  354   LVDRYEEMIEKYHPGLGDERWPFITHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVL  413

Query  1298  NLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
              LYGF HRGLLSP IKRIRNETT PL  VDR+D R
Sbjct  414   QLYGFGHRGLLSPKIKRIRNETTFPLKFVDRFDIR  448



>ref|XP_010452740.1| PREDICTED: putative glycosyltransferase 3 [Camelina sativa]
Length=459

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/455 (70%), Positives = 364/455 (80%), Gaps = 15/455 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKR--------PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKIT  217
             MG+      QKR         G LPTT T    G           R RQI +TFNN+K+T
Sbjct  1     MGKKDGFKTQKRVSTASSAVAGVLPTTMTSGRGGRRPPPP-----RSRQIQKTFNNVKMT  55

Query  218   ILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRF  397
             ILCGFVTILVLRGTIGV N  +SDA+  N  LI+ETNRIL EIRSD DP D   +  +  
Sbjct  56    ILCGFVTILVLRGTIGV-NFGTSDADAVNQNLIEETNRILAEIRSDSDPTD-TNEPPESD  113

Query  398   LSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYL  577
             L  N T++LG KIT WD++RK+W  ++P FPS V  K +VLL+TGSPP PC+NP+GDHYL
Sbjct  114   LDLNMTYTLGLKITNWDQKRKLWLTQNPGFPSVVNRKAKVLLLTGSPPKPCDNPIGDHYL  173

Query  578   LKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAF  757
             LK VKNKIDYCRIHGIEIVYN A++D+E+ G WAKLP++RRLMLSHPEIEWIWWMDSDA 
Sbjct  174   LKSVKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMLRRLMLSHPEIEWIWWMDSDAL  233

Query  758   FTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMG  937
             FTDM FEIPLS+Y++HNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMG
Sbjct  234   FTDMVFEIPLSRYENHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMG  293

Query  938   PKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAG  1117
             PKGPIREE+GK LTANLKGRP FEADDQSALIYLL+S+KD WM+KVF+EN YYLHG+W G
Sbjct  294   PKGPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEG  353

Query  1118  LVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVL  1297
             LVDRYEE++EKYHPG GDERWPF+THFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL
Sbjct  354   LVDRYEEMIEKYHPGLGDERWPFITHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVL  413

Query  1298  NLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
              LYGF HRGLLSP IKRIRNETT PL  VDR+D R
Sbjct  414   QLYGFGHRGLLSPKIKRIRNETTFPLKFVDRFDIR  448



>ref|XP_010678459.1| PREDICTED: putative glycosyltransferase 5 [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/413 (72%), Positives = 352/413 (85%), Gaps = 1/413 (0%)
 Frame = +2

Query  164   QVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDE  343
             ++ R R   +T NNIKITILCG +TILVLRGTIG+ NL  S  E EN  L++ETNR+L E
Sbjct  15    RILRERPTQKTLNNIKITILCGIITILVLRGTIGIENLTGSSYEAENKALVEETNRLLAE  74

Query  344   IRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLL  523
             IRSD D  +P+ Q+   F  PN T++LGPKI  WD QR+ W  ++P FPS++ GK RVLL
Sbjct  75    IRSDIDQSEPDVQNEPPF-DPNVTYTLGPKIDYWDTQRQKWLQQNPDFPSTIHGKGRVLL  133

Query  524   VTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRL  703
             VTGSPP PC+NP+GDHYLLKGVKNKIDYCR+HGIEI+YN A++D+EM G W+KLPLIR+L
Sbjct  134   VTGSPPNPCDNPIGDHYLLKGVKNKIDYCRLHGIEIMYNMAHLDKEMSGYWSKLPLIRKL  193

Query  704   MLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFL  883
             MLSHPE+EWIWW+DSDA FTDM FEIPL KY  HNLVIHGY DLL++QKSW AL+TGSFL
Sbjct  194   MLSHPEVEWIWWLDSDALFTDMVFEIPLQKYQDHNLVIHGYPDLLYEQKSWIALNTGSFL  253

Query  884   IRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQW  1063
             +RNCQW+LDLLD+WAPMGPKG +R+E+GK LTANLKGRP FEADDQSALIYLL+S+K++W
Sbjct  254   LRNCQWSLDLLDIWAPMGPKGQVRDEAGKLLTANLKGRPAFEADDQSALIYLLISQKEKW  313

Query  1064  MDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVE  1243
             M+KV++ENSYYLHG+W GLVD+YEE+ EKYHPG GDERWPFVTHFVGCK CGS GD+PVE
Sbjct  314   MNKVYVENSYYLHGFWLGLVDKYEEMAEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVE  373

Query  1244  KCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             KC+KSMERAFNFADNQVL LYGF+HRGLLSPNIKR+RNET  PL  VD +D R
Sbjct  374   KCLKSMERAFNFADNQVLKLYGFRHRGLLSPNIKRLRNETDKPLEFVDEFDIR  426



>emb|CDX69995.1| BnaA10g23440D [Brassica napus]
Length=455

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/455 (71%), Positives = 365/455 (80%), Gaps = 15/455 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKR------PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITIL  223
             MG++     QKR       G LPTT           R  P  PRG+QI +TFNN+K+TIL
Sbjct  1     MGKEDGFKTQKRVSTSASAGVLPTTIATPGG-----RKPP--PRGKQIKKTFNNLKMTIL  53

Query  224   CGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLS  403
             CG VTILVLRGTIGV N  +S+A+  N  LI+ETNR+L EIRSD DP D      D  L 
Sbjct  54    CGLVTILVLRGTIGV-NFGTSEADAVNQNLIEETNRLLAEIRSDSDPTD-PNDPPDSDLD  111

Query  404   PNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLK  583
              N T++LGPKIT WD+QR  W  ++P FPSS+ GKPRVLL+TGSPP PC+NP+GDHYLLK
Sbjct  112   LNATYTLGPKITNWDKQRATWLTQNPNFPSSLAGKPRVLLLTGSPPKPCDNPIGDHYLLK  171

Query  584   GVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFT  763
              VKNKIDYCRIHGIEIVYN A++D+E+ G WAKLP++RRLMLSHPEIEWIWWMDSDA FT
Sbjct  172   SVKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMLRRLMLSHPEIEWIWWMDSDALFT  231

Query  764   DMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPK  943
             DM FE+PLS+Y++HNLVIHGY DLL+DQKSW AL+TGSFL RNCQW+LDLLDVWAPMGPK
Sbjct  232   DMVFEVPLSRYENHNLVIHGYPDLLYDQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPK  291

Query  944   GPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLV  1123
             GPIREE+GK LTA LKGRP FEADDQSALIYLL+SEKD WM KVF+EN YYLHG+W GLV
Sbjct  292   GPIREEAGKVLTAFLKGRPAFEADDQSALIYLLLSEKDTWMGKVFVENQYYLHGFWEGLV  351

Query  1124  DRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNL  1303
             DRYEE+M+KYHPG GDERWPFVTHFVGCK CGS  D+ VE C+KSMERA+NFADNQVL L
Sbjct  352   DRYEEMMDKYHPGLGDERWPFVTHFVGCKPCGSYADYAVEHCLKSMERAYNFADNQVLKL  411

Query  1304  YGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHA  1408
             YGF HRGLLSP IKRIRNET  PL  V+R+D R A
Sbjct  412   YGFGHRGLLSPKIKRIRNETISPLKFVNRFDIRRA  446



>ref|XP_009122397.1| PREDICTED: putative glycosyltransferase 3 [Brassica rapa]
Length=455

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/455 (71%), Positives = 365/455 (80%), Gaps = 15/455 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKR------PGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITIL  223
             MG++     QKR       G LPTT           R  P  PRG+QI +TFNN+K+TIL
Sbjct  1     MGKEDGFKTQKRVSTSVSAGVLPTTIATPGG-----RKPP--PRGKQIKKTFNNLKMTIL  53

Query  224   CGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLS  403
             CG VTILVLRGTIGV N  +S+A+  N  LI+ETNR+L EIRSD DP D      D  L 
Sbjct  54    CGLVTILVLRGTIGV-NFGTSEADAVNQNLIEETNRLLAEIRSDSDPTD-PNDPPDSDLD  111

Query  404   PNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLK  583
              N T++LGPKIT WD+QR  W  ++P FPSS+ GKPRVLL+TGSPP PC+NP+GDHYLLK
Sbjct  112   LNATYTLGPKITNWDKQRATWLTQNPNFPSSLAGKPRVLLLTGSPPKPCDNPIGDHYLLK  171

Query  584   GVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFT  763
              VKNKIDYCRIHGIEIVYN A++D+E+ G WAKLP++RRLMLSHPEIEWIWWMDSDA FT
Sbjct  172   SVKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMLRRLMLSHPEIEWIWWMDSDALFT  231

Query  764   DMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPK  943
             DM FE+PLS+Y++HNLVIHGY DLL+DQKSW AL+TGSFL RNCQW+LDLLDVWAPMGPK
Sbjct  232   DMVFEVPLSRYENHNLVIHGYPDLLYDQKSWIALNTGSFLFRNCQWSLDLLDVWAPMGPK  291

Query  944   GPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLV  1123
             GPIREE+GK LTA LKGRP FEADDQSALIYLL+SEKD WM KVF+EN YYLHG+W GLV
Sbjct  292   GPIREEAGKVLTAFLKGRPAFEADDQSALIYLLLSEKDTWMGKVFVENQYYLHGFWEGLV  351

Query  1124  DRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNL  1303
             DRYEE+M+KYHPG GDERWPFVTHFVGCK CGS  D+ VE C+KSMERA+NFADNQVL L
Sbjct  352   DRYEEMMDKYHPGLGDERWPFVTHFVGCKPCGSYADYAVEHCLKSMERAYNFADNQVLKL  411

Query  1304  YGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHA  1408
             YGF HRGLLSP IKRIRNET  PL  V+R+D R A
Sbjct  412   YGFGHRGLLSPKIKRIRNETISPLKFVNRFDIRRA  446



>gb|KFK25153.1| hypothetical protein AALP_AA8G072800 [Arabis alpina]
Length=454

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/453 (68%), Positives = 363/453 (80%), Gaps = 13/453 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA------LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITIL  223
             MGQ+     QKR         LPTT ++   G  R +   +  +     +TFNN+K+TIL
Sbjct  1     MGQEDGFKTQKRISTVSGNVLLPTTTSNGGIGGRRQQQRGRQIK-----KTFNNVKMTIL  55

Query  224   CGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLS  403
             CGFVTILVLRGTIG+ N  +S+A+  N  LI+ETNR+L EIRSD DP D   +  D  L 
Sbjct  56    CGFVTILVLRGTIGI-NFGTSNADTINQNLIEETNRLLSEIRSDSDPTDI-NEPPDSDLD  113

Query  404   PNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLK  583
              N T++LGPKI  WD+QR  W  ++  FPS V GK +VLL+TGSPP PC+NP+GDHYLLK
Sbjct  114   LNMTYTLGPKIISWDKQRSTWLTQNQEFPSFVNGKAKVLLLTGSPPKPCDNPIGDHYLLK  173

Query  584   GVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFT  763
              VKNKIDYCRIHGIEIVYN A++D+E+ G WAKLP+IRRLMLSHPEIEWIWWMDSDA FT
Sbjct  174   SVKNKIDYCRIHGIEIVYNMAHLDKELAGYWAKLPMIRRLMLSHPEIEWIWWMDSDALFT  233

Query  764   DMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPK  943
             DM FEIPL +Y++HNLVIHGY DLLFDQKSW AL+TGSFL RNCQW+LDLLD WAPMGPK
Sbjct  234   DMVFEIPLVRYENHNLVIHGYPDLLFDQKSWIALNTGSFLFRNCQWSLDLLDAWAPMGPK  293

Query  944   GPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLV  1123
             GPIREE+GK LTANLKGRP FEADDQSALIYLL+S+K++WM+KV++EN YYLHG+W GLV
Sbjct  294   GPIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLV  353

Query  1124  DRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNL  1303
             D+YEE++EKYHPG GDERWPF+THFVGCK CGS  D+ VE+C+KSMERAFNFADNQVL L
Sbjct  354   DKYEEMIEKYHPGLGDERWPFITHFVGCKPCGSYADYAVERCLKSMERAFNFADNQVLKL  413

Query  1304  YGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             YGF HRGLLSP IKRIRNETT PL  V+R+D R
Sbjct  414   YGFGHRGLLSPKIKRIRNETTFPLKFVNRFDIR  446



>ref|XP_009606203.1| PREDICTED: putative glycosyltransferase 3 [Nicotiana tomentosiformis]
Length=462

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/384 (77%), Positives = 338/384 (88%), Gaps = 1/384 (0%)
 Frame = +2

Query  269   GNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWD  448
             GNL+SSDA+ E   LI+ETNRIL EIRSDKDPDDP  Q  + F+S NET+SLGPKI  WD
Sbjct  79    GNLSSSDADAETQNLIEETNRILAEIRSDKDPDDPVDQP-ETFMSLNETYSLGPKIVNWD  137

Query  449   EQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             + RK+W  ++P FP+ V GKPR+LLVTGSPP PC+N +GDHYLLK +KNKIDYCRIHGIE
Sbjct  138   KDRKMWLQKNPEFPNLVNGKPRILLVTGSPPNPCDNSIGDHYLLKAIKNKIDYCRIHGIE  197

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I+YN A++D+EM G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM FEIPLSKY+ HN
Sbjct  198   ILYNLAHLDKEMAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDMVFEIPLSKYNRHN  257

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
             LVIHGY DLLFDQKSW +++TGSFL RNCQW+LDLLD WAPMGPKGPIR+E+GK LTANL
Sbjct  258   LVIHGYPDLLFDQKSWISVNTGSFLFRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANL  317

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             KGRP FEADDQSALIYL +S+KD+WM KVF+ENSYYLHGYWAGLVDRYEE++EKYHPG G
Sbjct  318   KGRPAFEADDQSALIYLFISQKDKWMRKVFVENSYYLHGYWAGLVDRYEEMIEKYHPGLG  377

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             DERWPFVTHFVGCK CGS GD+P E+C+KSMERAFNFADNQVLNLYGF+H+GLLSPNIKR
Sbjct  378   DERWPFVTHFVGCKPCGSYGDYPAERCLKSMERAFNFADNQVLNLYGFRHKGLLSPNIKR  437

Query  1349  IRNETTLPLPNVDRYDFRHAKHES  1420
             IRNE+  PL  VD+ D RHAKH+S
Sbjct  438   IRNESDHPLQYVDQLDVRHAKHKS  461



>emb|CDP21247.1| unnamed protein product [Coffea canephora]
Length=436

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/457 (69%), Positives = 363/457 (79%), Gaps = 39/457 (9%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDA----RIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQ+   + QKRPG LPTTA  A         R  ++  VPRGRQIS+TFNNIKITILCG
Sbjct  1     MGQESNFTPQKRPGTLPTTAAAATANGGGGGGRSHSSSVVPRGRQISKTFNNIKITILCG  60

Query  230   FVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPN  409
             FVTILVLRGTIG GNLA          ++D+ +                          N
Sbjct  61    FVTILVLRGTIGFGNLA---------VVVDDNS--------------------------N  85

Query  410   ETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
              T+SLGPKI  WDEQRKVW  ++P FP+ V GKPR+LLVTGSPP PC+N +GDHYLLK V
Sbjct  86    GTYSLGPKIKNWDEQRKVWLSKNPEFPNFVNGKPRILLVTGSPPNPCDNAIGDHYLLKAV  145

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCRIHGIEIVYN A  D+EM G W+KLPLIRRLM+SHPEIEWIWWMDSDA FTDM
Sbjct  146   KNKIDYCRIHGIEIVYNMAQFDKEMAGYWSKLPLIRRLMVSHPEIEWIWWMDSDALFTDM  205

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
             AFEIP++KY  HNLV+HGY+DLLF+QKSW AL+TGSFL+RN QW+LDLLD WAPMGPKG 
Sbjct  206   AFEIPVTKYSEHNLVVHGYEDLLFEQKSWIALNTGSFLLRNSQWSLDLLDAWAPMGPKGY  265

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
             +R+E+GK LTANLKGRP+FEADDQSALIYLL+++K Q MDKVF+E+SYYLHGYWAGLVDR
Sbjct  266   VRDEAGKILTANLKGRPKFEADDQSALIYLLITKKKQLMDKVFVESSYYLHGYWAGLVDR  325

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             +EE++EKYHPG GDERWPFVTHFVGCK CGS GD+P E+C+KSMERAFNFADNQVL LYG
Sbjct  326   FEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPAERCLKSMERAFNFADNQVLKLYG  385

Query  1310  FKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             FKHRGL+SPNIKRIRNET +PL +VD++D RH++  S
Sbjct  386   FKHRGLVSPNIKRIRNETAIPLVSVDQFDIRHSRQHS  422



>ref|XP_006494985.1| PREDICTED: putative glycosyltransferase 3-like [Citrus sinensis]
Length=458

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/456 (69%), Positives = 364/456 (80%), Gaps = 14/456 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKRP------GALPTT-ATDAMNGDARIRANPQVPRGRQISRTFNNIKITI  220
             MGQD     ++        G LPTT A  A NG         +PRGRQI +TFNNIKITI
Sbjct  1     MGQDNFTPLKRSSTGAAAGGVLPTTNAASAANGRT---GRGAMPRGRQIQKTFNNIKITI  57

Query  221   LCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFL  400
             LCGFVTILVLRGTIGV N +S D E  N  LI+E NR+L EIRSD DPDDP+  S     
Sbjct  58    LCGFVTILVLRGTIGV-NFSSPDEETINQQLIEEANRVLAEIRSDVDPDDPDEPSDSE-T  115

Query  401   SPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLL  580
             +PN T+SLGPKI+ WD  RK W   +  FPS V GKP++LLVTGS P PC+NP+GDHYLL
Sbjct  116   NPNATYSLGPKISSWDLDRKAWLSHNAEFPSHVDGKPKILLVTGSTPKPCDNPIGDHYLL  175

Query  581   KGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFF  760
             K VKNKIDYCR+HGIEI+YN A++D+E+ G WAKLPL+R+LMLSHPEIEWIWWMDSDA F
Sbjct  176   KSVKNKIDYCRLHGIEIIYNMAHLDKELSGYWAKLPLLRKLMLSHPEIEWIWWMDSDAMF  235

Query  761   TDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGP  940
             TDM FE+P+ KY  +NLV+HGY DL+F QKSW AL+TGSFL RNCQW+LDLLD WAP GP
Sbjct  236   TDMVFELPMDKYKDYNLVVHGYHDLMFIQKSWIALNTGSFLFRNCQWSLDLLDAWAPFGP  295

Query  941   KGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGL  1120
             KG IR+E+GK +TA LKGRP FEADDQSALIYLL+++KD+W+DKVF+E+ +YLHGYW GL
Sbjct  296   KGVIRDEAGKIMTAYLKGRPAFEADDQSALIYLLLTQKDKWIDKVFIESEFYLHGYWVGL  355

Query  1121  VDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLN  1300
             VDRYEE+MEKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQV+ 
Sbjct  356   VDRYEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVIK  415

Query  1301  LYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHA  1408
             LYGF HRGLLSP IKRIRN+TT PL  VD+  FRH+
Sbjct  416   LYGFGHRGLLSPKIKRIRNDTTAPLEFVDQ--FRHS  449



>ref|XP_006440652.1| hypothetical protein CICLE_v10020086mg [Citrus clementina]
 gb|ESR53892.1| hypothetical protein CICLE_v10020086mg [Citrus clementina]
 gb|KDO55481.1| hypothetical protein CISIN_1g012705mg [Citrus sinensis]
Length=458

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/456 (69%), Positives = 364/456 (80%), Gaps = 14/456 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKRP------GALPTT-ATDAMNGDARIRANPQVPRGRQISRTFNNIKITI  220
             MGQD     ++        G LPTT A  A NG         +PRGRQI +TFNNIKITI
Sbjct  1     MGQDNFTPLKRSSTGAAAGGVLPTTNAASAANGRT---GRGAMPRGRQIQKTFNNIKITI  57

Query  221   LCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFL  400
             LCGFVTILVLRGTIGV N +S D E  N  LI+E NR+L EIRSD DPDDP+  S     
Sbjct  58    LCGFVTILVLRGTIGV-NFSSPDEETINQQLIEEANRVLAEIRSDVDPDDPDEPSDSE-T  115

Query  401   SPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLL  580
             +PN T+SLGPKI+ WD  RK W   +  FPS V GKP++LLVTGS P PC+NP+GDHYLL
Sbjct  116   NPNATYSLGPKISSWDLDRKAWLSHNAEFPSHVDGKPKILLVTGSTPKPCDNPIGDHYLL  175

Query  581   KGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFF  760
             K VKNKIDYCR+HGIEI+YN A++D+E+ G WAKLPL+R+LMLSHPEIEWIWWMDSDA F
Sbjct  176   KSVKNKIDYCRLHGIEIIYNMAHLDKELSGYWAKLPLLRKLMLSHPEIEWIWWMDSDAMF  235

Query  761   TDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGP  940
             TDM FE+P+ KY  +NLV+HGY DL+F QKSW AL+TGSFL RNCQW+LDLLD WAP GP
Sbjct  236   TDMVFELPMDKYKDYNLVVHGYHDLMFIQKSWIALNTGSFLFRNCQWSLDLLDAWAPYGP  295

Query  941   KGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGL  1120
             KG IR+E+GK +TA LKGRP FEADDQSALIYLL+++KD+W+DKVF+E+ +YLHGYW GL
Sbjct  296   KGVIRDEAGKIMTAYLKGRPAFEADDQSALIYLLLTQKDKWIDKVFIESEFYLHGYWVGL  355

Query  1121  VDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLN  1300
             VDRYEE+MEKYHPG GDERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQV+ 
Sbjct  356   VDRYEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVIK  415

Query  1301  LYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHA  1408
             LYGF HRGLLSP IKRIRN+TT PL  VD+  FRH+
Sbjct  416   LYGFGHRGLLSPKIKRIRNDTTAPLEFVDQ--FRHS  449



>ref|XP_010683109.1| PREDICTED: putative glycosyltransferase 5 [Beta vulgaris subsp. 
vulgaris]
Length=446

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/456 (68%), Positives = 361/456 (79%), Gaps = 13/456 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MGQ+G  +AQKRP A PT  T      +      +  RGRQI++T NNIKITILCGFVTI
Sbjct  1     MGQEG-FTAQKRPTAGPTGTTLPTTTLSSGNNRSRGSRGRQIAKTMNNIKITILCGFVTI  59

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDK---DPDDPEGQSGDRFLSPNE  412
             LVLRGTIG+    SSDAE  N  L  E  R++ EIRSD    D D+P         +PN 
Sbjct  60    LVLRGTIGLNLGTSSDAERSN--LEAEAMRVIAEIRSDGAEIDDDEPP-------FNPNI  110

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             TF+ GPKIT WD+QRK W   +  +P+ V GKPR+LLV+GSPP PC+NP+GDHYLLK +K
Sbjct  111   TFTFGPKITNWDDQRKEWLGLNKEYPNYVNGKPRMLLVSGSPPNPCDNPIGDHYLLKSIK  170

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKIDYCR+HGIEIVYN A++D+++ G W+KLPLIRRLMLSHPEIEWIWWMDSDA FTDM 
Sbjct  171   NKIDYCRLHGIEIVYNMAHLDKDLSGYWSKLPLIRRLMLSHPEIEWIWWMDSDALFTDMV  230

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FEIP+SKY+ HNLVIHGY DLLF++KSW AL+TGS L RNCQW LDLLD WAPMGPKGP 
Sbjct  231   FEIPVSKYEDHNLVIHGYPDLLFEKKSWIALNTGSVLFRNCQWTLDLLDTWAPMGPKGPT  290

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             R+E+G+ +TA L GRP FEADDQSALIYLL+S+K+ WM+KVF+ENSYYLHG+W GLVD+Y
Sbjct  291   RDEAGRLVTAFLSGRPAFEADDQSALIYLLISQKEVWMNKVFVENSYYLHGFWTGLVDKY  350

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE++EKYHPG GDERWPFVTHFVGCK CGS  D+PVEKC+KSMERAFNFADNQVL LYGF
Sbjct  351   EEMLEKYHPGLGDERWPFVTHFVGCKPCGSYADYPVEKCLKSMERAFNFADNQVLKLYGF  410

Query  1313  KHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             +HRGLLSPNIKR RNET  PL  VD++D R    +S
Sbjct  411   RHRGLLSPNIKRTRNETATPLVYVDQFDIRRGGSKS  446



>ref|XP_010912249.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=451

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/426 (70%), Positives = 349/426 (82%), Gaps = 16/426 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVE-NSFLIDETNRILDEIR  349
             R R+I ++FNN+KIT+LCGF+TILVLRGTIG GNL    A  + +  +I++ +RIL EIR
Sbjct  20    RRRKIQKSFNNLKITVLCGFITILVLRGTIGFGNLGGRGANSDSDQKVIEDIDRILHEIR  79

Query  350   SDKDPDDPEGQSGDR------FLSPNET--------FSLGPKITGWDEQRKVWFDRHPRF  487
             SD DPDD E  S D        ++ N T        ++LGPKI+ W+EQR+ W   +P F
Sbjct  80    SDSDPDDDETPSVDSASNSTSLVADNSTTAAAAAKNYTLGPKISDWNEQRRRWLTENPGF  139

Query  488   PSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREM  664
             PS V G KPR+LLVTGSPP PC+NP+GDHYLLK  KNKIDYCR+HGIEIVYN A++DRE+
Sbjct  140   PSQVAGGKPRILLVTGSPPNPCDNPIGDHYLLKSTKNKIDYCRLHGIEIVYNMAHLDREL  199

Query  665   DGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFD  844
              G WAKLPLIRRLMLSHPE+EWIWWMDSDAFFTDMAFEIPLS+YD+HNLVIHGY DLLF 
Sbjct  200   AGYWAKLPLIRRLMLSHPEVEWIWWMDSDAFFTDMAFEIPLSRYDAHNLVIHGYPDLLFA  259

Query  845   QKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQS  1024
             Q SW AL+TGSFL+RNCQW+LDLLD WAPMGPKGPIREE+G+ LTANLKGRP FEADDQS
Sbjct  260   QHSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFEADDQS  319

Query  1025  ALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVG  1204
             ALIYLL+S++D+W DKV++ENSY+LHG+W GLVDRYEE+++KYHPG GDERWPFVTHFVG
Sbjct  320   ALIYLLLSQQDRWGDKVYIENSYFLHGFWTGLVDRYEEMIDKYHPGLGDERWPFVTHFVG  379

Query  1205  CKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNV  1384
             CK CGS GD+PVEKC+ SMERAFNFADNQVL LYGF HRGL SP IKRIRN+T  PL   
Sbjct  380   CKPCGSYGDYPVEKCLGSMERAFNFADNQVLRLYGFGHRGLSSPKIKRIRNQTATPLDVK  439

Query  1385  DRYDFR  1402
             D+   +
Sbjct  440   DQLSLQ  445



>ref|XP_006307492.1| hypothetical protein CARUB_v10009116mg [Capsella rubella]
 gb|EOA40390.1| hypothetical protein CARUB_v10009116mg [Capsella rubella]
Length=451

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/449 (67%), Positives = 348/449 (78%), Gaps = 7/449 (2%)
 Frame = +2

Query  80    LSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGT  259
             L +    G + TTA    NG  R R      RG QI  TF NIKI ILCGFVTILVL GT
Sbjct  6     LRSSASGGGVSTTAVS--NGGGRSRG---FLRGWQIPNTFFNIKIMILCGFVTILVLLGT  60

Query  260   IGVGNLASSDAEVENSFLIDETNR-ILDEIRSDKDPDD-PEGQSGDRFLSPNETFSLGPK  433
             I +GNL SS AE  N  LI ET   IL EI SD    +  E    +   S N T++LGP+
Sbjct  61    ISIGNLGSSSAESVNQSLIKETVPPILAEIPSDSHSTELAEPPIAEIITSSNTTYTLGPR  120

Query  434   ITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCR  613
             IT WD QRKVW  ++P FPS V GK R+LL+TGS P PCE P+GD+YLLK VKNKIDYCR
Sbjct  121   ITNWDSQRKVWLSKNPEFPSIVNGKARILLLTGSSPGPCEKPIGDYYLLKSVKNKIDYCR  180

Query  614   IHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSK  793
             +HGIEIVYN A++D E+ G W KLP+IR+LMLSHPE+EWIWWMDSDA FTD+ FEIPLS+
Sbjct  181   LHGIEIVYNMAHLDEELSGYWTKLPMIRKLMLSHPEVEWIWWMDSDAMFTDILFEIPLSR  240

Query  794   YDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKT  973
             Y+ HNLVIHGY DLLF+QKSW AL+TG FL+RNCQW+LDLLD WAPMGPKGPIR+E+GK 
Sbjct  241   YEKHNLVIHGYPDLLFNQKSWIALNTGIFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKI  300

Query  974   LTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKY  1153
             LTA LKGRP FEADDQSALIYLL+S+KD+W+DKV++EN YYLHG+W GLVDRYEE++EKY
Sbjct  301   LTAYLKGRPAFEADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVDRYEEMIEKY  360

Query  1154  HPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLS  1333
             HPG GDERWPFVTHFVGCK CG   D+ V++C KSMERAFNFADNQVL LYGF HRGLLS
Sbjct  361   HPGLGDERWPFVTHFVGCKPCGKYADYAVDRCFKSMERAFNFADNQVLKLYGFSHRGLLS  420

Query  1334  PNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             PN+KRIRNET  PL  VD++D R    E+
Sbjct  421   PNVKRIRNETVSPLEAVDKFDIRRMHAET  449



>ref|XP_010907157.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=452

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/428 (69%), Positives = 347/428 (81%), Gaps = 18/428 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVE-NSFLIDETNRILDEIR  349
             R RQI +T NN+KIT+LCGFVTILVLRGTIGVGNL    A+ + +  +I++ +RIL EIR
Sbjct  20    RRRQIQKTLNNLKITVLCGFVTILVLRGTIGVGNLGRPGADADSDQKVIEDIDRILREIR  79

Query  350   SDKDPDDPEGQSGDRFLSPN----------------ETFSLGPKITGWDEQRKVWFDRHP  481
             SD DPDD E    D   +                  + ++LGPKI+ WDEQR+ W   +P
Sbjct  80    SDSDPDDEERPPLDSSSNSTSLSAANSTATAALAAAKNYTLGPKISDWDEQRRRWLRENP  139

Query  482   RFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDR  658
              FPS V G  PR+LLVTGSPP PC+NP+GDHYLLK  KNKIDYCR+HGIEIVYN A++DR
Sbjct  140   GFPSQVAGGNPRILLVTGSPPNPCDNPIGDHYLLKSTKNKIDYCRLHGIEIVYNMAHLDR  199

Query  659   EMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLL  838
             E+ G WAKLPLIRRLMLSHPE+EW+WWMDSDA FTDMAFEIP+S+YD+HNLVIHGY DLL
Sbjct  200   ELAGYWAKLPLIRRLMLSHPEVEWVWWMDSDALFTDMAFEIPISRYDAHNLVIHGYPDLL  259

Query  839   FDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADD  1018
             FDQ SW AL+TGSFL+RNCQW+LDLLD WAPMGPKGPIREE+G+ LTANLKGRP FEADD
Sbjct  260   FDQHSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFEADD  319

Query  1019  QSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHF  1198
             QSALIYLL+S++++W +KV++ENSYYLHG+WAGLV+RYEE+MEKYHPG GDERWPFVTHF
Sbjct  320   QSALIYLLLSQQERWGNKVYIENSYYLHGFWAGLVERYEEMMEKYHPGLGDERWPFVTHF  379

Query  1199  VGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLP  1378
             VGCK CGS GD+PVEKC+ SMERAFNFADNQVL LYGF HRGL SP IKRIRN+T  PL 
Sbjct  380   VGCKPCGSYGDYPVEKCLGSMERAFNFADNQVLRLYGFGHRGLSSPKIKRIRNQTATPLE  439

Query  1379  NVDRYDFR  1402
               D+   +
Sbjct  440   VKDKLSLQ  447



>ref|XP_010477058.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477059.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477061.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477062.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477063.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=456

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/447 (67%), Positives = 350/447 (78%), Gaps = 12/447 (3%)
 Frame = +2

Query  101   GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLA  280
             G L TTA     G +R        RG QI  TF NIKI ILCGFVTILVL  TI +GNL 
Sbjct  13    GGLSTTAVSTGGGRSR-----GFLRGWQIHNTFFNIKIMILCGFVTILVLLATISIGNLG  67

Query  281   SSDA--EVENSFLIDET--NRILDEIRSDKDPDD---PEGQSGDRFLSPNETFSLGPKIT  439
             SS     V+ SF+ +ET    IL EI SD +  D    E    + F +PN T++LGPK+T
Sbjct  68    SSSNADSVKQSFIEEETIPMTILPEIPSDSNSTDLVAAEPPKAEIFTTPNATYTLGPKVT  127

Query  440   GWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIH  619
              WD QRKVW +++P FPS+V GK R+LL+TGS P+PC+ P+GD+YLLK VKNKIDYCR+H
Sbjct  128   NWDSQRKVWLNQNPEFPSTVNGKARILLLTGSSPSPCDKPIGDYYLLKSVKNKIDYCRLH  187

Query  620   GIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYD  799
             GIEIVYN AN+D E+ G W KLP+IR LMLSHPE+EWIWWMDSDA FTD+ FEIPLS+Y+
Sbjct  188   GIEIVYNMANLDEELSGYWTKLPMIRILMLSHPEVEWIWWMDSDALFTDILFEIPLSRYE  247

Query  800   SHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLT  979
              HNLVIHGY DLLF+QKSW AL+TG FL+RNCQW+LDLLD WAPMGPKGPIR+E+GK LT
Sbjct  248   KHNLVIHGYPDLLFNQKSWIALNTGVFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLT  307

Query  980   ANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHP  1159
             A LKGRP FEADDQSALIYLL+S+KD+W+DKV++EN YYLHG+W GLVD+YEE++EKYHP
Sbjct  308   AYLKGRPAFEADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVDKYEEMVEKYHP  367

Query  1160  GFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPN  1339
             G GDERWPFVTHFVGCK CGS  D+ V++C KSMERAFNFADNQVL LYGF HRGLLSP 
Sbjct  368   GLGDERWPFVTHFVGCKPCGSYADYAVDRCFKSMERAFNFADNQVLKLYGFSHRGLLSPK  427

Query  1340  IKRIRNETTLPLPNVDRYDFRHAKHES  1420
             +KRIRNET  PL  VD++D R    E+
Sbjct  428   VKRIRNETVSPLEAVDKFDIRRMHVET  454



>ref|XP_009790055.1| PREDICTED: putative glycosyltransferase 5 [Nicotiana sylvestris]
Length=474

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/448 (67%), Positives = 364/448 (81%), Gaps = 6/448 (1%)
 Frame = +2

Query  80    LSAQKRP---GALPTTATDAMNGDARIR-ANPQVPRGRQISRTFNNIKITILCGFVTILV  247
              +A KRP   G   T  T   NG A  R A+  + R R+++ +F N+K+TILCG VTILV
Sbjct  22    FTALKRPTSAGVGATLPTSTKNGGASARSASAGLLRRRRVANSFGNLKLTILCGIVTILV  81

Query  248   LRGTIGVGNLASSDAEVENSF-LIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFSL  424
             LRGTIG+ N +S+ + ++ +  LI+ETNR++ EIRSD D DD   +      S N +++L
Sbjct  82    LRGTIGLTNFSSNSSSLDQTQELIEETNRVIAEIRSDSDDDDNNDEDDHSEFSHNASYTL  141

Query  425   GPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKID  604
             GPKIT WD  RK W   +PRFPS V GKPRVLLVTGS P+PC+N +GDHYLLK +KNKID
Sbjct  142   GPKITNWDFTRKAWLHENPRFPSYVNGKPRVLLVTGSSPSPCDNSIGDHYLLKSIKNKID  201

Query  605   YCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIP  784
             YCRIH IEIVYN A++D ++ G W+KLPLIR+LM+SHPEIEWIWWMDSDA FTDM FEIP
Sbjct  202   YCRIHNIEIVYNMAHLDNQLSGYWSKLPLIRKLMISHPEIEWIWWMDSDAMFTDMTFEIP  261

Query  785   LSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREES  964
             LSKYD  NL+IHGY +LL ++KSW AL+TGSFL+RNCQW+LDLLD WAPMGPKG IR+++
Sbjct  262   LSKYDGKNLIIHGYPELL-NEKSWVALNTGSFLLRNCQWSLDLLDSWAPMGPKGKIRDDA  320

Query  965   GKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVM  1144
             G+ LTANLKGRP FEADDQSALIYLL+S+ ++WM+KVF+E+SYYLHGYWAGLVDRYEE++
Sbjct  321   GEILTANLKGRPNFEADDQSALIYLLISQNNKWMEKVFIESSYYLHGYWAGLVDRYEEMI  380

Query  1145  EKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRG  1324
             EKY PGFGDERWPFVTHFVGCK+CGS GD+PVEKC+KSMERAFNFADNQVL LYGF+HRG
Sbjct  381   EKYKPGFGDERWPFVTHFVGCKSCGSYGDYPVEKCLKSMERAFNFADNQVLKLYGFRHRG  440

Query  1325  LLSPNIKRIRNETTLPLPNVDRYDFRHA  1408
             L SPNIKRIRNET  PL  V ++D RH+
Sbjct  441   LSSPNIKRIRNETFRPLEFVGQFDIRHS  468



>ref|XP_008788330.1| PREDICTED: putative glycosyltransferase 5 [Phoenix dactylifera]
Length=454

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/420 (71%), Positives = 344/420 (82%), Gaps = 19/420 (5%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENS-FLIDETNRILDEIR  349
             R RQI +T NN+KIT+LCGFVTILVLRGTIGVGNL     + ++   +I++ +RIL EIR
Sbjct  20    RRRQIQKTLNNLKITVLCGFVTILVLRGTIGVGNLGRPGGDGDSGQKVIEDIDRILREIR  79

Query  350   SDKDPDDPEGQSGDRFL------SPNET-----------FSLGPKITGWDEQRKVWFDRH  478
             SD DPDD E    D         + N T           ++LGPKI+ WDEQR+ W   +
Sbjct  80    SDSDPDDEERPPLDSSSNSTSLSAVNSTVAAAAHAAAKNYTLGPKISDWDEQRRRWLTEN  139

Query  479   PRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMD  655
             P FPS V G  PR+LLVTGSPP PC+NP+GDHYLLK  KNKIDYCR+HGIEIVYN A++D
Sbjct  140   PGFPSQVAGGNPRILLVTGSPPNPCDNPMGDHYLLKSTKNKIDYCRLHGIEIVYNMAHLD  199

Query  656   REMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDL  835
             RE+ G WAKLPL+RRLMLSHPE+EWIWWMDSDA FTDMAFEIP+S+YD+HNLVIHGY DL
Sbjct  200   RELAGYWAKLPLLRRLMLSHPEVEWIWWMDSDALFTDMAFEIPISRYDAHNLVIHGYPDL  259

Query  836   LFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEAD  1015
             LFDQ SW AL+TGSFL+RNCQW+LDLLD WAPMGPKGPIREE+G+ LTANLKGRP FEAD
Sbjct  260   LFDQHSWIALNTGSFLLRNCQWSLDLLDAWAPMGPKGPIREEAGRILTANLKGRPAFEAD  319

Query  1016  DQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTH  1195
             DQSALIYLL+S++D+W DKV++ENSYYLHG+WAGLV+RYEE+MEKYHPG GDERWPFVTH
Sbjct  320   DQSALIYLLLSQQDRWGDKVYIENSYYLHGFWAGLVERYEEMMEKYHPGLGDERWPFVTH  379

Query  1196  FVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             FVGCK CGS GD+PVEKC+ SMERAFNFADNQVL LYGF HRGL SP IKRIRN+T  PL
Sbjct  380   FVGCKPCGSYGDYPVEKCLGSMERAFNFADNQVLRLYGFGHRGLSSPKIKRIRNQTAAPL  439



>ref|XP_009379786.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009379787.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/463 (64%), Positives = 357/463 (77%), Gaps = 36/463 (8%)
 Frame = +2

Query  62    MGQDGVLS---AQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGF  232
             MGQ+G  S   A+   G+LP ++              ++PRGR+I + FNN+KIT+LCGF
Sbjct  1     MGQEGAASKAAARSGGGSLPASSRSG-----------RLPRGRKIQKAFNNLKITVLCGF  49

Query  233   VTILVLRGTIGVGNLASSD---AEVENSFLIDETNRILDEIRS-----------------  352
             VTILVLRGTIG+G+LA +    +E  +  +I++ +RIL EIRS                 
Sbjct  50    VTILVLRGTIGIGSLAGAGGDASEAADQRVIEDIDRILREIRSDADPDDDDQQQQFLSLN  109

Query  353   -DKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKG-KPRVLLV  526
                   D  G + D   +    ++LGPKI+ WD QR+ W   +P FP+ V+G KPR+LLV
Sbjct  110   STTATRDGGGNATDITSAVVANYTLGPKISDWDSQRRRWLSENPGFPNLVEGGKPRILLV  169

Query  527   TGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLM  706
             TGSPP PC+N  GDHYLLK +KNKIDYCR+HGIEIVYN A++DRE+ G WAKLPLIRRLM
Sbjct  170   TGSPPNPCDNATGDHYLLKAIKNKIDYCRLHGIEIVYNMAHLDRELAGYWAKLPLIRRLM  229

Query  707   LSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLI  886
             LSHPE+EWIWWMDSDA FTDMAFEIPL +YD+HNLV+HGY DL+FDQ SW  L+TGSFL+
Sbjct  230   LSHPEVEWIWWMDSDALFTDMAFEIPLPRYDAHNLVVHGYPDLIFDQHSWIGLNTGSFLL  289

Query  887   RNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWM  1066
             RNCQW+LDLLD WAPMGPKGP+R+E+GK LTA+LKGRP FEADDQSALIYLL+S++D+W 
Sbjct  290   RNCQWSLDLLDAWAPMGPKGPVRDEAGKILTASLKGRPAFEADDQSALIYLLLSQQDKWG  349

Query  1067  DKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEK  1246
             +KVF+ENSYYLHGYWAGLVDRYEE+MEKYHPG GDERWPFVTHFVGCK CGS GD+PVE+
Sbjct  350   NKVFIENSYYLHGYWAGLVDRYEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVER  409

Query  1247  CVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             C+ SMERAFNFADNQ+L +YGF HRGL S NIKRI+ +TT PL
Sbjct  410   CLGSMERAFNFADNQILRIYGFAHRGLASSNIKRIKRQTTRPL  452



>ref|XP_008783986.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
5 [Phoenix dactylifera]
Length=452

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/427 (68%), Positives = 345/427 (81%), Gaps = 17/427 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVE-NSFLIDETNRILDEIR  349
             R R+I ++FNN+KIT+LCGF+TILVLRGT+G GNL    A  + +  +I++ +RIL EIR
Sbjct  20    RRRKIQKSFNNLKITVLCGFITILVLRGTVGFGNLGGPGANSDSDQKVIEDIDRILREIR  79

Query  350   SDKDPDDPEGQSGDRFLSPN---------------ETFSLGPKITGWDEQRKVWFDRHPR  484
             SD DPDD E    D   +                 + ++LGPKI+ W+EQR+ W   +P 
Sbjct  80    SDSDPDDEEPPPVDSASNSTSLAADNSTATAAAAAKNYTLGPKISDWNEQRRRWLSENPG  139

Query  485   FPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDRE  661
             FPS V G KPR+LLVTGSPP PC+NP+GDHYLLK  KNKIDYCR+HGIEIVYN A++DRE
Sbjct  140   FPSKVAGGKPRILLVTGSPPNPCDNPIGDHYLLKSTKNKIDYCRLHGIEIVYNMAHLDRE  199

Query  662   MDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLF  841
             + G WAKLPL+R LM+SHPE+EWIWWMDSDAFFTDMAFEIPLS+YD+HNLVIHGY DLLF
Sbjct  200   LAGYWAKLPLMRHLMISHPEVEWIWWMDSDAFFTDMAFEIPLSRYDAHNLVIHGYPDLLF  259

Query  842   DQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQ  1021
              Q SW AL+TGSFL+RNCQW+LDLLD WAPMGPKGPIREE+G+ LTANLKGRP FEADDQ
Sbjct  260   GQHSWIALNTGSFLLRNCQWSLDLLDTWAPMGPKGPIREEAGRILTANLKGRPAFEADDQ  319

Query  1022  SALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFV  1201
             SALIYLL+S++D+W D+V++ENSYYLHG+W GLV+RYEE+M+KYHPG GDERWPFVTHFV
Sbjct  320   SALIYLLLSQQDRWGDRVYIENSYYLHGFWTGLVERYEEMMDKYHPGLGDERWPFVTHFV  379

Query  1202  GCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPN  1381
             GCK CGS GD+PVEKC+ SMERAFNFADNQVL LYGF HRGL SP IKRIRN+T  PL  
Sbjct  380   GCKPCGSYGDYPVEKCLGSMERAFNFADNQVLRLYGFGHRGLSSPKIKRIRNQTATPLDV  439

Query  1382  VDRYDFR  1402
              D+   +
Sbjct  440   KDQLSLQ  446



>ref|XP_006841140.1| hypothetical protein AMTR_s00086p00128700 [Amborella trichopoda]
 gb|ERN02815.1| hypothetical protein AMTR_s00086p00128700 [Amborella trichopoda]
Length=441

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/411 (71%), Positives = 342/411 (83%), Gaps = 7/411 (2%)
 Frame = +2

Query  179   RQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENS-FLIDETNRILDEIRSD  355
             RQI +TFNN+KITILCGFVTILVLRGTIGVGNL     + E S  +I+ETNRIL+EIRS 
Sbjct  27    RQIQKTFNNLKITILCGFVTILVLRGTIGVGNLGGGGGDAETSQNIIEETNRILEEIRST  86

Query  356   KDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKG-KPRVLLVTG  532
              D ++   +     ++PN T++LGPKI  WD++RK W + HP FP+ + G +PR+LLVTG
Sbjct  87    ADLEEDAAE-----INPNITYTLGPKILDWDQKRKAWLNEHPEFPNFLAGGRPRILLVTG  141

Query  533   SPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLS  712
             S P PC+NP+GDHYLLK  KNKIDYCR+HGIEIVYN A++DRE+ G WAKLPLIRRLMLS
Sbjct  142   SQPNPCDNPIGDHYLLKAAKNKIDYCRLHGIEIVYNMAHLDRELAGYWAKLPLIRRLMLS  201

Query  713   HPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRN  892
             HPE+EWIWWMDSDA FTDMAFEIPLS+Y+ +N V+HGY+DL+F+QKSW  L+TGSFL RN
Sbjct  202   HPEVEWIWWMDSDAMFTDMAFEIPLSRYNDYNFVLHGYKDLVFNQKSWIGLNTGSFLFRN  261

Query  893   CQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDK  1072
             CQW+LDLLD WAPMGPKG IR+E+GK LTANLKGRP FEADDQSALIYLL+S+KD+W  K
Sbjct  262   CQWSLDLLDAWAPMGPKGVIRDEAGKILTANLKGRPAFEADDQSALIYLLISKKDEWAGK  321

Query  1073  VFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCV  1252
             VFLE SYYLHGYWAGLVDRYEE+M+KYHPG GD+RWPFVTHFVGCK CGS GD+PVEKC+
Sbjct  322   VFLEESYYLHGYWAGLVDRYEEMMDKYHPGLGDDRWPFVTHFVGCKPCGSYGDYPVEKCM  381

Query  1253  KSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
              SMERAFNFADNQ+L +YGF HR L S  IKRIRNE+  PL   D  + RH
Sbjct  382   SSMERAFNFADNQILQIYGFAHRALSSAKIKRIRNESASPLEVKDPLNLRH  432



>ref|XP_010498276.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=456

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/447 (66%), Positives = 348/447 (78%), Gaps = 12/447 (3%)
 Frame = +2

Query  101   GALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLA  280
             G L TTA    NG  R R      RG QI  T  NIKI ILCGFVTILVL  TI +GN  
Sbjct  13    GGLSTTAVS--NGGGRSRG---FLRGWQIHNTLFNIKIMILCGFVTILVLLATISIGNFG  67

Query  281   SSDA--EVENSFLIDET--NRILDEIRSDKDPDD---PEGQSGDRFLSPNETFSLGPKIT  439
             SS     V+ SF+ +ET    IL EI SD +  D    E    + F +PN T++LGPK+T
Sbjct  68    SSSNADSVKQSFIKEETIPMTILPEIPSDSNSTDLGAAEPPKAEIFTTPNATYTLGPKVT  127

Query  440   GWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIH  619
              WD QRK W +++P FPS+V GK R+LL+TGS P+PC+ P+GD+YLLK VKNKIDYCR+H
Sbjct  128   NWDSQRKAWLNQNPEFPSTVNGKARILLLTGSSPSPCDKPIGDYYLLKSVKNKIDYCRLH  187

Query  620   GIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYD  799
             GIEIVYN A++D E+ G W KLP+IR LMLS+PE+EWIWWMDSDA FTD+ FEIPLS+Y+
Sbjct  188   GIEIVYNMAHLDEELSGYWTKLPMIRILMLSNPEVEWIWWMDSDALFTDILFEIPLSRYE  247

Query  800   SHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLT  979
              HNLVIHGY DLLF+QKSW AL+TG FL+RNCQW+LDLLD WAPMGPKGPIR+E+GK LT
Sbjct  248   KHNLVIHGYPDLLFNQKSWIALNTGVFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLT  307

Query  980   ANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHP  1159
             A LKGRP FEADDQSALIY+L+S+KD+W+DKV++EN YYLHG+W GLVD+YEE++EKYHP
Sbjct  308   AYLKGRPAFEADDQSALIYILLSQKDKWIDKVYVENQYYLHGFWEGLVDKYEEMVEKYHP  367

Query  1160  GFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPN  1339
             G GDERWPFVTHFVGCK CGS  D+ V++C KSMERAFNFADNQVL LYGF HRGLLS  
Sbjct  368   GLGDERWPFVTHFVGCKPCGSYADYAVDRCFKSMERAFNFADNQVLKLYGFSHRGLLSTK  427

Query  1340  IKRIRNETTLPLPNVDRYDFRHAKHES  1420
             +KRIRNET  PL +VDR+D R    E+
Sbjct  428   VKRIRNETVSPLESVDRFDIRRMHVET  454



>ref|XP_009393375.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393376.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/450 (65%), Positives = 350/450 (78%), Gaps = 22/450 (5%)
 Frame = +2

Query  110   PTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASS-  286
             PT A D  +  A      ++PR RQI +TFNN+K+TILCG VTILVLRGT+G+GNLA S 
Sbjct  11    PTAARDRPDAGAAA-PRSRIPRRRQIRKTFNNLKVTILCGVVTILVLRGTVGIGNLAGSG  69

Query  287   -DAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNET----------------  415
              DA   +  ++++ +RIL EIRSD DPDD E Q    F S   T                
Sbjct  70    GDAFAADQRVVEDIDRILREIRSDSDPDD-EDQIHSGFNSTTATALNYTSSDALFAAAAA  128

Query  416   -FSLGPKITGWDEQRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
              ++LGPKI  WD QR+ W   +  FPS    GKPR++LVTGSPP PC+NP+GDHYLLKG 
Sbjct  129   NYTLGPKIFDWDVQRRRWLAENRGFPSQTPAGKPRIILVTGSPPNPCDNPIGDHYLLKGT  188

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCR+HGIEIVYN A++DRE+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA FTDM
Sbjct  189   KNKIDYCRLHGIEIVYNMAHLDRELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDALFTDM  248

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
             AFEIPL +Y +HNLV+HGY DL+F++ SW  L+TGSFL+RNCQW+LDLLD WAPMGPKGP
Sbjct  249   AFEIPLDRYAAHNLVVHGYPDLIFEKHSWIGLNTGSFLLRNCQWSLDLLDAWAPMGPKGP  308

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
             IR+E+GK LTANLKGRP FEADDQSALIYLL+S++D+W DK+++ENSYYLHGYWAGLVDR
Sbjct  309   IRDEAGKMLTANLKGRPAFEADDQSALIYLLLSQQDRWGDKIYIENSYYLHGYWAGLVDR  368

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             YEE+MEKYHPG GDERWPFVTHFVGCK CGS GD+PV++C++SMERAFNFADNQVL +YG
Sbjct  369   YEEMMEKYHPGLGDERWPFVTHFVGCKPCGSYGDYPVKRCLRSMERAFNFADNQVLRMYG  428

Query  1310  FKHRGLLSPNIKRIRNETTLPLPNVDRYDF  1399
             F H  L SP I+R   +T  PL  +D+ + 
Sbjct  429   FAHGNLASPKIRRTEKQTAKPLEFLDQLNL  458



>ref|XP_009385087.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/455 (63%), Positives = 354/455 (78%), Gaps = 20/455 (4%)
 Frame = +2

Query  86    AQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIG  265
              Q+  G  PT+A D  +   R R    +PR RQI +TFNN+KIT+ CG VTILVLRGT+G
Sbjct  2     GQEAAGLKPTSARDRPDAATRSR----LPRRRQIRKTFNNLKITVFCGVVTILVLRGTVG  57

Query  266   VGNLASSDAEVENSF--LIDETNRILDEIRSDKDPDDPE-------------GQSGDRFL  400
             +G+LA +  +   +   ++++ +RIL EIRSD DPDD +               +    +
Sbjct  58    IGSLAGAGGDAAAADQKVVEDIDRILREIRSDSDPDDADQIPFGFNSTAASLNYTSAAVV  117

Query  401   SPNETFSLGPKITGWDEQRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYL  577
             +  E ++LGP+I+ WDEQR+ W   +P FPS    GKPR+LLVTGSPP PC++ +GDHYL
Sbjct  118   AAAENYTLGPRISDWDEQRRRWLGENPGFPSRTPGGKPRILLVTGSPPNPCDSSIGDHYL  177

Query  578   LKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAF  757
             LK  KNKIDYCR+HGIEIVYN A++DRE+ G WAKLPLIRRLMLSHPE+EWIWWMDSDA 
Sbjct  178   LKATKNKIDYCRLHGIEIVYNMAHLDRELAGYWAKLPLIRRLMLSHPEVEWIWWMDSDAL  237

Query  758   FTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMG  937
             FTDMAFEIPL +Y +HNLV+HGY DL+F++ SW  L+TGSFL+RNCQW LDLLD WAPMG
Sbjct  238   FTDMAFEIPLDRYAAHNLVVHGYPDLIFEKHSWIGLNTGSFLLRNCQWILDLLDAWAPMG  297

Query  938   PKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAG  1117
             PKGPIR+E+GK LTANLKGRP FEADDQSALIYLL+S++D+W DKV++ENSYYLHGYWAG
Sbjct  298   PKGPIRDEAGKILTANLKGRPAFEADDQSALIYLLLSQQDKWGDKVYIENSYYLHGYWAG  357

Query  1118  LVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVL  1297
             LVDRYEE+MEK+HPG GDERWPFVTHFVGCK CGS GD+PVE+C+ SMERAFNFADNQVL
Sbjct  358   LVDRYEEMMEKHHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLSSMERAFNFADNQVL  417

Query  1298  NLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
              +YGF H  L SPNI+R + +T  PL  +D+ + +
Sbjct  418   RMYGFAHGSLASPNIRRTKKQTAKPLEFLDQLNLK  452



>ref|XP_004239475.1| PREDICTED: putative glycosyltransferase 3 [Solanum lycopersicum]
Length=447

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/445 (65%), Positives = 355/445 (80%), Gaps = 14/445 (3%)
 Frame = +2

Query  80    LSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGT  259
             L++     ALPT++ D     +       V   R+++ +F NI++TILCG VTILVLRGT
Sbjct  10    LTSAGASAALPTSSNDGAGARS-------VSHRRRVANSFINIRLTILCGIVTILVLRGT  62

Query  260   IGVGNLASSDAEV-ENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSP-NETFSLGPK  433
             IG+ N +S+   + +N  L++ETNRI+ +IR D +    +    D F  P N ++SLGPK
Sbjct  63    IGLNNFSSNSPSLDQNQKLVEETNRIIAQIRYDDN----DNDDDDNFEYPQNSSYSLGPK  118

Query  434   ITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCR  613
             I  W+  RK W   +PRFPS + GKPRVLLVTGSPP+PC+N +GD+YLLK +KNKIDYCR
Sbjct  119   INNWNSTRKTWLHENPRFPSYINGKPRVLLVTGSPPSPCDNSIGDYYLLKSIKNKIDYCR  178

Query  614   IHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSK  793
             IH IEIVYN A+ D+++ G W+KLPLIR+LM+SHPEIEWIWWMDSDA FTDM FEIPLSK
Sbjct  179   IHNIEIVYNMAHFDKKLSGYWSKLPLIRKLMISHPEIEWIWWMDSDAMFTDMVFEIPLSK  238

Query  794   YDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKT  973
             Y   NL+IHGY +LL ++KSW AL+TGSFL+RNCQW+LDLLD WAPMGPKG IR+++GK 
Sbjct  239   YSEKNLIIHGYPELL-NEKSWVALNTGSFLLRNCQWSLDLLDSWAPMGPKGKIRDDAGKI  297

Query  974   LTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKY  1153
             L+ANLKGRP FEADDQSALIY+L+   ++WM+KVF+ENSYYLHGYWAGLVDRYEE+++KY
Sbjct  298   LSANLKGRPNFEADDQSALIYMLILRNNKWMEKVFVENSYYLHGYWAGLVDRYEEMIQKY  357

Query  1154  HPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLS  1333
             HPGFGDERWPFVTHFVGCK CGS GD+PVEKC+KSMERAFNFADNQVL LYGFKHRGL S
Sbjct  358   HPGFGDERWPFVTHFVGCKPCGSYGDYPVEKCLKSMERAFNFADNQVLKLYGFKHRGLSS  417

Query  1334  PNIKRIRNETTLPLPNVDRYDFRHA  1408
             PN+KRIRNET  PL  V+ +D RH+
Sbjct  418   PNVKRIRNETFRPLEFVNDFDIRHS  442



>ref|XP_010943718.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=453

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/418 (68%), Positives = 339/418 (81%), Gaps = 12/418 (3%)
 Frame = +2

Query  182   QISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKD  361
             QI +TFNN+KIT+LCG VTILVLRGTIGVGNL        +  ++++ +RIL EIRSD D
Sbjct  31    QIKKTFNNLKITVLCGLVTILVLRGTIGVGNLGGPADADSDQKVVEDIDRILREIRSDSD  90

Query  362   PDD----------PEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKG-K  508
             PDD              +     +  + ++LGPKI+ WDEQR+ W   HP FPS + G K
Sbjct  91    PDDEPPLDSTASNSTTSAAANVTTAAKNYTLGPKISDWDEQRRRWLADHPEFPSRIAGGK  150

Query  509   PRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLP  688
             PR+LLVTGSPP+PC+NP+GDHYLLKG KNKIDYCR+HGIEIVYN  ++D E+ G WAKLP
Sbjct  151   PRILLVTGSPPSPCDNPIGDHYLLKGTKNKIDYCRLHGIEIVYNLVHLDLELAGYWAKLP  210

Query  689   LIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALS  868
             LIR L LSHPE+EWIWWMDSDA FTDMAFEIPLS+YD+HNLVIHGY DLL +Q+SW AL+
Sbjct  211   LIRGLFLSHPEVEWIWWMDSDALFTDMAFEIPLSRYDAHNLVIHGYPDLL-EQQSWIALN  269

Query  869   TGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMS  1048
             TGSFL+RNCQW+LDLLD WAPMGPKGP+REE+G+ LTANLKGRP FEADDQSALIYLL+S
Sbjct  270   TGSFLLRNCQWSLDLLDTWAPMGPKGPVREEAGRILTANLKGRPAFEADDQSALIYLLIS  329

Query  1049  EKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSG  1228
             ++D+W DKV++ENSY+LHG+W GLVD+YEE+M+K+HPG GDERWPFVTHFVGCK CGS G
Sbjct  330   QQDRWSDKVYIENSYFLHGFWVGLVDKYEEMMDKHHPGLGDERWPFVTHFVGCKPCGSYG  389

Query  1229  DFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             D+PVE+C+ SMERAFNFADNQVL LYGF HRGL SP I+R RN+T  PL   D+ + +
Sbjct  390   DYPVERCLGSMERAFNFADNQVLRLYGFGHRGLSSPRIRRTRNQTARPLEFKDQLNLQ  447



>ref|XP_010459505.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459506.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459508.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459509.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=472

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/459 (64%), Positives = 348/459 (76%), Gaps = 28/459 (6%)
 Frame = +2

Query  113   TTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA  292
             TTA     G +R        RG QI  T  NIKI ILCGFVTILVL  TI +GN  SS  
Sbjct  17    TTAVSTGGGRSR-----GFLRGWQIHNTLFNIKIMILCGFVTILVLLATISIGNFGSSSN  71

Query  293   --EVENSFLIDET--NRILDEIRSDKDPDD------PE-------------GQSGDRFLS  403
                V+ SF+ +ET    IL EI SD +  D      P+             G   + F +
Sbjct  72    ADSVKQSFIKEETIPMTILPEIPSDSNSTDLGAAEPPKAEIFTTPNATSTLGPKAEIFTT  131

Query  404   PNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLK  583
             PN T++LGPK+T WD QRK W +++P FPS+V G+ R+LL+TGS P+PC+ P+GD+YLLK
Sbjct  132   PNATYTLGPKVTNWDSQRKAWLNQNPEFPSTVNGRARILLLTGSSPSPCDKPIGDYYLLK  191

Query  584   GVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFT  763
              VKNKIDYCR+HGIEIVYN AN+D E+ G W KLP+IR LMLSHPE+EWIWWMDSDA FT
Sbjct  192   SVKNKIDYCRLHGIEIVYNMANLDEELSGYWTKLPMIRILMLSHPEVEWIWWMDSDALFT  251

Query  764   DMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPK  943
             D+ FEIPLS+Y+ HNLVIHGY DLLF+QKSW AL+TG FL+RNCQW+LDLLD WAPMGPK
Sbjct  252   DILFEIPLSRYEKHNLVIHGYPDLLFNQKSWIALNTGVFLLRNCQWSLDLLDAWAPMGPK  311

Query  944   GPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLV  1123
             GPIR+E+GK LTA LKGRP FEADDQSALIYLL+S+KD+W+DKV++EN YYLHG+W GLV
Sbjct  312   GPIRDEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLV  371

Query  1124  DRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNL  1303
             D+YEE++EKYHPG GDERWPFVTHFVGCK CGS  D+ V++C KSMERAFNFADNQVL L
Sbjct  372   DKYEEMVEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVDRCFKSMERAFNFADNQVLKL  431

Query  1304  YGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             YGF HRGLLSP +KRIRNET  PL +VD+++ R    E+
Sbjct  432   YGFSHRGLLSPKVKRIRNETISPLESVDKFNIRRMHVET  470



>emb|CDY19235.1| BnaC05g14360D [Brassica napus]
Length=452

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/415 (68%), Positives = 333/415 (80%), Gaps = 2/415 (0%)
 Frame = +2

Query  182   QISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE-VENSFLIDETNRILDEIRSDK  358
             Q+  T  NIKI ILCGFVTILVL GT+  GNL SS+A+   N  LI ET  IL E  S  
Sbjct  36    QVQNTSMNIKIMILCGFVTILVLLGTVSFGNLGSSNADDAVNQNLIKETKPILAESPSAS  95

Query  359   DPDDPEGQSGDRF-LSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGS  535
              P+D + +   +  ++PN T++LGP+IT WD QRKVW +++P FPS V GK R+LL+TGS
Sbjct  96    VPNDLDLEEPPKAEVNPNVTYTLGPRITNWDSQRKVWLNQNPGFPSIVNGKARILLLTGS  155

Query  536   PPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSH  715
             PP PC+ P+GD+YLLK VKNKIDYCRIHGIEIVYN A++D E+ G W KLP+IRRLMLSH
Sbjct  156   PPGPCDKPIGDYYLLKSVKNKIDYCRIHGIEIVYNMAHLDEELSGYWTKLPMIRRLMLSH  215

Query  716   PEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNC  895
             PE+EWIWWMDSDA FTD+ FEIPLS+Y+ HNLVIHGY DLLF+QKSW AL+TG FL+RNC
Sbjct  216   PEVEWIWWMDSDALFTDILFEIPLSRYEKHNLVIHGYPDLLFNQKSWVALNTGVFLLRNC  275

Query  896   QWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKV  1075
             QW+LDLLD WAPMGPKGPIR E+GK LTA LKGRP FEADDQS LIYLL+S K++WM+KV
Sbjct  276   QWSLDLLDAWAPMGPKGPIRNEAGKVLTAYLKGRPAFEADDQSTLIYLLISHKEKWMEKV  335

Query  1076  FLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVK  1255
             ++EN YYLHG+W GLVD+YEE+ME+YHPG GDERWPFV+HFVGCK CGS  D+  E+C K
Sbjct  336   YVENQYYLHGFWEGLVDKYEEMMERYHPGLGDERWPFVSHFVGCKPCGSYADYAEERCFK  395

Query  1256  SMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
              MERAFNFADNQVL LYGF HRGLLSP +KRIRNET  P   VD++D R    E+
Sbjct  396   GMERAFNFADNQVLELYGFSHRGLLSPKVKRIRNETVSPFEYVDKFDIRRTHAEA  450



>ref|XP_002890293.1| hypothetical protein ARALYDRAFT_312817 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66552.1| hypothetical protein ARALYDRAFT_312817 [Arabidopsis lyrata subsp. 
lyrata]
Length=574

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/448 (65%), Positives = 340/448 (76%), Gaps = 17/448 (4%)
 Frame = +2

Query  119   ATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEV  298
              T   NG  RIR      RG QI  T  NIKI ILCGFVTIL+L GTI +GN  SS+A+ 
Sbjct  128   TTAVSNGGWRIRG---FLRGWQIQNTLFNIKIMILCGFVTILILLGTISIGNFGSSNADS  184

Query  299   ENSFLIDETNRILDEIRSDK------DPDDPEGQSGDRFL--------SPNETFSLGPKI  436
              N   I ET  IL EI SD       +P   E      +L        S N  ++LGP+I
Sbjct  185   VNQSFIKETIPILAEIPSDSHSTDLAEPPKAEVSPNATYLNEPPKAEVSSNAAYTLGPRI  244

Query  437   TGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRI  616
             T WD QRKVW +++P FPS V GK R+LL+TGS P PC+ P+GD+YLLK VKNKIDYCR+
Sbjct  245   TNWDSQRKVWLNQNPEFPSIVNGKARILLLTGSSPGPCDKPIGDYYLLKSVKNKIDYCRL  304

Query  617   HGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKY  796
             HGIEIVYN A++D E+ G W KLP+IR LMLSHPE+EWIWWMDSDA FTD+ FEIPL +Y
Sbjct  305   HGIEIVYNMAHLDEELSGYWTKLPMIRTLMLSHPEVEWIWWMDSDALFTDILFEIPLPRY  364

Query  797   DSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTL  976
             ++HNLVIHGY DLLF+QKSW AL+TG FL+RNCQW+LDLLD WAPMGPKG IR+E+GK L
Sbjct  365   ENHNLVIHGYPDLLFNQKSWVALNTGIFLLRNCQWSLDLLDAWAPMGPKGTIRDEAGKIL  424

Query  977   TANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYH  1156
             TA LKGRP FEADDQSALIYLL+S+KD+W++KV++EN YYLHG+W GLVDRYEE++EKYH
Sbjct  425   TAYLKGRPAFEADDQSALIYLLLSQKDKWIEKVYVENQYYLHGFWEGLVDRYEEMIEKYH  484

Query  1157  PGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSP  1336
             PG GDERWPFVTHFVGCK CG   D+ V++C KSMERAFNFADNQVL LYGF HRGLLSP
Sbjct  485   PGLGDERWPFVTHFVGCKPCGRYADYAVDRCFKSMERAFNFADNQVLKLYGFSHRGLLSP  544

Query  1337  NIKRIRNETTLPLPNVDRYDFRHAKHES  1420
              IKRIRNET  PL  VD +D R  + E+
Sbjct  545   KIKRIRNETVSPLEAVDEFDIRRMRVET  572



>dbj|BAK03947.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/470 (63%), Positives = 362/470 (77%), Gaps = 27/470 (6%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MG +   +     GALP TA  A  G + +  +    R R+ISRTFNN+KIT+LCG VTI
Sbjct  6     MGYNSGKAGGGGGGALPMTAARA-RGASPLNTHH---RSRKISRTFNNVKITVLCGLVTI  61

Query  242   LVLRGTIGVG-NLASSDAEVE---NSFLIDETNRILDEIRSDKDPDDPEGQSGDR-----  394
             LVLRGTIG+  +L S  +E +    +  +++ +RIL EIRSD DP DP     D      
Sbjct  62    LVLRGTIGLNLSLPSQPSEADALAGAKAVEDIDRILREIRSDSDPSDPTDSELDSSSVLS  121

Query  395   ---FLSPNE----------TFSLGPKITGWDEQRKVWFDRHPRFPSSV-KGKPRVLLVTG  532
                 L+ +E           ++LGP ++GWDEQR+ W  ++  FP++V  GKPR+LLVTG
Sbjct  122   NATALNTSEAAVAYAAAVGNYALGPNVSGWDEQRRRWLTQNQGFPATVPGGKPRILLVTG  181

Query  533   SPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLS  712
             S P PC+NP+GDHYLLK  KNKIDYCR H IEIV+N A++D+E+ G WAKLPL+RRLMLS
Sbjct  182   SQPGPCDNPLGDHYLLKSTKNKIDYCRFHDIEIVHNLAHLDKELAGYWAKLPLLRRLMLS  241

Query  713   HPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRN  892
             HPE+EWIWWMDSDA FTDMAFE+PLS+YD+HNL+IHGYQDLL ++ SW AL+TGSFL RN
Sbjct  242   HPEVEWIWWMDSDALFTDMAFELPLSRYDNHNLIIHGYQDLLVEKHSWIALNTGSFLFRN  301

Query  893   CQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDK  1072
             CQW+LDLLD WAPMGPKG IREE+GK LTA LKGRP FEADDQSALIYLL+S+K++WMDK
Sbjct  302   CQWSLDLLDAWAPMGPKGFIREEAGKILTAYLKGRPAFEADDQSALIYLLLSQKEKWMDK  361

Query  1073  VFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCV  1252
             V++ENSYYLHG+WAGLVD+YEE+ME +HPG GDERWPFVTHFVGCK CGS GD+PV++C+
Sbjct  362   VYIENSYYLHGFWAGLVDKYEEMMENHHPGLGDERWPFVTHFVGCKPCGSYGDYPVDRCL  421

Query  1253  KSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             KSMERAFNFADNQVL LYGF H+GL SP IKRIR++TT P+ + +  D +
Sbjct  422   KSMERAFNFADNQVLRLYGFAHKGLESPKIKRIRSQTTKPINDKENLDVK  471



>ref|XP_010235491.1| PREDICTED: putative glycosyltransferase 3 [Brachypodium distachyon]
 ref|XP_010235492.1| PREDICTED: putative glycosyltransferase 3 [Brachypodium distachyon]
 ref|XP_010235493.1| PREDICTED: putative glycosyltransferase 3 [Brachypodium distachyon]
Length=477

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/475 (63%), Positives = 366/475 (77%), Gaps = 33/475 (7%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA----LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCG  229
             MGQ+G+     + G     LP TA  A         +    R R+ISRTFNN+KIT++CG
Sbjct  1     MGQEGMGYNNSKGGGGGGGLPMTAARARGASPLSSQH----RSRKISRTFNNVKITVICG  56

Query  230   FVTILVLRGTIGVGNLA----SSDAE-VENSFLIDETNRILDEIRSDKDPDDPEGQS---  385
              VTILVLRGTIG+ NL+     SDA+ +  +  +++ +RIL EIRSD DP DP       
Sbjct  57    LVTILVLRGTIGI-NLSLPSHPSDADALAGAKAVEDIDRILREIRSDSDPSDPADADLDA  115

Query  386   -GDRFLSP--------------NETFSLGPKITGWDEQRKVWFDRHPRFPSSV-KGKPRV  517
              G RF +                  ++LGPKI+GWD+QR+ W  ++P FP++V  GK R+
Sbjct  116   AGLRFNASALSASEVAAAYAAAVGNYALGPKISGWDQQRRQWLAKNPGFPTTVPGGKSRI  175

Query  518   LLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIR  697
             LLVTGS P PC+NP+GDHYLLK  KNKIDYCR+HGIEIV+N A++D+E+ G WAKLPL+R
Sbjct  176   LLVTGSQPGPCDNPLGDHYLLKTTKNKIDYCRLHGIEIVHNLAHLDKELAGYWAKLPLLR  235

Query  698   RLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGS  877
             +LMLSHPE+EWIWWMDSDA FTDMAFE+PLS+Y++HNL+IHGYQDLLF++ SW AL+TGS
Sbjct  236   KLMLSHPEVEWIWWMDSDALFTDMAFELPLSRYENHNLIIHGYQDLLFEKHSWIALNTGS  295

Query  878   FLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKD  1057
             FL RNCQW+LDLLD WAPMGPKG IREE+GK LTANLKGRP FEADDQSALIYLL+S+KD
Sbjct  296   FLFRNCQWSLDLLDTWAPMGPKGFIREEAGKILTANLKGRPAFEADDQSALIYLLLSQKD  355

Query  1058  QWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFP  1237
             +WMDKVF+ENSYYLHG+WAGLVD+YE++ME +HPG GDERWPFVTHFVGCK CGS GD+P
Sbjct  356   KWMDKVFIENSYYLHGFWAGLVDKYEDMMENHHPGLGDERWPFVTHFVGCKPCGSYGDYP  415

Query  1238  VEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             VE+C+KSMERAFNFADNQVL LYGF H+GL SP IKRIR+ TT P+ + +  D +
Sbjct  416   VERCLKSMERAFNFADNQVLRLYGFGHKGLESPKIKRIRSPTTKPINDKENLDVK  470



>emb|CDY26738.1| BnaA06g12840D [Brassica napus]
Length=482

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/446 (64%), Positives = 334/446 (75%), Gaps = 33/446 (7%)
 Frame = +2

Query  182   QISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKD  361
             Q+  T  NIKI ILCGFVTILVL GT+  GNL SS+A+  N  LI ET  IL E  S   
Sbjct  35    QVQNTSINIKIMILCGFVTILVLLGTVSFGNLGSSNADAVNQNLIKETEPILAESPSASV  94

Query  362   PDD------PEGQSGDRF---------------------------LSPNETFSLGPKITG  442
             P D      PE                                  ++PN T++LGP+IT 
Sbjct  95    PTDLEELPKPEANPPTDLEEPPIAEEPSKPEANPPPELEEPPKAEVNPNVTYTLGPRITN  154

Query  443   WDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHG  622
             WD QRKVW +++P FPS V GK R+LL+TGSPP PC+ P+GD+YLLK VKNKIDYCRIHG
Sbjct  155   WDSQRKVWLNQNPGFPSIVNGKARILLLTGSPPGPCDKPIGDYYLLKTVKNKIDYCRIHG  214

Query  623   IEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDS  802
             IEIVYN A++D E+ G W KLP+IRRLMLSHPE+EWIWWMDSDA FTD+ FEIP+S+Y+ 
Sbjct  215   IEIVYNMAHLDEELSGYWTKLPMIRRLMLSHPEVEWIWWMDSDALFTDILFEIPMSRYEK  274

Query  803   HNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTA  982
             HNLVIHGY DLLF+QKSW AL+TG FL+RNCQW+LDLLD WAPMGPKGPIR+E+GK LTA
Sbjct  275   HNLVIHGYPDLLFNQKSWVALNTGVFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKVLTA  334

Query  983   NLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPG  1162
              LKGRP FEADDQSALIYLL+S+K++WM+KV++EN YYLHG+W GLVD+YEE++EKYHPG
Sbjct  335   YLKGRPAFEADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLVDKYEEMIEKYHPG  394

Query  1163  FGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNI  1342
              GDERWPFVTHFVGCK CGS  D+  E+C K MERAFNFADNQVL LYGF H GLLSP +
Sbjct  395   LGDERWPFVTHFVGCKPCGSYADYAEERCFKGMERAFNFADNQVLKLYGFSHMGLLSPKV  454

Query  1343  KRIRNETTLPLPNVDRYDFRHAKHES  1420
             KRIRNET  PL  VD++D R    E+
Sbjct  455   KRIRNETVSPLEFVDKFDIRRTHEET  480



>gb|AFW71661.1| putative glycosyltransferase [Zea mays]
Length=478

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/433 (66%), Positives = 350/433 (81%), Gaps = 24/433 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLA----SSDAE-VENSFLIDETNRIL  337
             R R+I RTFNN+KIT+LCG VTILVLRGTIG+ NL+     SDAE + ++  +++ +RIL
Sbjct  40    RSRKIHRTFNNLKITVLCGLVTILVLRGTIGL-NLSLPSQPSDAEALADAKAVEDIDRIL  98

Query  338   DEIRSDKDPD-DPEGQSG----------------DRFLSPNETFSLGPKITGWDEQRKVW  466
              EIRSD  PD D EG  G                  + +    ++LGPKI+ WD QR+ W
Sbjct  99    REIRSDSGPDPDDEGDFGAASGFNATALSATEAAAAYAAAVGKYALGPKISDWDAQRRRW  158

Query  467   FDRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNS  643
               ++P FP+++ G KPR++LVTGS P PC+NP+GDHYLLK  KNKIDYCR+HGIEIV+N 
Sbjct  159   LAQNPGFPATLAGGKPRIMLVTGSQPGPCDNPLGDHYLLKTTKNKIDYCRLHGIEIVHNL  218

Query  644   ANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHG  823
             A++D E+ G WAKLPL+RRLMLSHPE+EWIWWMDSDA FTDM+FE+PLS+YD HNL+IHG
Sbjct  219   AHLDNELAGYWAKLPLLRRLMLSHPEVEWIWWMDSDALFTDMSFELPLSRYDGHNLIIHG  278

Query  824   YQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPE  1003
             YQDLLF++ SW AL+TGSFL RNCQW+LDLLD WAPMGPKG IR+++GK LTANLKGRP 
Sbjct  279   YQDLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGFIRDQAGKVLTANLKGRPA  338

Query  1004  FEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWP  1183
             FEADDQSALIYLL+S+KD+WMDKVF+ENSYYLHG+WAGLVD+YEE+ME +HPG GDERWP
Sbjct  339   FEADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLVDKYEEMMENHHPGLGDERWP  398

Query  1184  FVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNET  1363
             FVTHFVGCK CGS GD+PVE+C++SMERAFNFADNQVL LYGF H+GL SP IKR R++T
Sbjct  399   FVTHFVGCKPCGSYGDYPVERCLRSMERAFNFADNQVLRLYGFSHKGLESPKIKRFRDQT  458

Query  1364  TLPLPNVDRYDFR  1402
             T P+ +V+  D +
Sbjct  459   TRPINDVENLDMK  471



>ref|XP_011075649.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum]
Length=443

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/453 (63%), Positives = 346/453 (76%), Gaps = 15/453 (3%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
             MG   + S       LPTT      G A      ++  G++ S    N++ITILCG +T+
Sbjct  1     MGLKRIFSTNS---TLPTTTIRG--GRATGAGRRRLHGGQKCS----NLRITILCGVITV  51

Query  242   LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             LV RGTIG+ +L SS  E   +  ++ETNRI+ EIRSD + +D E       +S N+T++
Sbjct  52    LVFRGTIGI-SLFSSFPETTRTSQMEETNRIIAEIRSDYNDNDNES-----VISSNDTYT  105

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             LGPKI  WD  R+ W   H  F S V G+PR+LLVTGS P+PC +P+GDHYLLK +KNKI
Sbjct  106   LGPKILNWDGSRQKWLQEHHGFLSHVNGRPRMLLVTGSQPSPCNSPIGDHYLLKSLKNKI  165

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCR+H IEIVYN A++D+E+ G W KLPLIR LMLSHPE+EWIWWMDSDAFFTDM FEI
Sbjct  166   DYCRVHNIEIVYNMAHLDKELAGYWTKLPLIRMLMLSHPEVEWIWWMDSDAFFTDMFFEI  225

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             P+SKYD +N+V+HGY  LLF +KSW AL+TGSFLIRNCQW+L+LLD WAPMGPKG +R+E
Sbjct  226   PISKYDRYNMVVHGYPSLLFKEKSWIALNTGSFLIRNCQWSLNLLDSWAPMGPKGRVRDE  285

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
             +GK LTANLKGRP FEADDQSALIYLL+S KD+WMDKVFLENSYYLHGYW GLVDRYEE 
Sbjct  286   AGKILTANLKGRPTFEADDQSALIYLLISRKDEWMDKVFLENSYYLHGYWVGLVDRYEEY  345

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             +E+YHPG GDERWPFVTHFVGCK CG  GD+ +E+C++SME+AFNFADNQ+L  YGF HR
Sbjct  346   IERYHPGLGDERWPFVTHFVGCKPCGGYGDYSLERCLQSMEKAFNFADNQLLKSYGFSHR  405

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             GLLSPN+KRIRNETT PL   D  + R + + S
Sbjct  406   GLLSPNVKRIRNETTRPLDVTDNINIRTSMYRS  438



>ref|XP_006348817.1| PREDICTED: putative glycosyltransferase 3-like [Solanum tuberosum]
Length=470

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/409 (69%), Positives = 338/409 (83%), Gaps = 7/409 (2%)
 Frame = +2

Query  188   SRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEV-ENSFLIDETNRILDEIRSDKDP  364
             + +F N+++TILCG VTILVLRGTIG+ N +S+   + +N  L++ETNR++ EIR D + 
Sbjct  25    ANSFINLRLTILCGVVTILVLRGTIGINNFSSNSPSLNQNQKLVEETNRVIAEIRYDDN-  83

Query  365   DDPEGQSGDRFLSP-NETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPP  541
                +    D F  P N T+SLGPKI  WD  RK W   +PRFPS + GKPRVLLVTGSPP
Sbjct  84    ---DNDDDDNFEYPQNSTYSLGPKIDNWDSTRKSWLHGNPRFPSYINGKPRVLLVTGSPP  140

Query  542   TPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPE  721
             +PC+N +GDHYLLK +KNKIDYCRIH IEIVYN A+ D+++ G W+KLPLIR+LM+SHPE
Sbjct  141   SPCDNSIGDHYLLKSIKNKIDYCRIHNIEIVYNMAHFDKQLSGYWSKLPLIRKLMMSHPE  200

Query  722   IEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQW  901
             IEWIWWMDSDA FTDM FEIPLSKY+  NL+IHGY +LL ++KSW AL+TGSFL+RNCQW
Sbjct  201   IEWIWWMDSDAMFTDMVFEIPLSKYNGKNLIIHGYPELL-NEKSWVALNTGSFLLRNCQW  259

Query  902   ALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFL  1081
             +LDLLD WAPMGPKG IR+++GK L+ NLKGRP FEADDQSALIY+L+   ++WMDKVF+
Sbjct  260   SLDLLDSWAPMGPKGKIRDDAGKILSENLKGRPNFEADDQSALIYMLILRNNKWMDKVFV  319

Query  1082  ENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSM  1261
             ENSYYLHGYWAGLVDRYEE+++KYHPGFGDERWPFVTHFVGCK CGS GD+PVEKC+KSM
Sbjct  320   ENSYYLHGYWAGLVDRYEEMIQKYHPGFGDERWPFVTHFVGCKPCGSYGDYPVEKCLKSM  379

Query  1262  ERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHA  1408
             ERAFNFADNQVL LYGF+HRGL SPN+KRIRNET  PL  V   D RH+
Sbjct  380   ERAFNFADNQVLKLYGFRHRGLSSPNVKRIRNETFRPLEFVSDLDIRHS  428



>ref|XP_002453927.1| hypothetical protein SORBIDRAFT_04g021570 [Sorghum bicolor]
 gb|EES06903.1| hypothetical protein SORBIDRAFT_04g021570 [Sorghum bicolor]
Length=480

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/433 (66%), Positives = 348/433 (80%), Gaps = 24/433 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLA-----SSDAEVENSFLIDETNRIL  337
             R R+I RTFNN+KIT+LCG VTILVLRGTIG+ NL+     S    + ++  +++ +RIL
Sbjct  42    RSRKIHRTFNNLKITVLCGLVTILVLRGTIGL-NLSLPSQPSDADALADAKAVEDIDRIL  100

Query  338   DEIRSDKDPD-DPEG--QSGDRFLSPNET--------------FSLGPKITGWDEQRKVW  466
              EIRSD  PD D EG   +   F +   +              ++LGPKI+ WD QR+ W
Sbjct  101   REIRSDSGPDPDDEGDFSAASGFNASALSATEADAAYAAAVGRYALGPKISDWDAQRRRW  160

Query  467   FDRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNS  643
               R+P FP++V G KPR++LVTGS P PC+NP+GDHYLLK  KNKIDYCRIHGI+IV+N 
Sbjct  161   LARNPGFPATVAGGKPRIMLVTGSQPGPCDNPLGDHYLLKTTKNKIDYCRIHGIQIVHNL  220

Query  644   ANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHG  823
             A++D E+ G WAKLPL+RRLMLSHPE+EWIWWMDSDA FTDMAFE+PLS+YD HNL+IHG
Sbjct  221   AHLDNELAGYWAKLPLLRRLMLSHPEVEWIWWMDSDALFTDMAFELPLSRYDGHNLIIHG  280

Query  824   YQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPE  1003
             YQDLLF++ SW AL+TGSFL RNCQW+LDLLD WAPMGPKG IR+++GK LTANLKGRP 
Sbjct  281   YQDLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGFIRDQAGKVLTANLKGRPA  340

Query  1004  FEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWP  1183
             FEADDQSALIYLL+S+KD+WMDKVF+ENSYYLHG+WAGLVD+YEE+ME +HPG GDERWP
Sbjct  341   FEADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLVDKYEEMMENHHPGLGDERWP  400

Query  1184  FVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNET  1363
             FVTHFVGCK CGS GD+PVE+C++SMERAFNFADNQVL LYGF H+GL SP IKR R++T
Sbjct  401   FVTHFVGCKPCGSYGDYPVERCLRSMERAFNFADNQVLRLYGFSHKGLESPKIKRTRDQT  460

Query  1364  TLPLPNVDRYDFR  1402
             T P+ +V+  D +
Sbjct  461   TRPINDVENLDMK  473



>ref|XP_009420521.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=456

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 341/420 (81%), Gaps = 14/420 (3%)
 Frame = +2

Query  182   QISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKD  361
             QI +TFNN+KIT+LCG VTILVLRGTIG+G+LA +  E ++  ++++ +RIL EIRSD D
Sbjct  29    QIRKTFNNLKITVLCGVVTILVLRGTIGIGSLAGAGGEADDQKVVEDIDRILREIRSDSD  88

Query  362   PDD----PEG---------QSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVK  502
             PDD    P G          +    L+    ++LGP+I+ WDEQR+ W   +P FPS   
Sbjct  89    PDDDDKIPFGFNSTAAALNYTSASVLAAAANYTLGPRISDWDEQRRRWLGENPGFPSRTF  148

Query  503   G-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWA  679
             G KPR+LLVTGSPP PC+NP+GDHYLLKG KNKIDYCR+HGIEIVYN A++DRE+ G WA
Sbjct  149   GLKPRILLVTGSPPNPCDNPIGDHYLLKGTKNKIDYCRLHGIEIVYNMAHLDRELAGYWA  208

Query  680   KLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWT  859
             KLPLIRRLMLSHPE+EWIWWMDSDA FTDMAFEIPL +Y +HNLV+HGY DL+F++ SW 
Sbjct  209   KLPLIRRLMLSHPEVEWIWWMDSDALFTDMAFEIPLDRYAAHNLVVHGYPDLIFEKHSWI  268

Query  860   ALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYL  1039
              L+TGSFL+RNCQW+LDLLD WAPMGPKGPIR+E+GK LTANL+GRP FEADDQSALIYL
Sbjct  269   GLNTGSFLLRNCQWSLDLLDAWAPMGPKGPIRDEAGKILTANLQGRPAFEADDQSALIYL  328

Query  1040  LMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACG  1219
             ++S++D+W DK+++ENSYYLHGYWAGLVDRYEE+M+K+HPG GDERWPFVTHFVGCK CG
Sbjct  329   VLSQQDRWGDKIYIENSYYLHGYWAGLVDRYEEMMDKHHPGLGDERWPFVTHFVGCKPCG  388

Query  1220  SSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDF  1399
             S GD+PVE+C+ SMERAFNFADNQVL +YGF H  L SP IKR R +T  PL  +D  + 
Sbjct  389   SYGDYPVERCLSSMERAFNFADNQVLRMYGFAHGKLSSPKIKRTRKQTAKPLEFLDHLNL  448



>ref|NP_001105849.1| putative glycosyltransferase [Zea mays]
 emb|CAJ57382.1| putative glycosyltransferase [Zea mays]
Length=478

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/433 (66%), Positives = 350/433 (81%), Gaps = 24/433 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLA----SSDAE-VENSFLIDETNRIL  337
             R R+I RTFNN+KIT+LCG VTILVLRGTIG+ NL+     SDAE + ++  +++ +RIL
Sbjct  40    RSRKIHRTFNNLKITVLCGLVTILVLRGTIGL-NLSLPSQPSDAEALADAKAVEDIDRIL  98

Query  338   DEIRSDKDPD-DPEGQSG----------------DRFLSPNETFSLGPKITGWDEQRKVW  466
              EIRSD  PD D EG  G                  + +    ++LGPKI+ WD QR+ W
Sbjct  99    REIRSDSGPDPDDEGDFGAASGFNATALSATEAAAAYAAAVGKYALGPKISDWDAQRRRW  158

Query  467   FDRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNS  643
               ++P FP+++ G KPR++LVTGS P PC+NP+GDHYLLK  KNKIDYCR+HGIEIV+N 
Sbjct  159   LAQNPGFPATLAGGKPRIMLVTGSQPGPCDNPLGDHYLLKTTKNKIDYCRLHGIEIVHNL  218

Query  644   ANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHG  823
             A++D E+ G WAKLPL+RRLMLSHPE+EWIWW+DSDA FTDM+FE+PLS+YD HNL+IHG
Sbjct  219   AHLDNELAGYWAKLPLLRRLMLSHPEVEWIWWIDSDALFTDMSFELPLSRYDGHNLIIHG  278

Query  824   YQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPE  1003
             YQDLLF++ SW AL+TGSFL RNCQW+LDLLD WAPMGPKG IR+++GK LTANLKGRP 
Sbjct  279   YQDLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGFIRDQAGKVLTANLKGRPA  338

Query  1004  FEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWP  1183
             FEADDQSALIYLL+S+KD+WMDKVF+ENSYYLHG+WAGLVD+YEE+ME +HPG GDERWP
Sbjct  339   FEADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLVDKYEEMMENHHPGLGDERWP  398

Query  1184  FVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNET  1363
             FVTHFVGCK CGS GD+PVE+C++SMERAFNFADNQVL LYGF H+GL SP IKR R++T
Sbjct  399   FVTHFVGCKPCGSYGDYPVERCLRSMERAFNFADNQVLRLYGFSHKGLESPKIKRFRDQT  458

Query  1364  TLPLPNVDRYDFR  1402
             T P+ +V+  D +
Sbjct  459   TRPINDVENLDMK  471



>ref|XP_006416577.1| hypothetical protein EUTSA_v10007657mg [Eutrema salsugineum]
 gb|ESQ34930.1| hypothetical protein EUTSA_v10007657mg [Eutrema salsugineum]
Length=440

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/411 (68%), Positives = 324/411 (79%), Gaps = 9/411 (2%)
 Frame = +2

Query  185   ISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDP  364
             +  T  NIKI ILCGF+TI++L GT  +GN  SS          D    IL E  S  DP
Sbjct  36    VQNTLINIKIMILCGFLTIVLLLGTTSIGNFGSSST--------DSVKPILAESPSGSDP  87

Query  365   DDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPT  544
              D + +     ++PN T++LGP+IT WD QRKVW + +P FPS V GK R+LL+TGS P 
Sbjct  88    TDLD-EPPKAEINPNVTYTLGPRITNWDSQRKVWLNHNPGFPSIVNGKARILLLTGSTPG  146

Query  545   PCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEI  724
             PC  PVGD+YLLK VKNKIDYCR+HGIEIVYN AN+D E+ G W KLP+IRRLMLSHPE+
Sbjct  147   PCVKPVGDYYLLKSVKNKIDYCRLHGIEIVYNMANLDEELGGYWTKLPMIRRLMLSHPEV  206

Query  725   EWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWA  904
             EWIWWMDSDA FTD+ FEIPL +Y+ HNLVIHGY DLLF+QKSW AL+TG FL+RNCQW+
Sbjct  207   EWIWWMDSDALFTDILFEIPLYRYEKHNLVIHGYPDLLFNQKSWVALNTGVFLLRNCQWS  266

Query  905   LDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLE  1084
             LDLLD WAPMGPKG IREE+GK LTA LKGRP FEADDQSALIYLL+S+KD+WM+KVF+E
Sbjct  267   LDLLDAWAPMGPKGTIREEAGKILTAYLKGRPAFEADDQSALIYLLLSQKDKWMEKVFVE  326

Query  1085  NSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSME  1264
             N YYLHG+W GLVDRYEE++EKYHPG GDERWPFVTHFVGCK CGS  D+ V++C KSME
Sbjct  327   NQYYLHGFWEGLVDRYEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYADYAVDRCFKSME  386

Query  1265  RAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHE  1417
             RAFNFADNQVL LYGF+HRGLLSP IKRIRNET  PL  VD++D R    E
Sbjct  387   RAFNFADNQVLELYGFRHRGLLSPKIKRIRNETVSPLEFVDKFDIRRRHAE  437



>ref|XP_004952632.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=475

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/437 (65%), Positives = 348/437 (80%), Gaps = 31/437 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLA----SSDAE-VENSFLIDETNRIL  337
             R R+I RTFNN+KIT+LCG VTILVLRGTIG+ NL+     +DAE +  +  +++ +RIL
Sbjct  36    RSRKIHRTFNNLKITVLCGLVTILVLRGTIGL-NLSLPSQPNDAEALAGAKAVEDIDRIL  94

Query  338   DEIRSDKDPDDPEGQSGDRFLSPNETFSLG---------------------PKITGWDEQ  454
              EIRSD  PD P+ + G+   S N  F+                       PKI+ WD Q
Sbjct  95    REIRSDSGPD-PDDEGGE--FSANAGFNASALSAAEAAAAYAAAAGKYALGPKISDWDAQ  151

Query  455   RKVWFDRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEI  631
             R+ W   +P FP++V G KPR++LVTGS P PC+NP+GDHYLLK  KNK+DYCR+HGIEI
Sbjct  152   RRRWLAENPGFPATVAGGKPRIMLVTGSQPGPCDNPLGDHYLLKSTKNKMDYCRLHGIEI  211

Query  632   VYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNL  811
             V+N A++D E+ G WAKLPL+RRLMLSHPE+EWIWWMDSDA FTDMAFE+PLS+YD HNL
Sbjct  212   VHNLAHLDTELAGYWAKLPLLRRLMLSHPEVEWIWWMDSDALFTDMAFELPLSRYDGHNL  271

Query  812   VIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLK  991
             +IHGYQDLLF++ SW AL+TGSFL RNCQW+LDLLD WAPMGPKG IR+++GK LTANLK
Sbjct  272   IIHGYQDLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGPKGFIRDQAGKVLTANLK  331

Query  992   GRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGD  1171
             GRP FEADDQSALIYLL+S+K++WMDKVF+ENSYYLHG+WAGLVD+YEE+ME +HPG GD
Sbjct  332   GRPAFEADDQSALIYLLLSQKEKWMDKVFIENSYYLHGFWAGLVDKYEEMMENHHPGLGD  391

Query  1172  ERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRI  1351
             ERWPFVTHFVGCK CGS GD+PVE+C+KSMERAFNFADNQVL LYGF H+GL SP IKRI
Sbjct  392   ERWPFVTHFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLRLYGFSHKGLESPKIKRI  451

Query  1352  RNETTLPLPNVDRYDFR  1402
             R++T+ P+ +V+  D +
Sbjct  452   RDQTSKPINDVENLDMK  468



>ref|XP_006647332.1| PREDICTED: putative glycosyltransferase 5-like [Oryza brachyantha]
Length=481

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/431 (66%), Positives = 342/431 (79%), Gaps = 25/431 (6%)
 Frame = +2

Query  182   QISRTFNNIKITILCGFVTILVLRGTIGVG----NLASSDAEVENSFLIDETNRILDEIR  349
             +I RTFNN+KIT+LCG VTILVLRGTIG+     N  +    +  +  +++ +RIL EIR
Sbjct  45    KIHRTFNNVKITVLCGLVTILVLRGTIGLNLSLPNQPTDADALAGAKAVEDIDRILREIR  104

Query  350   SDKDPDDPEGQSGDRFLSPNET-------------------FSLGPKITGWDEQRKVWFD  472
             SD  PDD +  +GD   S                       ++LGPKI+ WD QR+ W  
Sbjct  105   SDSGPDDVD-DAGDLGGSAAYNATALNATEAAAAYAAAVGRYALGPKISDWDGQRRRWLR  163

Query  473   RHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSAN  649
             ++P FP+S+  GKPR+LLVTGS P PC+NP+GDHYLLK  KNKIDYCR+HGIEIV+N A+
Sbjct  164   QNPGFPASIAAGKPRILLVTGSQPGPCDNPLGDHYLLKTTKNKIDYCRLHGIEIVHNLAH  223

Query  650   MDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQ  829
             +D E+ G WAKLPL+RRLMLSHPE+EWIWWMDSDA FTDMAFE+PLS+YD+ NL+IHGYQ
Sbjct  224   LDTELAGYWAKLPLLRRLMLSHPEVEWIWWMDSDALFTDMAFELPLSRYDNRNLIIHGYQ  283

Query  830   DLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFE  1009
             DLLFD+ SW AL+TGSFL RNCQW+LDLLD WAPMGPKG IR+E+GK LTANLKGRP FE
Sbjct  284   DLLFDKHSWIALNTGSFLFRNCQWSLDLLDSWAPMGPKGFIRDEAGKILTANLKGRPAFE  343

Query  1010  ADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFV  1189
             ADDQSALIYLL+S+K++WMDKVF+ENSYYLHG+WAGLVD+YEE+ME +HPG GDERWPFV
Sbjct  344   ADDQSALIYLLLSQKEKWMDKVFIENSYYLHGFWAGLVDKYEEMMENHHPGLGDERWPFV  403

Query  1190  THFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTL  1369
             THFVGCK CGS GD+PVE+C+KSMERAFNFADNQVL LYGF H+GL SP IKR+RN+TT 
Sbjct  404   THFVGCKPCGSYGDYPVERCLKSMERAFNFADNQVLRLYGFAHKGLESPKIKRVRNQTTK  463

Query  1370  PLPNVDRYDFR  1402
             P+ + +  D +
Sbjct  464   PIDDKENLDVK  474



>gb|AHC98117.1| putative xyloglucan alpha-1,6-xylosyltransferase [Pinus radiata]
 tpg|DAA64592.1| TPA_inf: xyloglucan alpha-1,6-xylosyltransferase [Pinus taeda]
Length=449

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/419 (65%), Positives = 337/419 (80%), Gaps = 7/419 (2%)
 Frame = +2

Query  167   VPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSF--LIDETNRILD  340
             +P+ R I +TFNN+KITILCGFVTILVLRGTIGVGNL         +   + +E  R L+
Sbjct  23    LPKARSIQKTFNNLKITILCGFVTILVLRGTIGVGNLGGQGTGDGGASQKVAEENARALE  82

Query  341   EIRSDKDPDDPEGQSGDRFLS----PNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGK  508
             EIR  +DPD+ E + G +  S    PN T++LGP+I+ WD+QR  W   +P+FPS V GK
Sbjct  83    EIRRKEDPDE-ENELGMQIDSNATYPNVTYTLGPRISDWDQQRITWIKENPQFPSYVNGK  141

Query  509   PRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLP  688
             PR+LLVTGS P PC++ VGDHYLLKG+KNKIDYCR+HGIEIVYN A++D+EM G WAKLP
Sbjct  142   PRILLVTGSQPNPCDSSVGDHYLLKGIKNKIDYCRLHGIEIVYNMAHLDKEMAGYWAKLP  201

Query  689   LIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALS  868
             L+RRLMLSHPE+EWIWWMDSDA FTDM FE+PL KY ++N V+HG+++L++ ++SW  L+
Sbjct  202   LLRRLMLSHPEVEWIWWMDSDAMFTDMVFELPLDKYKNYNFVLHGWENLVYGKQSWIGLN  261

Query  869   TGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMS  1048
             TGSFLIRNCQW+LD+LD WAPMGPKG IREE+GK LTA+L+GRP FEADDQSALIYLL+S
Sbjct  262   TGSFLIRNCQWSLDILDAWAPMGPKGKIREEAGKILTAHLEGRPAFEADDQSALIYLLIS  321

Query  1049  EKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSG  1228
             +K  W DKVFLE+SY+LHG+W  +VD+YE+++  YHPG GDERWPFVTHFVGCK CGS G
Sbjct  322   QKKLWGDKVFLESSYFLHGFWVVVVDKYEDMIRTYHPGLGDERWPFVTHFVGCKPCGSYG  381

Query  1229  DFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             D+PVE+C+KSMERAFNFADNQ+L +YGFKH+ L +  +KR RNET  PL   D ++  H
Sbjct  382   DYPVERCLKSMERAFNFADNQILQIYGFKHKSLNTAKVKRTRNETASPLEVKDEFNLLH  440



>gb|ADE59448.1| galactosyltransferase [Triticum aestivum]
Length=478

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/476 (62%), Positives = 365/476 (77%), Gaps = 34/476 (7%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA-----LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILC  226
             MGQ+G+  +  + G      LP TA  A  G + +  +    R R+ISRTFNN+KIT+LC
Sbjct  1     MGQEGMGYSSGKAGGGGGGALPMTAARA-RGASPLSTHH---RSRKISRTFNNVKITVLC  56

Query  227   GFVTILVLRGTIGVGNLA----SSDAE-VENSFLIDETNRILDEIRSDKDPDDPEGQS--  385
             G VTILVLRGTIG+ NL+     SDA+ +  +  +++ +RIL EIRSD DP DP      
Sbjct  57    GLVTILVLRGTIGL-NLSLPSQPSDADALAGAKAVEDIDRILREIRSDSDPSDPTDSDLD  115

Query  386   ------GDRFLSPNE----------TFSLGPKITGWDEQRKVWFDRHPRFPSSV-KGKPR  514
                       L+ +E           ++LGP ++GWDEQR+ W  ++  FP++V  GKPR
Sbjct  116   SSSVLSNATALNSSEAAAAYAAAVGNYALGPNVSGWDEQRRRWLAQNKGFPATVPGGKPR  175

Query  515   VLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLI  694
             +LLVTGS P PC+NP+GDHYLLK  KNKIDYCR H IEIV+N A++D E+ G WAKLPL+
Sbjct  176   ILLVTGSQPGPCDNPLGDHYLLKSTKNKIDYCRFHDIEIVHNLAHLDNELAGYWAKLPLL  235

Query  695   RRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTG  874
             RRLMLSHPE+EWIWWMDSDA FTDMAFE+PLS+YD+HNL+IHGY DLLF++ SW AL+TG
Sbjct  236   RRLMLSHPEVEWIWWMDSDALFTDMAFELPLSRYDNHNLIIHGYHDLLFEKHSWIALNTG  295

Query  875   SFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEK  1054
             SFL RNCQW+LDLL  WAPMGPKG IREE+GK LTA LKGRP FEADDQSALIYLL+S+K
Sbjct  296   SFLFRNCQWSLDLLAAWAPMGPKGFIREEAGKILTAYLKGRPAFEADDQSALIYLLLSQK  355

Query  1055  DQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDF  1234
             ++WMDKV++ENSYYLHG+WAGLVD+YEE+ME +HPG GDERWPFVTHFVGCK CGS GD+
Sbjct  356   EKWMDKVYIENSYYLHGFWAGLVDKYEEMMENHHPGLGDERWPFVTHFVGCKPCGSYGDY  415

Query  1235  PVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             PV++C+KSMERAFNFADNQVL+LYGF H+GL SP IKRIR++TT P+ + +  D +
Sbjct  416   PVDRCLKSMERAFNFADNQVLHLYGFAHKGLESPKIKRIRSQTTKPINDKENLDVK  471



>gb|AFK30383.1| galactosyltransferase B1 [Triticum aestivum]
 gb|AFK30384.1| galactosyltransferase B2 [Triticum aestivum]
 gb|AFK30385.1| galactosyltransferase B3 [Triticum aestivum]
Length=478

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/479 (62%), Positives = 364/479 (76%), Gaps = 40/479 (8%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA-----LPTTATDAMNGDARIRANPQVP---RGRQISRTFNNIKIT  217
             MGQ+G+  +  + G      LP TA       AR R    +    R R+ISRTFNN+KIT
Sbjct  1     MGQEGMGYSSGKAGGGGGGALPMTA-------ARARGASPLSTHHRSRKISRTFNNVKIT  53

Query  218   ILCGFVTILVLRGTIGVGNLA----SSDAE-VENSFLIDETNRILDEIRSDKDPDDPEGQ  382
             +LCG VTILVLRGTIG+ NL+     SDA+ +  +  +++ +RIL EIRSD DP DP   
Sbjct  54    VLCGLVTILVLRGTIGL-NLSLPSQPSDADALAGAKAVEDIDRILREIRSDSDPSDPTDS  112

Query  383   S--------GDRFLSPNE----------TFSLGPKITGWDEQRKVWFDRHPRFPSSV-KG  505
                          L+ +E           ++LGP ++GWDEQR+ W  ++  FP++V  G
Sbjct  113   DLDSSSVLSNATALNSSEAAAAYAAAVGNYALGPNVSGWDEQRRRWLAQNKGFPATVPGG  172

Query  506   KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKL  685
             KPR+LLVTGS P PC+NP+GDHYLLK  KNKIDYCR H IEIV+N A++D E+ G WAKL
Sbjct  173   KPRILLVTGSQPGPCDNPLGDHYLLKSTKNKIDYCRFHDIEIVHNLAHLDNELAGYWAKL  232

Query  686   PLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTAL  865
             PL+RRLMLSHPE+EWIWWMDSDA FTDMAFE+PLS+YD+HNL+IHGYQDLLF++ SW AL
Sbjct  233   PLLRRLMLSHPEVEWIWWMDSDALFTDMAFELPLSRYDNHNLIIHGYQDLLFEKHSWIAL  292

Query  866   STGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLM  1045
             +TGSFL RNCQW+LDLL  WAPMGPKG IREE+GK LTA LKGRP FEADDQSALI+LL+
Sbjct  293   NTGSFLFRNCQWSLDLLAAWAPMGPKGFIREEAGKILTAYLKGRPAFEADDQSALIHLLL  352

Query  1046  SEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSS  1225
             S+K++WMDKV++ENSYYLHG+WAGLVD+YEE+ME +HPG GDERWPFVTHFVGCK CGS 
Sbjct  353   SQKEKWMDKVYIENSYYLHGFWAGLVDKYEEMMENHHPGLGDERWPFVTHFVGCKPCGSY  412

Query  1226  GDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             GD+PV++C+KSMERAFNFADNQVL LYGF H+GL SP IKRIR++TT P+ + +  D +
Sbjct  413   GDYPVDRCLKSMERAFNFADNQVLRLYGFAHKGLESPKIKRIRSQTTKPINDKENLDVK  471



>gb|AFK30382.1| galactosyltransferase A [Triticum aestivum]
Length=478

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/479 (62%), Positives = 362/479 (76%), Gaps = 40/479 (8%)
 Frame = +2

Query  62    MGQDGVLSAQKRPGA-----LPTTATDAMNGDARIRANPQVP---RGRQISRTFNNIKIT  217
             MGQ+G+  +  + G      LP TA       AR R    +    R R+ISRTFNN+KIT
Sbjct  1     MGQEGMGYSSGKAGGGGGGALPMTA-------ARARGASPLSTHHRSRKISRTFNNVKIT  53

Query  218   ILCGFVTILVLRGTIGVGNLA----SSDAE-VENSFLIDETNRILDEIRSDKDPDDPEGQ  382
             +LCG VTILVLRGTIG+ NL+     SDA+ +  +  +++ +RIL EIRSD DP DP   
Sbjct  54    VLCGLVTILVLRGTIGL-NLSLPSQPSDADALAGAKAVEDIDRILREIRSDSDPSDPTDS  112

Query  383   S--------GDRFLSPNE----------TFSLGPKITGWDEQRKVWFDRHPRFPSSV-KG  505
                          L+ +E            +LGP ++GWDEQR+ W  ++  FP++V  G
Sbjct  113   DLDSSSVLSNATALNSSEAAAAYAAAVGNHALGPNVSGWDEQRRRWLAQNKGFPATVPGG  172

Query  506   KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKL  685
             KPR+LLVTGS P PC+NP+GDHYLLK  KNKIDYCR H IEIV+N A++D E+ G WAKL
Sbjct  173   KPRILLVTGSQPGPCDNPLGDHYLLKSTKNKIDYCRFHDIEIVHNLAHLDNELAGYWAKL  232

Query  686   PLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTAL  865
             PL+RRLMLSHPE+EWIWWMDSDA FTDMAFE+PLS+YD+HNL+IHGY DLLF++ SW AL
Sbjct  233   PLLRRLMLSHPEVEWIWWMDSDALFTDMAFELPLSRYDNHNLIIHGYHDLLFEKHSWIAL  292

Query  866   STGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLM  1045
             +TGSFL RNCQW+LDLL  WAPMGPKG IREE+GK LTA LKGRP FEADDQSALIYLL+
Sbjct  293   NTGSFLFRNCQWSLDLLAAWAPMGPKGFIREEAGKILTAYLKGRPAFEADDQSALIYLLL  352

Query  1046  SEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSS  1225
             S+K++WMDKV++ENSYYLHG+WAGLVD+YEE+ME +HPG GDERWPFVTHFVGCK CGS 
Sbjct  353   SQKEKWMDKVYIENSYYLHGFWAGLVDKYEEMMENHHPGLGDERWPFVTHFVGCKPCGSY  412

Query  1226  GDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             GD+PV++C+KSMERAFNFADNQVL LYGF H+GL SP IKRIR++TT P+ + +  D +
Sbjct  413   GDYPVDRCLKSMERAFNFADNQVLRLYGFAHKGLESPKIKRIRSQTTKPINDKEDLDVK  471



>ref|NP_001047014.1| Os02g0529600 [Oryza sativa Japonica Group]
 dbj|BAD25434.1| putative galactomannan galactosyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF08928.1| Os02g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94866.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73308.1| hypothetical protein OsI_07488 [Oryza sativa Indica Group]
 gb|EEE57116.1| hypothetical protein OsJ_06989 [Oryza sativa Japonica Group]
Length=480

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/454 (63%), Positives = 351/454 (77%), Gaps = 23/454 (5%)
 Frame = +2

Query  107   LPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVG----N  274
             LP TA     G + + ++    R R+I RTFNN+KIT+LCG VTILVLRGTIG+     N
Sbjct  21    LPMTAPRP-RGASPLSSHGHHHRSRKIHRTFNNVKITVLCGLVTILVLRGTIGLNLSLPN  79

Query  275   LASSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPN---------------  409
               +    +  +  +++ +RIL EIRSD   DD    +GD   S N               
Sbjct  80    QPTDADALAGAKAVEDIDRILREIRSDGGADDDAAAAGDLAGSFNATALNATEAAAAYAS  139

Query  410   --ETFSLGPKITGWDEQRKVWFDRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLL  580
               E ++LGPKI+ WD QR+ W  ++P FPS+V G KPR+LLVTGS P PC+NP+GDHYLL
Sbjct  140   AVERYALGPKISDWDGQRRRWLRQNPGFPSTVAGGKPRILLVTGSQPGPCDNPLGDHYLL  199

Query  581   KGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFF  760
             K  KNKIDYCR+HGIEIV+N A++D E+ G WAKLPL+RRLMLSHPE+EWIWWMDSDA F
Sbjct  200   KTTKNKIDYCRLHGIEIVHNLAHLDTELAGYWAKLPLLRRLMLSHPEVEWIWWMDSDALF  259

Query  761   TDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGP  940
             TDMAFE+PLS+Y   NL+IHGYQDLLF++ SW AL+TGSFL RNCQW+LDLLD WAPMGP
Sbjct  260   TDMAFELPLSRYQDRNLIIHGYQDLLFEKHSWIALNTGSFLFRNCQWSLDLLDAWAPMGP  319

Query  941   KGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGL  1120
             KG IR+E+GK LTANLKGRP FEADDQSALIYLL+S+K++WM+KVF+ENSYYLHG+WAGL
Sbjct  320   KGFIRDEAGKILTANLKGRPAFEADDQSALIYLLLSQKEKWMNKVFIENSYYLHGFWAGL  379

Query  1121  VDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLN  1300
             VD+YEE+ME +HPG GDERWPFVTHFVGCK CGS GD+PVE+C++SMERAFNFADNQVL 
Sbjct  380   VDKYEEMMENHHPGLGDERWPFVTHFVGCKPCGSYGDYPVERCLRSMERAFNFADNQVLR  439

Query  1301  LYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
             LYGF H+GL SP IKR+RN+TT P+ + +  D +
Sbjct  440   LYGFAHKGLESPKIKRVRNQTTKPIDDKENLDVK  473



>ref|NP_173304.2| putative glycosyltransferase 4 [Arabidopsis thaliana]
 sp|Q9M9U0.1|GT4_ARATH RecName: Full=Putative glycosyltransferase 4; Short=AtGT4 [Arabidopsis 
thaliana]
 gb|AAF27110.1|AC011809_19 Similar to galactosyltransferase [Arabidopsis thaliana]
 gb|AEE29746.1| putative glycosyltransferase 4 [Arabidopsis thaliana]
 gb|AHL38941.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=513

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/502 (59%), Positives = 347/502 (69%), Gaps = 69/502 (14%)
 Frame = +2

Query  107   LPTTATDAMNGDARIRANPQVPRGRQISRT-FNNIKITILCGFVTILVLRGTIGVGNLAS  283
             L TTA    NG  R R      RG QI  T FNNIK  ILC FVTIL+L GTI VGNL S
Sbjct  15    LSTTAVS--NGGWRTRG---FLRGWQIQNTLFNNIKFMILCCFVTILILLGTIRVGNLGS  69

Query  284   SDAEVENSFLIDETNRILDEIRSDKDPDD-------------------------PEGQSG  388
             S+A+  N   I ET  IL EI SD    D                          +  S 
Sbjct  70    SNADSVNQSFIKETIPILAEIPSDSHSTDLAEPPKADVSPNATYTLEPRIAEIPSDVHST  129

Query  389   DRF------LSPNETFSLGP--------------------------------KITGWDEQ  454
             D        +SPN T++LGP                                KIT WD Q
Sbjct  130   DLVELPKADISPNATYTLGPRIAEIPSDSHLTDLLEPPKADISPNATYTLGPKITNWDSQ  189

Query  455   RKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIV  634
             RKVW +++P FP+ V GK R+LL+TGS P PC+ P+G++YLLK VKNKIDYCR+HGIEIV
Sbjct  190   RKVWLNQNPEFPNIVNGKARILLLTGSSPGPCDKPIGNYYLLKAVKNKIDYCRLHGIEIV  249

Query  635   YNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLV  814
             YN AN+D E+ G W KLP+IR LMLSHPE+EWIWWMDSDA FTD+ FEIPL +Y++HNLV
Sbjct  250   YNMANLDEELSGYWTKLPMIRTLMLSHPEVEWIWWMDSDALFTDILFEIPLPRYENHNLV  309

Query  815   IHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKG  994
             IHGY DLLF+QKSW AL+TG FL+RNCQW+LDLLD WAPMGPKG IR+E+GK LTA LKG
Sbjct  310   IHGYPDLLFNQKSWVALNTGIFLLRNCQWSLDLLDAWAPMGPKGKIRDETGKILTAYLKG  369

Query  995   RPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDE  1174
             RP FEADDQSALIYLL+S+K++W++KV++EN YYLHG+W GLVDRYEE++EKYHPG GDE
Sbjct  370   RPAFEADDQSALIYLLLSQKEKWIEKVYVENQYYLHGFWEGLVDRYEEMIEKYHPGLGDE  429

Query  1175  RWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIR  1354
             RWPFVTHFVGCK CGS  D+ V++C KSMERAFNFADNQVL LYGF HRGLLSP IKRIR
Sbjct  430   RWPFVTHFVGCKPCGSYADYAVDRCFKSMERAFNFADNQVLKLYGFSHRGLLSPKIKRIR  489

Query  1355  NETTLPLPNVDRYDFRHAKHES  1420
             NET  PL +VD++D R    E+
Sbjct  490   NETVSPLESVDKFDIRRMHMET  511



>dbj|BAD43079.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01601.1| hypothetical protein [Arabidopsis thaliana]
Length=513

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/502 (59%), Positives = 347/502 (69%), Gaps = 69/502 (14%)
 Frame = +2

Query  107   LPTTATDAMNGDARIRANPQVPRGRQISRT-FNNIKITILCGFVTILVLRGTIGVGNLAS  283
             L TTA    NG  R R      RG QI  T FNNIK  ILC FVTIL+L GTI VGNL S
Sbjct  15    LSTTAVS--NGGWRTRG---FLRGWQIQNTLFNNIKFMILCCFVTILILLGTIRVGNLGS  69

Query  284   SDAEVENSFLIDETNRILDEIRSDKDPDD-------------------------PEGQSG  388
             S+A+  N   I ET  IL EI SD    D                          +  S 
Sbjct  70    SNADSVNQSFIKETIPILAEIPSDSYSTDLAEPPKADVSPNATYTLEPRIAEIPSDVHST  129

Query  389   DRF------LSPNETFSLGP--------------------------------KITGWDEQ  454
             D        +SPN T++LGP                                KIT WD Q
Sbjct  130   DLVELPKADISPNATYTLGPRIAEIPSDSHLTDLLEPPKADISPNATYTLGPKITNWDSQ  189

Query  455   RKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIV  634
             RKVW +++P FP+ V GK R+LL+TGS P PC+ P+G++YLLK VKNKIDYCR+HGIEIV
Sbjct  190   RKVWLNQNPEFPNIVNGKARILLLTGSSPGPCDKPIGNYYLLKAVKNKIDYCRLHGIEIV  249

Query  635   YNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLV  814
             YN AN+D E+ G W KLP+IR LMLSHPE+EWIWWMDSDA FTD+ FEIPL +Y++HNLV
Sbjct  250   YNMANLDEELSGYWTKLPMIRTLMLSHPEVEWIWWMDSDALFTDILFEIPLPRYENHNLV  309

Query  815   IHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKG  994
             IHGY DLLF+QKSW AL+TG FL+RNCQW+LDLLD WAPMGPKG IR+E+GK LTA LKG
Sbjct  310   IHGYPDLLFNQKSWVALNTGIFLLRNCQWSLDLLDAWAPMGPKGKIRDETGKILTAYLKG  369

Query  995   RPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDE  1174
             RP FEADDQSALIYLL+S+K++W++KV++EN YYLHG+W GLVDRYEE++EKYHPG GDE
Sbjct  370   RPAFEADDQSALIYLLLSQKEKWIEKVYVENQYYLHGFWEGLVDRYEEMIEKYHPGLGDE  429

Query  1175  RWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIR  1354
             RWPFVTHFVGCK CGS  D+ V++C KSMERAFNFADNQVL LYGF HRGLLSP IKRIR
Sbjct  430   RWPFVTHFVGCKPCGSYADYAVDRCFKSMERAFNFADNQVLKLYGFSHRGLLSPKIKRIR  489

Query  1355  NETTLPLPNVDRYDFRHAKHES  1420
             NET  PL +VD++D R    E+
Sbjct  490   NETVSPLESVDKFDIRRMHMET  511



>gb|EYU28806.1| hypothetical protein MIMGU_mgv1a003740mg [Erythranthe guttata]
Length=567

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/443 (63%), Positives = 337/443 (76%), Gaps = 17/443 (4%)
 Frame = +2

Query  74    GVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLR  253
             G+       GALPTT   A            V R R   +   N+K+TILCG +TILVLR
Sbjct  2     GLKRISSTAGALPTTTATA------------VRRRRHGGQKCGNLKLTILCGIITILVLR  49

Query  254   GTIGVGNLA-SSDAEVENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFSLGP  430
             GTIG+  ++  S++      + +ET+RI+ EIRS ++ DD E +S       N T++LGP
Sbjct  50    GTIGISLISFPSESTTIPRHVAEETDRIVAEIRSGEN-DDSESES---VTLTNRTYTLGP  105

Query  431   KITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYC  610
             KI  WD  R+ W  ++  FP+ V GKPR+LLVTGS P PC NP+GDHYLLK  KNKIDYC
Sbjct  106   KIIDWDSSRQKWLRQNRGFPNYVNGKPRILLVTGSQPGPCNNPIGDHYLLKSTKNKIDYC  165

Query  611   RIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLS  790
             R+H IEIVYN AN+D E+ G W KLPLIR+LM+SHPE EWIWWMDSDAFFTDM FEIP+S
Sbjct  166   RMHNIEIVYNMANLDEELSGYWTKLPLIRKLMVSHPEAEWIWWMDSDAFFTDMLFEIPIS  225

Query  791   KYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGK  970
             KY+ +N+V+HGY +LLF++KSW AL+TGSFL+RN QW+LDLLD WAPMGPKG +REE+GK
Sbjct  226   KYEPYNMVVHGYPNLLFEEKSWIALNTGSFLLRNRQWSLDLLDSWAPMGPKGAVREEAGK  285

Query  971   TLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEK  1150
              LTANLK RP FEADDQSALIYLL+S KD+WMDKVFLENSYYLHGYW GLVD+YEE +E 
Sbjct  286   ILTANLKDRPSFEADDQSALIYLLVSRKDEWMDKVFLENSYYLHGYWVGLVDKYEEYLES  345

Query  1151  YHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLL  1330
              HPG GDERWPFVTHFVGCK CG  GD+ +E C+KSMERAFNFADNQ+L++YGF+H+GLL
Sbjct  346   SHPGLGDERWPFVTHFVGCKTCGGYGDYTMESCLKSMERAFNFADNQLLDIYGFRHKGLL  405

Query  1331  SPNIKRIRNETTLPLPNVDRYDF  1399
             SP +KRIR+ETT PL  + R  F
Sbjct  406   SPGVKRIRSETTRPLERITRLSF  428



>gb|EMT05890.1| Putative glycosyltransferase 3 [Aegilops tauschii]
Length=722

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/484 (61%), Positives = 367/484 (76%), Gaps = 35/484 (7%)
 Frame = +2

Query  38    FSHIPTRYMGQDGVLSAQKRPGALPTT-----ATDAMNGDARIRANPQVPRGRQISRTFN  202
             FS I    +G++ + SA + P A P++        + NGD   RA    PR R   RTFN
Sbjct  238   FSGITMVLLGEE-LRSASQVP-ATPSSRRFWQQKRSANGDLYGRAT--TPR-RVGYRTFN  292

Query  203   NIKITILCGFVTILVLRGTIGVGNLA----SSDAE-VENSFLIDETNRILDEIRSDKDPD  367
             N+KIT+LCG VTILVLRGTIG+ NL+     SDA+ +  +  +++ +RIL EIRSD DP 
Sbjct  293   NVKITVLCGLVTILVLRGTIGL-NLSLPSQPSDADALAGAKAVEDIDRILREIRSDSDPS  351

Query  368   DPEGQS--------GDRFLSPNE----------TFSLGPKITGWDEQRKVWFDRHPRFPS  493
             DP                L+ +E           ++LGP ++GWDEQR+ W  ++  FP+
Sbjct  352   DPTDSDLDSSSVLSNATALNSSEAAAAYAAAVGNYALGPNVSGWDEQRRRWLAQNKGFPA  411

Query  494   SV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDG  670
             +V  GKPR+LLVTGS P PC+NP+GDHYLLK  KNKIDYCR H IEIV+N A++D E+ G
Sbjct  412   TVPGGKPRILLVTGSQPGPCDNPLGDHYLLKSTKNKIDYCRFHDIEIVHNLAHLDNELAG  471

Query  671   NWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQK  850
              WAKLPL+RRLMLSHPE+EWIWWMDSDA FTDMAFE+PLS+YD+HNL+IHGY DLLF++ 
Sbjct  472   YWAKLPLLRRLMLSHPEVEWIWWMDSDALFTDMAFELPLSRYDNHNLIIHGYHDLLFEKH  531

Query  851   SWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSAL  1030
             SW AL+TGSFL RNCQW+LDLL  WAPMGPKG IREE+GK LTA LKGRP FEADDQSAL
Sbjct  532   SWIALNTGSFLFRNCQWSLDLLAAWAPMGPKGFIREEAGKILTAYLKGRPAFEADDQSAL  591

Query  1031  IYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCK  1210
             IYLL+S+K++WMDKV++ENSYYLHG+WAGLVD+YEE+ME +HPG GDERWPFVTHFVGCK
Sbjct  592   IYLLLSQKEKWMDKVYIENSYYLHGFWAGLVDKYEEMMENHHPGLGDERWPFVTHFVGCK  651

Query  1211  ACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDR  1390
              CGS GD+PV++C+KSMERAFNFADNQVL+LYGF H+GL SP IKRIR++TT P+ + + 
Sbjct  652   PCGSYGDYPVDRCLKSMERAFNFADNQVLHLYGFAHKGLESPKIKRIRSQTTKPINDKEN  711

Query  1391  YDFR  1402
              D +
Sbjct  712   LDVK  715



>gb|EMT32465.1| Putative glycosyltransferase 3 [Aegilops tauschii]
Length=445

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/433 (61%), Positives = 334/433 (77%), Gaps = 24/433 (6%)
 Frame = +2

Query  179   RQISRTFNNIKITILCGFVTILVLRGTIGV---------GNLASSDAEVENSFLIDETNR  331
             +Q+ +T NN+K+T++CGF+TILVLRGT+G+         G  A++DA+V      ++  R
Sbjct  18    KQMQKTINNVKMTLICGFITILVLRGTVGINLMAFSGEGGGDAAADAKVA-----EDIER  72

Query  332   ILDEIRSDKDPDDPEGQSGDRFLSPNET---------FSLGPKITGWDEQRKVWFDRHPR  484
             IL EIR+D DPDD +    D  LS N T         ++LGP IT W+ +R+ W  ++P 
Sbjct  73    ILREIRTDSDPDDEDQPVVDASLSGNSTAMPVVEEKNYTLGPSITRWNAKRRQWLSQNPG  132

Query  485   FPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDRE  661
             FPS   +G PR+LLVTGS P PC+NP GDHYLLK  KNKIDYCR+HGIEIV+N  ++DRE
Sbjct  133   FPSRDARGNPRILLVTGSSPGPCDNPAGDHYLLKSTKNKIDYCRLHGIEIVHNMVHLDRE  192

Query  662   MDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLF  841
             + G W+KLPL+RRLMLSHPE+EW+WWMDSDA FTDM FEIPLS+Y+  NLVIHGY +LL 
Sbjct  193   LSGYWSKLPLLRRLMLSHPEVEWVWWMDSDALFTDMGFEIPLSRYEGSNLVIHGYPELLN  252

Query  842   DQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQ  1021
              Q+SW AL+TGSFL+RNCQW+++LLD WAPMGPKG +RE +GK LTA+L GRP FEADDQ
Sbjct  253   KQRSWVALNTGSFLLRNCQWSMELLDAWAPMGPKGRVREAAGKVLTASLTGRPAFEADDQ  312

Query  1022  SALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFV  1201
             SALI+LL++EK++WM+KV++EN YYLHG+WAGLVD+YEE+MEK+HPG GDERWPF+THFV
Sbjct  313   SALIHLLLTEKERWMEKVYVENQYYLHGFWAGLVDKYEEMMEKHHPGLGDERWPFITHFV  372

Query  1202  GCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPN  1381
             GCK CGS GD+PVE+C+  MERAFNFADNQVL LYGF+HR L +P +K + N T  PL N
Sbjct  373   GCKPCGSYGDYPVEQCLTGMERAFNFADNQVLRLYGFRHRSLTNPKVKPVANRTASPLLN  432

Query  1382  VDRYDFRHAKHES  1420
              +      AK E+
Sbjct  433   KEASLKMDAKIET  445



>dbj|BAK00169.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/426 (61%), Positives = 332/426 (78%), Gaps = 12/426 (3%)
 Frame = +2

Query  179   RQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSF----LIDETNRILDEI  346
             +Q+ +T NN+KIT++CGF+TILVLRGT+G+  +A S     ++     + ++  RIL EI
Sbjct  16    KQMQKTINNVKITLICGFITILVLRGTVGINLIAFSGDGGGDAAADAKVAEDIERILREI  75

Query  347   RSDKDPDDPE----GQSGDRFLSP---NETFSLGPKITGWDEQRKVWFDRHPRFPS-SVK  502
             RSD DPD+ +      SG+    P    + ++LGP IT W+ +R+ W  ++P FPS   +
Sbjct  76    RSDSDPDEGDQPVDASSGNSTTMPVVEEKNYTLGPSITRWNAKRRQWLSQNPGFPSRDAR  135

Query  503   GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAK  682
             G PR+LLVTGS P PC+NP GDHYLLK  KNKIDYCRIHGIEIV+N  ++DRE+ G W+K
Sbjct  136   GNPRILLVTGSSPGPCDNPAGDHYLLKPTKNKIDYCRIHGIEIVHNMVHLDRELSGYWSK  195

Query  683   LPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTA  862
             LPL+RRLMLSHPE+EW+WWMDSDA FTDM FE+PLS+Y+  NLVIHGY +LL  Q+SW A
Sbjct  196   LPLLRRLMLSHPEVEWVWWMDSDALFTDMGFEVPLSRYEGSNLVIHGYPELLNKQRSWVA  255

Query  863   LSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLL  1042
             L+TGSFL+RNCQW+++LLD WAPMGPKG +RE +GK LTA+L GRP FEADDQSALI+LL
Sbjct  256   LNTGSFLLRNCQWSMELLDAWAPMGPKGRVREAAGKVLTASLTGRPAFEADDQSALIHLL  315

Query  1043  MSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGS  1222
             ++EK++WM+KV++EN YYLHG+WAGLVD+YEE+MEK+HPG GDERWPF+THFVGCK CGS
Sbjct  316   LTEKERWMEKVYVENEYYLHGFWAGLVDKYEEMMEKHHPGLGDERWPFITHFVGCKPCGS  375

Query  1223  SGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFR  1402
              GD+PVE+C+  MERAFNFADNQVL LYGF+HR L +P +K + N T  PL N +     
Sbjct  376   YGDYPVEQCLTGMERAFNFADNQVLRLYGFRHRSLTNPKVKPVANRTASPLQNKEASLKM  435

Query  1403  HAKHES  1420
              AK E+
Sbjct  436   DAKIET  441



>emb|CBX25402.1| hypothetical_protein [Oryza brachyantha]
Length=450

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/443 (59%), Positives = 329/443 (74%), Gaps = 32/443 (7%)
 Frame = +2

Query  128   AMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENS  307
             A+ G  R    P   RG+Q+ RT NN+KIT++CGF+T+LVLRGT+G+  LA   A  +  
Sbjct  2     AVAGGGRPAGRPA--RGKQMQRTINNVKITLICGFITLLVLRGTVGINILAYGVAGSDAV  59

Query  308   FLID------ETNRILDEIRSDK------------------DPDDPEGQSGDRFLSPNET  415
                +      +  RIL EIRSD                   +   P  +      S N T
Sbjct  60    AAAEEARVVEDLERILREIRSDADDDDEEEEGGGVHASATTNSTTPTARK-----SSNHT  114

Query  416   FSLGPKITGWDEQRKVWFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             ++LGPK+T W+ +R+ W  R+P FPS   +GKP++LLVTGS P PC++  GDHYLLK  K
Sbjct  115   YTLGPKVTRWNAKRRQWLSRNPAFPSRDARGKPKILLVTGSQPAPCDDATGDHYLLKATK  174

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKIDYCR+HGIEIV+N A++DRE+ G WAKLPL+RRLMLSHPE+EW+WWMDSDA FTDMA
Sbjct  175   NKIDYCRLHGIEIVHNMAHLDRELAGYWAKLPLLRRLMLSHPEVEWVWWMDSDALFTDMA  234

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FE+PL +Y + NLVIHGY +LLF ++SW AL+TGSFL+RNCQW+L+LLD WAPMGPKG +
Sbjct  235   FELPLERYVASNLVIHGYPELLFGKRSWVALNTGSFLLRNCQWSLELLDAWAPMGPKGRV  294

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             R+E+GK LTA+L GRP FEADDQSALI+LL++EK +WM KV++E+ Y+LHG+WAGLVD+Y
Sbjct  295   RDEAGKVLTASLTGRPAFEADDQSALIHLLLTEKKRWMGKVYVEDKYFLHGFWAGLVDKY  354

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE+MEK+HPG GDERWPFVTHFVGCK CGS GD+P ++C+  MERAFNFADNQVL LYGF
Sbjct  355   EEMMEKHHPGLGDERWPFVTHFVGCKPCGSFGDYPRDRCLSGMERAFNFADNQVLRLYGF  414

Query  1313  KHRGLLSPNIKRIRNETTLPLPN  1381
             +HR L S  ++R+ N T  PL N
Sbjct  415   RHRSLASARVRRLANRTNSPLVN  437



>gb|EAY82266.1| hypothetical protein OsI_37474 [Oryza sativa Indica Group]
Length=463

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/462 (59%), Positives = 346/462 (75%), Gaps = 31/462 (7%)
 Frame = +2

Query  128   AMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLA---------  280
             A+ G  R  A  Q  RG+Q+ RTFNN+KIT++CGF+T+LVLRGT+G+  L          
Sbjct  2     AVTGGGRPAARQQAARGKQMQRTFNNVKITLICGFITLLVLRGTVGINLLTYGVGGGGGS  61

Query  281   SSDAEVENSFLIDETNRILDEIRSDKDPDD------PEG---------------QSGDRF  397
              + A  E + ++++  RIL EIRSD D DD      P G                +  R 
Sbjct  62    DAVAAAEEARVVEDIERILREIRSDTDDDDDDEEEEPLGVDASTTTTTNSTTTTATAARR  121

Query  398   LSPNETFSLGPKITGWDEQRKVWFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHY  574
              S N T++LGPK+T W+ +R+ W  R+P FPS   +GKPR+LLVTGS P PC++  GDHY
Sbjct  122   RSSNHTYTLGPKVTRWNAKRRQWLSRNPGFPSRDARGKPRILLVTGSQPAPCDDAAGDHY  181

Query  575   LLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDA  754
             LLK  KNKIDYCRIHGIEIV++ A++DRE+ G WAKLPL+RRLMLSHPE+EW+WWMDSDA
Sbjct  182   LLKATKNKIDYCRIHGIEIVHSMAHLDRELAGYWAKLPLLRRLMLSHPEVEWVWWMDSDA  241

Query  755   FFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPM  934
              FTDMAFE+PL++YD+ NLVIHGY +LLF ++SW AL+TGSFL+RNCQW+L+LLD WAPM
Sbjct  242   LFTDMAFELPLARYDTSNLVIHGYPELLFAKRSWIALNTGSFLLRNCQWSLELLDAWAPM  301

Query  935   GPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWA  1114
             GPKG +R+E+GK LTA+L GRP FEADDQSALI++L+++K++WMDKV++E+ Y+LHG+WA
Sbjct  302   GPKGRVRDEAGKVLTASLTGRPAFEADDQSALIHILLTQKERWMDKVYVEDKYFLHGFWA  361

Query  1115  GLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQV  1294
             GLVD+YEE+ME++HPG GDERWPFVTHFVGCK CG  GD+P E+C+  MERAFNFADNQV
Sbjct  362   GLVDKYEEMMERHHPGLGDERWPFVTHFVGCKPCGGYGDYPRERCLGGMERAFNFADNQV  421

Query  1295  LNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             L LYGF+HR L S  ++R+ N T  PL N +      AK ES
Sbjct  422   LRLYGFRHRSLASARVRRVANRTDNPLVNKEAALKMDAKIES  463



>ref|XP_009149356.1| PREDICTED: putative glycosyltransferase 4 [Brassica rapa]
Length=503

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/341 (72%), Positives = 290/341 (85%), Gaps = 0/341 (0%)
 Frame = +2

Query  398   LSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYL  577
             ++PN T++LGP+IT WD QRKVW  ++P FPS V GK R+LL+TGS P PC+ P+GD+YL
Sbjct  161   VNPNVTYTLGPRITNWDSQRKVWLSQNPGFPSIVNGKARILLLTGSSPGPCDKPIGDYYL  220

Query  578   LKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAF  757
             LK VKNKIDYCRIHGIEIVYN A++D E+ G W KLP+IRRLMLSHPE+EWIWWMDSDA 
Sbjct  221   LKTVKNKIDYCRIHGIEIVYNMAHLDEELSGYWTKLPMIRRLMLSHPEVEWIWWMDSDAL  280

Query  758   FTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMG  937
             FTD+ FEIP+S+Y+ HNLVIHGY DLLF+Q SW AL+TG FL+RNCQW+LDLLD WAPMG
Sbjct  281   FTDILFEIPMSRYEKHNLVIHGYPDLLFNQMSWVALNTGVFLLRNCQWSLDLLDAWAPMG  340

Query  938   PKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAG  1117
             PKGPIREE+GK LTA LKGRP FEADDQSALIYLL+S+K++WM+KV++EN YYLHG+W G
Sbjct  341   PKGPIREEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEG  400

Query  1118  LVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVL  1297
             LVD+YEE++EKYHPG GDERWPFVTHFVGCK CGS  D+  E+C KSMERAFNFADNQVL
Sbjct  401   LVDKYEEMIEKYHPGLGDERWPFVTHFVGCKPCGSYADYAEERCFKSMERAFNFADNQVL  460

Query  1298  NLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
              LYGF H GLLSP +KRIRNET  PL  VD++D R    E+
Sbjct  461   KLYGFSHMGLLSPKVKRIRNETVSPLEFVDKFDIRRTHEET  501


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +2

Query  62   MGQDGVLSAQKRPGALPTTATDAMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTI  241
            M QD + S+    G LPTTA     G  R        RG Q+  T  NIKI ILCGFVTI
Sbjct  1    MVQDALRSSGSG-GGLPTTAVSNGGGRGRGLL-----RGWQVQNTSINIKIMILCGFVTI  54

Query  242  LVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKDPDD  370
            LVL GT+  GNL SS+A+  N  LI ET  IL E R    P D
Sbjct  55   LVLLGTVSFGNLGSSNADAVNQNLIKETEPILAESRPASVPTD  97



>ref|NP_001066160.1| Os12g0149300 [Oryza sativa Japonica Group]
 gb|ABA95806.1| Glycosyltransferase 3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29179.1| Os12g0149300 [Oryza sativa Japonica Group]
 gb|EAZ19653.1| hypothetical protein OsJ_35230 [Oryza sativa Japonica Group]
 dbj|BAG99053.1| unnamed protein product [Oryza sativa Japonica Group]
Length=463

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/462 (58%), Positives = 345/462 (75%), Gaps = 31/462 (7%)
 Frame = +2

Query  128   AMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLA---------  280
             A+ G  R     Q  RG+Q+ RTFNN+KIT++CGF+T+LVLRGT+G+  L          
Sbjct  2     AVTGGGRPAVRQQAARGKQMQRTFNNVKITLICGFITLLVLRGTVGINLLTYGVGGGGGS  61

Query  281   SSDAEVENSFLIDETNRILDEIRSDKDPDD------PEG---------------QSGDRF  397
              + A  E + ++++  RIL EIRSD D DD      P G                +  R 
Sbjct  62    DAVAAAEEARVVEDIERILREIRSDTDDDDDDEEEEPLGVDASTTTTTNSTTTTATAARR  121

Query  398   LSPNETFSLGPKITGWDEQRKVWFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHY  574
              S N T++LGPK+T W+ +R+ W  R+P FPS   +GKPR+LLVTGS P PC++  GDHY
Sbjct  122   RSSNHTYTLGPKVTRWNAKRRQWLSRNPGFPSRDARGKPRILLVTGSQPAPCDDAAGDHY  181

Query  575   LLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDA  754
             LLK  KNKIDYCRIHGIEIV++ A++DRE+ G WAKLPL+RRLMLSHPE+EW+WWMDSDA
Sbjct  182   LLKATKNKIDYCRIHGIEIVHSMAHLDRELAGYWAKLPLLRRLMLSHPEVEWVWWMDSDA  241

Query  755   FFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPM  934
              FTDMAFE+PL++YD+ NLVIHGY +LLF ++SW AL+TGSFL+RNCQW+L+LLD WAPM
Sbjct  242   LFTDMAFELPLARYDTSNLVIHGYPELLFAKRSWIALNTGSFLLRNCQWSLELLDAWAPM  301

Query  935   GPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWA  1114
             GPKG +R+E+GK LTA+L GRP FEADDQSALI++L+++K++WM+KV++E+ Y+LHG+WA
Sbjct  302   GPKGRVRDEAGKVLTASLTGRPAFEADDQSALIHILLTQKERWMEKVYVEDKYFLHGFWA  361

Query  1115  GLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQV  1294
             GLVD+YEE+ME++HPG GDERWPFVTHFVGCK CG  GD+P E+C+  MERAFNFADNQV
Sbjct  362   GLVDKYEEMMERHHPGLGDERWPFVTHFVGCKPCGGYGDYPRERCLGGMERAFNFADNQV  421

Query  1295  LNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
             L LYGF+HR L S  ++R+ N T  PL N +      AK ES
Sbjct  422   LRLYGFRHRSLASARVRRVANRTDNPLVNKEAALKMDAKIES  463



>ref|XP_004977544.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=453

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/439 (58%), Positives = 329/439 (75%), Gaps = 26/439 (6%)
 Frame = +2

Query  128   AMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASS---DAEV  298
              + G  R+RA+  + + RQ  RT NNIKIT+LCGF+T+LVLRGT G   L +S   D   
Sbjct  2     GVAGGGRLRAS-SIKKQRQ--RTMNNIKITLLCGFITVLVLRGTAGFNLLVNSGDPDGAA  58

Query  299   ENSFLIDETNRILDEIRSDKDPDDPEGQSGD-RFLSPNET------------------FS  421
              ++ ++++  RIL EIRSD +PDD     GD    SPN                    + 
Sbjct  59    ADAKVVEDIERILAEIRSDSEPDDVVVLVGDGSSSSPNNATAGLGNFSSSATLIRVKEYI  118

Query  422   LGPKITGWDEQRKVWFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             LGPK++ WD QR+ W  RHP FPS   +G PRVLLVTGSPP PC+NP GDHYLLK  KNK
Sbjct  119   LGPKVSDWDSQRQEWLSRHPEFPSRDARGSPRVLLVTGSPPGPCDNPAGDHYLLKATKNK  178

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCR+HG++IV+N A++D E+ G W+K+PL+RRLML+HPE+EWIWW+DSDA FTDMAFE
Sbjct  179   IDYCRLHGMDIVHNMAHLDPELTGYWSKIPLVRRLMLAHPEVEWIWWVDSDAIFTDMAFE  238

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             +PLS+Y+  NLV+HGY DLLF+++SW +L+ G FL+RNCQW+LDLLD W PMGP+GP R 
Sbjct  239   LPLSRYEGRNLVVHGYTDLLFEKRSWISLNAGIFLLRNCQWSLDLLDAWVPMGPRGPSRV  298

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+GK LTA+L GRP FEADDQSALI+LL+ +KD+WM+KV +E  +YLHG+W GLVDRYE+
Sbjct  299   EAGKLLTASLSGRPPFEADDQSALIHLLLIQKDKWMEKVQIETEFYLHGFWTGLVDRYEQ  358

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             +ME++HPG GD+RWPF+THFVGCK CG   D+P+E+C++ MERAFNFADNQVL LYGF+H
Sbjct  359   MMEEHHPGLGDDRWPFITHFVGCKTCGRYEDYPLERCLRGMERAFNFADNQVLRLYGFQH  418

Query  1319  RGLLSPNIKRIRNETTLPL  1375
             R L+S  ++R+ +    PL
Sbjct  419   RSLVSAKVRRVTDPRANPL  437



>ref|XP_010238722.1| PREDICTED: putative glycosyltransferase 5 [Brachypodium distachyon]
Length=458

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/426 (60%), Positives = 325/426 (76%), Gaps = 23/426 (5%)
 Frame = +2

Query  179   RQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSF--------LIDETNRI  334
             +Q+ +T  N+KIT++CGF+TILVLRGT+GV  L+ S A   +          + ++ +R+
Sbjct  24    KQMQKTIGNVKITLICGFITILVLRGTVGVNLLSFSGAGSTSGDAAAADAAQVAEDIDRL  83

Query  335   LDEIRSDK-DPDDPEGQSGDRFLSPN------------ETFSLGPKITGWDEQRKVWFDR  475
             L EIRSD  D DD    S D   +              + ++LGPKIT W+ +R+ W  R
Sbjct  84    LREIRSDAADEDDNIDLSPDNSTTTTLNGAATESTTTIKNYTLGPKITRWNAKRRQWQAR  143

Query  476   HPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANM  652
             HP FP+   +GKPR+LLVTGS P PC++P GDH+LLK  KNKIDYCRIHGIE+V++ A++
Sbjct  144   HPGFPARDARGKPRILLVTGSSPGPCDDPAGDHFLLKSTKNKIDYCRIHGIELVHSMAHL  203

Query  653   DREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQD  832
             DRE+ G W+KLPL+RRLMLSHPE EW+WWMDSDA FTDMAFE+PL++YD  NLVIHGY D
Sbjct  204   DRELSGYWSKLPLLRRLMLSHPETEWVWWMDSDALFTDMAFELPLARYDGSNLVIHGYHD  263

Query  833   LLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEA  1012
             LL  Q+SW AL+TGSFL+RNCQW+L+LLD WAPMGPKG +RE +GK LTA+L GRP FEA
Sbjct  264   LLHKQRSWVALNTGSFLLRNCQWSLELLDAWAPMGPKGQVREAAGKVLTASLTGRPAFEA  323

Query  1013  DDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVT  1192
             DDQSALI+LL+++K +WMDKV++E+ +YLHG+WAGLVDRYEE+MEK+HPG GDERWPFVT
Sbjct  324   DDQSALIHLLLADKQRWMDKVYVEDKFYLHGFWAGLVDRYEEMMEKHHPGLGDERWPFVT  383

Query  1193  HFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRI-RNETTL  1369
             HFVGCK CGS GD+P + C+ +MERAFNFADNQVL +YGF+HR L SP +K +  N T  
Sbjct  384   HFVGCKPCGSYGDYPKDVCLAAMERAFNFADNQVLRIYGFRHRSLASPKVKPVPVNRTAT  443

Query  1370  PLPNVD  1387
             P   +D
Sbjct  444   PFDALD  449



>ref|XP_006489090.1| PREDICTED: putative glycosyltransferase 2-like [Citrus sinensis]
Length=454

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/433 (59%), Positives = 328/433 (76%), Gaps = 22/433 (5%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN---SFLID----ETNR  331
             R RQI R   + KIT+LC F+T++VLRGTIG G   + + ++++    F       E +R
Sbjct  10    RARQIQRAIRHGKITLLCLFMTVIVLRGTIGAGKFGTPEQDIDDIRQHFYAHRKRVEPHR  69

Query  332   ILDEIRSD-----KDPDDPEG---------QSGDRFLSPNETFSLGPKITGWDEQRKVWF  469
             +L+E+++      +DP++ E          +  D    PN+ +SLGPKI+ WDEQR  W 
Sbjct  70    VLEEVQTTDAAKTEDPNNYEKFDMNKLFVDEGEDEKRDPNKQYSLGPKISDWDEQRSEWL  129

Query  470   DRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSA  646
              ++P  P+ ++  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHGIEI YN A
Sbjct  130   KKNPTLPNFLRPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRIHGIEIFYNMA  189

Query  647   NMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGY  826
              +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HNLV+HG+
Sbjct  190   LLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHNLVMHGW  249

Query  827   QDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEF  1006
             +++++D+K+W  L+TGSFL+RNCQWALDLLD WAPMGPKG IR+++GK LT  LKGRP F
Sbjct  250   KEMVYDEKNWIGLNTGSFLLRNCQWALDLLDAWAPMGPKGKIRDDAGKILTRELKGRPVF  309

Query  1007  EADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPF  1186
             EADDQSA++YLL++++D+W +KV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP 
Sbjct  310   EADDQSAMVYLLITQRDKWGEKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPL  369

Query  1187  VTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETT  1366
             VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQVLN+YGF+HR L S  +KRIRNET+
Sbjct  370   VTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQVLNMYGFEHRTLASKKVKRIRNETS  429

Query  1367  LPLPNVDRYDFRH  1405
              PL   D    RH
Sbjct  430   TPLEVKDELGIRH  442



>ref|XP_006419581.1| hypothetical protein CICLE_v10004948mg [Citrus clementina]
 gb|ESR32821.1| hypothetical protein CICLE_v10004948mg [Citrus clementina]
Length=454

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/433 (59%), Positives = 327/433 (76%), Gaps = 22/433 (5%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN---SFLID----ETNR  331
             R RQI R   + KIT+LC F+T++VLRGTIG G   + + ++++    F       E +R
Sbjct  10    RARQIQRAIRHGKITLLCLFMTVIVLRGTIGAGKFGTPEQDIDDIRQHFYAHRKRVEPHR  69

Query  332   ILDEIRSD-----KDPDDPEG---------QSGDRFLSPNETFSLGPKITGWDEQRKVWF  469
             +L+E+++       DP++ E          +  D    PN+ +SLGPKI+ WDEQR  W 
Sbjct  70    VLEEVQTTDAAKTADPNNYEKFDMNKLFVDEGEDEKRDPNKQYSLGPKISDWDEQRSEWL  129

Query  470   DRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSA  646
              ++P  P+ ++  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHGIEI YN A
Sbjct  130   KKNPTLPNFLRPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRIHGIEIFYNMA  189

Query  647   NMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGY  826
              +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HNLV+HG+
Sbjct  190   LLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHNLVMHGW  249

Query  827   QDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEF  1006
             +++++D+K+W  L+TGSFL+RNCQWALDLLD WAPMGPKG IR+++GK LT  LKGRP F
Sbjct  250   KEMVYDEKNWIGLNTGSFLLRNCQWALDLLDAWAPMGPKGKIRDDAGKILTRELKGRPVF  309

Query  1007  EADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPF  1186
             EADDQSA++YLL++++D+W +KV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP 
Sbjct  310   EADDQSAMVYLLITQRDKWGEKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPL  369

Query  1187  VTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETT  1366
             VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQVLN+YGF+HR L S  +KRIRNET+
Sbjct  370   VTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQVLNMYGFEHRTLASKKVKRIRNETS  429

Query  1367  LPLPNVDRYDFRH  1405
              PL   D    RH
Sbjct  430   TPLEVKDELGIRH  442



>ref|XP_006663818.1| PREDICTED: putative glycosyltransferase 3-like [Oryza brachyantha]
Length=450

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/443 (58%), Positives = 327/443 (74%), Gaps = 32/443 (7%)
 Frame = +2

Query  128   AMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENS  307
             A+ G  R    P   RG+Q+ RT NN+KIT++CGF+T+LVLRGT+G+  LA   A  +  
Sbjct  2     AVAGGGRPAGRPA--RGKQMQRTINNVKITLICGFITLLVLRGTVGINILAYGVAGSDAV  59

Query  308   FLID------ETNRILDEIRSDK------------------DPDDPEGQSGDRFLSPNET  415
                +      +  RIL EIRSD                   +   P  +      S N T
Sbjct  60    AAAEEARVVEDLERILREIRSDADDDDEEEEGGGVHASATTNSTTPTARK-----SSNHT  114

Query  416   FSLGPKITGWDEQRKVWFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVK  592
             ++LGPK+T W+ +R+ W  R+P FPS   +GKP++LLVTGS P PC+   GDH L+KG K
Sbjct  115   YTLGPKVTRWNAKRRQWLSRNPAFPSRDARGKPKILLVTGSHPAPCDGAPGDHSLVKGPK  174

Query  593   NKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMA  772
             NKI YCR+HGIEIV+N A++DRE+ G WAKLPL+RRLMLSHPE+EW+WWMDSDA FTDMA
Sbjct  175   NKIYYCRLHGIEIVHNMAHLDRELAGYWAKLPLLRRLMLSHPEVEWVWWMDSDALFTDMA  234

Query  773   FEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPI  952
             FE+PL +Y + NLVIHGY +LLF ++SW AL+TGSFL+RNCQW+L+LLD WAPMGPKG +
Sbjct  235   FELPLERYVASNLVIHGYPELLFGKRSWVALNTGSFLLRNCQWSLELLDAWAPMGPKGRV  294

Query  953   REESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRY  1132
             R+E+GK LTA+L GRP FEADDQSALI+LL++EK +WM KV++E+ Y+LHG+WAGLVD+Y
Sbjct  295   RDEAGKVLTASLTGRPAFEADDQSALIHLLLTEKKRWMGKVYVEDKYFLHGFWAGLVDKY  354

Query  1133  EEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGF  1312
             EE+MEK+HPG GDERWPFVTHFVGCK CGS GD+P ++C+  MERAFNFADNQVL LYGF
Sbjct  355   EEMMEKHHPGLGDERWPFVTHFVGCKPCGSFGDYPRDRCLSGMERAFNFADNQVLRLYGF  414

Query  1313  KHRGLLSPNIKRIRNETTLPLPN  1381
             +HR L S  ++R+ N T  PL N
Sbjct  415   RHRSLASARVRRLANRTNSPLVN  437



>ref|XP_004980167.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=460

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/442 (57%), Positives = 330/442 (75%), Gaps = 32/442 (7%)
 Frame = +2

Query  137   GDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASS---DAEVENS  307
             G  R+RA+  + + RQ  RT NNIKIT+LCGF+T+LVLRGT G   L +S   D    ++
Sbjct  6     GGGRMRAS-SIKKQRQ--RTMNNIKITLLCGFITVLVLRGTAGFNLLVNSGDPDGAAADA  62

Query  308   FLIDETNRILDEIRSDKDPDD-------------------PEGQSGDRFLSPNET-----  415
              ++++  RIL EIRSD +PD+                     G  G+   SP+ T     
Sbjct  63    KVVEDIERILAEIRSDSEPDEVVVFVGDGGSSSSSSPSNVTAGGFGNFSFSPSATLIKVK  122

Query  416   -FSLGPKITGWDEQRKVWFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
              +SLGPK++ WD QR+ W  RHP FPS   +G P+VLLVTGSPP PC+NP GDHYLLK +
Sbjct  123   EYSLGPKVSDWDSQRQEWLSRHPEFPSRDARGNPKVLLVTGSPPGPCDNPAGDHYLLKAI  182

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCR+HG++IV+N A++D E+ G W+K+PL+RRLML+HPE+EWIWWMDSDA FTDM
Sbjct  183   KNKIDYCRLHGMDIVHNMAHLDPELTGYWSKIPLVRRLMLAHPEVEWIWWMDSDAIFTDM  242

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
             AFE+P S+Y+  NLV+HGY DLLF+++SW +L+ G FL+RNCQW+LDLLD W PMGP+GP
Sbjct  243   AFELPFSRYEGRNLVVHGYPDLLFEKRSWISLNAGIFLLRNCQWSLDLLDAWVPMGPRGP  302

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
              R E+GK LTA+L GRP FEADDQS LI+LL+ +KD+WM+KV +E  +YLHG+W GLVDR
Sbjct  303   SRIEAGKLLTASLSGRPPFEADDQSVLIHLLLIQKDKWMEKVQIETEFYLHGFWTGLVDR  362

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             YE++ME++HPG GD+RWPF+THFVGCK CG   D+P+E+C++ MERAFNFADNQVL LYG
Sbjct  363   YEQMMEEHHPGLGDDRWPFITHFVGCKTCGRYEDYPLERCLRGMERAFNFADNQVLRLYG  422

Query  1310  FKHRGLLSPNIKRIRNETTLPL  1375
             F+HR L+S  ++R+ +    PL
Sbjct  423   FQHRSLVSAKVRRVTDPRANPL  444



>ref|XP_008662460.1| PREDICTED: putative glycosyltransferase 3 [Zea mays]
 gb|AFW56034.1| hypothetical protein ZEAMMB73_202735 [Zea mays]
Length=456

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/442 (57%), Positives = 324/442 (73%), Gaps = 29/442 (7%)
 Frame = +2

Query  128   AMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASS---DAEV  298
             A  G AR+RA+      +Q  RT NNIKIT+LCGF+T+LVLRGT G   L SS   D   
Sbjct  4     AAGGGARLRASSA---KKQRQRTLNNIKITLLCGFITVLVLRGTAGFNLLVSSGDLDGAA  60

Query  299   ENSFLIDETNRILDEIRSDKD-----------------PDDPEGQSGDRF-----LSPNE  412
              ++ ++++  RIL EIRSD +                 P +    S   F     L    
Sbjct  61    ADAKVVEDVERILAEIRSDSEADDVVVVVEGGSSSSSSPRNATAASFGNFSASATLVKVR  120

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
              +SLGP + GWD QR+ W  +HP FP    +G+PRVLLVTGSPP PC+NP GDHYLLK  
Sbjct  121   EYSLGPPVRGWDAQRREWMAQHPEFPRLHPRGRPRVLLVTGSPPGPCDNPAGDHYLLKAT  180

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCR+HGI++V+N A++D E+ G W+KLPL+RRLML+HPE+EWIWW+DSDA FTDM
Sbjct  181   KNKIDYCRLHGIDVVHNMAHLDPELTGYWSKLPLVRRLMLAHPEVEWIWWVDSDAIFTDM  240

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
             AFE+PLS+YD  NLVIHGY DLLF+++SW +L+ G FL+RNCQW+LDLLD W PMGP+GP
Sbjct  241   AFELPLSRYDGRNLVIHGYPDLLFEKRSWISLNAGIFLLRNCQWSLDLLDAWVPMGPRGP  300

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
              R E+GK LTA+L GRP F+ADDQSALI+LL+ +K++WMDKV +E  +YLHG+W GLVDR
Sbjct  301   SRVEAGKLLTASLTGRPPFDADDQSALIHLLLVQKERWMDKVHVETEFYLHGFWTGLVDR  360

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             YE++ME  HPG GD+RWPF+THFVGCK CG   D+P+++C++ MERAFNFADNQVL LYG
Sbjct  361   YEQMMEDNHPGLGDDRWPFITHFVGCKTCGRYEDYPLDRCIRGMERAFNFADNQVLRLYG  420

Query  1310  FKHRGLLSPNIKRIRNETTLPL  1375
             F+HR L +  ++R+ + TT PL
Sbjct  421   FRHRSLTTAKVRRVTDPTTNPL  442



>emb|CBX24469.1| hypothetical_protein [Oryza glaberrima]
Length=443

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/443 (59%), Positives = 336/443 (76%), Gaps = 31/443 (7%)
 Frame = +2

Query  185   ISRTFNNIKITILCGFVTILVLRGTIGVGNLA---------SSDAEVENSFLIDETNRIL  337
             + RTFNN+KIT++CGF+T+LVLRGT+G+  L           + A  E + ++++  RIL
Sbjct  1     MQRTFNNVKITLICGFITLLVLRGTVGINLLTYGVGGGGGSDAVAAAEEARVVEDIERIL  60

Query  338   DEIRSDKDPDD------PEG---------------QSGDRFLSPNETFSLGPKITGWDEQ  454
              EIRSD D DD      P G                +  R  S N T++LGPK+T W+ +
Sbjct  61    REIRSDTDDDDDDEEEEPLGVDASTTTTTNSTTTTATAARRRSSNHTYTLGPKVTRWNAK  120

Query  455   RKVWFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEI  631
             R+ W  R+P FPS   +GKPR+LLVTGS P PC++  GDHYLLK  KNKIDYCRIHGIEI
Sbjct  121   RRQWLSRNPGFPSRDARGKPRILLVTGSQPAPCDDAAGDHYLLKATKNKIDYCRIHGIEI  180

Query  632   VYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNL  811
             V++ A++DRE+ G WAKLPL+RRLMLSHPE+EW+WWMDSDA FTDMAFE+PL++YD+ NL
Sbjct  181   VHSMAHLDRELAGYWAKLPLLRRLMLSHPEVEWVWWMDSDALFTDMAFELPLARYDTSNL  240

Query  812   VIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLK  991
             VIHGY +LLF ++SW AL+TGSFL+RNCQW+L+LLD WAPMGPKG +R+E+GK LTA+L 
Sbjct  241   VIHGYPELLFAKRSWIALNTGSFLLRNCQWSLELLDAWAPMGPKGRVRDEAGKVLTASLT  300

Query  992   GRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGD  1171
             GRP FEADDQSALI++L+++K++WM+KV++E+ Y+LHG+WAGLVD+YEE+ME++HPG GD
Sbjct  301   GRPAFEADDQSALIHILLTQKERWMEKVYVEDKYFLHGFWAGLVDKYEEMMERHHPGLGD  360

Query  1172  ERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRI  1351
             ERWPFVTHFVGCK CG  GD+P E+C+  MERAFNFADNQVL LYGF+HR L S  ++R+
Sbjct  361   ERWPFVTHFVGCKPCGGYGDYPRERCLGGMERAFNFADNQVLRLYGFRHRSLASARVRRL  420

Query  1352  RNETTLPLPNVDRYDFRHAKHES  1420
              N T  PL N +      AK ES
Sbjct  421   ANRTDNPLVNKEAALKMDAKIES  443



>ref|XP_008662468.1| PREDICTED: putative glycosyltransferase 3 [Zea mays]
 gb|AFW56046.1| hypothetical protein ZEAMMB73_358929 [Zea mays]
Length=456

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/442 (57%), Positives = 322/442 (73%), Gaps = 29/442 (7%)
 Frame = +2

Query  128   AMNGDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASS---DAEV  298
             A  G  R+RA+      +Q  RT NNIKIT+LCGF+T+LVLRGT G   L SS   D   
Sbjct  4     AAGGGVRLRASSA---KKQRQRTLNNIKITLLCGFITVLVLRGTAGFNLLVSSGDLDGAA  60

Query  299   ENSFLIDETNRILDEIRSDKD-----------------PDDPEGQSGDRF-----LSPNE  412
              ++ ++++  RIL EIRSD +                 P +    S   F     L    
Sbjct  61    ADAKVVEDVERILAEIRSDSEADDVVVVVEGGSSSSSSPRNATAASFGNFSASATLVKVR  120

Query  413   TFSLGPKITGWDEQRKVWFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGV  589
              +SLGP + GWD QR+ W  +HP FP    +G+PRVLLVTGSPP PC+NP GDHYLLK  
Sbjct  121   EYSLGPPVRGWDAQRRDWMAQHPEFPRLHPRGRPRVLLVTGSPPGPCDNPAGDHYLLKAT  180

Query  590   KNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDM  769
             KNKIDYCR+HGI++V+N A++D E+ G W+KLPL+RRLML+HPE+EWIWW+DSDA FTDM
Sbjct  181   KNKIDYCRLHGIDVVHNMAHLDPELTGYWSKLPLVRRLMLAHPEVEWIWWVDSDAIFTDM  240

Query  770   AFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGP  949
             AFE+PLS+YD  NLVIHGY DLLF+++SW +L+ G FL+RNCQW+LDLLD W PMGP+GP
Sbjct  241   AFELPLSRYDGSNLVIHGYPDLLFEKRSWISLNAGIFLLRNCQWSLDLLDAWVPMGPRGP  300

Query  950   IREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDR  1129
              R E+GK LTA+L GRP F+ADDQSALI+LL+ +K++WMDKV +E  +YLHG+W GLVDR
Sbjct  301   SRVEAGKLLTASLTGRPPFDADDQSALIHLLLVQKERWMDKVHVETEFYLHGFWTGLVDR  360

Query  1130  YEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYG  1309
             YE++ME  HPG GD+RWPF+THFVGCK CG   D+P+++C++ MERAFNFADNQVL LYG
Sbjct  361   YEQMMEDNHPGLGDDRWPFITHFVGCKTCGRYEDYPLDRCIRGMERAFNFADNQVLRLYG  420

Query  1310  FKHRGLLSPNIKRIRNETTLPL  1375
             F+HR L +  ++R+ +  T PL
Sbjct  421   FRHRSLTTAKVRRVTDPATNPL  442



>ref|XP_002442801.1| hypothetical protein SORBIDRAFT_08g003090 [Sorghum bicolor]
 gb|EES16639.1| hypothetical protein SORBIDRAFT_08g003090 [Sorghum bicolor]
Length=465

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/447 (57%), Positives = 320/447 (72%), Gaps = 37/447 (8%)
 Frame = +2

Query  137   GDARIRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSF--  310
             G  R+RA+      +Q  RT NNIKIT+LCGF+T+LVLRGT G   L S       +   
Sbjct  6     GGGRLRASSA---KKQRQRTLNNIKITLLCGFITVLVLRGTAGFNLLISGGDLDGAAAAA  62

Query  311   ----LIDETNRILDEIRSDKDP---------------------DDPEGQSGDRFLSPN--  409
                 ++++  RIL EIRSD +                      ++     G+   S    
Sbjct  63    ADAKVVEDVERILAEIRSDSEADDVVFVVEDDGSSLPSSSPRRNETAASFGNFSASATVV  122

Query  410   --ETFSLGPKITGWDEQRKVWFDRHPRFPS---SVKGKPRVLLVTGSPPTPCENPVGDHY  574
                 +SLGPK+T WD QR+ W  RHP FP       G+PRVLLV+GSPP PC+NPVGDHY
Sbjct  123   KVREYSLGPKLTDWDAQRREWMSRHPEFPPLDPRRGGRPRVLLVSGSPPGPCDNPVGDHY  182

Query  575   LLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDA  754
             LLK  KNKIDYCR+HGI++V+N A++D E+ G W+KLPL+RRLML+HPE+EWIWWMDSDA
Sbjct  183   LLKSTKNKIDYCRLHGIDVVHNMAHLDPELTGYWSKLPLVRRLMLAHPEVEWIWWMDSDA  242

Query  755   FFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPM  934
              FTDMAFE+PLS+YD  NLVIHGY DLLF+++SW AL+ G FL+RNCQW+LDLLD W PM
Sbjct  243   IFTDMAFELPLSRYDGANLVIHGYPDLLFEKRSWIALNAGIFLLRNCQWSLDLLDAWVPM  302

Query  935   GPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWA  1114
             GP+GP R E+GK LTA+L GRP FEADDQSALI+LL+ +K++WMDKV +E  +YLHG+W 
Sbjct  303   GPRGPSRVEAGKLLTASLTGRPAFEADDQSALIHLLLMQKERWMDKVHVETEFYLHGFWT  362

Query  1115  GLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQV  1294
             GLVDRYEE+ME++HPG GD+RWPF+THFVGCK CG   D+P+++CV  MERAFNFADNQV
Sbjct  363   GLVDRYEEMMEEHHPGLGDDRWPFITHFVGCKTCGRYEDYPLDRCVGGMERAFNFADNQV  422

Query  1295  LNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             L LYGF+HR L +  ++R+ +  T PL
Sbjct  423   LRLYGFRHRSLTTAKVRRVTDPATNPL  449



>gb|ABK24302.1| unknown [Picea sitchensis]
 gb|ACN41079.1| unknown [Picea sitchensis]
Length=444

 Score =   531 bits (1367),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 241/424 (57%), Positives = 315/424 (74%), Gaps = 13/424 (3%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSFLID---ETNRI  334
             R RQI +   N K+T+LC FVT+LVLRGTIG G   + +   AE+    ++    E +R+
Sbjct  13    RVRQIQKAMQNAKVTLLCLFVTVLVLRGTIGAGKFGTPEQDFAEIREHLIVGRRGEPHRV  72

Query  335   LDEIRSDKDPDDPEGQSGDRFLS------PNETFSLGPKITGWDEQRKVWFDRHPRFPSS  496
             L E+ ++   +       +          PN  +S GPKI+ WD+QR+ W   +P FP+ 
Sbjct  73    LTEVVAENSSNKSPPVVEEEVEEPEVERDPNVPYSFGPKISDWDDQRREWLAENPAFPNF  132

Query  497   V-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGN  673
             +  G+PR+LLVTGS P PCENPVGDH+LLK +KNKIDYCR+HGIEI YN A++DREM G 
Sbjct  133   LPGGRPRILLVTGSAPAPCENPVGDHFLLKSIKNKIDYCRLHGIEIFYNMAHLDREMSGF  192

Query  674   WAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKS  853
             WAKLPLIR+LML+HPE+E+IWWMDSDA FTDM FE+P  +Y +HN ++HG+++L++++K+
Sbjct  193   WAKLPLIRKLMLAHPEVEFIWWMDSDAMFTDMVFELPFERYKNHNFIMHGWEELVYNRKN  252

Query  854   WTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALI  1033
             W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR ++GK LT +L GRPEFEADDQSAL+
Sbjct  253   WIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIRLDAGKLLTRSLVGRPEFEADDQSALV  312

Query  1034  YLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKA  1213
             YLL++++++W DKV+LE++YYLHGYW  LVD+YEE+MEKY PG GD RWP VTHFVGCK 
Sbjct  313   YLLITQREKWGDKVYLESAYYLHGYWGILVDKYEEMMEKYQPGLGDHRWPLVTHFVGCKP  372

Query  1214  CGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRY  1393
             CG  GD+PV +C+K MERAFNF DNQ+L +YGF H+ L S  +KR RN+T  PL   D  
Sbjct  373   CGKFGDYPVAQCLKQMERAFNFGDNQILQIYGFTHKSLSSRGVKRTRNDTDKPLEVKDEL  432

Query  1394  DFRH  1405
                H
Sbjct  433   GLLH  436



>ref|XP_010269507.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nelumbo nucifera]
Length=455

 Score =   530 bits (1365),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 252/439 (57%), Positives = 318/439 (72%), Gaps = 30/439 (7%)
 Frame = +2

Query  167   VPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETN  328
             V R RQI R   + K+T+LC F+T++VLRGTIG G   + +    E+ + F      E +
Sbjct  10    VRRVRQIQRGIRHAKVTLLCLFLTVIVLRGTIGAGKFGTPEQDFNEIRDHFYFRKRAEPH  69

Query  329   RILDEIRSDK--------------DP-----DDPEGQSGDRFLSPNETFSLGPKITGWDE  451
             R+L+E ++ +              DP     D+ E +  D    PN+ +SLGPKI+ WDE
Sbjct  70    RVLEEAQTTEGATTTTTSNNHATFDPSKLMVDEEEDEKPD----PNKPYSLGPKISDWDE  125

Query  452   QRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W   +P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  126   QRARWLQENPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  185

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HN
Sbjct  186   IFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHN  245

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
              V+HG+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR E+GK LT  L
Sbjct  246   FVMHGWNEMIYDQKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIRTEAGKILTREL  305

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             K RP FEADDQSA++YLL +++D+W DKV+LE++YYLHGYW  LVDRYEE++E YHPG G
Sbjct  306   KDRPVFEADDQSAMVYLLATQRDKWGDKVYLESAYYLHGYWGILVDRYEEMIENYHPGLG  365

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR
Sbjct  366   DHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVKR  425

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             IRNET+ PL   D     H
Sbjct  426   IRNETSNPLEVKDELGLLH  444



>ref|XP_002967572.1| glycosyltransferase, CAZy family GT34-like protein [Selaginella 
moellendorffii]
 ref|XP_002981772.1| xyloglucan alpha-1,6-glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17254.1| xyloglucan alpha-1,6-glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ30919.1| glycosyltransferase, CAZy family GT34-like protein [Selaginella 
moellendorffii]
Length=439

 Score =   529 bits (1363),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 252/405 (62%), Positives = 318/405 (79%), Gaps = 5/405 (1%)
 Frame = +2

Query  176   GRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEV----ENSFLIDETNRILDE  343
             GRQI +T NNIK+T+LCGFVTILVLRGTIG G+  +   ++    +      +  R+L E
Sbjct  21    GRQIHKTLNNIKMTVLCGFVTILVLRGTIGAGSFGTPAQDLHDIRDTVHRRKDAGRVLAE  80

Query  344   IRSDKDPDDPEGQSGDRFLSPNET-FSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVL  520
              +S       E    +  +  +   +SLGPKI+ WDEQR  W  ++P  P+ V GKPR+L
Sbjct  81    AKSSSSAIAEEEAEVEAEVVDSGMPYSLGPKISDWDEQRGEWLRKNPHMPAVVNGKPRIL  140

Query  521   LVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRR  700
             LVTGS P PC+NPVGDHYLLK +KNK+DYCR+HGIEI YN A++D EM G WAKLPL+R+
Sbjct  141   LVTGSQPKPCDNPVGDHYLLKAIKNKVDYCRLHGIEIFYNMAHLDHEMAGYWAKLPLLRK  200

Query  701   LMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSF  880
             L+L+HPE+EWIWWMDSDA FTDM FE+P+ KY ++N V+HG+ +L++++K+W  L+TGSF
Sbjct  201   LLLAHPEVEWIWWMDSDAMFTDMVFELPMEKYANYNFVLHGWDELVYNKKNWIGLNTGSF  260

Query  881   LIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQ  1060
             LIRNCQW LD+LD WAPMGPKG IR+E+GK LTA+L GRP FEADDQSAL+YLLM+++D+
Sbjct  261   LIRNCQWTLDILDDWAPMGPKGKIRDEAGKILTASLAGRPAFEADDQSALVYLLMTKRDR  320

Query  1061  WMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPV  1240
             W D+VFLE+SYYLHGYWA LVD+YEE++EK HPG GD+RWPFVTHFVGCK CG  GD+PV
Sbjct  321   WGDRVFLESSYYLHGYWAILVDKYEEMIEKNHPGLGDDRWPFVTHFVGCKPCGRYGDYPV  380

Query  1241  EKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             E+C+K MERAFNFADNQ+L +YGF+HR L S  +KR RNET  PL
Sbjct  381   ERCLKQMERAFNFADNQILEIYGFRHRALGSAKVKRTRNETDRPL  425



>ref|XP_001776727.1| predicted protein [Physcomitrella patens]
 gb|EDQ58421.1| predicted protein [Physcomitrella patens]
Length=454

 Score =   530 bits (1364),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 240/410 (59%), Positives = 307/410 (75%), Gaps = 12/410 (3%)
 Frame = +2

Query  167   VPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEI  346
             +PRGR + R  +N+++TILCGFVT+LVLRGTIG    +     VE+S       +I  + 
Sbjct  26    LPRGRSLQRMAHNLRVTILCGFVTVLVLRGTIGTSFGSQRKGTVEHS----AQPKIFSDE  81

Query  347   RSDKDP-------DDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKG  505
             +S ++P        +PE    +  L  +  + LGP I+ WDEQR +W  +HPR   + +G
Sbjct  82    KSSREPRRVLSATTEPETDI-EPVLDSSLPYKLGPHISNWDEQRAMWLQKHPRMAKTSRG  140

Query  506   KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKL  685
             + R+LLVTGS P PC+NP GDH LLK +KNK+DYCR+H IEI YN A++D+EM G WAKL
Sbjct  141   RDRILLVTGSQPKPCDNPAGDHLLLKSLKNKMDYCRLHDIEIFYNMAHLDQEMAGFWAKL  200

Query  686   PLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTAL  865
             PL+R+LML HPE+EWIWWMDSDA FTDM FE+P+ KY  HN+V+HG+ ++++  KSW  L
Sbjct  201   PLLRKLMLQHPEVEWIWWMDSDAMFTDMLFELPIDKYKDHNMVLHGFDEMVYKMKSWVGL  260

Query  866   STGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLM  1045
             +TGSFL+RNCQW+LDLLD WAPMGPKG +R E+GK LTA L GRPEFEADDQSALI+LL+
Sbjct  261   NTGSFLLRNCQWSLDLLDAWAPMGPKGVVRVEAGKQLTATLTGRPEFEADDQSALIFLLV  320

Query  1046  SEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSS  1225
             ++   W  KVFLEN YYLHGYW  LV+RYEE+M+K  PG GD+RWPFVTHFVGCK CGS 
Sbjct  321   TQARLWASKVFLENQYYLHGYWVILVERYEEMMQKNKPGTGDDRWPFVTHFVGCKPCGSY  380

Query  1226  GDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             GD+ VE+C+K MERAFNF DNQ+L  YGF+HR L +  ++RIRN+T+ PL
Sbjct  381   GDYSVERCLKQMERAFNFGDNQILEHYGFQHRTLETYKVRRIRNDTSNPL  430



>emb|CAJ57380.1| alpha-1,6-xylosyltransferase [Physcomitrella patens]
Length=454

 Score =   528 bits (1361),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 239/410 (58%), Positives = 307/410 (75%), Gaps = 12/410 (3%)
 Frame = +2

Query  167   VPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEI  346
             +PRGR + R  +N+++TILCGFVT+LVLRGTIG    +     VE+S       +I  + 
Sbjct  26    LPRGRSLQRMAHNLRVTILCGFVTVLVLRGTIGTSFGSQRKGTVEHS----AQPKIFSDE  81

Query  347   RSDKDP-------DDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKG  505
             +S ++P        +PE    +  L  +  + LGP I+ WDEQR +W  +HPR   + +G
Sbjct  82    KSSREPRRVLSATTEPETDI-EPVLDSSLPYKLGPHISNWDEQRAMWLQKHPRMAKTSRG  140

Query  506   KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKL  685
             + R+LLVTGS P PC+NP GDH LLK +KNK+DYCR+H +EI YN A++D+EM G WAKL
Sbjct  141   RDRILLVTGSQPKPCDNPAGDHLLLKSLKNKMDYCRLHDMEIFYNMAHLDQEMAGFWAKL  200

Query  686   PLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTAL  865
             PL+R+LML HPE+EWIWWMDSDA FTDM FE+P+ KY  HN+V+HG+ ++++  KSW  L
Sbjct  201   PLLRKLMLQHPEVEWIWWMDSDAMFTDMLFELPIDKYKDHNMVLHGFDEMVYKMKSWVGL  260

Query  866   STGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLM  1045
             +TGSFL+RNCQW+LDLLD WAPMGPKG +R E+GK LTA L GRPEFEADDQSALI+LL+
Sbjct  261   NTGSFLLRNCQWSLDLLDAWAPMGPKGVVRVEAGKQLTATLTGRPEFEADDQSALIFLLV  320

Query  1046  SEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSS  1225
             ++   W  KVFLEN YYLHGYW  LV+RYEE+M+K  PG GD+RWPFVTHFVGCK CGS 
Sbjct  321   TQARLWASKVFLENQYYLHGYWVILVERYEEMMQKNKPGTGDDRWPFVTHFVGCKPCGSY  380

Query  1226  GDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             GD+ VE+C+K MERAFNF DNQ+L  YGF+HR L +  ++RIRN+T+ PL
Sbjct  381   GDYSVERCLKQMERAFNFGDNQILEHYGFQHRTLETYKVRRIRNDTSNPL  430



>ref|XP_004134208.1| PREDICTED: putative glycosyltransferase 2-like [Cucumis sativus]
 ref|XP_004164306.1| PREDICTED: putative glycosyltransferase 2-like [Cucumis sativus]
 gb|KGN57106.1| hypothetical protein Csa_3G154300 [Cucumis sativus]
Length=456

 Score =   526 bits (1354),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 247/435 (57%), Positives = 315/435 (72%), Gaps = 25/435 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID----ETNR  331
             R R+I R F +  +T+LC F+T++VLRGT+G G   + +    E+ + F       E  R
Sbjct  10    RFRRIQRAFRHSAVTVLCLFLTVVVLRGTVGAGKFGTPEQDFNEIRSHFSSRGRRVEPRR  69

Query  332   ILDEIRSDKDPDDPEGQSG----------------DRFLSPNETFSLGPKITGWDEQRKV  463
             +L+E + +   + P  QS                 D    PN+ FSLGPKI+ WD+QR  
Sbjct  70    VLEEAQPETT-NKPAEQSNNYATFDISKILVDEGEDEKPDPNKPFSLGPKISDWDQQRGE  128

Query  464   WFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYN  640
             W   +P FP+ ++  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN
Sbjct  129   WLKNNPDFPNFIRPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEIFYN  188

Query  641   SANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIH  820
              A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y  HN V+H
Sbjct  189   FALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFEVPWERYKDHNFVMH  248

Query  821   GYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRP  1000
             G+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +REE+GK LT  LK RP
Sbjct  249   GWNEMVYDQKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVREEAGKILTRELKDRP  308

Query  1001  EFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERW  1180
              FEADDQSA++YLL +++DQW +KV+LEN+YYLHGYW  LVDRYEE++E +HPG GD RW
Sbjct  309   VFEADDQSAMVYLLATQRDQWGEKVYLENAYYLHGYWGILVDRYEEMIENHHPGLGDHRW  368

Query  1181  PFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNE  1360
             P VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR+RN+
Sbjct  369   PLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLGSRRVKRVRND  428

Query  1361  TTLPLPNVDRYDFRH  1405
             T+ PL   D     H
Sbjct  429   TSNPLEVKDELGLLH  443



>ref|XP_008438884.1| PREDICTED: putative glycosyltransferase 2 [Cucumis melo]
Length=456

 Score =   525 bits (1352),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 246/435 (57%), Positives = 315/435 (72%), Gaps = 25/435 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID----ETNR  331
             R R+I R F +  +T+LC F+T++VLRGT+G G   + +    E+ + F       E  R
Sbjct  10    RLRRIQRAFRHSAVTVLCLFLTVVVLRGTVGAGKFGTPEQDFNEIRHHFSSRGRRVEPRR  69

Query  332   ILDEIRSDKDPDDPEGQSG----------------DRFLSPNETFSLGPKITGWDEQRKV  463
             +L+E + +   + P  QS                 D    PN+ FSLGPKI+ WD+QR  
Sbjct  70    VLEEAQPETT-NKPAEQSNNYATFDISKILVDEGEDEKPDPNKPFSLGPKISDWDQQRGE  128

Query  464   WFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYN  640
             W   +P FP+ ++  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE+ YN
Sbjct  129   WLKNNPDFPNFIRPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYN  188

Query  641   SANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIH  820
              A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y  HN V+H
Sbjct  189   FALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFEVPWERYKDHNFVMH  248

Query  821   GYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRP  1000
             G+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +REE+GK LT  LK RP
Sbjct  249   GWNEMVYDQKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVREEAGKILTRELKDRP  308

Query  1001  EFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERW  1180
              FEADDQSA++YLL +++DQW +KV+LEN+YYLHGYW  LVDRYEE++E +HPG GD RW
Sbjct  309   VFEADDQSAMVYLLATQRDQWGEKVYLENAYYLHGYWGILVDRYEEMIENHHPGLGDHRW  368

Query  1181  PFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNE  1360
             P VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR+RN+
Sbjct  369   PLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLGSRRVKRVRND  428

Query  1361  TTLPLPNVDRYDFRH  1405
             T+ PL   D     H
Sbjct  429   TSNPLEVKDELGLLH  443



>gb|KEH24376.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=466

 Score =   525 bits (1352),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 252/445 (57%), Positives = 315/445 (71%), Gaps = 34/445 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSF---LIDETNRI  334
             R R+  R  N+ K+TILC F+TI+VLRGTIG G   + +    ++ N F    + E +RI
Sbjct  10    RARKFQRFLNHCKVTILCLFLTIVVLRGTIGAGKFGTPEQDFVDIRNRFSSRKLSEPHRI  69

Query  335   LDEIR-------------------SDKDPDD--------PEGQSGDRFLSPNETFSLGPK  433
             L EI                    +D D +          E        S NE +SLGPK
Sbjct  70    LGEIHSTTSSSSRSDSSTTSTTNYNDFDINTILVDEEEEEEQGDEFEKRSSNEPYSLGPK  129

Query  434   ITGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYC  610
             I+ WDEQR  W   +P F + ++ GKPRVLLVTGS P PCENPVGDHYLLK +KNKIDYC
Sbjct  130   ISNWDEQRSKWIRENPNFSNFIRPGKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYC  189

Query  611   RIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLS  790
             R+HGIE+ YN A  D EM G WAKLPLIR+L+L+HPE+E++WWMDSDA FTDMAFE+P  
Sbjct  190   RLHGIEVFYNMALFDAEMAGFWAKLPLIRKLLLAHPEVEFLWWMDSDAMFTDMAFEVPWE  249

Query  791   KYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGK  970
             +Y   NLV+HG+ ++++D+K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+E+GK
Sbjct  250   RYKDSNLVMHGWNEMVYDEKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDEAGK  309

Query  971   TLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEK  1150
              LT  LKGRP FEADDQSA++YLL  EK++W DKV+LEN YYLHGYW  LVDRYEE++E 
Sbjct  310   ILTRELKGRPVFEADDQSAMVYLLAKEKEKWGDKVYLENGYYLHGYWGILVDRYEEMIEN  369

Query  1151  YHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLL  1330
             YHPGFGD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L+
Sbjct  370   YHPGFGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLV  429

Query  1331  SPNIKRIRNETTLPLPNVDRYDFRH  1405
             S  ++RIRNET+ PL   D     H
Sbjct  430   SRRVRRIRNETSNPLEVKDELGLLH  454



>ref|XP_006838788.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
 gb|ERN01357.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
Length=439

 Score =   524 bits (1349),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 246/429 (57%), Positives = 316/429 (74%), Gaps = 17/429 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID---ETNRI  334
             R RQI R   + K+T+LC F+T+LVLRGTIG G   + +    E+ +        + +R+
Sbjct  10    RMRQIQRALRHGKVTLLCLFITVLVLRGTIGAGKFGTPEQDFNEIRSHLSFSKRSQPHRV  69

Query  335   LDEIRSDKDPDDPEGQS------GDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSS  496
             L E +    PD  + QS       +    PN+ +SLGPKI+ WD QR  W + +P FP+ 
Sbjct  70    LVEAK----PDSEKLQSLLIDNEPEEIPDPNKPYSLGPKISDWDSQRAQWLEENPSFPNF  125

Query  497   VK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGN  673
             +   KPRVLLVTGS P  CENPVGDHYLLK +KNKIDYCR+HGIEI YN A +D EM G 
Sbjct  126   ITPNKPRVLLVTGSAPKACENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMALLDAEMAGF  185

Query  674   WAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKS  853
             WAKLPLIR+L+L+HPE+E++WWMDSDA FTDMAFE+P  +Y  HNLV+HG+ ++++DQK+
Sbjct  186   WAKLPLIRKLLLTHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHNLVMHGWNEMVYDQKN  245

Query  854   WTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALI  1033
             W  L+TGSFL+RN QWALDLLD WAPMGPKG IR ++GK LT  L+GRPEFEADDQSA++
Sbjct  246   WIGLNTGSFLLRNGQWALDLLDAWAPMGPKGKIRMDAGKLLTRTLRGRPEFEADDQSAMV  305

Query  1034  YLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKA  1213
             YLL++++++W DKV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFVGCK 
Sbjct  306   YLLITQREKWGDKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFVGCKP  365

Query  1214  CGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRY  1393
             CG  GD+ VEKC+K M+RAFNF DNQ+L +YGF H+ L S  ++RIRN+T+ PL   D  
Sbjct  366   CGKFGDYSVEKCLKQMDRAFNFGDNQILQMYGFMHKSLSSRAVRRIRNDTSDPLEVKDEL  425

Query  1394  DFRHAKHES  1420
                H + +S
Sbjct  426   GLLHPEFKS  434



>emb|CBI26079.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   523 bits (1347),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 242/412 (59%), Positives = 306/412 (74%), Gaps = 22/412 (5%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRS  352
             R RQ+ R F + KIT++C  +T++VLRGTIG GN         N++   + +++  +   
Sbjct  10    RVRQMQRAFRHGKITLMCLLMTVVVLRGTIGAGN---------NNYATFDISKLTVDEGE  60

Query  353   DKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVT  529
             D+ PD            PN+ +SLGPKI+ WDEQR  W  ++P FP+ +   KPRVLLVT
Sbjct  61    DEKPD------------PNKPYSLGPKISDWDEQRAEWLRKNPNFPNFIGPNKPRVLLVT  108

Query  530   GSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLML  709
             GS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A +D EM G WAKLPLIR+L+L
Sbjct  109   GSSPKPCENPVGDHYLLKAIKNKIDYCRLHGIEIFYNMALLDAEMAGFWAKLPLIRKLLL  168

Query  710   SHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIR  889
             SHPEIE++WWMDSDA FTDMAFE+P  +Y  HN V+HG+ ++++DQK+W  L+TGSFL+R
Sbjct  169   SHPEIEFLWWMDSDAMFTDMAFEVPWERYKDHNFVMHGWNEMVYDQKNWIGLNTGSFLLR  228

Query  890   NCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMD  1069
             NCQWALD+LD WAPMGPKG IR E+GK LT  LK RP FEADDQSA++YLL +++D W D
Sbjct  229   NCQWALDILDAWAPMGPKGKIRTEAGKILTRELKDRPVFEADDQSAMVYLLATQRDNWGD  288

Query  1070  KVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKC  1249
             KV+LE++YYLHGYW  LVDRYEE+++ +HPG GD RWP VTHFVGCK CG  GD+PVE+C
Sbjct  289   KVYLESAYYLHGYWGILVDRYEEMIKNHHPGLGDHRWPLVTHFVGCKPCGKFGDYPVERC  348

Query  1250  VKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             +K M+RAFNF DNQ+L +YGF H+ L S  +KR RN+T+ PL   D     H
Sbjct  349   LKQMDRAFNFGDNQILQIYGFTHKSLASRRVKRTRNDTSNPLEVKDDLGLLH  400



>ref|XP_008795804.1| PREDICTED: putative glycosyltransferase 2 [Phoenix dactylifera]
Length=452

 Score =   524 bits (1349),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 247/427 (58%), Positives = 309/427 (72%), Gaps = 16/427 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLIDET--NRIL  337
             R RQI R     KIT+LC F+T++VLRGTIG G   + +    E+ +  L   +  +R L
Sbjct  10    RVRQIQRALRQGKITLLCLFLTVIVLRGTIGAGKFGTPEQDFNEIRHRLLPHRSLPHRAL  69

Query  338   DEIRSDKDPDDPEGQSGDRFLS----------PNETFSLGPKITGWDEQRKVWFDRHPRF  487
              E ++D         +   F++          PN  +SLGPKI+ WDEQR  W  RHP  
Sbjct  70    VEQQTDHTSSSATAGATKAFIAGEGDDDPPRDPNVPYSLGPKISDWDEQRAAWLRRHPES  129

Query  488   PSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREM  664
             P+     KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A +D EM
Sbjct  130   PNFWGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRVHGIEIFYNLALLDAEM  189

Query  665   DGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFD  844
              G WAKLPLIR L+L+HPE+E++WWMDSDA FTDMAFE+P  +Y   NLV+HG+ ++++D
Sbjct  190   AGFWAKLPLIRSLLLAHPEVEFLWWMDSDAMFTDMAFELPWDRYAPFNLVMHGWNEMVYD  249

Query  845   QKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQS  1024
              K+W  L+TGSFL+RNCQW+LDLLD WAPMGPKG +R E+GK LT+ LK RP FEADDQS
Sbjct  250   DKNWIGLNTGSFLLRNCQWSLDLLDAWAPMGPKGKVRTEAGKVLTSFLKDRPVFEADDQS  309

Query  1025  ALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVG  1204
             A++YLL++++D+W DKV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFVG
Sbjct  310   AMVYLLVTQRDRWADKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFVG  369

Query  1205  CKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNV  1384
             CK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KRIRNET+ PL   
Sbjct  370   CKPCGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLASRRVKRIRNETSNPLDVK  429

Query  1385  DRYDFRH  1405
             D     H
Sbjct  430   DELGLLH  436



>emb|CAI11450.1| alpha-1,6-xylosyltransferase [Pinus taeda]
 gb|AHC98116.1| xyloglucan alpha-1,6-xylosyltransferase [Pinus radiata]
 tpg|DAA64591.1| TPA_inf: xyloglucan alpha-1,6-xylosyltransferase [Pinus taeda]
Length=444

 Score =   523 bits (1346),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 238/424 (56%), Positives = 312/424 (74%), Gaps = 13/424 (3%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID---ETNRI  334
             R RQI R   N K+T+LC FVT+LVLRGTIG G   + +    E+    ++    E +R+
Sbjct  13    RIRQIQRAMQNAKVTLLCLFVTVLVLRGTIGAGKFGTPEQDFNEIREHLIVGRRGEPHRV  72

Query  335   LDEIRSDKDPDDPEGQSGDRFLS------PNETFSLGPKITGWDEQRKVWFDRHPRFPSS  496
             L E+ ++   +       +          P+  +S GPKI+ WD+QR  W   +P FP+ 
Sbjct  73    LTEVVAESSNNKTPPVVEEEVEEPDVERDPSVPYSFGPKISDWDDQRSEWLAENPAFPNF  132

Query  497   V-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGN  673
             +  G+PR+LLVTGS P PCE+PVGDH LLK +KNKIDYCR+HGIEI YN A++D EM G 
Sbjct  133   LPGGRPRILLVTGSAPAPCESPVGDHLLLKSIKNKIDYCRLHGIEIFYNMAHLDHEMSGF  192

Query  674   WAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKS  853
             WAKLPLIR+LML+HPE+E+IWWMDSDA FTDM FE+P  +Y +HN ++HG+++L++++K+
Sbjct  193   WAKLPLIRKLMLTHPEVEFIWWMDSDAMFTDMVFELPFERYKNHNFIMHGWEELVYNRKN  252

Query  854   WTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALI  1033
             W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR E+GK LT +L GRPEFEADDQSAL+
Sbjct  253   WIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIRTEAGKLLTRSLVGRPEFEADDQSALV  312

Query  1034  YLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKA  1213
             YLL++++++W DKV+LE++YYLHGYW  LVD+YEE+MEK+HPG GD RWP VTHFVGCK 
Sbjct  313   YLLITQREKWGDKVYLESAYYLHGYWGILVDKYEEMMEKHHPGLGDHRWPLVTHFVGCKP  372

Query  1214  CGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRY  1393
             CG  GD+PV +C++ MERAFNF DNQ+L +YGF H+ L S  +KR RN+T  PL   D  
Sbjct  373   CGKVGDYPVAQCLRQMERAFNFGDNQILQIYGFTHKSLSSRGVKRTRNDTDKPLEVKDEL  432

Query  1394  DFRH  1405
                H
Sbjct  433   GLLH  436



>ref|NP_001288054.1| calmodulin binding transcription activator 1 [Malus domestica]
 ref|XP_008340813.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
 ref|XP_008353228.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
 ref|XP_008361964.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
 gb|ADL36660.1| CAMTA domain class transcription factor [Malus domestica]
Length=461

 Score =   523 bits (1347),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 246/439 (56%), Positives = 313/439 (71%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE---VENSFLID----ETNR  331
             R RQI R   +  +T LC F+T++VLRGTIG G   + + +   +   F       E +R
Sbjct  10    RARQIQRALRHGTVTFLCLFLTVVVLRGTIGAGKFGTPEQDFNDIRERFYTHNRRVEPHR  69

Query  332   ILDEI--RSDKDPDDPEGQSG------------------DRFLSPNETFSLGPKITGWDE  451
             +L+E    +++   DP GQS                   D    PN+ +SLGPKI+ WDE
Sbjct  70    VLEEATPETNQKDADPAGQSNNYAEFDISKILKDEPATDDEKRDPNQPYSLGPKISDWDE  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   QRSDWLKKNPGFPNFVGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             + YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HN
Sbjct  190   VFYNFALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
              V+HG+ ++++D K+W  L+TGSFL+RNCQW+LD+LDVWAPMGPKG IR+E+GK LT  L
Sbjct  250   FVMHGWNEMVYDDKNWIGLNTGSFLLRNCQWSLDILDVWAPMGPKGKIRDEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             KGRP FEADDQSA++Y+L   +D W  KV+LEN YYLHGYW  LVD+YEE++E +HPG G
Sbjct  310   KGRPVFEADDQSAMVYILAKGRDTWGKKVYLENGYYLHGYWGILVDKYEEMIENHHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+PVE+C+K M+RA+NF DNQVL +YGF+H+ L S  +KR
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQVLQMYGFEHKSLGSRRVKR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             +RNE++ PL   D+    H
Sbjct  430   VRNESSNPLEVKDKLGLLH  448



>ref|XP_009352257.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
Length=463

 Score =   522 bits (1344),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 245/439 (56%), Positives = 312/439 (71%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE---VENSFLID----ETNR  331
             R RQI R      +T LC F+T++VLRGT+G G   + + +   +   F       E +R
Sbjct  10    RARQIQRALRQGTVTFLCLFLTVVVLRGTVGAGKFGTPEQDFNDIRERFYTHNRRVEPHR  69

Query  332   ILDEIRSDKDPDDPE--GQSG------------------DRFLSPNETFSLGPKITGWDE  451
             +L E   + + +D +  GQS                   D    PN+ +SLGPKI+ WDE
Sbjct  70    VLKEATPETNQNDADQAGQSNNYAEFDISKILKDEPETEDEKRDPNQPYSLGPKISDWDE  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   QRSDWLKKNPSFPNFVGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             + YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HN
Sbjct  190   VFYNFALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
              V+HG+ ++++D K+W  L+TGSFL+RNCQW+LD+LDVWAPMGPKG IR+E+GK LT  L
Sbjct  250   FVMHGWNEMVYDDKNWIGLNTGSFLLRNCQWSLDMLDVWAPMGPKGKIRDEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             KGRP FEADDQSA++Y+L   +D W +KV+LEN YYLHGYW  LVDRYEE++E +HPG G
Sbjct  310   KGRPVFEADDQSAMVYILAKGRDTWGEKVYLENGYYLHGYWGILVDRYEEMIENHHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+PVE+C+K M+RA+NF DNQVL +YGF+H+ L S  +KR
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQVLQMYGFEHKSLGSRRVKR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             +RNE++ PL   D+    H
Sbjct  430   VRNESSNPLEVKDKLGLLH  448



>ref|XP_010259619.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nelumbo nucifera]
Length=449

 Score =   521 bits (1341),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 245/427 (57%), Positives = 310/427 (73%), Gaps = 18/427 (4%)
 Frame = +2

Query  179   RQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRILD  340
             RQI R   + K+ +LC FVTI+VLR TIG     + +    E+ +        E  R+L+
Sbjct  12    RQIHRALRHGKVALLCLFVTIIVLRSTIGAEKSGTPEQDFDEIRDHLHFRRRAEPRRVLE  71

Query  341   EIRSDKDPD-------DPEG----QSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRF  487
             E ++    +       DP      +  D    PN+ +SLGPKI+GWDEQR  W +++P F
Sbjct  72    EAQTTDATNINNYNTFDPSKLMVDEEEDEKPDPNKPYSLGPKISGWDEQRANWLEKNPDF  131

Query  488   PSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREM  664
             P+ +   KPRVLLVTGS P PCENPVGDHYL+K +KNKIDYCR+HGIEI YN A +D EM
Sbjct  132   PNFIGPNKPRVLLVTGSSPKPCENPVGDHYLVKSIKNKIDYCRLHGIEIFYNMALLDAEM  191

Query  665   DGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFD  844
              G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HN V+HG+ ++++D
Sbjct  192   AGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWQRYKDHNFVMHGWNEMVYD  251

Query  845   QKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQS  1024
             QK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR E+GK LT  LK RP FEADDQS
Sbjct  252   QKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIRTEAGKILTRELKDRPVFEADDQS  311

Query  1025  ALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVG  1204
             A++YLL++++D+W DKV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFVG
Sbjct  312   AMVYLLVTQRDKWGDKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFVG  371

Query  1205  CKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNV  1384
             CK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR RNET  PL   
Sbjct  372   CKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVKRTRNETDNPLEVK  431

Query  1385  DRYDFRH  1405
             D     H
Sbjct  432   DELGLLH  438



>ref|XP_010652172.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Vitis vinifera]
 emb|CAN59912.1| hypothetical protein VITISV_017033 [Vitis vinifera]
Length=452

 Score =   520 bits (1339),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 245/432 (57%), Positives = 308/432 (71%), Gaps = 21/432 (5%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSF---LIDETNRI  334
             R RQI R   + K+TILC  +TI+VLRGTIG G   + +    E+ + F      E +R+
Sbjct  10    RARQIHRALRHFKVTILCLVMTIVVLRGTIGAGKFGTPEQDFVEIRDHFSPRKRAEPHRV  69

Query  335   LDEIRSDKDPDDPEGQSGDRFLS--------------PNETFSLGPKITGWDEQRKVWFD  472
             L+E+++               L+              P + +SLGPKI+ WDEQR  W +
Sbjct  70    LEEVQTTSSSSSELNNYATFDLNKLLVDEEDDSEKPDPKKPYSLGPKISDWDEQRSTWLE  129

Query  473   RHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSAN  649
             ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A 
Sbjct  130   QNPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMAL  189

Query  650   MDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQ  829
             +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  +N V+HG+ 
Sbjct  190   LDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERYKDYNFVMHGWN  249

Query  830   DLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFE  1009
             ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR E+GK LT  LK RP FE
Sbjct  250   EMVYDQKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIRTEAGKILTRELKDRPVFE  309

Query  1010  ADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFV  1189
             ADDQSA++YLL ++KD W  KV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP V
Sbjct  310   ADDQSAMVYLLATQKDTWGGKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLV  369

Query  1190  THFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTL  1369
             THFVGCK CG  GD+PVE+C+K M+RAFNF DNQVL +YGF H+ L S  +KR RN+T  
Sbjct  370   THFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQVLQIYGFTHKSLGSRRVKRTRNDTNN  429

Query  1370  PLPNVDRYDFRH  1405
             PL   D     H
Sbjct  430   PLEVKDELGLLH  441



>ref|XP_003609672.1| Xyloglucan 6-xylosyltransferase [Medicago truncatula]
 gb|AES91869.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=454

 Score =   520 bits (1339),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 243/435 (56%), Positives = 310/435 (71%), Gaps = 26/435 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID----ETNR  331
             R RQ+ R F    +T LC F+T++VLRGTIG G   + +    E+           E +R
Sbjct  10    RLRQMQRAFRRGTLTFLCLFLTVIVLRGTIGAGKFGTPEQDLNEIRQQLYSRGRRVEPHR  69

Query  332   ILDEIRSDKD----------------PDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKV  463
             +L+E++S ++                 D+  G    R   PN  ++LGPKI+ WDEQR  
Sbjct  70    VLEEVQSSENNNDNNNYATFDITKILKDEEAGDDEKR--DPNTPYTLGPKISDWDEQRSS  127

Query  464   WFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYN  640
             W   +P +P+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN
Sbjct  128   WLSNNPDYPNFINPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEIFYN  187

Query  641   SANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIH  820
              A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HN V+H
Sbjct  188   MALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHNFVMH  247

Query  821   GYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRP  1000
             G+ ++++D+K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR+E+GK LT  LK RP
Sbjct  248   GWNEMIYDEKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIRDEAGKILTRELKNRP  307

Query  1001  EFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERW  1180
              FEADDQSA++YLL + ++QW  KV+LEN YYLHGYW  LVDRYEE++E YHPGFGD RW
Sbjct  308   VFEADDQSAMVYLLATGREQWGGKVYLENHYYLHGYWGILVDRYEEMIENYHPGFGDHRW  367

Query  1181  PFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNE  1360
             P VTHFVGCK CG  GD+PVE+C+K M+RA+NF DNQ+L +YGF H+ L S  +KR+RNE
Sbjct  368   PLVTHFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQILQMYGFTHKSLASRRVKRVRNE  427

Query  1361  TTLPLPNVDRYDFRH  1405
             ++ PL   D     H
Sbjct  428   SSNPLDVKDELGLLH  442



>emb|CAN77730.1| hypothetical protein VITISV_027412 [Vitis vinifera]
Length=450

 Score =   520 bits (1338),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 244/430 (57%), Positives = 308/430 (72%), Gaps = 19/430 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID---ETNRI  334
             R RQ+ R F + KIT++C  +T++VLRGTIG G   + +    E+   F      E +R+
Sbjct  10    RVRQMQRAFRHGKITLMCLLMTVVVLRGTIGAGKFGTPEQDFNEIREHFHNRKRVEPHRV  69

Query  335   LDEIRSDKDPDDPEG------------QSGDRFLSPNETFSLGPKITGWDEQRKVWFDRH  478
             L+E     +  +               +  D    PN+ +SLGPKI+ WDEQR  W  ++
Sbjct  70    LEEAEVSTESSESNNYATFDISKLTVDEGEDEKPDPNKPYSLGPKISDWDEQRAEWLRKN  129

Query  479   PRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMD  655
             P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HG EI YN A +D
Sbjct  130   PNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKAIKNKIDYCRLHGXEIFYNMALLD  189

Query  656   REMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDL  835
              EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y  HN V+HG+ ++
Sbjct  190   AEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFEVPWERYKDHNFVMHGWNEM  249

Query  836   LFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEAD  1015
             ++DQK+W  L+TGSFL+RNCQWALD+LD WAPMGPKG IR E+GK LT  LK RP FEAD
Sbjct  250   VYDQKNWIGLNTGSFLLRNCQWALDILDAWAPMGPKGKIRTEAGKILTRELKDRPVFEAD  309

Query  1016  DQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTH  1195
             DQSA++YLL +++D W DKV+LE++YYLHGYW  LVDRYEE++E +HPG GD RWP VTH
Sbjct  310   DQSAMVYLLATQRDNWGDKVYLESAYYLHGYWGILVDRYEEMIENHHPGLGDHRWPLVTH  369

Query  1196  FVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             FVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR RN+T+ PL
Sbjct  370   FVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVKRTRNDTSNPL  429

Query  1376  PNVDRYDFRH  1405
                D     H
Sbjct  430   EVKDDLGLLH  439



>ref|XP_010938345.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Elaeis guineensis]
Length=449

 Score =   519 bits (1337),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 245/421 (58%), Positives = 301/421 (71%), Gaps = 27/421 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD-------------------AE  295
             R RQI R     K+T+LC F+T++VLRGTIG G   + +                   A 
Sbjct  10    RVRQIQRALRRGKLTLLCLFLTVIVLRGTIGAGKFGTPEQDFNEIRQRLRHHRSLPHRAL  69

Query  296   VENSFLIDETNRILDEIRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDR  475
             VEN               +D+  DDP          PN  +SLGPKI+ WDEQR  W  R
Sbjct  70    VENQAGHSSATTAGKTFAADEGDDDPPR-------DPNIPYSLGPKISDWDEQRAAWLRR  122

Query  476   HPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANM  652
             HP  P+     KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A +
Sbjct  123   HPESPNFWGSNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRVHGIEIFYNLALL  182

Query  653   DREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQD  832
             D EM G WAKLPLIR L+L+HPE+E++WWMDSDA FTDMAFE+P  +Y   NLV+HG+ +
Sbjct  183   DAEMAGFWAKLPLIRSLLLAHPEVEFLWWMDSDAMFTDMAFELPWERYAPFNLVMHGWNE  242

Query  833   LLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEA  1012
             +++D K+W  L+TGSFL+RNCQW+LDLLD WAPMGPKG +R E+GK LT+ LK RP FEA
Sbjct  243   MVYDDKNWIGLNTGSFLLRNCQWSLDLLDAWAPMGPKGKVRTEAGKVLTSFLKDRPVFEA  302

Query  1013  DDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVT  1192
             DDQSA++YLL++++D+W DKV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP VT
Sbjct  303   DDQSAMVYLLVTQRDRWADKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVT  362

Query  1193  HFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLP  1372
             HFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KRIRNET+ P
Sbjct  363   HFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLASRRVKRIRNETSNP  422

Query  1373  L  1375
             L
Sbjct  423   L  423



>ref|XP_009414141.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=441

 Score =   519 bits (1337),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 242/417 (58%), Positives = 306/417 (73%), Gaps = 6/417 (1%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-----SFLIDETNRIL  337
             R RQ+ R   N ++T+LC  +TI+VLRGTIG G   + + ++ +            +R L
Sbjct  12    RVRQLHRALRNGRLTLLCLVMTIVVLRGTIGAGRFGTPEQDLHDIRRLLHSHPHHPHRAL  71

Query  338   DEIRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSV-KGKPR  514
              E +      +   +  D    P++ +SLGPKI+ WDEQR  W  RHP  P+ +   KPR
Sbjct  72    TEQQPQHTDSNGAEEEEDPPRDPSKPYSLGPKISDWDEQRADWLRRHPERPNFLGSTKPR  131

Query  515   VLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLI  694
             VLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A +D EM G WAKLPLI
Sbjct  132   VLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRVHGIEIFYNLALLDAEMAGFWAKLPLI  191

Query  695   RRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTG  874
             R L+L+HPE+E++WWMDSDA FTDMAFE+P  +Y   NLV+HG+ ++++D ++W  L+TG
Sbjct  192   RSLLLAHPEVEFLWWMDSDAMFTDMAFELPWERYAPFNLVLHGWNEMVYDDRNWIGLNTG  251

Query  875   SFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEK  1054
             SFL+RNCQW+LDLLDVWAPMGPKG  R E+GK LTA LK RP FEADDQSA++YLL++++
Sbjct  252   SFLLRNCQWSLDLLDVWAPMGPKGKTRTEAGKVLTAFLKDRPVFEADDQSAMVYLLVTQR  311

Query  1055  DQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDF  1234
             D+W DKV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFVGCK CG  GD+
Sbjct  312   DRWGDKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFVGCKPCGKFGDY  371

Query  1235  PVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KRIRNET+ PL   D     H
Sbjct  372   PVERCLKQMDRAFNFGDNQILQMYGFTHKSLASRKVKRIRNETSNPLELKDELGLLH  428



>ref|XP_002516919.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
 gb|EEF45533.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
Length=461

 Score =   519 bits (1336),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 313/442 (71%), Gaps = 33/442 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R  +I R   + K+T+ C F+T++VLRGTIG G   + + +  +       S    E +R
Sbjct  10    RVVRIQRAIRHGKVTLFCLFMTVIVLRGTIGAGKFGTPEQDFNDLRERFYASRKHAEPHR  69

Query  332   ILDEIRSDKDPD---------DP--------------EGQSGDRFLSPNETFSLGPKITG  442
             +L E +   +           DP              EGQ  D    PN+ +SLGP+I+ 
Sbjct  70    VLVEAQLSTESTQNNNNNDNTDPKNYATFDINTILVDEGQ--DEKPDPNKPYSLGPRISD  127

Query  443   WDEQRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIH  619
             WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+H
Sbjct  128   WDEQRAEWLKKNPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLH  187

Query  620   GIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYD  799
             GIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y 
Sbjct  188   GIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFEVPWERYK  247

Query  800   SHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLT  979
               N V+HG+ ++++DQK+W  L+TGSFL+RNCQWALD+LD WAPMGPKG IREE+GK LT
Sbjct  248   DSNFVMHGWNEMIYDQKNWIGLNTGSFLLRNCQWALDILDAWAPMGPKGKIREEAGKVLT  307

Query  980   ANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHP  1159
               LK RP FEADDQSA++YLL +++D+W DKV+LE++YYLHGYW  LVDRYEE++E YHP
Sbjct  308   RELKDRPVFEADDQSAMVYLLATQRDKWGDKVYLESAYYLHGYWGILVDRYEEMIENYHP  367

Query  1160  GFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPN  1339
             G GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  
Sbjct  368   GLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLASRR  427

Query  1340  IKRIRNETTLPLPNVDRYDFRH  1405
             +KR+RNE+++PL   D     H
Sbjct  428   VKRVRNESSIPLEVKDELGLLH  449



>ref|XP_008367147.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=460

 Score =   518 bits (1335),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/439 (56%), Positives = 311/439 (71%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE---VENSFLID----ETNR  331
             R RQI R      +T LC F+T++VLRGT+G G   + + +   +   F       E +R
Sbjct  10    RARQIQRALRQGMVTFLCLFLTVVVLRGTVGAGKFGTPEQDFNDIRERFYTHNRRVEPHR  69

Query  332   ILDEIRSDKDPDDPE--GQSG------------------DRFLSPNETFSLGPKITGWDE  451
             +L E   + + +D +  GQS                   D    PN+ +SLGPKI+ WDE
Sbjct  70    VLKEATPETNQNDADQAGQSNNYAEFDISKILKDEPETEDXKRDPNQPYSLGPKISNWDE  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   QRSDWLKKNPGFPNFVGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             + YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HN
Sbjct  190   VFYNFALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
              V+HG+ ++++  K+W  L+TGSFL+RNCQW+LD+LDVWAPMGPKG IR+E+GK LT  L
Sbjct  250   FVMHGWNEMVYXDKNWIGLNTGSFLLRNCQWSLDMLDVWAPMGPKGKIRDEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             KGRP FEADDQSA++Y+L   +D W +KV+LEN YYLHGYW  LVDRYEE++E +HPG G
Sbjct  310   KGRPVFEADDQSAMVYILAKGRDTWGEKVYLENGYYLHGYWGILVDRYEEMIENHHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+PVE+C+K M+RA+NF DNQVL +YGF+H+ L S  +KR
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQVLQMYGFEHKSLGSRRVKR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             +RNE++ PL   D+    H
Sbjct  430   VRNESSNPLEVKDKLGLLH  448



>ref|XP_010098280.1| Xyloglucan 6-xylosyltransferase [Morus notabilis]
 gb|EXB74784.1| Xyloglucan 6-xylosyltransferase [Morus notabilis]
Length=463

 Score =   518 bits (1335),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/442 (56%), Positives = 317/442 (72%), Gaps = 31/442 (7%)
 Frame = +2

Query  167   VPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID----ET  325
             V R RQI R   +  +T LC F+T++VLRGTIG G   + +    E+ +         E 
Sbjct  8     VRRVRQIQRAVRHGTVTFLCLFLTVVVLRGTIGAGKFGTPELDFNEIRDHLSYTRRRGEP  67

Query  326   NRILDEIR----------SDKDPDD-----------PEGQSGDRFLSPNETFSLGPKITG  442
             +R+L+E            S+ DP++            EG+   R   P++ ++LGP+I+ 
Sbjct  68    HRVLEEASAQNDAGTAAASNADPNNYATFDISKILVDEGEDEKR--DPSKPYTLGPRISD  125

Query  443   WDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIH  619
             WDEQR  W   +P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+H
Sbjct  126   WDEQRWEWLKNNPGFPNFLAPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLH  185

Query  620   GIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYD  799
             GIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y 
Sbjct  186   GIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFEVPWERYK  245

Query  800   SHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLT  979
              HN V+HG+ ++++D+++W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR+E+GK LT
Sbjct  246   DHNFVMHGWNEMIYDERNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIRDEAGKILT  305

Query  980   ANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHP  1159
               LKGRP FEADDQSA++YLLM E+D+W +KV+LE++YYLHGYW  LVDRYEE+++ YHP
Sbjct  306   RELKGRPVFEADDQSAMVYLLMKERDKWGEKVYLESAYYLHGYWGILVDRYEEMIDNYHP  365

Query  1160  GFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPN  1339
             G GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  
Sbjct  366   GLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLASRK  425

Query  1340  IKRIRNETTLPLPNVDRYDFRH  1405
             +KR+RN+T+ PL   D     H
Sbjct  426   VKRVRNDTSNPLEVKDELGLLH  447



>ref|XP_009144556.1| PREDICTED: putative glycosyltransferase 2 [Brassica rapa]
Length=462

 Score =   518 bits (1335),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 247/443 (56%), Positives = 316/443 (71%), Gaps = 36/443 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVE-------NSFLIDETNR  331
             R R+I R   ++K+T+LC  +TI+VLRGTIG G   + + +++        S    E +R
Sbjct  10    RCRRIQRALRHLKVTVLCLVLTIVVLRGTIGAGKFGTPEQDLDEIRQHIYTSRKRAEPHR  69

Query  332   ILDEIRSDKDP------------------------DDPEGQSGDRFLSPNETFSLGPKIT  439
             +L+EI++  D                         D+ E +  D    PN+ ++LGPKI+
Sbjct  70    VLEEIQTGGDSSSSGGGGGGGSNNYETFDINKIFVDEGEEEKPD----PNKPYTLGPKIS  125

Query  440   GWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRI  616
              WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+
Sbjct  126   DWDEQRSDWLAKNPTFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRL  185

Query  617   HGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKY  796
             HGIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y
Sbjct  186   HGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWERY  245

Query  797   DSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTL  976
               +NLV+HG+ ++++D+K+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK L
Sbjct  246   KDYNLVMHGWNEMVYDEKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKVL  305

Query  977   TANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYH  1156
             T  LKGRP FEADDQSA++YLL +++  W +KV+LEN YYLHGYW  LVD+YEE++E +H
Sbjct  306   TRELKGRPVFEADDQSAMVYLLATQRATWGNKVYLENGYYLHGYWGILVDKYEEMIENHH  365

Query  1157  PGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSP  1336
             PG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S 
Sbjct  366   PGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASR  425

Query  1337  NIKRIRNETTLPLPNVDRYDFRH  1405
              +KR+RNET+ PL   D     H
Sbjct  426   KVKRVRNETSNPLEMKDELGLLH  448



>ref|XP_010922270.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Elaeis guineensis]
Length=454

 Score =   518 bits (1334),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 245/428 (57%), Positives = 309/428 (72%), Gaps = 17/428 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLIDET--NRIL  337
             R RQI R     K+T+LC F+T++VLRGTIG G   + +    E+ +  L   +  +R L
Sbjct  10    RVRQIQRALQRGKLTLLCLFLTVIVLRGTIGAGKFGTPEQDFNEIRHHLLSHRSLPHRAL  69

Query  338   DEIRSDKDPDDPEGQSGDR-FLS----------PNETFSLGPKITGWDEQRKVWFDRHPR  484
              E ++D            + F++          PN  ++LGPKI+ WDEQR  W  RHP 
Sbjct  70    VEQQADHTSSSSATAGATKPFIADEGGDDPPQDPNIPYTLGPKISDWDEQRAAWLRRHPE  129

Query  485   FPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDRE  661
              P+     KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A +D E
Sbjct  130   SPNFWGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRVHGIEIFYNLALLDAE  189

Query  662   MDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLF  841
             M G WAKLPLIR L+L+HPE+E++WWMDSDA FTDMAFE+P  +Y   NLV+HG+ ++++
Sbjct  190   MAGFWAKLPLIRSLLLAHPEVEFLWWMDSDAMFTDMAFELPWDRYAPFNLVMHGWNEMVY  249

Query  842   DQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQ  1021
             D K+W  L+TGSFL+RNCQW+LDLLD WAPMGPKG +R E+GK LT+ LK RP FEADDQ
Sbjct  250   DDKNWIGLNTGSFLLRNCQWSLDLLDAWAPMGPKGKVRTEAGKVLTSFLKDRPVFEADDQ  309

Query  1022  SALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFV  1201
             SA++YLL++++D+W DKV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFV
Sbjct  310   SAMVYLLVTQRDRWGDKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFV  369

Query  1202  GCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPN  1381
             GCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KRIRNET+ PL  
Sbjct  370   GCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLASRRVKRIRNETSNPLDV  429

Query  1382  VDRYDFRH  1405
              D     H
Sbjct  430   KDELGLLH  437



>ref|XP_003554517.1| PREDICTED: putative glycosyltransferase 2-like [Glycine max]
Length=455

 Score =   518 bits (1333),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 313/438 (71%), Gaps = 28/438 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSFL---IDETNRI  334
             R R+  R   + K+TILC  +TI+VLRGTIG G   + +    ++ N F    + E +R+
Sbjct  10    RARRFHRALRHCKVTILCLVLTIVVLRGTIGAGKFGTPEQDLVDIRNRFYTRKLPEPHRL  69

Query  335   LDEIRSDKDP--------------------DDPEGQSGDRFLSPNETFSLGPKITGWDEQ  454
             L E+ S   P                    D+ E ++ ++ ++P+E + LGPKI+ WDEQ
Sbjct  70    LAELHSTTTPFESSTSTTNYNAFDINTILVDETEDENREK-VNPHEAYRLGPKISIWDEQ  128

Query  455   RKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEI  631
             R  W   +P F + ++  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE+
Sbjct  129   RSRWLRENPNFSNFLRPNKPRVLLVTGSSPKPCENPVGDHYLLKAIKNKIDYCRLHGIEV  188

Query  632   VYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNL  811
              YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDM F +P  +Y   NL
Sbjct  189   FYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMKFAVPWERYKDSNL  248

Query  812   VIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLK  991
             V+HG+ ++++D K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+E+GK LT  LK
Sbjct  249   VMHGWNEMVYDDKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDEAGKVLTRELK  308

Query  992   GRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGD  1171
              RP FEADDQSA++YLL  E+++W  KV+LEN YYLHGYW  LVDRYEE++E YHPGFGD
Sbjct  309   DRPVFEADDQSAMVYLLAKEREKWGGKVYLENGYYLHGYWGILVDRYEEMIENYHPGFGD  368

Query  1172  ERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRI  1351
              RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L++YGF H+ L S  +KRI
Sbjct  369   HRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILHIYGFTHKSLGSRGVKRI  428

Query  1352  RNETTLPLPNVDRYDFRH  1405
             RNET+ PL   D     H
Sbjct  429   RNETSNPLEVKDELGLLH  446



>ref|XP_007050873.1| Alpha-1,6-xylosyltransferase isoform 1 [Theobroma cacao]
 gb|EOX95030.1| Alpha-1,6-xylosyltransferase isoform 1 [Theobroma cacao]
Length=455

 Score =   518 bits (1333),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 243/439 (55%), Positives = 312/439 (71%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R   + K+TI+C  +T++VLRGTIG G   + +    E+ + F      E +R+
Sbjct  10    RSRKIQRALRHCKVTIICLVLTLVVLRGTIGAGKFGTPEQDFIEIRDHFYSRKRAEPHRV  69

Query  335   LDEIRSDKDPDDP---------------------EGQSGDRFLSPNETFSLGPKITGWDE  451
             L+E+++    +                       + +S D  L  N  +SLGPKI+ WD+
Sbjct  70    LEEVQTTSSNNHAATDTDAGTNNYNEFDINKILVDEESDDSKLDRNRPYSLGPKISDWDK  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W   +P +P+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   QRSEWLKENPDYPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDSN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
             LV+HG+ ++++DQK+W  L+TGSFL+RN QWALD+LD WAPMGPKG IREE+GK LT  L
Sbjct  250   LVMHGWNEMVYDQKNWIGLNTGSFLLRNGQWALDILDAWAPMGPKGKIREEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             K RP FEADDQSA++YLL +++++W DKV+LE++YYLHGYW  LVDRYEE++E YHPG G
Sbjct  310   KDRPVFEADDQSAMVYLLATQREKWGDKVYLESAYYLHGYWGILVDRYEEMIENYHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVKR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             +RNET  PL   D     H
Sbjct  430   VRNETGHPLEVKDELGLLH  448



>ref|XP_008360279.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=460

 Score =   518 bits (1333),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 244/439 (56%), Positives = 311/439 (71%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE---VENSFLID----ETNR  331
             R RQI R      +T LC F+T++VLRGT+G G   + + +   +   F       E +R
Sbjct  10    RARQIQRALRQGMVTFLCLFLTVVVLRGTVGAGKFGTPEQDFNDIRERFYTHNRRVEPHR  69

Query  332   ILDEIRSDKDPDDPE--GQSG------------------DRFLSPNETFSLGPKITGWDE  451
             +L E   + + +D +  GQS                   D    PN+ +SLGPKI+ WDE
Sbjct  70    VLKEATPETNQNDADQAGQSNNYAEFDISKILKDEPETEDDKRDPNQPYSLGPKISNWDE  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   QRSDWLKKNPGFPNFVGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             + YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HN
Sbjct  190   VFYNFALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
              V+HG+ ++++  K+W  L+TGSFL+RNCQW+LD+LDVWAPMGPKG IR+E+GK LT  L
Sbjct  250   FVMHGWNEMVYXDKNWIGLNTGSFLLRNCQWSLDMLDVWAPMGPKGKIRDEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             KGRP FEADDQSA++Y+L   +D W +KV+LEN YYLHGYW  LVDRYEE++E +HPG G
Sbjct  310   KGRPVFEADDQSAMVYILAKGRDTWGEKVYLENGYYLHGYWGILVDRYEEMIENHHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+PVE+C+K M+RA+NF DNQVL +YGF+H+ L S  +KR
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQVLQMYGFEHKSLGSRRVKR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             +RNE++ PL   D+    H
Sbjct  430   VRNESSNPLEVKDKLGLLH  448



>ref|XP_004508217.1| PREDICTED: putative glycosyltransferase 2-like [Cicer arietinum]
Length=452

 Score =   517 bits (1332),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 246/433 (57%), Positives = 307/433 (71%), Gaps = 24/433 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID----ETNR  331
             R RQ+ R      +T LC F+T++VLRGTIG G   + +    E+   F       E +R
Sbjct  10    RLRQMQRACRRGSLTFLCLFLTVIVLRGTIGAGKFGTPEQDLNEIRQQFYSRGRRVEPHR  69

Query  332   ILDEIRS--------------DKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWF  469
             +L+E++S               K   D  G    R   P   ++LGPKI+ WDEQR  W 
Sbjct  70    VLEEVQSTDNNNNNNYATFDISKILVDEGGDDEKR--DPKTPYTLGPKISDWDEQRSKWL  127

Query  470   DRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSA  646
               +P +PS ++  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A
Sbjct  128   RNNPDYPSFIRPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMA  187

Query  647   NMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGY  826
              +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HN V+HG+
Sbjct  188   LLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHNFVMHGW  247

Query  827   QDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEF  1006
              ++++D+K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IREE+GK LT  LK RP F
Sbjct  248   NEMIYDEKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIREEAGKILTRELKNRPVF  307

Query  1007  EADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPF  1186
             EADDQSA++YLL + K+QW  KV+LEN YYLHGYW  LVDRYEE++E YHPGFGD RWP 
Sbjct  308   EADDQSAMVYLLATGKEQWGGKVYLENHYYLHGYWGILVDRYEEMIENYHPGFGDHRWPL  367

Query  1187  VTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETT  1366
             VTHFVGCK CG  GD+PVE+C+K M+RA+NF DNQ+L +YGF H+ L S  +KR+RNE+ 
Sbjct  368   VTHFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQILQMYGFTHKSLASRRVKRVRNESG  427

Query  1367  LPLPNVDRYDFRH  1405
              PL   D     H
Sbjct  428   NPLDVKDELGLLH  440



>ref|XP_008790864.1| PREDICTED: putative glycosyltransferase 2 [Phoenix dactylifera]
Length=449

 Score =   517 bits (1331),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 244/414 (59%), Positives = 305/414 (74%), Gaps = 13/414 (3%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLIDET--NRIL  337
             R RQI R     K+T LC FVT++VLRGTIG G   + +    E+        +  +R L
Sbjct  10    RVRQIRRALRRGKLTFLCLFVTVIVLRGTIGAGKFGTPEQDFNEIRQRLRPHGSLPHRAL  69

Query  338   DEIRSDKDPDDPEGQS-------GDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSS  496
              E ++D       G++        D    PN  +SLGPKI+ WDEQR  W  RHP  P+ 
Sbjct  70    VEQQADHSSAATAGKAFVADEGDDDPPRDPNIPYSLGPKISDWDEQRAAWLRRHPESPNF  129

Query  497   V-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGN  673
                 KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A +D EM G 
Sbjct  130   WGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRVHGIEIFYNLALLDAEMAGF  189

Query  674   WAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKS  853
             WAKLPLIR L+L+HPE+E++WWMDSDA FTDMAF++P  +Y   NLV+HG+ ++++D K+
Sbjct  190   WAKLPLIRSLLLAHPEVEFLWWMDSDAMFTDMAFDLPWERYAPFNLVMHGWNEMVYDDKN  249

Query  854   WTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALI  1033
             W  L+TGSFL+RNCQW+LDLLD WAPMGPKG +R E+GK LT+ LK RP FEADDQSA++
Sbjct  250   WIGLNTGSFLLRNCQWSLDLLDAWAPMGPKGKVRTEAGKVLTSFLKDRPVFEADDQSAMV  309

Query  1034  YLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKA  1213
             YLL++++D+W DKV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFVGCK 
Sbjct  310   YLLVTQRDRWADKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFVGCKP  369

Query  1214  CGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L+S  +KRIRNET+ PL
Sbjct  370   CGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLVSRRVKRIRNETSNPL  423



>ref|XP_007050874.1| Alpha-1,6-xylosyltransferase isoform 2 [Theobroma cacao]
 gb|EOX95031.1| Alpha-1,6-xylosyltransferase isoform 2 [Theobroma cacao]
Length=469

 Score =   518 bits (1333),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 246/460 (53%), Positives = 322/460 (70%), Gaps = 29/460 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R   + K+TI+C  +T++VLRGTIG G   + +    E+ + F      E +R+
Sbjct  10    RSRKIQRALRHCKVTIICLVLTLVVLRGTIGAGKFGTPEQDFIEIRDHFYSRKRAEPHRV  69

Query  335   LDEIRSDKDPDDP---------------------EGQSGDRFLSPNETFSLGPKITGWDE  451
             L+E+++    +                       + +S D  L  N  +SLGPKI+ WD+
Sbjct  70    LEEVQTTSSNNHAATDTDAGTNNYNEFDINKILVDEESDDSKLDRNRPYSLGPKISDWDK  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W   +P +P+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   QRSEWLKENPDYPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDSN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
             LV+HG+ ++++DQK+W  L+TGSFL+RN QWALD+LD WAPMGPKG IREE+GK LT  L
Sbjct  250   LVMHGWNEMVYDQKNWIGLNTGSFLLRNGQWALDILDAWAPMGPKGKIREEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             K RP FEADDQSA++YLL +++++W DKV+LE++YYLHGYW  LVDRYEE++E YHPG G
Sbjct  310   KDRPVFEADDQSAMVYLLATQREKWGDKVYLESAYYLHGYWGILVDRYEEMIENYHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVKR  429

Query  1349  IRNETTLPLPNVDRYDFRH-AKHES*DYTIFNSLESVGNE  1465
             +RNET  PL   D     H A   +  +++ + L+  G +
Sbjct  430   VRNETGHPLEVKDELGLLHPAFKAAKSFSVLDYLDPGGGK  469



>ref|XP_004296837.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=452

 Score =   517 bits (1331),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 246/436 (56%), Positives = 311/436 (71%), Gaps = 25/436 (6%)
 Frame = +2

Query  167   VPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE---VENSFLID----ET  325
             V R RQI R   +  +T LC F+T++VLRGTIG G   + + +   +   F       E 
Sbjct  8     VRRVRQIQRAARHGTVTFLCLFMTVVVLRGTIGAGKFGTPEQDFNDIRERFYSHNRRVEP  67

Query  326   NRILDEIRSDKDPD--------------DPEGQSGDRFLS-PNETFSLGPKITGWDEQRK  460
             +R+L+E+ +    D              D EG  GD +   PN  +SLGPKI+ WD QR 
Sbjct  68    HRVLEEVETTTSADANNYATFDFSKILKDEEG--GDEWKKDPNAPYSLGPKISDWDAQRG  125

Query  461   VWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVY  637
              W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI Y
Sbjct  126   EWLKQNPNFPNFLGPTKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEIFY  185

Query  638   NSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVI  817
             N A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y +HN V+
Sbjct  186   NMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKNHNFVM  245

Query  818   HGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGR  997
             HG+ ++++D  +W  L+TGSFL+RNCQW+LDLLD WAPMGPKG IR+E+GK LT  LKGR
Sbjct  246   HGWNEMVYDDHNWIGLNTGSFLLRNCQWSLDLLDAWAPMGPKGKIRDEAGKVLTKFLKGR  305

Query  998   PEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDER  1177
             P FEADDQSA++Y+L + ++ W +KV+LEN YYLHGYW  LVDRYEE++E YHPG GD R
Sbjct  306   PVFEADDQSAMVYILATGRETWGEKVYLENHYYLHGYWGILVDRYEEMIENYHPGLGDHR  365

Query  1178  WPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRN  1357
             WP VTHFVGCK CG  GD+PVE+C+K M+RA+NF DNQVL +YGF H+ L S  +KR+RN
Sbjct  366   WPLVTHFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQVLQMYGFTHKSLASRRVKRVRN  425

Query  1358  ETTLPLPNVDRYDFRH  1405
             E++ PL   D     H
Sbjct  426   ESSTPLQVKDELGLLH  441



>ref|XP_006389383.1| glycosyltransferase 2 family protein [Populus trichocarpa]
 gb|ERP48297.1| glycosyltransferase 2 family protein [Populus trichocarpa]
Length=459

 Score =   517 bits (1331),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 245/439 (56%), Positives = 307/439 (70%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R RQI R   + KIT+LC F+T++VLRGTIG G   + + +  +       S    E +R
Sbjct  10    RVRQIQRATRHGKITLLCLFMTVVVLRGTIGAGKSGTPEQDFNDLRNHIYASRKHAEPHR  69

Query  332   ILDEIRSDKDPDDPEG--------------------QSGDRFLSPNETFSLGPKITGWDE  451
             +L E     +  + EG                    +  D    PN+ + LGPKI+ WDE
Sbjct  70    VLTESNQSNNNKNDEGSNANDANNYAAFDINKILVDEGEDEKPDPNKPYFLGPKISDWDE  129

Query  452   QRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W   +P F + +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   QRAKWLSENPNFSNFIGANKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L++SHPEIE++WWMDSDA FTDMAFE+P  +Y   N
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRKLLISHPEIEFLWWMDSDAMFTDMAFEVPWERYKDSN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
              V+HG+ ++++DQK+W  L+TGSFL+RNCQW+LDLLD W+PMGPKG IR+E+GK LT  L
Sbjct  250   FVMHGWNEMVYDQKNWIGLNTGSFLLRNCQWSLDLLDAWSPMGPKGKIRDEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             K RP FEADDQSA++YLL +++D+W DKV+LEN+YYLHGYW  LVDRYEE++E YHPG G
Sbjct  310   KNRPVFEADDQSAMVYLLATQRDKWGDKVYLENAYYLHGYWGILVDRYEEMIENYHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+ VE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYSVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVKR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             +RNET  PL   D     H
Sbjct  430   VRNETGNPLEAKDELGLLH  448



>ref|XP_011006778.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Populus euphratica]
Length=459

 Score =   516 bits (1330),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 245/439 (56%), Positives = 307/439 (70%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R RQI R   + KIT+LC F+T++VLRGTIG G   + + +  +       S    E +R
Sbjct  10    RVRQIQRATRHGKITLLCLFMTVVVLRGTIGAGKFGTPEQDFNDLRNHIYASRKHAEPHR  69

Query  332   ILDEIRSDKDPDDPEG--------------------QSGDRFLSPNETFSLGPKITGWDE  451
             +L E     +  + E                     +  D    PN+ + LGPKI+ WDE
Sbjct  70    VLTESNQSNNNKNDEASNANDANNYAAFDINKILVDEGEDEKPDPNKPYILGPKISDWDE  129

Query  452   QRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W   +P F + +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   QRAKWLSENPNFSNFIGANKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L++SHPEIE++WWMDSDA FTDMAFE+P  +Y   N
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRKLLISHPEIEFLWWMDSDAMFTDMAFEVPWERYKDSN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
             LV+HG+ ++++DQK+W  L+TGSFL+RNCQW+LDLLD W+PMGPKG IR+E+GK LT  L
Sbjct  250   LVMHGWNEMVYDQKNWIGLNTGSFLLRNCQWSLDLLDAWSPMGPKGKIRDEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             K RP FEADDQSA++YLL +++D+W DKV+LEN+YYLHGYW  LVDRYEE++E YHPG G
Sbjct  310   KNRPVFEADDQSAMVYLLATQRDKWGDKVYLENAYYLHGYWGILVDRYEEMIENYHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+ VE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYSVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVKR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             +RNET  PL   D     H
Sbjct  430   VRNETGNPLEAKDELGLLH  448



>ref|XP_009416128.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009416136.1| PREDICTED: putative glycosyltransferase 2 [Musa acuminata subsp. 
malaccensis]
Length=432

 Score =   515 bits (1326),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 241/409 (59%), Positives = 299/409 (73%), Gaps = 4/409 (1%)
 Frame = +2

Query  182   QISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSDKD  361
              + R   + K+T+LC  +T+LVLRGT+G G   + + ++    L      +   I S   
Sbjct  14    HLRRALRSAKLTLLCLALTVLVLRGTVGAGRFGTPEQDLNQIRLRLRRPLVETTISSSNS  73

Query  362   PDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSV-KGKPRVLLVTGSP  538
              DD E    D    P++ +SLGPKI+ WDEQR  W  RHP  PS +   KPRVLLVTGS 
Sbjct  74    LDDSEE---DPPRDPSQPYSLGPKISDWDEQRADWLRRHPERPSFLGPNKPRVLLVTGSS  130

Query  539   PTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHP  718
             P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A +D EM G WAKLPLIR L+L+HP
Sbjct  131   PKPCENPVGDHYLLKSIKNKIDYCRVHGIEIFYNMALLDAEMAGFWAKLPLIRSLLLAHP  190

Query  719   EIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQ  898
             E+E++WWMDSDA FTDMAFE+P  +Y  +NLV+HG+ ++++D  +W  L+TGSFL+RNCQ
Sbjct  191   EVEFLWWMDSDAMFTDMAFELPWERYAPYNLVMHGWNEMVYDDHNWIGLNTGSFLLRNCQ  250

Query  899   WALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVF  1078
             W+LDLLD WAPMGPKG  R E+GK LTA LK RP FEADDQSA++YLL + +DQW DKV+
Sbjct  251   WSLDLLDAWAPMGPKGKTRTEAGKVLTAFLKDRPVFEADDQSAMVYLLATRRDQWGDKVY  310

Query  1079  LENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKS  1258
             LE++YYLHGYW  LVDRYEE++E +HPG GD RWP VTHFVGCK CG  GD+PVE+C+K 
Sbjct  311   LESAYYLHGYWGILVDRYEEMIENHHPGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQ  370

Query  1259  MERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             M+RAFNF DNQ+L +YGF H+ L S  +KRIRNET+ PL   D     H
Sbjct  371   MDRAFNFGDNQILQIYGFTHKSLASRRVKRIRNETSNPLDVKDELGLLH  419



>gb|KDO71643.1| hypothetical protein CISIN_1g047753mg [Citrus sinensis]
Length=441

 Score =   515 bits (1326),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 245/425 (58%), Positives = 316/425 (74%), Gaps = 19/425 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN---SFLID----ETNR  331
             R RQI R   + KIT+LC F+T++VLRGTIG G   + + ++++    F       E +R
Sbjct  10    RARQIQRVIRHGKITLLCLFMTVIVLRGTIGAGKFGTPEQDIDDIRQHFYAHRKRVEPHR  69

Query  332   ILDEIRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRK------VWFDRHPRFPS  493
             +L+E+++       +  + ++F   N+ F       G DE+R           R+P  P+
Sbjct  70    VLEEVQTTDAAKTEDPNNYEKF-DMNKLFV----DEGEDEKRDPNKHDPSGSKRNPTLPN  124

Query  494   SVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDG  670
              ++  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHGIEI YN A +D EM G
Sbjct  125   FLRPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRIHGIEIFYNMALLDAEMAG  184

Query  671   NWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQK  850
              WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HNLV+HG++++++D+K
Sbjct  185   FWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHNLVMHGWKEMVYDEK  244

Query  851   SWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSAL  1030
             +W  L+TGSFL+RNCQWALDLLD WAPMGPKG IR+++GK LT  LKGRP FEADDQSA+
Sbjct  245   NWIGLNTGSFLLRNCQWALDLLDAWAPMGPKGKIRDDAGKILTRELKGRPVFEADDQSAM  304

Query  1031  IYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCK  1210
             +YLL++++D+W +KV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFVGCK
Sbjct  305   VYLLITQRDKWGEKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFVGCK  364

Query  1211  ACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDR  1390
              CG  GD+PVE+C+K M+RAFNF DNQVLN+YGF+HR L S  +KRIRNET+ PL   D 
Sbjct  365   PCGKFGDYPVERCLKQMDRAFNFGDNQVLNMYGFEHRTLASKKVKRIRNETSTPLEVKDE  424

Query  1391  YDFRH  1405
                RH
Sbjct  425   LGIRH  429



>ref|XP_007138911.1| hypothetical protein PHAVU_009G248100g [Phaseolus vulgaris]
 gb|ESW10905.1| hypothetical protein PHAVU_009G248100g [Phaseolus vulgaris]
Length=452

 Score =   515 bits (1327),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 239/432 (55%), Positives = 308/432 (71%), Gaps = 21/432 (5%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLIDETNRILDE  343
             R RQI R   +  +T LC F+T++VLRGTIG G   + +    E+          R+L+E
Sbjct  10    RVRQIQRACRHSTVTFLCLFLTVVVLRGTIGAGKFGTPEQDFDEIRYHISAARARRVLEE  69

Query  344   IR------SDKDPDD-----------PEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFD  472
              +      +D +P++            E  S D    PN  ++LGPKI+ WDEQR+ W  
Sbjct  70    TKPDAGSNADSNPNNYATFDLSKILVDEPPSEDEKRDPNAPYTLGPKISDWDEQRRAWLR  129

Query  473   RHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSAN  649
              +P +P+ ++  KPRVLLVTGS P PCENPVGDHYL+K +KNKIDYCR+HGIEI YN A 
Sbjct  130   ANPEYPNFIRPNKPRVLLVTGSSPKPCENPVGDHYLVKSIKNKIDYCRVHGIEIFYNMAL  189

Query  650   MDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQ  829
             +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N V+HG+ 
Sbjct  190   LDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDSNFVMHGWN  249

Query  830   DLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFE  1009
             ++++D+K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR+E+GK LT  LK RP FE
Sbjct  250   EMVYDEKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIRDEAGKVLTRELKNRPVFE  309

Query  1010  ADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFV  1189
             ADDQSA++YLL + ++ W DKV+LEN YYLHGYW  LVDRYEE++E YHPG GD RWP V
Sbjct  310   ADDQSAMVYLLATGRETWGDKVYLENHYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLV  369

Query  1190  THFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTL  1369
             THFVGCK CG  GD+PVE+C+K M+RA+NF DNQ+L +YGF H+ L S  +K++RN+T  
Sbjct  370   THFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQILQMYGFTHKTLASRRVKKVRNDTGN  429

Query  1370  PLPNVDRYDFRH  1405
             PL   D     H
Sbjct  430   PLEIKDDLGLLH  441



>ref|XP_003533377.1| PREDICTED: putative glycosyltransferase 2-like isoform 3 [Glycine 
max]
Length=450

 Score =   514 bits (1325),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 240/432 (56%), Positives = 308/432 (71%), Gaps = 23/432 (5%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLIDETNRILDE  343
             R RQI R   +  +T LC F+T++VLRGTIG G   + +    E+ +        R+L+E
Sbjct  10    RVRQIHRACRHSTVTFLCLFLTLVVLRGTIGAGKFGTPEQDFNEIRHHLSAARARRVLEE  69

Query  344   IR-----------------SDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFD  472
             ++                 S    D+P   + D   +PN  ++LGPKI+ WDEQR  W  
Sbjct  70    VKPESLSSSESNNYATFDLSKILVDEP--PTDDEKPNPNAPYTLGPKISNWDEQRSSWLS  127

Query  473   RHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSAN  649
              +P +P+ +   KPRVLLVTGS P PCENPVGDHYL+K +KNKIDYCR+HGIEI YN A 
Sbjct  128   NNPDYPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLVKSIKNKIDYCRVHGIEIFYNMAL  187

Query  650   MDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQ  829
             +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N V+HG+ 
Sbjct  188   LDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDSNFVMHGWN  247

Query  830   DLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFE  1009
             ++++D+K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR+E+GK LT  LK RP FE
Sbjct  248   EMVYDEKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIRDEAGKVLTRELKNRPVFE  307

Query  1010  ADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFV  1189
             ADDQSA++YLL + K++W DKV+LEN YYLHGYW  LVDRYEE++E YHPG GD RWP V
Sbjct  308   ADDQSAMVYLLATGKEKWGDKVYLENHYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLV  367

Query  1190  THFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTL  1369
             THFVGCK CG  GD+PVE+C+K M+RA+NF DNQ+L +YGF H+ L S  +KR+RN+T+ 
Sbjct  368   THFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQILQMYGFTHKSLGSRKVKRVRNDTSN  427

Query  1370  PLPNVDRYDFRH  1405
             PL   D     H
Sbjct  428   PLEVKDELGLLH  439



>ref|XP_007163097.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
 ref|XP_007163098.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
 gb|ESW35091.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
 gb|ESW35092.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
Length=448

 Score =   514 bits (1324),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 241/427 (56%), Positives = 312/427 (73%), Gaps = 27/427 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE---VENSFL---IDETNRI  334
             R R+  R   + K+TILC  +TI+VLRGTIG G   +   +   + + F    + + +R 
Sbjct  10    RVRRFQRALRHCKVTILCLVLTIVVLRGTIGAGKFGTPKQDFLDIRDRFYSRKLPDNHRH  69

Query  335   LDEIRSDKDP-------------------DDPEGQSGDRFLSPNETFSLGPKITGWDEQR  457
             L E++S                       D+P+ ++G++ L+P+E + LGPKI+ WDE+R
Sbjct  70    LGELQSTTSEDSTSTTTNYNAFDINTILVDEPDDENGEK-LNPHEPYRLGPKISNWDEER  128

Query  458   KVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIV  634
               W  ++P   + V+  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE+ 
Sbjct  129   SRWLRKNPNLSNFVRPNKPRVLLVTGSSPKPCENPVGDHYLLKAIKNKIDYCRLHGIEVF  188

Query  635   YNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLV  814
             YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HNLV
Sbjct  189   YNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHNLV  248

Query  815   IHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKG  994
             +HG+ ++++D K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+E+GK LT  LK 
Sbjct  249   MHGWDEMVYDDKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGRVRDEAGKVLTRELKD  308

Query  995   RPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDE  1174
             RP FEADDQSA++YLL  E+D+W DKV+LEN YYLHGYW  LVD+YEE++E YHPG GD 
Sbjct  309   RPVFEADDQSAMVYLLARERDKWGDKVYLENGYYLHGYWGILVDKYEEMIENYHPGLGDH  368

Query  1175  RWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIR  1354
             RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H  L S  +KRIR
Sbjct  369   RWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHTSLASKGVKRIR  428

Query  1355  NETTLPL  1375
             +ET+ PL
Sbjct  429   DETSNPL  435



>ref|NP_001268156.1| alpha-1,6-xylosyltransferase [Vitis vinifera]
 emb|CAI11449.1| alpha-1,6-xylosyltransferase [Vitis vinifera]
Length=450

 Score =   514 bits (1323),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 242/430 (56%), Positives = 305/430 (71%), Gaps = 19/430 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID---ETNRI  334
             R RQ+ R F + KIT++C  +T++VLRGTIG G   +      E+   F      E +R+
Sbjct  10    RVRQMQRAFRHGKITLMCLLMTVVVLRGTIGAGKFGTPGQDFNEIREHFHNRKRVEPHRV  69

Query  335   LDEIRSDKDPDDPEG------------QSGDRFLSPNETFSLGPKITGWDEQRKVWFDRH  478
             L+E     +  +               +  D    PN  +SLGPKI+ WDEQR  W  ++
Sbjct  70    LEEAEVSTESSESNNYATFDISKLTVDEGEDEKPDPNRPYSLGPKISDWDEQRAEWLRKN  129

Query  479   PRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMD  655
             P FP+ +   KPRVLLVTGS P PCENP GDHYLLK +KNKIDYCR+HG+EI YN A +D
Sbjct  130   PNFPNFIGPNKPRVLLVTGSSPKPCENPGGDHYLLKAIKNKIDYCRLHGVEIFYNMALLD  189

Query  656   REMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDL  835
              EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y  HN V+HG+ ++
Sbjct  190   AEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFEVPWERYKDHNFVMHGWNEM  249

Query  836   LFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEAD  1015
             ++DQK+W  L+TGSFL+RNCQWALD+LD WAPMGPKG IR E+GK LT  LK RP FEAD
Sbjct  250   VYDQKNWIGLNTGSFLLRNCQWALDILDAWAPMGPKGKIRTEAGKILTRELKDRPVFEAD  309

Query  1016  DQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTH  1195
             DQSA++YLL +++D W DKV+LE++YYLHGYW  LVDRYEE++E +HPG GD RWP VTH
Sbjct  310   DQSAMVYLLATQRDNWGDKVYLESAYYLHGYWGILVDRYEEMIENHHPGLGDHRWPLVTH  369

Query  1196  FVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             FVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR RN+ + PL
Sbjct  370   FVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVKRTRNDPSNPL  429

Query  1376  PNVDRYDFRH  1405
                D     H
Sbjct  430   EVKDDLGLLH  439



>ref|XP_002315554.2| glycosyltransferase 2 family protein [Populus trichocarpa]
 gb|EEF01725.2| glycosyltransferase 2 family protein [Populus trichocarpa]
Length=460

 Score =   514 bits (1324),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 242/439 (55%), Positives = 313/439 (71%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI----DETNR  331
             R RQI R   + KIT+LC  +T++VLRGTIG G   + +    +++N F       E +R
Sbjct  10    RVRQIQRAIRHGKITLLCLCMTVVVLRGTIGAGKFGTPEQDFNDLKNHFYAARKHGEPHR  69

Query  332   ILDEI---RSDKDPDDPEGQSGDRFLS-----------------PNETFSLGPKITGWDE  451
             +L E     ++K+ +      G+ + +                 PN  +SLGPKI+ W++
Sbjct  70    VLTESNQPNNNKNDEASNADGGNNYATFDINKILVDEGEDEKPDPNRPYSLGPKISDWNQ  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
              R+ W   +P F + +K  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   LREKWLSENPSFSNFIKPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDSN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
              V+HG+ ++++D+K+W  L+TGSFL+RNCQW+LDLLD W+PMGPKG IR+E+GK LT  L
Sbjct  250   FVMHGWNEMVYDEKNWIGLNTGSFLLRNCQWSLDLLDAWSPMGPKGKIRDEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             K RP FEADDQSA++YLL +++D+W DKV+LEN+YYLHGYW  LVDRYEE++E YHPG G
Sbjct  310   KNRPVFEADDQSAMVYLLATQRDKWGDKVYLENAYYLHGYWGILVDRYEEMIENYHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+ VE+C+K M+RAFNF DNQ+L +YGF H+ L S  ++R
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYSVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVRR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             +RNETT PL   D     H
Sbjct  430   VRNETTNPLEVKDELGLLH  448



>ref|XP_003628458.1| Alpha-1 6-xylosyltransferase [Medicago truncatula]
Length=763

 Score =   525 bits (1352),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 262/485 (54%), Positives = 330/485 (68%), Gaps = 43/485 (9%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSF---LIDETNRI  334
             R R+  R  N+ K+TILC F+TI+VLRGTIG G   + +    ++ N F    + E +RI
Sbjct  10    RARKFQRFLNHCKVTILCLFLTIVVLRGTIGAGKFGTPEQDFVDIRNRFSSRKLSEPHRI  69

Query  335   LDEIR-------------------SDKDPDD--------PEGQSGDRFLSPNETFSLGPK  433
             L EI                    +D D +          E        S NE +SLGPK
Sbjct  70    LGEIHSTTSSSSRSDSSTTSTTNYNDFDINTILVDEEEEEEQGDEFEKRSSNEPYSLGPK  129

Query  434   ITGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYC  610
             I+ WDEQR  W   +P F + ++ GKPRVLLVTGS P PCENPVGDHYLLK +KNKIDYC
Sbjct  130   ISNWDEQRSKWIRENPNFSNFIRPGKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYC  189

Query  611   RIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLS  790
             R+HGIE+ YN A  D EM G WAKLPLIR+L+L+HPE+E++WWMDSDA FTDMAFE+P  
Sbjct  190   RLHGIEVFYNMALFDAEMAGFWAKLPLIRKLLLAHPEVEFLWWMDSDAMFTDMAFEVPWE  249

Query  791   KYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGK  970
             +Y   NLV+HG+ ++++D+K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+E+GK
Sbjct  250   RYKDSNLVMHGWNEMVYDEKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDEAGK  309

Query  971   TLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEK  1150
              LT  LKGRP FEADDQSA++YLL  EK++W DKV+LEN YYLHGYW  LVDRYEE++E 
Sbjct  310   ILTRELKGRPVFEADDQSAMVYLLAKEKEKWGDKVYLENGYYLHGYWGILVDRYEEMIEN  369

Query  1151  YHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLL  1330
             YHPGFGD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L+
Sbjct  370   YHPGFGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLV  429

Query  1331  SPNIKRIRNETTLPLPNVDRYDFRHAKHES*DYTIFNSLESVGNEK-NPFLYIYLVDRVL  1507
             S  ++RIRNET+ PL   D     H          F ++ES+   K +  L +  V    
Sbjct  430   SRRVRRIRNETSNPLEVKDELGLLHPT--------FKAVESICTPKEDGGLGVRRVSAFN  481

Query  1508  LQLLG  1522
             L LLG
Sbjct  482   LSLLG  486



>emb|CDO98874.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   513 bits (1322),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 313/440 (71%), Gaps = 29/440 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-----SFLI--DETNR  331
             R RQ+ R   N K+T+LC F+T++VLR  +G G   + + ++ +     S++    E  R
Sbjct  10    RARQMQRLLRNGKLTLLCLFLTVIVLRANLGAGKFGTPEQDLNDIRETFSYIRRRAEPRR  69

Query  332   ILDEIR-----SDKDPDDPEGQS-------------GDRFL---SPNETFSLGPKITGWD  448
             +L+E R     +D    D    +             GD  +    PN+ +SLGPKI+ WD
Sbjct  70    VLEEARQTFTATDNGASDTNSYADFDIKRIIADEDDGDEVVYKRDPNQPYSLGPKISNWD  129

Query  449   EQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGI  625
             +QR  W  ++P F + V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGI
Sbjct  130   QQRAEWLKKNPNFRNFVAPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGI  189

Query  626   EIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSH  805
             EI YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  H
Sbjct  190   EIFYNFALLDAEMSGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERYKDH  249

Query  806   NLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTAN  985
             N V+HG+ ++++DQ++W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR+E+G+ LT  
Sbjct  250   NFVMHGWNEMVYDQRNWIGLNTGSFLLRNCQWSLDILDTWAPMGPKGKIRDEAGELLTRE  309

Query  986   LKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGF  1165
             LK RP FEADDQSA++Y+L +++++W +KV+LE++YYLHGYW  LVDRYEE++E YHPG 
Sbjct  310   LKDRPVFEADDQSAMVYILTTQREKWAEKVYLESAYYLHGYWGILVDRYEEMIENYHPGL  369

Query  1166  GDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIK  1345
             GD RWP VTHFVGCK CG  GD+ VE+C+K M+RA NFADNQ+L +YGF H+ L S  +K
Sbjct  370   GDHRWPLVTHFVGCKPCGKFGDYSVERCLKQMDRAHNFADNQILQMYGFTHKSLASRKVK  429

Query  1346  RIRNETTLPLPNVDRYDFRH  1405
             R RNET+ PL   D     H
Sbjct  430   RTRNETSNPLEAQDELGLLH  449



>ref|XP_011071657.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like, partial [Sesamum 
indicum]
Length=454

 Score =   513 bits (1320),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 239/443 (54%), Positives = 312/443 (70%), Gaps = 32/443 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-----SFLID--ETNR  331
             R RQ  R   N K+T+LC F+T+++LRG +G G   + + +++      S++    E  R
Sbjct  4     RPRQFQRLLRNGKLTLLCLFLTVIMLRGNLGAGKFGTPEKDLDELRETFSYIRKRVEPRR  63

Query  332   ILDEI----RSDKDPDDPEGQSGDRFLS--------------------PNETFSLGPKIT  439
             +L+E     +  +   D  G   + +                      P++ +SLGP I+
Sbjct  64    VLEEATVVAQGQQKATDSTGSGTNNYAEFDITKILKDEDDGVPEFKRDPSQPYSLGPNIS  123

Query  440   GWDEQRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRI  616
              WDEQR  W  ++P FP+ + + KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+
Sbjct  124   DWDEQRAEWLKKNPDFPNFIAENKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRL  183

Query  617   HGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKY  796
             HGIEI YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y
Sbjct  184   HGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERY  243

Query  797   DSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTL  976
               HN V+HG+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD W+PMGPKG IREE+GK L
Sbjct  244   KDHNFVMHGWNEMIYDQKNWIGLNTGSFLLRNCQWSLDILDTWSPMGPKGKIREEAGKLL  303

Query  977   TANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYH  1156
             T  LK RP FEADDQSA++Y+L +++++W +KV+LEN+YYLHGYW  LVDRYEE++E YH
Sbjct  304   TRELKDRPVFEADDQSAMVYILATQREKWGNKVYLENAYYLHGYWGILVDRYEEMIENYH  363

Query  1157  PGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSP  1336
             PG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S 
Sbjct  364   PGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLASR  423

Query  1337  NIKRIRNETTLPLPNVDRYDFRH  1405
              + RIRNET  PL   D     H
Sbjct  424   RVIRIRNETNNPLEVRDDLGLLH  446



>ref|XP_007035584.1| CAMTA domain class transcription factor [Theobroma cacao]
 gb|EOY06510.1| CAMTA domain class transcription factor [Theobroma cacao]
Length=441

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 240/417 (58%), Positives = 303/417 (73%), Gaps = 19/417 (5%)
 Frame = +2

Query  209   KITILCGFVTILVLRGTIGVGNLASSDAEVEN-----SFLIDETNRILDEIRSDKDPD--  367
             KIT+LC  +T +VL GT       SS+   +N     S    E+ R+L+E ++D +    
Sbjct  14    KITVLCLLLTFIVLHGTFTPAKSGSSEESSDNHTSYASRKRAESRRLLEEAQNDNNDKNY  73

Query  368   ----------DPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVK-GKPR  514
                       D EG   ++   PN+ +SLGPKI+ WD+QR  W   +P F + +   KPR
Sbjct  74    AEFDISKILVDEEGGDEEK-PHPNKPYSLGPKISDWDQQRSEWLKNNPEFSNFIGPNKPR  132

Query  515   VLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLI  694
             VLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HG+EI YN A +D EM G WAKLPLI
Sbjct  133   VLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGVEIFYNMALLDAEMAGFWAKLPLI  192

Query  695   RRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTG  874
             R+L+LSHPEIE++WWMDSDA FTDMA+E+P  +Y   NLV+HG+ ++++D+K+W  L+TG
Sbjct  193   RKLLLSHPEIEFLWWMDSDAMFTDMAYEVPWERYKDSNLVMHGWNEMVYDEKNWIGLNTG  252

Query  875   SFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEK  1054
             SFL+RNCQW+LDLLD WAPMGPKG IREE+GK LT  LKGRP FEADDQSA++YLL+ E+
Sbjct  253   SFLLRNCQWSLDLLDAWAPMGPKGKIREEAGKVLTRELKGRPVFEADDQSAMVYLLVKER  312

Query  1055  DQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDF  1234
              +W +KV+LEN+YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFVGCK CG  GD+
Sbjct  313   AKWGEKVYLENAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFVGCKPCGKFGDY  372

Query  1235  PVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             PVE+C++ M+RAFNF DNQ+L +YGF H+ L S  +KR+RNET  PL   D     H
Sbjct  373   PVERCLRQMDRAFNFGDNQILQMYGFMHKSLASRRVKRVRNETANPLETKDALGLLH  429



>ref|XP_010037455.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Eucalyptus 
grandis]
 gb|KCW84484.1| hypothetical protein EUGRSUZ_B01313 [Eucalyptus grandis]
Length=461

 Score =   513 bits (1320),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 242/443 (55%), Positives = 312/443 (70%), Gaps = 34/443 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE---VENSFLI---DETNRI  334
             RG QI R   + K+T LC  +T++VLRGTIG G   + + +   + + F+     E +R+
Sbjct  10    RGYQIRRAMRHGKVTALCLVMTVVVLRGTIGAGKFGTPEQDFNDLRDHFISRKRGEPHRV  69

Query  335   LDEIRSDKDPDDP-------------------------EGQSGDRFLSPNETFSLGPKIT  439
             L+E+  D                               EG+   R   P++ ++LGP+I+
Sbjct  70    LEEVAVDPGRSSGQSESSSDSSSTKSYETFDISTILVDEGEEEKR--DPSKPYALGPRIS  127

Query  440   GWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRI  616
              WDEQR  W   +P +P+ ++  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+
Sbjct  128   DWDEQRAEWLKNNPDYPNFIRPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRL  187

Query  617   HGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKY  796
             HG+EI YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y
Sbjct  188   HGVEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERY  247

Query  797   DSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTL  976
                N V+HG+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IREE+GK L
Sbjct  248   KDSNFVLHGWNEMVYDQKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKIREEAGKIL  307

Query  977   TANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYH  1156
             T  LK RP FEADDQSA++YLL +++D+W +KV+LE++YYLHGYW  LVDRYEE++E YH
Sbjct  308   TRELKDRPVFEADDQSAMVYLLATQRDKWGEKVYLESAYYLHGYWGILVDRYEEMIENYH  367

Query  1157  PGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSP  1336
             PG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S 
Sbjct  368   PGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLASR  427

Query  1337  NIKRIRNETTLPLPNVDRYDFRH  1405
              +KRIRNET  PL   D     H
Sbjct  428   RVKRIRNETGNPLEVKDELGLLH  450



>ref|NP_191831.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 ref|NP_001030917.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 sp|Q9LZJ3.1|XXT1_ARATH RecName: Full=Xyloglucan 6-xylosyltransferase 1; Short=AtXT1 
[Arabidopsis thaliana]
 gb|AAL11581.1|AF424587_1 AT3g62720/F26K9_150 [Arabidopsis thaliana]
 emb|CAB83122.1| alpha galactosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAN73295.1| At3g62720/F26K9_150 [Arabidopsis thaliana]
 dbj|BAH20193.1| AT3G62720 [Arabidopsis thaliana]
 gb|AEE80383.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AEE80384.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AHL38717.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=460

 Score =   512 bits (1319),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 309/438 (71%), Gaps = 27/438 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN---SFLID----ETNR  331
             R R++ R     K+TILC  +T++VLRGTIG G   + + ++E     F       E +R
Sbjct  10    RFRRLQRFMRQGKVTILCLVLTVIVLRGTIGAGKFGTPEKDIEEIREHFFYTRKRGEPHR  69

Query  332   ILDEIRSDKDPDDPEGQSGDRFLS-------------------PNETFSLGPKITGWDEQ  454
             +L E+ S     +  G  G+ + +                    N+ +SLGPKI+ WDEQ
Sbjct  70    VLVEVSSKTTSSEDGGNGGNSYETFDINKLFVDEGDEEKSRDRTNKPYSLGPKISDWDEQ  129

Query  455   RKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEI  631
             R+ W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHGIEI
Sbjct  130   RRDWLKQNPSFPNFVAPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRIHGIEI  189

Query  632   VYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNL  811
              YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDM FE+P  +Y  +NL
Sbjct  190   FYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPWERYKDYNL  249

Query  812   VIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLK  991
             V+HG+ ++++DQK+W  L+TGSFL+RN QW+LDLLD WAPMGPKG IREE+GK LT  LK
Sbjct  250   VMHGWNEMVYDQKNWIGLNTGSFLLRNSQWSLDLLDAWAPMGPKGKIREEAGKVLTRELK  309

Query  992   GRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGD  1171
              RP FEADDQSA++YLL +E+++W  KV+LE+ YYLHGYW  LVDRYEE++E + PGFGD
Sbjct  310   DRPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILVDRYEEMIENHKPGFGD  369

Query  1172  ERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRI  1351
              RWP VTHFVGCK CG  GD+PVE+C++ M+RAFNF DNQ+L +YGF H+ L S  +K  
Sbjct  370   HRWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILQMYGFTHKSLGSRRVKPT  429

Query  1352  RNETTLPLPNVDRYDFRH  1405
             RN+T  PL   D +   H
Sbjct  430   RNQTDRPLDAKDEFGLLH  447



>gb|ACE95677.1| putative xylosyl transferase [Coffea canephora]
Length=460

 Score =   512 bits (1318),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 312/440 (71%), Gaps = 29/440 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-----SFLI--DETNR  331
             R RQ+ R   N K+T+LC F+T++VLR  +G G   + + ++ +     S++    E  R
Sbjct  10    RARQMQRLLRNGKLTLLCLFLTVIVLRANLGAGKFGTPEQDLNDIRETFSYIRRRAEPRR  69

Query  332   ILDEIR-----SDKDPDDPEGQS-------------GDRFL---SPNETFSLGPKITGWD  448
             +L+E R     +D    D    +             GD  +    PN+ +SLGPKI+ WD
Sbjct  70    VLEEARQTFTATDNGASDTNSYADFDIKRIIADEDDGDEVVYKRDPNQPYSLGPKISNWD  129

Query  449   EQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGI  625
             +QR  W  ++P F + V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGI
Sbjct  130   QQRAEWLKKNPNFRNFVAPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGI  189

Query  626   EIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSH  805
             EI YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  H
Sbjct  190   EIFYNFALLDAEMSGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERYKDH  249

Query  806   NLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTAN  985
             N V+HG+ ++++DQ++W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR+E+G+ LT  
Sbjct  250   NFVMHGWNEMVYDQRNWIGLNTGSFLLRNCQWSLDILDTWAPMGPKGKIRDEAGELLTRE  309

Query  986   LKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGF  1165
             LK RP FEADDQSA++Y+L +++++W  KV+LE++YYLHGYW  LVDRYEE++E YHPG 
Sbjct  310   LKDRPVFEADDQSAMVYILTTQREKWAGKVYLESAYYLHGYWGILVDRYEEMIENYHPGL  369

Query  1166  GDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIK  1345
             GD RWP VTHFVGCK CG  GD+ VE+C+K M+RA NFADNQ+L +YGF H+ L S  +K
Sbjct  370   GDHRWPLVTHFVGCKPCGKFGDYSVERCLKQMDRAHNFADNQILQMYGFTHKSLASRKVK  429

Query  1346  RIRNETTLPLPNVDRYDFRH  1405
             R RNET+ PL   D     H
Sbjct  430   RTRNETSNPLEVQDELGLLH  449



>ref|XP_011000518.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Populus euphratica]
 ref|XP_011015482.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Populus euphratica]
Length=460

 Score =   511 bits (1317),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 242/439 (55%), Positives = 311/439 (71%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI----DETNR  331
             R RQI R   + KIT+LC  +T++VLRGTIG G   + +    +++N F       E +R
Sbjct  10    RVRQIQRAIRHGKITLLCLCMTVVVLRGTIGAGKFGTPEQDFNDLKNHFYAARKHGEPHR  69

Query  332   ILDEIRSDKDPDDPEGQSGD-----------RFL---------SPNETFSLGPKITGWDE  451
             +L E     +  + E  + D           + L          PN+ +SLGPKI+ W++
Sbjct  70    VLTESNQPNNNKNDEASNADGANNYATFDISKILVDEGEDEKPDPNKPYSLGPKISDWNQ  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
              R+ W   +P F + +K  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   LREKWLSENPSFSNFIKPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDSN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
              V+HG+ ++++D+K+W  L+TGSFL+RNCQW+LDLLD W+PMGPKG IR+E+GK LT  L
Sbjct  250   FVMHGWNEMVYDEKNWIGLNTGSFLLRNCQWSLDLLDAWSPMGPKGKIRDEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             K RP FEADDQSA++YLL +++D+W DKV+LEN+YYLHGYW  LVDRYEE++E Y PG G
Sbjct  310   KNRPVFEADDQSAMVYLLATQRDKWGDKVYLENAYYLHGYWGILVDRYEEMIENYRPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+ VE+C+K M+RAFNF DNQ+L +YGF H+ L S  ++R
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYSVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVRR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             +RNETT PL   D     H
Sbjct  430   VRNETTNPLEVKDELGLLH  448



>ref|XP_006291070.1| hypothetical protein CARUB_v10017185mg [Capsella rubella]
 gb|EOA23968.1| hypothetical protein CARUB_v10017185mg [Capsella rubella]
Length=465

 Score =   511 bits (1317),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 248/453 (55%), Positives = 315/453 (70%), Gaps = 35/453 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN---SFLID----ETNR  331
             R R++ R     K+TILC  +T++VLRGTIG G   + + ++E     F       E +R
Sbjct  10    RFRRLQRIMRQGKVTILCLVLTVIVLRGTIGAGKFGTPEKDIEEIREHFFYTRKRGEPHR  69

Query  332   ILDEIRS-------------------------DKDPDDPEGQSGDRFLSPNETFSLGPKI  436
             +L E+ S                         D++  D +  S DR    N+ +SLGPKI
Sbjct  70    VLVEVSSKTSSSKDGDGNGNSYETFDVNKLFVDEEEGDGDKTSQDR--RTNKPYSLGPKI  127

Query  437   TGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCR  613
             + WDEQR  W +++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR
Sbjct  128   SDWDEQRLDWLEQNPNFPNFVAPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCR  187

Query  614   IHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSK  793
             IHGIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDM FE+P  +
Sbjct  188   IHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPWER  247

Query  794   YDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKT  973
             Y  HNLV+HG+ ++++DQK+W  L+TGSFL+RN QW+LDLLD WAPMGPKG IREE+GK 
Sbjct  248   YKDHNLVMHGWNEMVYDQKNWIGLNTGSFLLRNSQWSLDLLDAWAPMGPKGKIREEAGKI  307

Query  974   LTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKY  1153
             LT  LK RP FEADDQSA++YLL +E+++W  KV+LE+ YYLHGYW  LVDRYEE++E +
Sbjct  308   LTRELKDRPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILVDRYEEMIENH  367

Query  1154  HPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLS  1333
              PGFGD RWP VTHFVGCK CG  GD+PVE+C++ M+RAFNF DNQ+L++YGF H+ L S
Sbjct  368   KPGFGDHRWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILDMYGFTHKSLGS  427

Query  1334  PNIKRIRNETTLPLPNVDRYDFRHAKHES*DYT  1432
               +K  RN+T  PL   D     H   ++  +T
Sbjct  428   RRVKPTRNQTDRPLDAKDELGLLHPPFKAAKFT  460



>ref|XP_010512668.1| PREDICTED: xyloglucan 6-xylosyltransferase 1-like [Camelina sativa]
Length=466

 Score =   511 bits (1317),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 244/440 (55%), Positives = 309/440 (70%), Gaps = 29/440 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R R++ R     K+TILC  +T++VLRGTIG G   + + ++E        S    E +R
Sbjct  11    RFRRLQRIMRQSKVTILCLVLTVIVLRGTIGAGKFGTPEQDIEEIREHFFYSRKHGEPHR  70

Query  332   ILDEIRSDKDP---------------------DDPEGQSGDRFLSPNETFSLGPKITGWD  448
             +L E+ S  +                      ++ + +S DR  +    +SLGPKI+ WD
Sbjct  71    VLVEVSSKSEDGDNGNNNNSYETFDINKLFVDEEDDKKSQDRTSNNKPYYSLGPKISDWD  130

Query  449   EQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGI  625
             EQR  W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHGI
Sbjct  131   EQRLDWLKQNPSFPNYVAPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRIHGI  190

Query  626   EIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSH  805
             EI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDM FE+P  +Y  +
Sbjct  191   EIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPWERYKDY  250

Query  806   NLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTAN  985
             NLV+HG+ ++++DQK+W  L+TGSFL+RN QW+LDLLD WAPMGPKG IREE+GK LT  
Sbjct  251   NLVMHGWNEMVYDQKNWIGLNTGSFLLRNSQWSLDLLDAWAPMGPKGKIREEAGKILTRE  310

Query  986   LKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGF  1165
             LK RP FEADDQSA++YLL +E+D+W  KV+LE+ YYLHGYW  LVDRYEE++E + PGF
Sbjct  311   LKDRPAFEADDQSAMVYLLATERDKWGGKVYLESGYYLHGYWGILVDRYEEMIENHKPGF  370

Query  1166  GDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIK  1345
             GD RWP VTHFVGCK CG  GD+PVE+C++ M+RAFNF DNQ+L +YGF H+ L S  +K
Sbjct  371   GDHRWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILQMYGFTHKSLGSRRVK  430

Query  1346  RIRNETTLPLPNVDRYDFRH  1405
               RN+T  PL   D +   H
Sbjct  431   PTRNQTDRPLETKDEFGLLH  450



>ref|XP_010523942.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Tarenaya hassleriana]
Length=455

 Score =   511 bits (1316),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 249/437 (57%), Positives = 312/437 (71%), Gaps = 25/437 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSFLI----DETNR  331
             R R+I R   + K+TILC  +T++VLRGTIG G   + +    E+   F       E +R
Sbjct  10    RCRRIHRALRHGKVTILCLVLTVVVLRGTIGAGKFGTPEQDLVEIREHFFHPRKRAEPHR  69

Query  332   ILDEIRSDKDPDDPEGQSGDRFLS-----------------PNETFSLGPKITGWDEQRK  460
             +L E+ +          +G+ + +                 PN+ +SLGPKI+ WDEQR 
Sbjct  70    VLVEVSTQTTSSSDGNGNGNNYETLDINKIFVDEGEEEKTDPNKPYSLGPKISNWDEQRS  129

Query  461   VWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVY  637
              W  R+P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+H IEI Y
Sbjct  130   EWLKRNPNFPNFVAPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHNIEIFY  189

Query  638   NSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVI  817
             N A  D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y  +NLV+
Sbjct  190   NMALFDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWERYKDYNLVM  249

Query  818   HGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGR  997
             HG+ ++++DQK+W  L+TGSFL+RNCQWALDLLD W+PMGPKG IREE+GK LT  LK R
Sbjct  250   HGWNEMIYDQKNWIGLNTGSFLLRNCQWALDLLDAWSPMGPKGKIREEAGKILTRELKDR  309

Query  998   PEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDER  1177
             P FEADDQSA++YLL +++D+W DKV+LE++YYLHGYW  LVDRYEE++E YHPG GD R
Sbjct  310   PVFEADDQSAMVYLLATQRDKWGDKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHR  369

Query  1178  WPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRN  1357
             WP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR+RN
Sbjct  370   WPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFAHKSLSSRRVKRVRN  429

Query  1358  ETTLPLPNVDRYDFRHA  1408
             ET  PL   D     H+
Sbjct  430   ETDRPLDVKDELGLLHS  446



>gb|KDP27794.1| hypothetical protein JCGZ_18874 [Jatropha curcas]
Length=463

 Score =   510 bits (1313),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 243/444 (55%), Positives = 309/444 (70%), Gaps = 35/444 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE---VENSFLID----ETNR  331
             R  +I R   + K+T+ C F+T++VLRGTIG G   + + +   + + F       E +R
Sbjct  10    RVLRIQRAIRHAKVTLFCLFMTVVVLRGTIGAGKFGTPEQDFNDLRDRFYASRKHAEPHR  69

Query  332   ILDEIRSDKDPDDP-------------------------EGQSGDRFLSPNETFSLGPKI  436
             +L E +   +                             EG+   R   PN+ +SLGPKI
Sbjct  70    VLVEAQVATESAQSSTNNNNNNNDPNNYATFDLNKILVDEGEEEKR--DPNKPYSLGPKI  127

Query  437   TGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCR  613
             + WDEQR  W   +P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR
Sbjct  128   SDWDEQRAEWLRNNPNFPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCR  187

Query  614   IHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSK  793
             +HGIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +
Sbjct  188   LHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFEVPWER  247

Query  794   YDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKT  973
             Y   N V+HG+ ++++DQK+W  L+TGSFL+RN QWALD+LD WAPMGPKG IR+E+GK 
Sbjct  248   YKDSNFVMHGWNEMVYDQKNWIGLNTGSFLLRNGQWALDILDAWAPMGPKGKIRDEAGKV  307

Query  974   LTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKY  1153
             LT  LK RP FEADDQSA++YLL +++D+W DKV+LE++YYLHGYW  LVDRYEE++E Y
Sbjct  308   LTRELKDRPVFEADDQSAMVYLLATQRDKWGDKVYLESAYYLHGYWGILVDRYEEMIENY  367

Query  1154  HPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLS  1333
             HPG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S
Sbjct  368   HPGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLAS  427

Query  1334  PNIKRIRNETTLPLPNVDRYDFRH  1405
               +KR+RNE++ PL   D     H
Sbjct  428   RKVKRVRNESSNPLEVKDELGLLH  451



>ref|XP_004290777.1| PREDICTED: putative glycosyltransferase 2-like [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   508 bits (1309),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 241/429 (56%), Positives = 318/429 (74%), Gaps = 18/429 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R   + K+TILC  +T++VLRGTIG G   + +    E+ + F      E +R+
Sbjct  11    RSRRIQRALRHSKVTILCLVLTVVVLRGTIGAGKFGTPEQDFLEIRDHFYSRKRAEPHRV  70

Query  335   LDEIRSD-KDPDDPEGQSGDRFLS----------PNETFSLGPKITGWDEQRKVWFDRHP  481
             L+E+++   DP++      ++ L           PN+ ++LGPKI+ WD+QR  W  ++P
Sbjct  71    LEEVQTTPSDPNNYNAFDINKILKDEEGEEEKPDPNKPYTLGPKISDWDQQRSKWLKQNP  130

Query  482   RFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDR  658
                + V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE+ YN A +D 
Sbjct  131   NMSNFVGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNMALLDA  190

Query  659   EMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLL  838
             EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N V+HG+++++
Sbjct  191   EMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERYKGSNFVMHGWKEMV  250

Query  839   FDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADD  1018
             +D+K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IR+E+GK LT+ LKGRP FEADD
Sbjct  251   YDEKNWIGLNTGSFLLRNCQWSLDMLDAWAPMGPKGRIRDEAGKVLTSALKGRPVFEADD  310

Query  1019  QSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHF  1198
             QSA++Y+L +++++W DKV+LEN+YYLHGYW  LVDRYEE++EK+ PG GD RWP VTHF
Sbjct  311   QSAMVYILATQREKWGDKVYLENAYYLHGYWGILVDRYEEMIEKHRPGLGDHRWPLVTHF  370

Query  1199  VGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLP  1378
             VGCK CG  GD+PVE+C+K M+RAFNF DNQVL +YGF H+ L S  +KR+RNET+ PL 
Sbjct  371   VGCKPCGKFGDYPVERCLKQMDRAFNFGDNQVLQIYGFTHKSLASKRVKRVRNETSKPLE  430

Query  1379  NVDRYDFRH  1405
               D     H
Sbjct  431   VKDELGLLH  439



>ref|XP_002876686.1| hypothetical protein ARALYDRAFT_907847 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52945.1| hypothetical protein ARALYDRAFT_907847 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score =   508 bits (1309),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 246/437 (56%), Positives = 310/437 (71%), Gaps = 26/437 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN---SFLID----ETNR  331
             R R++ R     K+TILC  +T++VLRGTIG G   + + ++E     F       E +R
Sbjct  10    RFRRLQRFMRQGKVTILCLVLTVIVLRGTIGAGKFGTPEKDIEEIREHFFYTRKRGEPHR  69

Query  332   ILDEIRS---DKDPDDPEGQS-------------GDRFLSPNET--FSLGPKITGWDEQR  457
             +L E+ S     +  D  G S             GD   S + T  +SLGPKI+ WDEQR
Sbjct  70    VLVEVSSKTTSSEDGDANGNSYETFDINKLFVDEGDEEKSQDRTKPYSLGPKISDWDEQR  129

Query  458   KVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIV  634
             + W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHG+EI 
Sbjct  130   RDWLKQNPNFPNFVAPKKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRIHGVEIF  189

Query  635   YNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLV  814
             YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDM FE+P  +Y  +NLV
Sbjct  190   YNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPWERYKDYNLV  249

Query  815   IHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKG  994
             +HG+ ++++DQK+W  L+TGSFL+RN QW+LDLLD WAPMGPKG IREE+GK LT  LK 
Sbjct  250   MHGWDEMVYDQKNWIGLNTGSFLLRNSQWSLDLLDAWAPMGPKGKIREEAGKVLTRELKD  309

Query  995   RPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDE  1174
             RP FEADDQSA++YLL +E+++W  KV+LE+ YYLHGYW  LVDRYEE++E + PGFGD 
Sbjct  310   RPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILVDRYEEMIENHKPGFGDH  369

Query  1175  RWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIR  1354
             RWP VTHFVGCK CG  GD+PVE+C++ M+RAFNF DNQ+L +YGF H+ L S  +K  R
Sbjct  370   RWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILQMYGFTHKSLGSRRVKPTR  429

Query  1355  NETTLPLPNVDRYDFRH  1405
             N+T  PL   D +   H
Sbjct  430   NQTDRPLDAKDEFGLLH  446



>ref|XP_011090963.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Sesamum indicum]
Length=459

 Score =   508 bits (1309),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 238/439 (54%), Positives = 312/439 (71%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI----DETNR  331
             R R+  R   N K+T+LC  +T++VLR  +G G   + +    E+  +F       E  R
Sbjct  10    RARRFQRLLRNGKLTLLCLVLTVIVLRANLGAGKFGTPEKDLDEIRETFSYIRRRAEPRR  69

Query  332   ILDEIRSDKDPDDPEGQSGDRFLS--------------------PNETFSLGPKITGWDE  451
             +L+E ++++          + +                      P++ +SLGPKI+ WD+
Sbjct  70    VLEEAKTEQKSGSSTESGSNSYAEFDITKILKDEDDGVEEFKRDPSQPYSLGPKISDWDQ  129

Query  452   QRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W  R+PRFP+ + + KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   QRAEWLQRNPRFPNFIAENKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRVHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  HN
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDHN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
              V+HG+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+E+GK LT  L
Sbjct  250   FVMHGWNEMVYDQKNWIGLNTGSFLLRNCQWSLDILDTWAPMGPKGKVRDEAGKLLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             KGRP FEADDQSA++Y+L +++++W DKV+LEN+YYLHGYW  LVDRYEE++E YHPG G
Sbjct  310   KGRPVFEADDQSAMVYILATQREKWGDKVYLENAYYLHGYWGILVDRYEEMIENYHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  ++R
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLASRRVRR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
              RNET+ PL   D     H
Sbjct  430   TRNETSNPLEVRDELGLLH  448



>ref|XP_004980166.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=497

 Score =   509 bits (1312),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 239/435 (55%), Positives = 309/435 (71%), Gaps = 33/435 (8%)
 Frame = +2

Query  170   PRG---RQISRTFNNIKITILCGFVTILVLRGTIGVGN----LASSDAEVENSFLIDETN  328
             PRG   +   R  NNI+ T+LC FVT LVLRGT+GV      +A SD     +   ++  
Sbjct  13    PRGSSSKLTQRAINNIRFTLLCAFVTFLVLRGTVGVNRRLVYIAGSDRAPPGAKATEDIE  72

Query  329   RILDEIRSDKDPDDPEGQSGDRFLSPNET-------------FSLGPKITGWDEQRKVWF  469
             RIL EIR+D DPD      G+   S   T             +SLGP++T W+ +R+ W 
Sbjct  73    RILREIRADSDPDPEPNDDGNTSPSTRATRYYDRGSAWSTANYSLGPRVTRWNARRRRWL  132

Query  470   DRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSA  646
               +P FPS   +G PRVLLVT SPP PC++P GDH+LL+  KNKIDYCR+HGIE+ + +A
Sbjct  133   HLNPGFPSRDARGNPRVLLVTASPPGPCDDPAGDHFLLRATKNKIDYCRLHGIELAHITA  192

Query  647   NMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGY  826
              +D E+ G WAKLPL+RRLML+HPE+EW+WW+D DA  TDM FE+PL++Y+  +LV+HG 
Sbjct  193   RLDGELTGGWAKLPLLRRLMLAHPEVEWLWWVDGDALVTDMGFELPLARYEGAHLVVHGN  252

Query  827   QDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEF  1006
               LLF  +SW A+STGSFLIRNCQW+L+LLD WA MG +G  R ++GK LTA L GRP F
Sbjct  253   SYLLFQLRSWVAVSTGSFLIRNCQWSLELLDAWAVMGSRGRARNDAGKLLTATLHGRPAF  312

Query  1007  EADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPF  1186
             EADDQSALI+LL++EK++WM+KV+LEN YYLHG+W+GLVDRYE+ MEK+HPG+GD+RWPF
Sbjct  313   EADDQSALIHLLITEKERWMEKVYLENEYYLHGHWSGLVDRYEQAMEKHHPGYGDDRWPF  372

Query  1187  VTHFVGCKACG------------SSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLL  1330
             VTHFVGCK CG            SS ++P+++CV+ MERAFNFADNQVL LYGF+H  L 
Sbjct  373   VTHFVGCKPCGGGVGRSIRSGGNSSDEYPLDRCVRGMERAFNFADNQVLRLYGFRHESLA  432

Query  1331  SPNIKRIRNETTLPL  1375
             S  ++R+ N +  PL
Sbjct  433   SAEVRRVTNRSANPL  447



>ref|XP_007201035.1| hypothetical protein PRUPE_ppa005690mg [Prunus persica]
 gb|EMJ02234.1| hypothetical protein PRUPE_ppa005690mg [Prunus persica]
Length=448

 Score =   506 bits (1303),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 242/433 (56%), Positives = 319/433 (74%), Gaps = 17/433 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R   + K+TILC  +T++VLRGTIG G   + +    E+ + F      E +R+
Sbjct  10    RTRRIHRALRHGKVTILCLVLTVVVLRGTIGAGKFGTPEQDFIEIRDHFYSRKRAEPHRV  69

Query  335   LDEIRSD-KDPDDPEGQSGDRFL---------SPNETFSLGPKITGWDEQRKVWFDRHPR  484
             L+E++S   DP++      ++ L          PN+ ++LGPKI+ WDEQR  W   +P 
Sbjct  70    LEEVQSTPADPNNYNAFDINKILVDEGEEDRPEPNKPYTLGPKISNWDEQRSKWLKENPN  129

Query  485   FPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDRE  661
             FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE+ YN A +D E
Sbjct  130   FPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNMALLDAE  189

Query  662   MDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLF  841
             M G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  ++ V+HG++++++
Sbjct  190   MAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDYDFVMHGWKEMVY  249

Query  842   DQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQ  1021
             DQK+W  L+TGSFL+RN QW+LD+LD WAPMGPKG IR+E+GK LT  LK RP FEADDQ
Sbjct  250   DQKNWIGLNTGSFLLRNTQWSLDMLDTWAPMGPKGKIRDEAGKILTRELKDRPVFEADDQ  309

Query  1022  SALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFV  1201
             SA++Y+L +++++W DKV+LEN+YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFV
Sbjct  310   SAMVYILATQREKWGDKVYLENAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFV  369

Query  1202  GCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPN  1381
             GCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H  L S  +KR+RNET+ PL  
Sbjct  370   GCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHSSLGSRRVKRVRNETSNPLEV  429

Query  1382  VDRYDFRHAKHES  1420
              D     H + ++
Sbjct  430   KDELGLLHPEFKA  442



>ref|XP_004494368.1| PREDICTED: putative glycosyltransferase 2-like [Cicer arietinum]
Length=467

 Score =   506 bits (1304),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 246/451 (55%), Positives = 309/451 (69%), Gaps = 35/451 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE---VENSFL---IDETNRI  334
             R R+  R   + KIT LC F+TILVLRGTIG G   + + +   + N F    + + +RI
Sbjct  10    RARKFQRFLGHCKITSLCLFLTILVLRGTIGAGKFGTPEQDFLNIRNRFYSRKLPQRHRI  69

Query  335   LDEIRSDKDP----------------------------DDPEGQSGDRFLSPNETFSLGP  430
             L E+ S                                D+ E +        +  + LGP
Sbjct  70    LGELHSTTTSSSSSSSSNSHSSTSTTNYNAFDINTILIDEKEQEEEFEKRDSHVPYRLGP  129

Query  431   KITGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDY  607
             KI+ WDEQR  W   +P F + ++  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDY
Sbjct  130   KISNWDEQRSKWLRENPNFSNFIRPEKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDY  189

Query  608   CRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPL  787
             CR+HGIE+ YN A  D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P 
Sbjct  190   CRLHGIEVFYNMALFDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPW  249

Query  788   SKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESG  967
              +Y   NLV+HG+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+E+G
Sbjct  250   ERYKDSNLVLHGWNEMVYDQKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDEAG  309

Query  968   KTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVME  1147
             K LT  LK RP FEADDQSA++YLL  EK++W  KV+LEN YYLHGYW  LVDRYEE++E
Sbjct  310   KILTKELKDRPVFEADDQSAMVYLLAKEKEKWGGKVYLENGYYLHGYWGILVDRYEEMIE  369

Query  1148  KYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGL  1327
              YHPGFGD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQVL +YGF H+ L
Sbjct  370   NYHPGFGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQVLQIYGFTHKSL  429

Query  1328  LSPNIKRIRNETTLPLPNVDRYDFRHAKHES  1420
              S  ++RIRNET+ PL   D     H+  ++
Sbjct  430   GSRRVRRIRNETSNPLDVKDELGLLHSAFKA  460



>ref|XP_010468926.1| PREDICTED: xyloglucan 6-xylosyltransferase 1 [Camelina sativa]
Length=466

 Score =   505 bits (1300),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 245/444 (55%), Positives = 309/444 (70%), Gaps = 35/444 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVE---NSFLID----ETNR  331
             R R++ R     K+TILC  +T++VLRGTIG G   + + ++E     F       E +R
Sbjct  11    RFRRLQRIMRQGKVTILCLVLTVIVLRGTIGAGKFGTPEQDIEEIREHFFYTRKRGEPHR  70

Query  332   ILDEIRSDKDP-------------------------DDPEGQSGDRFLSPNETFSLGPKI  436
             +L E+ S                             DD + +S DR  + N+ +SLGPKI
Sbjct  71    VLVEVSSKTTSSSSEDGNNGNKNNSYETFDINKLFVDDEDDKSQDR--TNNKPYSLGPKI  128

Query  437   TGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCR  613
             + WDEQR  W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR
Sbjct  129   SDWDEQRLDWLKQNPSFPNFVAPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCR  188

Query  614   IHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSK  793
             IHGIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDM FE+P  +
Sbjct  189   IHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPWER  248

Query  794   YDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKT  973
             Y  +NLV+HG+ ++++DQK+W  L+TGSFL+RN QW+LDLLD WAPMGPKG IREE+GK 
Sbjct  249   YKDYNLVMHGWSEMVYDQKNWIGLNTGSFLLRNSQWSLDLLDAWAPMGPKGKIREEAGKV  308

Query  974   LTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKY  1153
             LT  LK RP FEADDQSA++YLL +E+++W  KV+LE+ YYLHGYW  LVDRYEE++E +
Sbjct  309   LTRELKDRPAFEADDQSAMVYLLATERERWGGKVYLESGYYLHGYWGILVDRYEEMIENH  368

Query  1154  HPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLS  1333
              PGFGD RWP VTHFVGCK CG  GD+PVE+C++ M+RA NF DNQ+L +YGF H+ L S
Sbjct  369   KPGFGDHRWPLVTHFVGCKPCGKFGDYPVERCLRQMDRALNFGDNQILQMYGFTHKSLGS  428

Query  1334  PNIKRIRNETTLPLPNVDRYDFRH  1405
               +K  RN+T  PL   D +   H
Sbjct  429   RRVKPTRNQTDRPLEAKDEFGLLH  452



>ref|XP_010413252.1| PREDICTED: xyloglucan 6-xylosyltransferase 1-like [Camelina sativa]
Length=464

 Score =   504 bits (1299),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 242/442 (55%), Positives = 309/442 (70%), Gaps = 33/442 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN---SFLID----ETNR  331
             R R++ R     K+TILC  +T++VLRGTIG G   + + ++E     F       E +R
Sbjct  11    RFRRLQRIMRQGKVTILCLVLTVIVLRGTIGAGKFGTPEQDIEEIREHFFYTRKRGEPHR  70

Query  332   ILDEIRSDKDP-----------------------DDPEGQSGDRFLSPNETFSLGPKITG  442
             +L E+ S  +                        DD + +S +R  + N+ + LGPKI+ 
Sbjct  71    VLVEVSSKSEDGDGNNGNNNNNSYETFDINKLFVDDEDDKSQER--TNNKPYYLGPKISD  128

Query  443   WDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIH  619
             WDEQR+ W  ++P F + V   KPRVLLVTGS P PCENPVGDHY LK +KNKIDYCRIH
Sbjct  129   WDEQRRDWLKQNPSFRNYVAPNKPRVLLVTGSAPKPCENPVGDHYFLKSIKNKIDYCRIH  188

Query  620   GIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYD  799
             GIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDM FE+P  +Y 
Sbjct  189   GIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPWERYK  248

Query  800   SHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLT  979
              +NLV+HG+ ++++DQK+W  L+TGSFL+RN QW+LDLLD WAPMGPKG IREE+GK LT
Sbjct  249   DYNLVMHGWNEMVYDQKNWIGLNTGSFLLRNSQWSLDLLDAWAPMGPKGKIREEAGKILT  308

Query  980   ANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHP  1159
               LK RP FEADDQSA++YLL +E+++W  KV+LE+ YYLHGYW  LVDRYEE++E + P
Sbjct  309   RELKDRPAFEADDQSAMVYLLATERERWGGKVYLESGYYLHGYWGILVDRYEEMIENHKP  368

Query  1160  GFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPN  1339
             GFGD RWP VTHFVGCK CG  GD+PVE+C++ M+RAFNF DNQ+L +YGF H+ L S  
Sbjct  369   GFGDHRWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILQMYGFTHKSLGSRR  428

Query  1340  IKRIRNETTLPLPNVDRYDFRH  1405
             +K  RN+T  PL   D +   H
Sbjct  429   VKPTRNQTDRPLEAKDEFGLLH  450



>ref|XP_008386651.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=449

 Score =   503 bits (1294),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 240/430 (56%), Positives = 307/430 (71%), Gaps = 21/430 (5%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R   + K+TILC  +T++VLRGTIG G   + +    E+ + F      E +R+
Sbjct  11    RSRRIQRALRHSKVTILCLVLTVVVLRGTIGAGKFGTPEQDFLEIRDHFYSRKRAEAHRV  70

Query  335   LDEIRSDKDPDDPEGQSG------------DRFLSPNETFSLGPKITGWDEQRKVWFDRH  478
             L+E+ +   P DP   +             +  + PN+ ++LGPKI+ WDE R  W   +
Sbjct  71    LEEVHAT--PSDPNNYNAFDIKKLLVDEGEEEQVDPNKPYTLGPKISNWDELRSKWLREN  128

Query  479   PRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMD  655
             P FP+ +  GKPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE+ YN A +D
Sbjct  129   PNFPNFIGPGKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNMALLD  188

Query  656   REMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDL  835
              EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N V+HG+   
Sbjct  189   AEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERYKDSNFVMHGWNKT  248

Query  836   LFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEAD  1015
             ++D+KSW  L+TGSFL+RN QW+LD+LD WAPMGPKG IREE+GK LT  LKGRP FEAD
Sbjct  249   VYDEKSWIGLNTGSFLLRNTQWSLDMLDAWAPMGPKGKIREEAGKVLTKELKGRPVFEAD  308

Query  1016  DQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTH  1195
             DQSA++Y+L +++ +W DKV+LE+ YYLHGYW  LVDRYEE++E Y PG GD RWP VTH
Sbjct  309   DQSAMVYILATQRQKWGDKVYLESGYYLHGYWGILVDRYEEMIENYRPGLGDHRWPLVTH  368

Query  1196  FVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             FVGCK CG   D+PVE+C+K M+RAFNF DNQ+L +YGF HR L S  +KR+RN+  +PL
Sbjct  369   FVGCKPCGKLADYPVERCLKQMDRAFNFGDNQILQIYGFAHRSLGSRRVKRVRNQKNIPL  428

Query  1376  PNVDRYDFRH  1405
                D     H
Sbjct  429   EVKDELGLLH  438



>ref|XP_006287708.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 ref|XP_006287709.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 gb|EOA20606.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
 gb|EOA20607.1| hypothetical protein CARUB_v10000915mg [Capsella rubella]
Length=460

 Score =   503 bits (1295),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 250/442 (57%), Positives = 313/442 (71%), Gaps = 35/442 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R    +K+TILC  +T++VLR TIG G   + +    E+   F      E +R+
Sbjct  10    RCRRIQRALRQLKVTILCLVLTVVVLRSTIGAGKFGTPEQDLDEIRQHFHARKRGEPHRV  69

Query  335   LDEIRSDKDP------------------------DDPEGQSGDRFLSPNETFSLGPKITG  442
             L+EI++  D                         D+ E +  D    PN+ ++LGPKI+ 
Sbjct  70    LEEIQTGGDSTGDGGGNSGGSNNYETFDINKIFVDEGEEEKPD----PNKPYTLGPKISD  125

Query  443   WDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIH  619
             WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+H
Sbjct  126   WDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRLH  185

Query  620   GIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYD  799
             GIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y 
Sbjct  186   GIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWERYK  245

Query  800   SHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLT  979
              +NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK LT
Sbjct  246   DYNLVMHGWNEMVYDQKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKVLT  305

Query  980   ANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHP  1159
               LK RP FEADDQSA++YLL +++D W +KV+LE+ YYLHGYW  LVDRYEE+ME YHP
Sbjct  306   RELKDRPVFEADDQSAMVYLLATQRDAWGNKVYLESGYYLHGYWGILVDRYEEMMENYHP  365

Query  1160  GFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPN  1339
             G GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  
Sbjct  366   GLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRK  425

Query  1340  IKRIRNETTLPLPNVDRYDFRH  1405
             +KR+RNET+ PL   D     H
Sbjct  426   VKRVRNETSNPLDMKDELGLLH  447



>ref|XP_008235042.1| PREDICTED: putative glycosyltransferase 2 [Prunus mume]
Length=449

 Score =   502 bits (1293),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 241/433 (56%), Positives = 318/433 (73%), Gaps = 17/433 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R   + K+TILC  +T++VLRGTIG G   + +    E+ + F      E +R+
Sbjct  11    RTRRIHRALRHGKVTILCLVLTVVVLRGTIGAGKFGTPEQDFIEIRDHFYSRKRAEPHRV  70

Query  335   LDEIRSD-KDPDDPEGQSGDRFL---------SPNETFSLGPKITGWDEQRKVWFDRHPR  484
             L+E++S   DP++      ++ L          PN+ ++LGPKI+ WDEQR  W   +P 
Sbjct  71    LEEVQSTPADPNNYNAFDINKILVDEGEEDRPDPNKPYNLGPKISNWDEQRSKWLKENPN  130

Query  485   FPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDRE  661
             FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE+ YN A +D E
Sbjct  131   FPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNMALLDAE  190

Query  662   MDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLF  841
             M G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  ++ V+HG+ ++++
Sbjct  191   MAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYRDYDFVMHGWNEMVY  250

Query  842   DQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQ  1021
             DQK+W  L+TGSFL+RN QW+LD+LD WAPMGPKG IR+E+GK LT  LK RP FEADDQ
Sbjct  251   DQKNWIGLNTGSFLLRNTQWSLDMLDTWAPMGPKGKIRDEAGKILTRELKDRPVFEADDQ  310

Query  1022  SALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFV  1201
             SA++Y+L +++++W DKV+LE++YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFV
Sbjct  311   SAMVYILATQREKWGDKVYLESAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFV  370

Query  1202  GCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPN  1381
             GCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H  L S  +KR+RNET+ PL  
Sbjct  371   GCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHSSLGSRRVKRVRNETSNPLEV  430

Query  1382  VDRYDFRHAKHES  1420
              D     H + ++
Sbjct  431   KDELGLLHPEFKA  443



>emb|CDY22055.1| BnaA09g00840D [Brassica napus]
Length=449

 Score =   502 bits (1292),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 249/427 (58%), Positives = 315/427 (74%), Gaps = 16/427 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R R+I R   ++K+T+LC  +T++VLRGTIG G   + + +++        S    E +R
Sbjct  10    RCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFQPSRKRAEPHR  69

Query  332   ILDEIRSDKDPDDPEGQSGDRFLSPNETF--------SLGPKITGWDEQRKVWFDRHPRF  487
             +L+EI++  D D     SG    +  ETF        +LGPKI+ WDEQR  W  ++P F
Sbjct  70    VLEEIQTGGDSDSSSAASGAGGSNNYETFEINKIFPYTLGPKISDWDEQRSDWLAKNPTF  129

Query  488   PSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREM  664
             P+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A +D EM
Sbjct  130   PNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMALLDAEM  189

Query  665   DGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFD  844
              G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  +NLV+HG+ ++++D
Sbjct  190   AGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERYKEYNLVMHGWNEMVYD  249

Query  845   QKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQS  1024
             +K+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK LT  LKGRP FEADDQS
Sbjct  250   EKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKVLTRELKGRPVFEADDQS  309

Query  1025  ALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVG  1204
             A++YLL +++D W +KV+LEN YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFVG
Sbjct  310   AMVYLLATQRDTWGNKVYLENGYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFVG  369

Query  1205  CKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNV  1384
             CK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR+RNET+ PL   
Sbjct  370   CKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRKVKRVRNETSNPLEMK  429

Query  1385  DRYDFRH  1405
             D     H
Sbjct  430   DELGLLH  436



>ref|XP_008368989.1| PREDICTED: putative glycosyltransferase 2 [Malus domestica]
Length=448

 Score =   502 bits (1292),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 243/429 (57%), Positives = 310/429 (72%), Gaps = 20/429 (5%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R   + K+TILC  +T++VLRGTIG G   + +    E+ + F      E +R+
Sbjct  11    RSRRIQRALRHSKVTILCLVLTVVVLRGTIGAGKFGTPEQDFLEIRDHFYSRKRAEPHRV  70

Query  335   LDEIRSDKDPDDPEGQS-----------GDRFLSPNETFSLGPKITGWDEQRKVWFDRHP  481
             L+E+ S   P DP   +           G+    PN+ ++LGPKI+ WDEQR  W   +P
Sbjct  71    LEEVHST--PSDPNNYNAFDFNKIVVDEGEDRPDPNKPYTLGPKISNWDEQRSKWLRENP  128

Query  482   RFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDR  658
              FP+ V  GKPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE+ YN A +D 
Sbjct  129   NFPNFVGPGKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNMALLDA  188

Query  659   EMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLL  838
             EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N V+HG+ +++
Sbjct  189   EMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERYKDSNFVMHGWNEMV  248

Query  839   FDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADD  1018
             +D+KSW  L+TGSFL+RN QW+LD+LD WAPMGPKG IREE+GK LT  LKGRP FEADD
Sbjct  249   YDEKSWIGLNTGSFLLRNTQWSLDMLDAWAPMGPKGKIREEAGKVLTRELKGRPVFEADD  308

Query  1019  QSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHF  1198
             QSA++Y+L +++++W DKV+LE+ YYLHGYW  LVD+YEE++E Y PG GD RWP VTHF
Sbjct  309   QSAMVYILATQREKWGDKVYLESGYYLHGYWGILVDKYEEMIENYRPGLGDHRWPLVTHF  368

Query  1199  VGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLP  1378
             VGCK CG  GD+ V++C + M+RAFNF DNQ+L +YGF HR L S  +KR+RNET  PL 
Sbjct  369   VGCKPCGKFGDYSVKRCFEQMDRAFNFGDNQILQIYGFTHRSLGSRRVKRVRNETNNPLE  428

Query  1379  NVDRYDFRH  1405
               D     H
Sbjct  429   VKDELGLLH  437



>gb|AAC78266.1| putative glycosyltransferase [Arabidopsis thaliana]
 emb|CAB80743.1| putative glycosyltransferase [Arabidopsis thaliana]
Length=459

 Score =   502 bits (1293),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 249/443 (56%), Positives = 313/443 (71%), Gaps = 36/443 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R    +K+TILC  +T++VLR TIG G   + +    E+   F      E +R+
Sbjct  10    RCRRIQRALRQLKVTILCLLLTVVVLRSTIGAGKFGTPEQDLDEIRQHFHARKRGEPHRV  69

Query  335   LDEIRSDKDP-------------------------DDPEGQSGDRFLSPNETFSLGPKIT  439
             L+EI++  D                          D+ E +  D    PN+ ++LGPKI+
Sbjct  70    LEEIQTGGDSSSGDGGGNSGGSNNYETFDINKIFVDEGEEEKPD----PNKPYTLGPKIS  125

Query  440   GWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRI  616
              WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+
Sbjct  126   DWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRL  185

Query  617   HGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKY  796
             HGIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y
Sbjct  186   HGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWERY  245

Query  797   DSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTL  976
               +NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK L
Sbjct  246   KDYNLVMHGWNEMVYDQKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKVL  305

Query  977   TANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYH  1156
             T  LK RP FEADDQSA++YLL +++D W +KV+LE+ YYLHGYW  LVDRYEE++E YH
Sbjct  306   TRELKDRPVFEADDQSAMVYLLATQRDAWGNKVYLESGYYLHGYWGILVDRYEEMIENYH  365

Query  1157  PGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSP  1336
             PG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S 
Sbjct  366   PGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASR  425

Query  1337  NIKRIRNETTLPLPNVDRYDFRH  1405
              +KR+RNET+ PL   D     H
Sbjct  426   KVKRVRNETSNPLEMKDELGLLH  448



>ref|XP_010429788.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Camelina sativa]
Length=464

 Score =   502 bits (1293),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 248/442 (56%), Positives = 314/442 (71%), Gaps = 31/442 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R F+ +K+TILC  +T++VLR TIG G   + +    E+   F      E +R+
Sbjct  10    RCRRIQRAFHQLKVTILCLVLTVVVLRSTIGAGKFGTPEQDLDEIRQHFYTRKRGEPHRV  69

Query  335   LDEIRS--------------------DKDPDDPEGQSGDRFLS----PNETFSLGPKITG  442
             L+EI++                    + +  D      D  +     PN+ ++LGPKI+ 
Sbjct  70    LEEIQTGGDSSAAGGDGGGGNSGGSNNYETFDINKIFVDEGVEEKPDPNKPYTLGPKISD  129

Query  443   WDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIH  619
             WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+H
Sbjct  130   WDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRLH  189

Query  620   GIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYD  799
             GIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y 
Sbjct  190   GIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWERYK  249

Query  800   SHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLT  979
              +NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK LT
Sbjct  250   DYNLVMHGWNEMVYDQKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKVLT  309

Query  980   ANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHP  1159
               LK RP FEADDQSA++YLL +++D W +KV+LE+ YYLHGYW  LVDRYEE++E YHP
Sbjct  310   RELKDRPVFEADDQSAMVYLLATQRDAWGNKVYLESGYYLHGYWGILVDRYEEMIENYHP  369

Query  1160  GFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPN  1339
             G GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  
Sbjct  370   GLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRK  429

Query  1340  IKRIRNETTLPLPNVDRYDFRH  1405
             +KR+RNET+ PL   D     H
Sbjct  430   VKRVRNETSNPLEMKDELGLLH  451



>ref|XP_010422579.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Camelina sativa]
Length=463

 Score =   502 bits (1293),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 247/441 (56%), Positives = 312/441 (71%), Gaps = 30/441 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R F+ +K+TILC  +T++VLR TIG G   + +    E+   F      E +R+
Sbjct  10    RCRRIQRAFHQLKVTILCLVLTVVVLRSTIGAGKFGTPEQDLDEIRQHFYTRKRGEPHRV  69

Query  335   LDEIRSDKDPDDPEG-----------------------QSGDRFLSPNETFSLGPKITGW  445
             L+EI++  D                             +  +    PN+ ++LGPKI+ W
Sbjct  70    LEEIQTGGDSSGGGDGGGGNSGGSNNYETFDINKIFVDEGVEEKPDPNKPYTLGPKISDW  129

Query  446   DEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHG  622
             DEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HG
Sbjct  130   DEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRLHG  189

Query  623   IEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDS  802
             IEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y  
Sbjct  190   IEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWERYKD  249

Query  803   HNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTA  982
             +NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK LT 
Sbjct  250   YNLVMHGWNEMVYDQKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKVLTR  309

Query  983   NLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPG  1162
              LK RP FEADDQSA++YLL +++D W +KV+LE+ YYLHGYW  LVDRYEE++E YHPG
Sbjct  310   ELKDRPVFEADDQSAMVYLLATQRDAWGNKVYLESGYYLHGYWGILVDRYEEMIENYHPG  369

Query  1163  FGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNI  1342
              GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +
Sbjct  370   LGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRKV  429

Query  1343  KRIRNETTLPLPNVDRYDFRH  1405
             KR+RNET+ PL   D     H
Sbjct  430   KRVRNETSNPLEMKDELGLLH  450



>ref|XP_008235045.1| PREDICTED: putative glycosyltransferase 2 [Prunus mume]
Length=448

 Score =   501 bits (1291),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 241/433 (56%), Positives = 316/433 (73%), Gaps = 17/433 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I     + K+TILC  +T++VLRGT+G G   + +    E+ + F      E +R+
Sbjct  11    RTRRIHSALRHGKVTILCLVLTVVVLRGTVGAGKFGTPEQDFIEIRDHFYSRKRAEPHRV  70

Query  335   LDEIRSD-KDPDDPEGQSGDRFL---------SPNETFSLGPKITGWDEQRKVWFDRHPR  484
             L E++S   DP++      ++ L          PN+ ++LGPKI+ WDEQR  W   +  
Sbjct  71    LQEVQSTPADPNNYNAFDINKILVDEGEEDRPDPNKPYTLGPKISNWDEQRSKWLKENTN  130

Query  485   FPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDRE  661
             FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE+ YN A +D E
Sbjct  131   FPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNMALLDAE  190

Query  662   MDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLF  841
             M G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  ++ V+HG+ ++++
Sbjct  191   MAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDYDFVMHGWNEMVY  250

Query  842   DQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQ  1021
             DQK+W  L+TGSFL+RN QW+LD+LD WAPMGPKG IR+E+GK LT  LKGRP FEADDQ
Sbjct  251   DQKNWIGLNTGSFLLRNTQWSLDMLDTWAPMGPKGKIRDEAGKILTRELKGRPVFEADDQ  310

Query  1022  SALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFV  1201
             SA++Y+L +++++W DKV+LEN+YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFV
Sbjct  311   SAMVYILATQREKWGDKVYLENAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFV  370

Query  1202  GCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPN  1381
             GCK CG  GD+PVE+C+K M+RAFNF DNQVL +YGF H  L S  +KR+RNET+ PL  
Sbjct  371   GCKPCGKFGDYPVERCLKQMDRAFNFGDNQVLQIYGFTHSSLGSRRVKRVRNETSNPLEV  430

Query  1382  VDRYDFRHAKHES  1420
              D     H + ++
Sbjct  431   KDELGLLHPEFKA  443



>ref|NP_567241.1| UDP-xylosyltransferase 2 [Arabidopsis thaliana]
 sp|O22775.1|XXT2_ARATH RecName: Full=Xyloglucan 6-xylosyltransferase 2; Short=AtXT2; 
AltName: Full=Putative glycosyltransferase 2; Short=AtGT2 [Arabidopsis 
thaliana]
 gb|AAC19271.1| T14P8.23 [Arabidopsis thaliana]
 emb|CAC01674.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 gb|AAL14393.1| AT4g02500/T10P11_20 [Arabidopsis thaliana]
 gb|AAM98170.1| putative glycosyltransferase [Arabidopsis thaliana]
 gb|AAP31945.1| At4g02500 [Arabidopsis thaliana]
 gb|AEE82181.1| UDP-xylosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38708.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=461

 Score =   502 bits (1292),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 249/443 (56%), Positives = 313/443 (71%), Gaps = 36/443 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R    +K+TILC  +T++VLR TIG G   + +    E+   F      E +R+
Sbjct  10    RCRRIQRALRQLKVTILCLLLTVVVLRSTIGAGKFGTPEQDLDEIRQHFHARKRGEPHRV  69

Query  335   LDEIRSDKDP-------------------------DDPEGQSGDRFLSPNETFSLGPKIT  439
             L+EI++  D                          D+ E +  D    PN+ ++LGPKI+
Sbjct  70    LEEIQTGGDSSSGDGGGNSGGSNNYETFDINKIFVDEGEEEKPD----PNKPYTLGPKIS  125

Query  440   GWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRI  616
              WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+
Sbjct  126   DWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRL  185

Query  617   HGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKY  796
             HGIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y
Sbjct  186   HGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWERY  245

Query  797   DSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTL  976
               +NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK L
Sbjct  246   KDYNLVMHGWNEMVYDQKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKVL  305

Query  977   TANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYH  1156
             T  LK RP FEADDQSA++YLL +++D W +KV+LE+ YYLHGYW  LVDRYEE++E YH
Sbjct  306   TRELKDRPVFEADDQSAMVYLLATQRDAWGNKVYLESGYYLHGYWGILVDRYEEMIENYH  365

Query  1157  PGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSP  1336
             PG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S 
Sbjct  366   PGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASR  425

Query  1337  NIKRIRNETTLPLPNVDRYDFRH  1405
              +KR+RNET+ PL   D     H
Sbjct  426   KVKRVRNETSNPLEMKDELGLLH  448



>ref|XP_010456020.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Camelina sativa]
 ref|XP_010456021.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Camelina sativa]
Length=463

 Score =   502 bits (1292),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 248/441 (56%), Positives = 313/441 (71%), Gaps = 30/441 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R F  +K+TILC  +T++VLR TIG G   + +    E+   F      E +R+
Sbjct  10    RCRRIQRAFRQLKVTILCLVLTVVVLRSTIGAGKFGTPEQDLDEIRQHFYTRKRGEPHRV  69

Query  335   LDEIRSDKDPDDPEG-----------------------QSGDRFLSPNETFSLGPKITGW  445
             L+EI++  D    +G                       +  +    PN+ ++LGPKI+ W
Sbjct  70    LEEIQTGGDSSAGDGGGGGNSGGSNNYETFDINKIFVDEGVEEKPDPNKPYTLGPKISDW  129

Query  446   DEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHG  622
             DEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HG
Sbjct  130   DEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRLHG  189

Query  623   IEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDS  802
             IEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y  
Sbjct  190   IEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWERYKD  249

Query  803   HNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTA  982
             +NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK LT 
Sbjct  250   YNLVMHGWNEMVYDQKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKVLTR  309

Query  983   NLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPG  1162
              LK RP FEADDQSA++YLL +++D W +KV+LE+ YYLHGYW  LVDRYEE++E YHPG
Sbjct  310   ELKDRPVFEADDQSAMVYLLATQRDAWGNKVYLESGYYLHGYWGILVDRYEEMIENYHPG  369

Query  1163  FGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNI  1342
              GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +
Sbjct  370   LGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRKV  429

Query  1343  KRIRNETTLPLPNVDRYDFRH  1405
             KR+RNET+ PL   D     H
Sbjct  430   KRVRNETSNPLEMKDELGLLH  450



>emb|CDY50378.1| BnaCnng19100D [Brassica napus]
Length=469

 Score =   502 bits (1292),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 246/433 (57%), Positives = 313/433 (72%), Gaps = 31/433 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R R+I R   ++K+T+LC  +T++VLRGTIG G   + + +++        S    E +R
Sbjct  33    RCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIHQHFQPSRKRAEPHR  92

Query  332   ILDEIR--------------SDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWF  469
             +L+EI+              S    D P+         PN+ ++LGPKI+ WDEQR  W 
Sbjct  93    VLEEIQTGGDSSSSTSGDGNSAGKEDKPD---------PNKPYTLGPKISDWDEQRSDWL  143

Query  470   DRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSA  646
              ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A
Sbjct  144   AKNPTFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMA  203

Query  647   NMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGY  826
              +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y  +NLV+HG+
Sbjct  204   LLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERYKEYNLVMHGW  263

Query  827   QDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEF  1006
              ++++D+K+W  L+TGSFL RN QWALDLLD WAPMGPKG IREE+GK LT  LKGRP F
Sbjct  264   NEMVYDEKNWIGLNTGSFLFRNNQWALDLLDTWAPMGPKGKIREEAGKVLTRELKGRPVF  323

Query  1007  EADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPF  1186
             EADDQSA++YLL +++D W +KV+LE+ YYLHGYW  LVDRYEE++E YHPG GD RWP 
Sbjct  324   EADDQSAMVYLLATQRDTWGNKVYLESGYYLHGYWGILVDRYEEMIENYHPGLGDHRWPL  383

Query  1187  VTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETT  1366
             VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR+RNET+
Sbjct  384   VTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRKVKRVRNETS  443

Query  1367  LPLPNVDRYDFRH  1405
              PL   D     H
Sbjct  444   NPLEMKDELGLLH  456



>gb|KHG26935.1| Putative glycosyltransferase 2 -like protein [Gossypium arboreum]
Length=459

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 247/439 (56%), Positives = 311/439 (71%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSFLI---DETNRI  334
             R R+I RT  + K+TILC  +T++VLRGTIG G   +      E+ +        E +R+
Sbjct  10    RSRKIQRTLRHCKVTILCLVLTVVVLRGTIGAGKFGTPGQDFVEIRDHLYSRKQGEPHRV  69

Query  335   LDEIR--SDKDPDDPEGQSG---------DRFL----------SPNETFSLGPKITGWDE  451
             L E++  S  + D  +  +G         ++ L           PN  +SLGPKI+ WDE
Sbjct  70    LKEVQTTSSDNHDGADTNAGTNNYNEFDINKILIDEEPDVSKRDPNAPYSLGPKISDWDE  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W   +P +P+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE
Sbjct  130   QRSRWLQDNPNYPNFIGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDSN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
              V+HG+ ++++DQK+W  L+TGSFL+RN QWALD+LD WAPMGPKG IREE+GK LT  L
Sbjct  250   FVMHGWNEMVYDQKNWIGLNTGSFLLRNGQWALDILDAWAPMGPKGEIREEAGKVLTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             K RP FEADDQSA++YLL +++++W DKV+LENSYYLHGYW  LVDRYEE++E YHPG G
Sbjct  310   KNRPVFEADDQSAMVYLLATQREKWGDKVYLENSYYLHGYWGILVDRYEEMIENYHPGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+ VE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYSVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVKR  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
             +RNET  PL   D     H
Sbjct  430   VRNETGNPLEVKDELGLLH  448



>emb|CDX90935.1| BnaA03g26150D [Brassica napus]
Length=449

 Score =   500 bits (1288),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/426 (57%), Positives = 308/426 (72%), Gaps = 15/426 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRS  352
             R R+I R   ++K+T+LC  +T++VLRGTIG G   + + +++      +T+R   E   
Sbjct  10    RCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFQTSRKRAEPHH  69

Query  353   DKDPDDPEGQSGDRF--------------LSPNETFSLGPKITGWDEQRKVWFDRHPRFP  490
               D       + + F                PN+ ++LGPKI+ WDEQR  W  ++P FP
Sbjct  70    SGDGGGAGSNNYETFDINKIFVDEGEEEKPDPNKPYTLGPKISDWDEQRSDWLSKNPSFP  129

Query  491   SSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMD  667
             + +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A +D EM 
Sbjct  130   NFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMALLDAEMA  189

Query  668   GNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQ  847
             G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y  +NLV+HG+ ++++D 
Sbjct  190   GFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWERYKDYNLVMHGWNEMVYDD  249

Query  848   KSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSA  1027
             K+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK LT  LKGRP FEADDQSA
Sbjct  250   KNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKVLTRGLKGRPVFEADDQSA  309

Query  1028  LIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGC  1207
             ++YLL +++D W +KV+LEN YYLHGYW  LVDRY+E++E YHPG GD RWP VTHFVGC
Sbjct  310   MVYLLATQRDTWGNKVYLENGYYLHGYWGILVDRYKEMIENYHPGLGDHRWPLVTHFVGC  369

Query  1208  KACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVD  1387
             K CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR+RNET+ PL   D
Sbjct  370   KPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRKVKRVRNETSNPLEMKD  429

Query  1388  RYDFRH  1405
                  H
Sbjct  430   ELGLLH  435



>ref|XP_002874911.1| hypothetical protein ARALYDRAFT_490316 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51170.1| hypothetical protein ARALYDRAFT_490316 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 249/445 (56%), Positives = 312/445 (70%), Gaps = 38/445 (9%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R    +K+TILC  +T++VLR TIG G   + +    E+   F      E +R+
Sbjct  10    RCRRIQRALRQLKVTILCLVLTVVVLRSTIGAGKFGTPEQDLDEIRQHFHARKRGEPHRV  69

Query  335   LDEIRSDKDP---------------------------DDPEGQSGDRFLSPNETFSLGPK  433
             L+EI++  D                            D+ E +  D    PN+ ++LGPK
Sbjct  70    LEEIQTGGDSSSSSGDGGGNSGGSNNYETFDINKIFVDEGEEEKPD----PNKPYTLGPK  125

Query  434   ITGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYC  610
             I+ WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYC
Sbjct  126   ISDWDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYC  185

Query  611   RIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLS  790
             R+HGIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  
Sbjct  186   RLHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWE  245

Query  791   KYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGK  970
             +Y  +NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK
Sbjct  246   RYKDYNLVMHGWNEMVYDQKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGK  305

Query  971   TLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEK  1150
              LT  LK RP FEADDQSA++YLL +++D W  KV+LE+ YYLHGYW  LVDRYEE++E 
Sbjct  306   VLTRELKDRPVFEADDQSAMVYLLATQRDAWGSKVYLESGYYLHGYWGILVDRYEEMIEN  365

Query  1151  YHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLL  1330
             YHPG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L 
Sbjct  366   YHPGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLA  425

Query  1331  SPNIKRIRNETTLPLPNVDRYDFRH  1405
             S  +KR+RNET+ PL   D     H
Sbjct  426   SRKVKRVRNETSNPLEMKDELGLLH  450



>ref|XP_006396461.1| hypothetical protein EUTSA_v10028641mg [Eutrema salsugineum]
 gb|ESQ37914.1| hypothetical protein EUTSA_v10028641mg [Eutrema salsugineum]
Length=464

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 312/442 (71%), Gaps = 31/442 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID----ETNR  331
             R R+I R   ++K+T+LC  +T++VLRGTIG G   + +    E+   F       E +R
Sbjct  10    RCRKIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFHTSRKRAEPHR  69

Query  332   ILDEIRSDKDPDDPEGQSG-----------------------DRFLSPNETFSLGPKITG  442
             +L+EI++  D        G                       +    PN+ ++LGPKI+ 
Sbjct  70    VLEEIQTGGDSSSTGDTGGANSGGSNNYETFDINKIFVDEGEEEKPDPNKPYTLGPKISD  129

Query  443   WDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIH  619
             WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+H
Sbjct  130   WDEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRLH  189

Query  620   GIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYD  799
             GIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +Y 
Sbjct  190   GIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWERYK  249

Query  800   SHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLT  979
              +NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK LT
Sbjct  250   DYNLVMHGWNEMVYDQKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKVLT  309

Query  980   ANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHP  1159
               LK RP FEADDQSA++YLL +++D W +KV+LE+ YYLHGYW  LVDRYEE++E YHP
Sbjct  310   RELKDRPVFEADDQSAMVYLLATQRDTWGNKVYLESGYYLHGYWGILVDRYEEMIENYHP  369

Query  1160  GFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPN  1339
             G GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  
Sbjct  370   GLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRK  429

Query  1340  IKRIRNETTLPLPNVDRYDFRH  1405
             +KR+RNET+ PL   D     H
Sbjct  430   VKRVRNETSNPLEMKDELGLLH  451



>ref|XP_009342118.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
 ref|XP_009342138.1| PREDICTED: putative glycosyltransferase 2 [Pyrus x bretschneideri]
Length=449

 Score =   499 bits (1286),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 240/428 (56%), Positives = 311/428 (73%), Gaps = 17/428 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI---DETNRI  334
             R R+I R   + K+TILC  +T++VLRGTIG G   + +    E+ + F      E +R+
Sbjct  11    RSRRIQRALRHSKVTILCLVLTVVVLRGTIGAGKFGTPEQDFLEIRDHFYSRKRAEPHRV  70

Query  335   LDEIRSD-KDPDDPEGQSGDRFL---------SPNETFSLGPKITGWDEQRKVWFDRHPR  484
             L+E+ +   DP++      ++ L          PN+ ++LGPKI+ WDEQR  W   +P 
Sbjct  71    LEEVHATPSDPNNYNALDFNKILVDEGEDDRPDPNKPYTLGPKISNWDEQRSKWLRENPN  130

Query  485   FPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDRE  661
             FP+ V  GKPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIE+ YN A +D E
Sbjct  131   FPNFVGPGKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEVFYNMALLDAE  190

Query  662   MDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLF  841
             M G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N V+HG+ ++++
Sbjct  191   MAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERYKDSNFVMHGWNEMVY  250

Query  842   DQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQ  1021
             D+KSW  L+TGSFL+RN QW+LD+LD WAPMGPKG IREE+GK LT  LKGRP FEADDQ
Sbjct  251   DEKSWIGLNTGSFLLRNTQWSLDMLDAWAPMGPKGKIREEAGKVLTRELKGRPVFEADDQ  310

Query  1022  SALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFV  1201
             SA++Y+L +++++W DKV+LE+ YYLHGYW  LVD+YEE+++ Y PG GD RWP VTHFV
Sbjct  311   SAMVYILATQREKWGDKVYLESGYYLHGYWGILVDKYEEMIQNYRPGLGDHRWPLVTHFV  370

Query  1202  GCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPN  1381
             GCK CG  GD+ V++C + M+RAFNF DNQ+L +YGF HR L S  +KR+RNET  PL  
Sbjct  371   GCKPCGKFGDYSVKRCFEQMDRAFNFGDNQILQIYGFTHRSLGSRRVKRVRNETNNPLEV  430

Query  1382  VDRYDFRH  1405
              D     H
Sbjct  431   KDELGLLH  438



>ref|XP_009111280.1| PREDICTED: putative glycosyltransferase 2 [Brassica rapa]
Length=462

 Score =   500 bits (1287),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 248/444 (56%), Positives = 316/444 (71%), Gaps = 37/444 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R R+I R   ++K+T+LC  +T++VLRGTIG G   + + +++        S    E +R
Sbjct  10    RCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFQPSRKRAEPHR  69

Query  332   ILDEIRSDKDP-------------------------DDPEGQSGDRFLSPNETFSLGPKI  436
             +L+EI++  D                          D+ E    D    PN+ ++LGPKI
Sbjct  70    VLEEIQTGGDSDSSSAASGAGGSNNYETFDINKIFVDEGEEAKPD----PNKPYTLGPKI  125

Query  437   TGWDEQRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCR  613
             + WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR
Sbjct  126   SDWDEQRSDWLAKNPTFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCR  185

Query  614   IHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSK  793
             +HGIEI YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +
Sbjct  186   LHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWER  245

Query  794   YDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKT  973
             Y  +NLV+HG+ ++++D+K+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK 
Sbjct  246   YKEYNLVMHGWNEMVYDEKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGKV  305

Query  974   LTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKY  1153
             LT  LKGRP FEADDQSA++YLL +++D W +KV+LEN YYLHGYW  LVDRYEE++E Y
Sbjct  306   LTRELKGRPVFEADDQSAMVYLLATQRDTWGNKVYLENGYYLHGYWGILVDRYEEMIENY  365

Query  1154  HPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLS  1333
             HPG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S
Sbjct  366   HPGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLAS  425

Query  1334  PNIKRIRNETTLPLPNVDRYDFRH  1405
               +KR+RNET+ PL   D     H
Sbjct  426   RKVKRVRNETSNPLEMKDELGLLH  449



>ref|XP_001777149.1| predicted protein [Physcomitrella patens]
 gb|EDQ58034.1| predicted protein [Physcomitrella patens]
Length=438

 Score =   499 bits (1284),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 231/422 (55%), Positives = 310/422 (73%), Gaps = 17/422 (4%)
 Frame = +2

Query  149   IRANPQVPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLAS--SDAEVENSFLIDE  322
             I+ +   P+GR++ +T NN+K+T+LCG +TILVLRGTIG GN  +   D E   + L   
Sbjct  7     IQRSLSTPKGRRLQKTINNMKVTVLCGLMTILVLRGTIGAGNFGTPAQDFEELRAHLRSA  66

Query  323   TN-----RILDEIRSD-----KDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFD  472
             T      R+L++I  +        DD E  + D    P + +SLGPK++ WD+QRK W  
Sbjct  67    TREYHAVRVLNQIDEETLVDGSYSDDAEESNRD----PEKPYSLGPKVSDWDQQRKQWLS  122

Query  473   RHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANM  652
              + +    +K KPR+LLVTGS P+ CE+  GD++LLK +KNK+DY R+H I+  YN A++
Sbjct  123   ENSQTLPKLKRKPRILLVTGSQPSSCESAEGDNFLLKSIKNKVDYARLHNIDFFYNMAHL  182

Query  653   DREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQD  832
             D+EM G WAKLPL+R+LML++PE+EW+WWMDSDA FTDM+F++PL KY+++NLV+HG+ D
Sbjct  183   DQEMTGFWAKLPLLRKLMLTNPEMEWVWWMDSDALFTDMSFKVPLEKYNNYNLVLHGFDD  242

Query  833   LLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEA  1012
              ++ QK WT L+TGSF IRNCQW+LDLLD WAPMGPKG IR  +G+ L+ +L GR  FEA
Sbjct  243   KVYQQKLWTGLNTGSFFIRNCQWSLDLLDAWAPMGPKGVIRNRAGEMLSKSLVGRTNFEA  302

Query  1013  DDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVT  1192
             DDQSAL++LL++++ +W +KV LENSYYLHGYW  LV +YEE M K HPGFGD+RWPFVT
Sbjct  303   DDQSALVHLLIAQRQEWANKVLLENSYYLHGYWVDLVGKYEENMAKSHPGFGDDRWPFVT  362

Query  1193  HFVGCKAC-GSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTL  1369
             HFVGCK C  + GD+PV+ C K M RAF FADNQ+L++ GF+HR L SP + RIR +T+ 
Sbjct  363   HFVGCKPCVKNGGDYPVDTCFKQMARAFTFADNQILDVLGFRHRKLGSPRVVRIREDTSH  422

Query  1370  PL  1375
             PL
Sbjct  423   PL  424



>ref|XP_001755467.1| predicted protein [Physcomitrella patens]
 gb|EDQ79947.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   498 bits (1282),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 231/410 (56%), Positives = 303/410 (74%), Gaps = 10/410 (2%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLAS--SDAEVENSFLIDETN-----R  331
             +GR++ R+ NN+KIT+LCG +TILVLRGTIG GN  +   D E   + L   T      R
Sbjct  5     KGRRLQRSINNMKITVLCGLMTILVLRGTIGAGNFGTPAQDFEEIRAHLRSATREFHAVR  64

Query  332   ILDEIRSDKDPDDPEGQSGDRFLS-PNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGK  508
             +L+++     PD       +     P  T+SLGPKI  WD QR+ W   +     ++KG+
Sbjct  65    VLNQVDEKTSPDMVNNDVTEELREDPLVTYSLGPKINDWDGQREKWMSENS-LSLNLKGR  123

Query  509   PRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLP  688
             PRVLLVTGS P+ C+N  GD++LLK +KNK+DY R+H +EI YN A++D+EM G WAKLP
Sbjct  124   PRVLLVTGSQPSSCDNAEGDNFLLKSIKNKLDYARLHNMEIFYNMAHLDQEMTGFWAKLP  183

Query  689   LIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALS  868
             LIRRLML++PE EWIWWMDSDA FTDM+FE+PL  Y++ NLV+HG+ D ++ QK WT L+
Sbjct  184   LIRRLMLTNPETEWIWWMDSDALFTDMSFEVPLEHYENFNLVLHGFDDKVYQQKLWTGLN  243

Query  869   TGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMS  1048
             TGSFLIRNCQW+LDLLD WAPMGP+G +R ++G+ L+ +L GR  FEADDQSAL+YLL++
Sbjct  244   TGSFLIRNCQWSLDLLDAWAPMGPRGIVRNQAGEMLSKSLTGRTNFEADDQSALVYLLIT  303

Query  1049  EKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKAC-GSS  1225
             ++ +W  KV LENSYYLHGYW  LV +YEE M K HPGFGD+RWPF+THFVGCK C  + 
Sbjct  304   QRQEWAKKVMLENSYYLHGYWVDLVGKYEENMAKSHPGFGDDRWPFITHFVGCKPCLKNG  363

Query  1226  GDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             GD+PV+ C K MERAF FADNQ+L++ GF+HR L SP + R+R++++ PL
Sbjct  364   GDYPVDTCFKQMERAFTFADNQILDVLGFRHRKLGSPRVVRVRDDSSHPL  413



>ref|XP_010522780.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Tarenaya hassleriana]
 ref|XP_010522781.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Tarenaya hassleriana]
Length=463

 Score =   499 bits (1284),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 247/445 (56%), Positives = 317/445 (71%), Gaps = 38/445 (9%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSFLI---DETNRI  334
             R R+I R   ++K+T+LC  +T++VLRGTIG G   + +   AE+   F      E +R+
Sbjct  10    RCRKIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDIAEIREHFYTRKRAEPHRV  69

Query  335   LDEIRSDKDP---------------------------DDPEGQSGDRFLSPNETFSLGPK  433
             L E+++ +                             D+ E +  D+    N+ +SLGPK
Sbjct  70    LVEVQTGESSSGGGDGGGGGSEGSNNYETFDINKIFVDEGEEEKPDQ----NKPYSLGPK  125

Query  434   ITGWDEQRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYC  610
             I+ WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYC
Sbjct  126   ISDWDEQRSEWLKKNPNFPNFLGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYC  185

Query  611   RIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLS  790
             R+HGIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  
Sbjct  186   RLHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWE  245

Query  791   KYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGK  970
             +Y  +NLV+HG+ ++++DQK+W  L+TGSFL+RNCQWALDLLD WAPMGPKG IREE+GK
Sbjct  246   RYKDYNLVMHGWNEMVYDQKNWIGLNTGSFLLRNCQWALDLLDTWAPMGPKGKIREEAGK  305

Query  971   TLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEK  1150
              LT  LK RP FEADDQSA++YLL ++++ W +KV+LE++YYLHGYW  LVDRYEE+++ 
Sbjct  306   LLTRELKDRPVFEADDQSAMVYLLATQRETWGNKVYLESAYYLHGYWGILVDRYEEMIDN  365

Query  1151  YHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLL  1330
             YHPG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L 
Sbjct  366   YHPGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLA  425

Query  1331  SPNIKRIRNETTLPLPNVDRYDFRH  1405
             S  +KR+RNET+ PL   D     H
Sbjct  426   SRRVKRVRNETSNPLDVKDELGLLH  450



>ref|XP_009134428.1| PREDICTED: putative glycosyltransferase 2 [Brassica rapa]
Length=463

 Score =   498 bits (1282),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 249/444 (56%), Positives = 313/444 (70%), Gaps = 37/444 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID----ETNR  331
             R R+I R   ++K+T+LC  +T++VLRGTIG G   + +    E+   F       E +R
Sbjct  10    RCRRIQRALRHLKVTVLCLVLTVVVLRGTIGAGKFGTPEQDLDEIRQHFQTSRKRAEPHR  69

Query  332   ILDEIRSDKDP-------------------------DDPEGQSGDRFLSPNETFSLGPKI  436
             +L+EI+S                             D+ E +  D    PN+ ++LGPKI
Sbjct  70    VLEEIQSGGGGGGDSGDGGGAGSNNYETFDINKIFVDEGEEEKPD----PNKPYTLGPKI  125

Query  437   TGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCR  613
             + WDEQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR
Sbjct  126   SDWDEQRSDWLGKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCR  185

Query  614   IHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSK  793
             +HGIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  +
Sbjct  186   LHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWER  245

Query  794   YDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKT  973
             Y  +NLV+HG+ ++++D K+W  L+TGSFL+RN QWALDLL  WAPMGPKG IREE+GK 
Sbjct  246   YKDYNLVMHGWNEMVYDDKNWIGLNTGSFLLRNNQWALDLLHTWAPMGPKGKIREEAGKV  305

Query  974   LTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKY  1153
             LT  LKGRP FEADDQSA++YLL +++D W +KV+LEN YYLHGYW  LVDRYEE++E Y
Sbjct  306   LTRELKGRPVFEADDQSAMVYLLATQRDTWGNKVYLENGYYLHGYWGILVDRYEEMIENY  365

Query  1154  HPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLS  1333
             HPG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S
Sbjct  366   HPGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLAS  425

Query  1334  PNIKRIRNETTLPLPNVDRYDFRH  1405
               +KR+RNET+ PL   D     H
Sbjct  426   RKVKRVRNETSNPLEMKDELGLLH  449



>ref|XP_004978367.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=500

 Score =   499 bits (1285),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 235/438 (54%), Positives = 307/438 (70%), Gaps = 36/438 (8%)
 Frame = +2

Query  170   PRGRQ---ISRTFNNIKITILCGFVTILVLRGTIGVGN----LASSDAEVENSFLIDETN  328
             PRGR      RT NNI+ T+LC FVT LVLRGT+GV      +A SD     +   ++  
Sbjct  13    PRGRSSKLTQRTINNIRFTLLCAFVTFLVLRGTVGVNRRLVYIAGSDRAPPGAKAAEDIE  72

Query  329   RILDEIRS--------------DKDPDDPEGQSGDRFLS-PNETFSLGPKITGWDEQRKV  463
             RI  +IR+              +  P  P  +  D   +     +SLGP++T W+ +R+ 
Sbjct  73    RIFRDIRADSDPDPDPEPNDDGNTSPSTPATRYYDHGSAWSTANYSLGPRVTRWNARRRR  132

Query  464   WFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYN  640
             W   +P FPS   +G PRVLLVT SPP PC++P GDH+LL+  KNKIDYCRIHGIE+ + 
Sbjct  133   WLHLNPGFPSRDARGNPRVLLVTASPPGPCDDPAGDHFLLRATKNKIDYCRIHGIELAHI  192

Query  641   SANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIH  820
             +A +D ++ G WAKLPL+RRLML+HPE+EW+WW+D DA  TDM FE+PL++Y+  +LV+H
Sbjct  193   TARLDGQLTGGWAKLPLLRRLMLAHPEVEWLWWVDGDALVTDMGFELPLARYEGAHLVVH  252

Query  821   GYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRP  1000
             G   LLF  +SW A+STGSFLIRNCQW+L+LLD WA MGP+G  R ++GK LTA L  RP
Sbjct  253   GNSYLLFQLRSWVAVSTGSFLIRNCQWSLELLDAWAVMGPRGRARNDAGKLLTATLHRRP  312

Query  1001  EFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERW  1180
              FEADDQSALI+LL++EK++WM+KV+LEN YYLHG+W+GLVDRYE+ MEK+HPG+GD+RW
Sbjct  313   AFEADDQSALIHLLITEKERWMEKVYLENEYYLHGHWSGLVDRYEQAMEKHHPGYGDDRW  372

Query  1181  PFVTHFVGCKACG-------------SSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             PFVTHFVGCK CG             SS ++P+++CV+ MERAFNFADNQVL LYGF+H 
Sbjct  373   PFVTHFVGCKPCGVGGVGRSVRSGGNSSDEYPLDRCVRGMERAFNFADNQVLRLYGFRHE  432

Query  1322  GLLSPNIKRIRNETTLPL  1375
              L S  ++R+ N +  PL
Sbjct  433   SLASAEVRRVTNRSANPL  450



>ref|XP_010666578.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Beta vulgaris subsp. 
vulgaris]
Length=452

 Score =   496 bits (1278),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 239/435 (55%), Positives = 316/435 (73%), Gaps = 24/435 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLAS--SDAEVENSFLID------ETN  328
             R  QI R+F+ +K+TILC  +T++++R  +G G   +   D ++ +S L           
Sbjct  10    RVAQIQRSFHKMKVTILCLLLTLIMIRSMLGAGEYGTPKQDFDLLHSSLASAGSHHTHNR  69

Query  329   RILDEIR-SDKDPDDPEGQSGDRF--------------LSPNETFSLGPKITGWDEQRKV  463
             RIL+E++ +D    +    S + F              + PN+ +SLGPKI+ WDEQR+ 
Sbjct  70    RILEEVKDADDKKSNTNSNSYESFDISKILVDDEPAEKIDPNKPYSLGPKISDWDEQRRE  129

Query  464   WFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYN  640
             W +++  FP+ V+  KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHGIEI YN
Sbjct  130   WLEKNKEFPNFVQPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRIHGIEIFYN  189

Query  641   SANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIH  820
              A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDM FE+P  +Y  +N+V+H
Sbjct  190   LALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPWERYKDYNMVMH  249

Query  821   GYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRP  1000
             G+ ++++D+K+W  L+TGSFL+RN QW+LD+LD WAPMGPKG +R+E+GK LT  LKGRP
Sbjct  250   GWNEMIYDEKNWIGLNTGSFLLRNNQWSLDMLDTWAPMGPKGKVRDEAGKILTRELKGRP  309

Query  1001  EFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERW  1180
              FEADDQSA++Y+L +++++W +KV+LEN YYLHGYW  LVD YEE++EKY PGFGD RW
Sbjct  310   VFEADDQSAMVYILATQREKWGNKVYLENHYYLHGYWGILVDSYEEMIEKYRPGFGDHRW  369

Query  1181  PFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNE  1360
             P VTHFVGCK CG  GD+PVE+C+K M+RA+NF DNQVL +YGF H+ L S  + +IRNE
Sbjct  370   PLVTHFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQVLQMYGFSHKSLASRKVVKIRNE  429

Query  1361  TTLPLPNVDRYDFRH  1405
             T+ PL   D     H
Sbjct  430   TSNPLEVKDELGLLH  444



>ref|XP_009780568.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Nicotiana 
sylvestris]
Length=466

 Score =   497 bits (1280),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 238/450 (53%), Positives = 309/450 (69%), Gaps = 44/450 (10%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSF-----------  310
             R  Q+ R   N K+T LC F+TI+VLRG +G G   +      E+ ++F           
Sbjct  10    RAWQVRRIVRNGKLTFLCLFLTIVVLRGNLGAGKFGTPGQDLKEIRDTFSYVRKRVEPRR  69

Query  311   LIDETNRI------------------------LDEIRSDKDPDDPEGQSGDRFLSPNETF  418
             +++E  ++                        L +I  D+D  +PE +       PNE +
Sbjct  70    VLEEAQQVDTATEGGGGATATSSDSNNYATFDLKKILVDEDDGEPEFKR-----DPNEPY  124

Query  419   SLGPKITGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKN  595
             +LGPKI+ WDEQR  W  ++  FP+ V   KPRVLLVTGS P PCENP+GDHYLLK +KN
Sbjct  125   NLGPKISDWDEQRAEWLKKNLNFPNFVGPNKPRVLLVTGSSPKPCENPIGDHYLLKSIKN  184

Query  596   KIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAF  775
             KIDYCR+HGIEI YN A +D EM G WAKLPL+R+++LSHPE+E+IWWMDSDA FTDMAF
Sbjct  185   KIDYCRLHGIEIFYNMALLDAEMSGFWAKLPLLRKILLSHPEVEFIWWMDSDAMFTDMAF  244

Query  776   EIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIR  955
             E+P  +Y   +LV+HG+ D+++++K+W  L+TGSFL+RN QWALDLLD  APMGPKG IR
Sbjct  245   ELPWERYKDVDLVMHGWNDMVYNEKNWIGLNTGSFLLRNTQWALDLLDTLAPMGPKGKIR  304

Query  956   EESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYE  1135
             +E+G  LT  LKGRP FEADDQSA++Y+L ++K++W DKV+LE++YYLHGYW  LVD+YE
Sbjct  305   DEAGAVLTRELKGRPVFEADDQSAMVYILATQKEKWGDKVYLESAYYLHGYWGILVDKYE  364

Query  1136  EVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFK  1315
             E++E YHPG GD RWP VTHFVGCK C   GD+ VE+C+K M+RAFNF DNQ+L +YGF 
Sbjct  365   EMIENYHPGLGDHRWPLVTHFVGCKPCAKFGDYSVERCLKQMDRAFNFGDNQILQMYGFT  424

Query  1316  HRGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             H+ L S  +KR RNET+ PL   D     H
Sbjct  425   HKSLGSRRVKRTRNETSNPLEVNDELGLLH  454



>emb|CDX93965.1| BnaC04g21240D [Brassica napus]
Length=458

 Score =   496 bits (1277),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 244/437 (56%), Positives = 316/437 (72%), Gaps = 26/437 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R R++ R +   K+T+LC  +T++VLRGTIG G   + + ++E        S    ET+R
Sbjct  10    RLRRLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFYSRKRAETHR  69

Query  332   ILDEIRSDKDPDDPEGQS----------------GD--RFLSPNETFSLGPKITGWDEQR  457
             +L E+ S K     +G                  GD  + L  ++ +SLGPKI+ WDEQR
Sbjct  70    VLVELSSSKTTSTKDGAGTSNNNYETFDFKKIFEGDEEKALDRSKPYSLGPKISDWDEQR  129

Query  458   KVWFDRHPRFPS-SVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIV  634
             + W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHGIEI 
Sbjct  130   RDWLKQNPSFPNFAAANKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRIHGIEIF  189

Query  635   YNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLV  814
             YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDM FE+P  +Y+ +NLV
Sbjct  190   YNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPWERYEDYNLV  249

Query  815   IHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKG  994
             +HG++++++DQK+W  L+TGSFLIRN QWALDLLD WAPMGPKG IREE+GK LT  LK 
Sbjct  250   MHGWKEMVYDQKNWIGLNTGSFLIRNSQWALDLLDAWAPMGPKGRIREEAGKVLTRELKD  309

Query  995   RPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDE  1174
             RP FEADDQSA++YLL +E+++W  KV+LE+ YYLHGYW  LVDRYEE++E + PGFGD 
Sbjct  310   RPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILVDRYEEMIENHKPGFGDH  369

Query  1175  RWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIR  1354
             RWP VTHFVGCK CG  GD+PVE+C++ M+RAFNF DNQ+L +YGF H+ L S ++K  R
Sbjct  370   RWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILQMYGFTHKSLGSRSVKPTR  429

Query  1355  NETTLPLPNVDRYDFRH  1405
             ++T +P+   D +   H
Sbjct  430   SQTDMPVDAKDEFGLLH  446



>ref|XP_002974473.1| xyloglucan xylosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ24695.1| xyloglucan xylosyltransferase-like protein [Selaginella moellendorffii]
Length=436

 Score =   495 bits (1274),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 240/415 (58%), Positives = 308/415 (74%), Gaps = 13/415 (3%)
 Frame = +2

Query  179   RQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN------SFLIDETNRILD  340
             R++ RTF+N+K+ ++CG +TILVLRGTIG G   +   ++            +  +R+L 
Sbjct  20    RRLQRTFHNVKLMVMCGMITILVLRGTIGAGKFGTPAQDLREIREHLPRRHKEAASRVLA  79

Query  341   EIRSD--KDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPR  514
             E      K P D E +  +   + +  +SLGPKI+ W+EQR  W   +     +   K  
Sbjct  80    EAHESRKKAPGDREEREEEERSAGSSPYSLGPKISDWNEQRSQWLLENRAGGGAATSK--  137

Query  515   VLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLI  694
             +LLVTGS P PC+NPVGDHYLLK +KNKIDYCRIHGIEI YN A++D EM G WAKLPL+
Sbjct  138   ILLVTGSQPNPCDNPVGDHYLLKSLKNKIDYCRIHGIEIFYNMAHLDSEMAGYWAKLPLL  197

Query  695   RRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTG  874
             R+L+LSHP++EW+WWMDSDA FTDM+F IPL KY +HN+V+HG+ +L++ +K+W  L+TG
Sbjct  198   RKLLLSHPDVEWLWWMDSDAMFTDMSFAIPLDKYANHNMVLHGWDELVYAKKNWIGLNTG  257

Query  875   SFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEK  1054
             SFL+RNCQW+LDLLD WAPMGPKG IRE++GK LT  L GRPEFEADDQSAL+YLL +++
Sbjct  258   SFLLRNCQWSLDLLDAWAPMGPKGKIREDAGKILTRELVGRPEFEADDQSALVYLLATQR  317

Query  1055  DQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDF  1234
              QW D VFLE+SYYLHGYWA LVD+YEE++ K HPG GD+RWP VTHFVGCK CGS GD+
Sbjct  318   SQWGDGVFLESSYYLHGYWAILVDKYEEMIAKNHPGLGDDRWPLVTHFVGCKPCGSYGDY  377

Query  1235  PVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLP---LPNVDR  1390
             PVE+C++ MERAFNF DNQ+L  YGF+HR L S  +KR RN+T  P   LP++ R
Sbjct  378   PVEQCLREMERAFNFGDNQILGGYGFQHRRLESARVKRTRNDTARPLDDLPSISR  432



>ref|XP_001772519.1| predicted protein [Physcomitrella patens]
 gb|EDQ62695.1| predicted protein [Physcomitrella patens]
Length=438

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 230/413 (56%), Positives = 306/413 (74%), Gaps = 15/413 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLAS--SDAEVENSFLIDETN-----R  331
             +GR++ R+ NN+KIT+LCG +TILVLRGTIG GN  +   D E   + L   T      R
Sbjct  15    KGRRLQRSINNMKITVLCGLMTILVLRGTIGAGNFGTPAQDFEEIKAHLRSATREYHAAR  74

Query  332   IL----DEIRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSV  499
             +L    +++ +D    D   +     ++P   + LGPKI+ WD+QRK W   + +   S 
Sbjct  75    VLTQVDEKVSADGASSDDIEEVRSNLMTP---YRLGPKISDWDDQRKQWLSENSQTSISW  131

Query  500   KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWA  679
             +G+PRVLLVTGS P+ CEN  GD++LLK VKNK+DY R+H IE+ YN A++D+EM G WA
Sbjct  132   QGRPRVLLVTGSQPSSCENSEGDNFLLKSVKNKLDYARLHDIELFYNMAHLDQEMIGFWA  191

Query  680   KLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWT  859
             KLPL+R+LML++P +EWIWWMDSDA FTDM+FE+PL KY+++NLV+HG+ D ++ QK WT
Sbjct  192   KLPLLRKLMLTNPAVEWIWWMDSDALFTDMSFEVPLEKYENYNLVLHGFDDKVYQQKLWT  251

Query  860   ALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYL  1039
              L+TGSF IRNCQWALDLLD WAPMGPKG IR ++G+ L+ +L GR  FEADDQSAL+YL
Sbjct  252   GLNTGSFFIRNCQWALDLLDAWAPMGPKGVIRNQAGEMLSKSLTGRANFEADDQSALVYL  311

Query  1040  LMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKAC-  1216
             L++++ +W +KV LE S+YLHGYW  LV +YEE M K HPGFGD+RWPF+THFVGCK C 
Sbjct  312   LITQRLEWANKVMLEKSFYLHGYWVDLVGKYEENMAKSHPGFGDDRWPFITHFVGCKPCL  371

Query  1217  GSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
              + GD+ V+ C K MERAF FADNQ+L++ GF+HR L SP I R+R++++ PL
Sbjct  372   KNGGDYSVDTCFKQMERAFTFADNQILDVLGFRHRKLGSPRIVRVRDDSSHPL  424



>ref|XP_002990826.1| xyloglucan xylosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ08099.1| xyloglucan xylosyltransferase-like protein [Selaginella moellendorffii]
Length=437

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 239/416 (57%), Positives = 309/416 (74%), Gaps = 14/416 (3%)
 Frame = +2

Query  179   RQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN------SFLIDETNRILD  340
             R++ RTF+N+K+ ++CG +TILVLRGTIG G   +   ++            +  +R+L 
Sbjct  20    RRLQRTFHNVKLMVMCGMITILVLRGTIGAGKFGTPAQDLREIREHLPRRHKEAASRVLA  79

Query  341   EIRSD--KDPDDPEGQSGDRFLSPNET-FSLGPKITGWDEQRKVWFDRHPRFPSSVKGKP  511
             E      K P D E +  +   S   + +SLGPKI+ W+EQR  W  ++    ++   K 
Sbjct  80    EAHESRKKAPGDREEREEEEERSAGSSPYSLGPKISDWNEQRSQWLLKNRAGGAAATSK-  138

Query  512   RVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPL  691
              +LLVTGS P PC+NPVGDHYLLK +KNKIDYCRIHGIEI YN A++D EM G WAKLPL
Sbjct  139   -ILLVTGSQPNPCDNPVGDHYLLKSLKNKIDYCRIHGIEIFYNMAHLDSEMAGYWAKLPL  197

Query  692   IRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALST  871
             +R L+LSHP++EW+WWMDSDA FTDM+F IPL KY +HN+++HG+ +L++ +K+W  L+T
Sbjct  198   LRNLLLSHPDVEWLWWMDSDAMFTDMSFAIPLDKYANHNMILHGWDELVYAKKNWIGLNT  257

Query  872   GSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSE  1051
             GSFL+RNCQW+LDLLD WAPMGPKG IRE++GK LT  L GRPEFEADDQSAL+YLL ++
Sbjct  258   GSFLLRNCQWSLDLLDAWAPMGPKGKIREDAGKILTRELVGRPEFEADDQSALVYLLATQ  317

Query  1052  KDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGD  1231
             + +W D VFLE+SYYLHGYWA LVD+YEE++ K HPG GD+RWP VTHFVGCK CGS GD
Sbjct  318   RSKWGDGVFLESSYYLHGYWAILVDKYEEMIAKNHPGLGDDRWPLVTHFVGCKPCGSYGD  377

Query  1232  FPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLP---LPNVDR  1390
             +PVE+C++ MERAFNF DNQ+L  YGF+HR L S  +KR RN+T  P   LP++ R
Sbjct  378   YPVEQCLREMERAFNFGDNQILGGYGFQHRRLESARVKRTRNDTARPLDDLPSISR  433



>emb|CAI11451.1| alpha-1,6-xylosyltransferase [Gossypium raimondii]
Length=413

 Score =   491 bits (1265),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 223/358 (62%), Positives = 277/358 (77%), Gaps = 8/358 (2%)
 Frame = +2

Query  335   LDEIRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSV-KGKP  511
             +++I  D++PD P+         PN  +SLGP+I+ WDEQR  W   +P +P+ +   KP
Sbjct  52    INKILIDEEPDVPK-------RDPNAPYSLGPRISDWDEQRSRWLQENPNYPNFIGPNKP  104

Query  512   RVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPL  691
             RVLLVTGS P PCENPVGDHYLLK +KNKIDYCR+HGIEI YN A +D EM G WAKLPL
Sbjct  105   RVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHGIEIFYNMALLDAEMAGFWAKLPL  164

Query  692   IRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALST  871
             IR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   N V+HG+ ++++DQK+W  L+T
Sbjct  165   IRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDSNFVMHGWNEMVYDQKNWIGLNT  224

Query  872   GSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSE  1051
             GSFL+RN QWALD+LD WAPMGPKG IREE+GK LT  LK RP FEADDQSA++YLL ++
Sbjct  225   GSFLLRNGQWALDILDAWAPMGPKGKIREEAGKVLTRELKNRPVFEADDQSAMVYLLATQ  284

Query  1052  KDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGD  1231
             +++W DKV+LENSYYLHGYW  LVDRYEE++E YHPG GD RWP VTHFVGCK CG  GD
Sbjct  285   REKWGDKVYLENSYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFVGCKPCGKFGD  344

Query  1232  FPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             + VE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KR+RNET+ PL   D     H
Sbjct  345   YSVERCLKQMDRAFNFGDNQILQIYGFTHKSLASRRVKRVRNETSNPLEVKDELGLLH  402



>gb|EYU45549.1| hypothetical protein MIMGU_mgv1a027105mg [Erythranthe guttata]
Length=460

 Score =   492 bits (1267),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 238/445 (53%), Positives = 311/445 (70%), Gaps = 36/445 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVE-----NSFLI--DETNR  331
             R RQ  R  +N KIT+LC F+T++ LR  +G G   + + +++     +S++    E  R
Sbjct  10    RSRQFHRLASNGKITLLCLFLTVVTLREDLGAGKSGTPEKDLDEIRDTSSYIRRRAEPRR  69

Query  332   ILDEI------RSDKD------------------PDDPEGQSGDRFL-SPNETFSLGPKI  436
             +L+++      R  KD                   DD +G   D F   P++ +SLGPKI
Sbjct  70    VLEDVPVTTQGRRSKDTYVSGSNSYADFDITKILKDDDDGV--DEFQRDPSQPYSLGPKI  127

Query  437   TGWDEQRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCR  613
             + WD QR  W  ++P  P+ + + KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR
Sbjct  128   SNWDSQRSQWLKKNPNSPNFIAENKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCR  187

Query  614   IHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSK  793
             +HGIEI YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +
Sbjct  188   LHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWER  247

Query  794   YDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKT  973
             Y  HN V+HG+  ++++ K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG IREE+G+ 
Sbjct  248   YKDHNFVMHGWNHMVYEHKNWIGLNTGSFLLRNCQWSLDILDTWAPMGPKGKIREEAGEI  307

Query  974   LTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKY  1153
             LT  LK RP FEADDQSA++Y+L ++K++W DKV+LEN Y+LHGYW  LVD++EE++E Y
Sbjct  308   LTRELKDRPVFEADDQSAMVYILATQKEKWGDKVYLENWYFLHGYWGILVDKFEEMIENY  367

Query  1154  HPGFGDERWPFVTHFVGCKACGSSGD-FPVEKCVKSMERAFNFADNQVLNLYGFKHRGLL  1330
             HPG GD RWP VTHFVGCK CG   D + VEKC+K M+RAFNF DNQ+L +YGF H+ L 
Sbjct  368   HPGLGDHRWPLVTHFVGCKPCGKFKDYYSVEKCLKQMDRAFNFGDNQILQMYGFTHKSLE  427

Query  1331  SPNIKRIRNETTLPLPNVDRYDFRH  1405
             S  +KR+RNET+ P    D     H
Sbjct  428   SKRVKRVRNETSNPREVRDELGLLH  452



>ref|XP_009116931.1| PREDICTED: xyloglucan 6-xylosyltransferase [Brassica rapa]
Length=456

 Score =   491 bits (1263),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 244/437 (56%), Positives = 311/437 (71%), Gaps = 26/437 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R R++ R +   K+T+LC  +T++VLRGTIG G   + + ++E        S    E +R
Sbjct  10    RCRKLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFYSRKRAEPHR  69

Query  332   ILDEIRSDKDPDDPEGQS---------------GDRFLSP---NETFSLGPKITGWDEQR  457
             +L EI S+      +G                 GD   S    N+ +SLGPKI+ WDEQR
Sbjct  70    VLVEISSETTSSTGDGNGNNYETFDFNKIFVDEGDEEKSEENRNKPYSLGPKISDWDEQR  129

Query  458   KVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIV  634
             + W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHGIEI 
Sbjct  130   RDWLKQNPSFPNFVAPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRIHGIEIF  189

Query  635   YNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLV  814
             YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDM FE+P  +Y+ +NLV
Sbjct  190   YNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPWERYEDYNLV  249

Query  815   IHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKG  994
             +HG+ +++++QK+W  L+TGSFL+RN QWALDLLD WAPMGPKG +REE+GK LT  LK 
Sbjct  250   MHGWNEMVYEQKNWIGLNTGSFLLRNSQWALDLLDAWAPMGPKGKVREEAGKVLTRELKD  309

Query  995   RPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDE  1174
             RP FEADDQSA++YLL +E+++W  KV+LE+ YYLHGYW  LVDRYEE++E + PGFGD 
Sbjct  310   RPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILVDRYEEMIESHKPGFGDH  369

Query  1175  RWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIR  1354
             RWP VTHFVGCK CG  GD+PVE+C++ M+RAFNF DNQ+L +YGF H+ L S  +K  R
Sbjct  370   RWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILQMYGFTHKSLGSRRVKPTR  429

Query  1355  NETTLPLPNVDRYDFRH  1405
             N+T  PL   D +   H
Sbjct  430   NQTDRPLDAKDEFGLLH  446



>gb|EYU43946.1| hypothetical protein MIMGU_mgv1a027073mg [Erythranthe guttata]
Length=462

 Score =   490 bits (1262),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 228/414 (55%), Positives = 298/414 (72%), Gaps = 22/414 (5%)
 Frame = +2

Query  182   QISRTFNNIKIT-----ILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEI  346
             +I  TF+ I+       +L    T +  +   G  N  +S AE + + ++ +    ++E 
Sbjct  53    EIRETFSYIRRRAEPRRVLEEATTAVEQKSGGGTDNGGNSYAEFDITKVLKDEEDGVEEF  112

Query  347   RSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVK-GKPRVLL  523
             + D                P++ ++LGPKI+ WD+QR  W   +P +P+ +   KPRVLL
Sbjct  113   KRD----------------PSQPYALGPKISDWDQQRSEWLTNNPNYPNFITDKKPRVLL  156

Query  524   VTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRL  703
             VTGS P PCENPVGDHYLLK +KNKIDYCR+H I+I YN A +D EM G WAKLPLIR+L
Sbjct  157   VTGSSPKPCENPVGDHYLLKSIKNKIDYCRLHSIDIFYNMALLDAEMAGFWAKLPLIRKL  216

Query  704   MLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFL  883
             +LSHPEIE++WWMDSDA FTDMAFE+P  +Y  HNLV+HG+ ++++D+K+W  L+TGSFL
Sbjct  217   LLSHPEIEFLWWMDSDAMFTDMAFEVPWERYKDHNLVMHGWNEMIYDEKNWIGLNTGSFL  276

Query  884   IRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQW  1063
             +RNCQW+LD+LD WAPMGPK  IREE+GK LT  LKGRP FEADDQSA++Y+L ++K++W
Sbjct  277   LRNCQWSLDMLDTWAPMGPKVKIREEAGKLLTRELKGRPTFEADDQSAMVYILATQKEKW  336

Query  1064  MDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVE  1243
              DKV+LEN YYLHGYW  LVD+YE+++E YHPGFGD RWP VTHFVGCK CG  GD+PVE
Sbjct  337   GDKVYLENHYYLHGYWGILVDKYEDMIESYHPGFGDHRWPLVTHFVGCKPCGKFGDYPVE  396

Query  1244  KCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             +C+K M+RAFNF DNQ+L +YGF H+ L S  +KR+RNET+ PL   D     H
Sbjct  397   RCLKQMDRAFNFGDNQILQMYGFTHKSLGSRRVKRVRNETSNPLEVRDELGLLH  450



>ref|XP_011000519.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Populus euphratica]
Length=434

 Score =   487 bits (1254),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 228/423 (54%), Positives = 296/423 (70%), Gaps = 28/423 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVG--------------NLASSDAEVENSF  310
             R     R   + K+T+LC F+T +VL GTIG G              N  SS    E   
Sbjct  10    RDHPFQRPMCHAKVTLLCLFMTAIVLLGTIGAGKFGTQEQHVNYLRNNFYSSRKRAEPQK  69

Query  311   LIDETNRILDEIRSDKDPDDPEGQSG-------------DRFLSPNETFSLGPKITGWDE  451
             ++ E  R      ++   DDP   +              D     ++ +SLGPKI+ WD+
Sbjct  70    VVTELTRNNSRNDTNTKSDDPNSYASFDINKLLVDEGEDDENPDSDKPYSLGPKISDWDQ  129

Query  452   QRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             +R  W   +P+FP+ V   KPRVLLVTGS P PCEN VGDHYLLK +KNKIDYCR+HGI+
Sbjct  130   KRAKWLGENPKFPNFVGPDKPRVLLVTGSSPKPCENRVGDHYLLKSIKNKIDYCRLHGID  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L++S PE+E++WWMDSDA FTDMAFE+P  KY  +N
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRKLLVSQPEVEFLWWMDSDAMFTDMAFEVPWEKYKDYN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
             LV+HG++++++DQ++W  L+TGSF IRNCQW+LDLLD WAPMGPKG IR+E+GK L   L
Sbjct  250   LVMHGWKEMVYDQRNWIGLNTGSFFIRNCQWSLDLLDAWAPMGPKGKIRDEAGKLLAKEL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             KGRP FEADDQSA++YLL +++D+W DKV+LEN+YYLHGYW  LVDRYEE++EKYH G G
Sbjct  310   KGRPVFEADDQSAMVYLLATQRDKWADKVYLENAYYLHGYWEILVDRYEEMIEKYHAGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D+RWP VTHFVGCK CG +GD+PVE+C+K M+RAFNF D+Q+L +YG+ H  L +  +++
Sbjct  370   DDRWPLVTHFVGCKPCGKAGDYPVERCLKQMDRAFNFGDDQILQIYGYTHTSLAAWRVRK  429

Query  1349  IRN  1357
               N
Sbjct  430   SSN  432



>ref|XP_009138722.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Brassica rapa]
Length=459

 Score =   487 bits (1254),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 245/441 (56%), Positives = 313/441 (71%), Gaps = 30/441 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R R++ R +   K+T+LC  +T++VLRGTIG G   + + ++E        S    ET+R
Sbjct  10    RLRRLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFYSRKRAETHR  69

Query  332   ILDEIRSDK--------------------DPDDPEGQSGD--RFLSPNETFSLGPKITGW  445
             +L E+ S                      D        GD  + L  ++ +SLGPKI+ W
Sbjct  70    VLVELSSSSKTTSSSAAGNSNNNNNYETFDFKKIFADEGDEEKALDRSKPYSLGPKISDW  129

Query  446   DEQRKVWFDRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHG  622
             DEQR+ W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHG
Sbjct  130   DEQRRDWLKQNPSFPNFVAANKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRIHG  189

Query  623   IEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDS  802
             IEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDM FE+P  +Y+ 
Sbjct  190   IEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPWERYED  249

Query  803   HNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTA  982
             +NLV+HG++++++DQKSW  L+TGSFLIRN QWALDLLD WAPMGPKG IREE+GK LT 
Sbjct  250   YNLVMHGWKEMVYDQKSWIGLNTGSFLIRNSQWALDLLDAWAPMGPKGKIREEAGKVLTR  309

Query  983   NLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPG  1162
              LK RP FEADDQSA++YLL +E+++W  KV+LE+ YYLHGYW  LVDRYEE++E + PG
Sbjct  310   ELKDRPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILVDRYEEMIENHKPG  369

Query  1163  FGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNI  1342
             FGD RWP VTHFVGCK CG  GD+PVE+C++ M+RAFNF DNQ+L +YGF H+ L S ++
Sbjct  370   FGDHRWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILQMYGFTHKSLGSRSV  429

Query  1343  KRIRNETTLPLPNVDRYDFRH  1405
             K  R++T  P+   D +   H
Sbjct  430   KPTRSQTGRPVDVKDEFGLLH  450



>ref|XP_004984900.1| PREDICTED: putative glycosyltransferase 2-like [Setaria italica]
Length=451

 Score =   486 bits (1252),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 238/437 (54%), Positives = 303/437 (69%), Gaps = 32/437 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEV--ENSFLIDETNRILDEI  346
             R RQI R   N K+T++C  +T++VLRGT+G G   +   ++       +   +R L E 
Sbjct  11    RMRQIQRFARNAKLTVVCLLLTVVVLRGTVGAGRFGTPQQDLIELRQHFVSHPHRALAEH  70

Query  347   -----------------------RSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQR  457
                                    R D +PD P     D        ++LGPKI+ WDEQR
Sbjct  71    HDARSRASTTTTTTSSSSSSSSGRGDDEPDPPPRTLRD------PPYTLGPKISDWDEQR  124

Query  458   KVWFDRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIV  634
               W  RHP  P  +   KPRVLLV+GS P PCENPVGDHYLLK +KNKIDYCR+HG+EI 
Sbjct  125   ANWHRRHPETPPFLNDVKPRVLLVSGSSPKPCENPVGDHYLLKSIKNKIDYCRVHGLEIF  184

Query  635   YNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLV  814
             YN A +D EM G WAKLPL+R L+L+HPE+E+IWWMDSDA FTDMAFE+P  +Y  +NL+
Sbjct  185   YNMALLDAEMAGFWAKLPLMRALLLAHPEVEFIWWMDSDAMFTDMAFELPWERYGPYNLI  244

Query  815   IHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKG  994
             +HG+ ++++D K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKGP+R E+GK LT +LK 
Sbjct  245   MHGWDEMIYDDKNWIGLNTGSFLLRNCQWSLDMLDTWAPMGPKGPVRIEAGKVLTKSLKD  304

Query  995   RPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDE  1174
             RP FEADDQSA++Y+L +++++W DKV+LEN YYLHGYW  LVDRYEE++E Y PG GD 
Sbjct  305   RPVFEADDQSAMVYILATQREKWGDKVYLENGYYLHGYWGILVDRYEEMLENYKPGLGDH  364

Query  1175  RWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIR  1354
             RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L S  +KRIR
Sbjct  365   RWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQMYGFTHKSLASRRVKRIR  424

Query  1355  NETTLPLPNVDRYDFRH  1405
             NET+ PL   D     H
Sbjct  425   NETSNPLEMKDELGLLH  441



>gb|AFW88652.1| glycosyltransferase 5 [Zea mays]
Length=448

 Score =   486 bits (1250),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 235/434 (54%), Positives = 303/434 (70%), Gaps = 29/434 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEV--ENSFLIDETNRILDEI  346
             R RQI R   N K+T++C  +T++VLRGT+G G   +   ++       +   +R L E 
Sbjct  11    RMRQIQRFARNAKLTVVCLLLTVVVLRGTVGAGRFGTPQQDLIELRQHFVSHPHRALAEH  70

Query  347   RSDK--------------------DPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVW  466
                +                    +PD P     D        ++LGPKI+ WDEQR  W
Sbjct  71    HDARSRASTTTTSSSSSSSSGRRDEPDPPPRSLRD------PPYTLGPKISDWDEQRAAW  124

Query  467   FDRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNS  643
               RHP  P  +   KPRVLLVTGS P PCENPVGDHYLLK +KNK+DYCR+HGIE+ YN 
Sbjct  125   HRRHPETPPFLNDIKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKMDYCRVHGIEVFYNM  184

Query  644   ANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHG  823
             A +D EM G WAKLPL+R L+L+HPE+E++WWMDSDA FTDMAFE+P  +Y  +NL++HG
Sbjct  185   ALLDAEMAGFWAKLPLMRALLLAHPEVEFLWWMDSDAMFTDMAFELPWERYGPYNLIMHG  244

Query  824   YQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPE  1003
             + ++++D K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKGP+R E+GK LT +LK RP 
Sbjct  245   WDEMVYDDKNWIGLNTGSFLLRNCQWSLDMLDTWAPMGPKGPVRIEAGKVLTKSLKDRPV  304

Query  1004  FEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWP  1183
             FEADDQSA++Y+L +++++W DKV+LEN YYLHGYW  LVDRYEE++E Y PG GD RWP
Sbjct  305   FEADDQSAMVYILATQREKWGDKVYLENGYYLHGYWGILVDRYEEMLENYKPGLGDHRWP  364

Query  1184  FVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNET  1363
              VTHFVGCK CG  GD+PVE+C+K+M+RAFNF DNQ+L +YGF H+ L S  +KRIRNET
Sbjct  365   LVTHFVGCKPCGKFGDYPVERCLKNMDRAFNFGDNQILQMYGFTHKSLASRRVKRIRNET  424

Query  1364  TLPLPNVDRYDFRH  1405
             + PL   D     H
Sbjct  425   SNPLETKDELGLLH  438



>ref|NP_001150077.1| glycosyltransferase 5 [Zea mays]
 gb|ACG37718.1| glycosyltransferase 5 [Zea mays]
Length=450

 Score =   485 bits (1248),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 235/436 (54%), Positives = 303/436 (69%), Gaps = 31/436 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN--SFLIDETNRILDEI  346
             R RQI R   N K+T++C  +T++VLRGT+G G   +   ++       +   +R L E 
Sbjct  11    RMRQIQRFARNAKLTVVCLLLTVVVLRGTVGAGRFGTPQQDLIKLRQHFVSHPHRALAEH  70

Query  347   RSDK----------------------DPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRK  460
                +                      +PD P     D        ++LGPKI+ WDEQR 
Sbjct  71    HDARSRASTTTTSSSSSSSSSSGRRDEPDPPPRSLRD------PPYTLGPKISDWDEQRA  124

Query  461   VWFDRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVY  637
              W  RHP  P  +   KPRVLLVTGS P PCENPVGDHYLLK +KNK+DYCR+HGIE+ Y
Sbjct  125   AWHRRHPETPPFLNDIKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKMDYCRVHGIEVFY  184

Query  638   NSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVI  817
             N A +D EM G WAKLPL+R L+L+HPE+E++WWMDSDA FTDMAFE+P  +Y  +NL++
Sbjct  185   NMALLDAEMAGFWAKLPLMRALLLAHPEVEFLWWMDSDAMFTDMAFELPWERYGPYNLIM  244

Query  818   HGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGR  997
             HG+ ++++D K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKGP+R E+GK LT +LK R
Sbjct  245   HGWDEMVYDDKNWIGLNTGSFLLRNCQWSLDMLDTWAPMGPKGPVRIEAGKVLTKSLKDR  304

Query  998   PEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDER  1177
             P FEADDQSA++Y+L +++++W DKV+LEN YYLHGYW  LVDRYEE++E Y PG GD R
Sbjct  305   PVFEADDQSAMVYILATQREKWGDKVYLENGYYLHGYWGILVDRYEEMLENYKPGLGDHR  364

Query  1178  WPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRN  1357
             WP VTHFVGCK CG  GD+PVE+C+K+M+RAFNF DNQ+L +YGF H+ L S  +KRIRN
Sbjct  365   WPLVTHFVGCKPCGKFGDYPVERCLKNMDRAFNFGDNQILQMYGFTHKSLASRRVKRIRN  424

Query  1358  ETTLPLPNVDRYDFRH  1405
             ET+ PL   D     H
Sbjct  425   ETSNPLETKDELGLLH  440



>gb|KEH19400.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=538

 Score =   488 bits (1256),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 233/405 (58%), Positives = 290/405 (72%), Gaps = 34/405 (8%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSF---LIDETNRI  334
             R R+  R  N+ K+TILC F+TI+VLRGTIG G   + +    ++ N F    + E +RI
Sbjct  10    RARKFQRFLNHCKVTILCLFLTIVVLRGTIGAGKFGTPEQDFVDIRNRFSSRKLSEPHRI  69

Query  335   LDEIR-------------------SDKDPDD--------PEGQSGDRFLSPNETFSLGPK  433
             L EI                    +D D +          E        S NE +SLGPK
Sbjct  70    LGEIHSTTSSSSRSDSSTTSTTNYNDFDINTILVDEEEEEEQGDEFEKRSSNEPYSLGPK  129

Query  434   ITGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYC  610
             I+ WDEQR  W   +P F + ++ GKPRVLLVTGS P PCENPVGDHYLLK +KNKIDYC
Sbjct  130   ISNWDEQRSKWIRENPNFSNFIRPGKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYC  189

Query  611   RIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLS  790
             R+HGIE+ YN A  D EM G WAKLPLIR+L+L+HPE+E++WWMDSDA FTDMAFE+P  
Sbjct  190   RLHGIEVFYNMALFDAEMAGFWAKLPLIRKLLLAHPEVEFLWWMDSDAMFTDMAFEVPWE  249

Query  791   KYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGK  970
             +Y   NLV+HG+ ++++D+K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+E+GK
Sbjct  250   RYKDSNLVMHGWNEMVYDEKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDEAGK  309

Query  971   TLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEK  1150
              LT  LKGRP FEADDQSA++YLL  EK++W DKV+LEN YYLHGYW  LVDRYEE++E 
Sbjct  310   ILTRELKGRPVFEADDQSAMVYLLAKEKEKWGDKVYLENGYYLHGYWGILVDRYEEMIEN  369

Query  1151  YHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFAD  1285
             YHPGFGD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNFA+
Sbjct  370   YHPGFGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFAN  414



>ref|XP_006402349.1| hypothetical protein EUTSA_v10005949mg [Eutrema salsugineum]
 gb|ESQ43802.1| hypothetical protein EUTSA_v10005949mg [Eutrema salsugineum]
Length=468

 Score =   484 bits (1246),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 242/439 (55%), Positives = 309/439 (70%), Gaps = 28/439 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN---SFLID----ETNR  331
             R R++ R +   K+T+LC  +T++VLRGTIG G   + + ++E     F       E +R
Sbjct  10    RFRRLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFYTRKRAEPHR  69

Query  332   ILDEIRSDKDPDDPEGQ-SGDRFLS-------------------PNETFSLGPKITGWDE  451
             +L E+ +       +G  +G+ + S                    ++ +SLGPKI+ WDE
Sbjct  70    VLVEVSTKTTSSSEDGDGNGNNYESFDINKIFVDEGDEEKSEEDRSKPYSLGPKISNWDE  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             QR  W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCR HGIE
Sbjct  130   QRNDWLKQNPSFPNFVAPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRTHGIE  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIRRL+LSHPEIE++WWMDSDA FTDM FE+P  +Y  +N
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRRLLLSHPEIEFLWWMDSDAMFTDMVFELPWERYKDYN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
             LV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK LT  L
Sbjct  250   LVMHGWNEMVYDQKNWIGLNTGSFLLRNSQWALDLLDAWAPMGPKGKIREEAGKILTREL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             K RP FEADDQSA++YLL +E+++W  KV+LE+ YYLHGYW  LVDRYEE++E + PGFG
Sbjct  310   KDRPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILVDRYEEMIENHKPGFG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D RWP VTHFVGCK CG  GD+PVE+C++ M+RAFNF DNQ+L +YGF H+ L S  +K 
Sbjct  370   DHRWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILQMYGFTHKSLGSRRVKP  429

Query  1349  IRNETTLPLPNVDRYDFRH  1405
              RN+T  PL   D +   H
Sbjct  430   TRNQTDRPLDAEDEFGLLH  448



>ref|XP_006356974.1| PREDICTED: putative glycosyltransferase 2-like [Solanum tuberosum]
Length=464

 Score =   483 bits (1244),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 308/449 (69%), Gaps = 43/449 (10%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSF-----------  310
             R  Q+ R   N K+T LC F+T++VLRG +G G   +      E+  +F           
Sbjct  10    RAWQVRRIMRNGKLTFLCLFLTVIVLRGNLGAGRFGTPGQDLKEIRETFSYYRKRVEPRR  69

Query  311   LIDETNRI-----------------------LDEIRSDKDPDDPEGQSGDRFLSPNETFS  421
             +++E  ++                       L +I  D+D  +PE +       PN+ ++
Sbjct  70    VLEEAQQVSSTSTVSDGGDSSSDSNNYATFDLKKILVDEDDGEPEFKR-----DPNQPYA  124

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             LGPKIT WDEQR  W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNK
Sbjct  125   LGPKITDWDEQRGEWLKKNPNFPNFVGTNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNK  184

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCR+HG+EI YN A +D EM G WAKLPL+R+L+LSHPE+E++WWMDSDA FTDMAFE
Sbjct  185   IDYCRLHGMEIFYNMALLDAEMAGFWAKLPLLRKLLLSHPEVEFLWWMDSDAMFTDMAFE  244

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             +P  +Y   NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLDV APMGPKG +RE
Sbjct  245   LPWERYKDANLVMHGWNEMVYDQKNWIGLNTGSFLLRNTQWALDLLDVLAPMGPKGKVRE  304

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+G  LT  LK RP FEADDQSA++Y+L ++K+ W DKV+LEN+YYLHGYW  LVD+YEE
Sbjct  305   EAGALLTRELKDRPVFEADDQSAMVYILATQKEIWGDKVYLENAYYLHGYWGILVDKYEE  364

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++E YHPG GD RWP VTHFVGCK C   GD+ VE+C+K M+RAFNF DNQ+L +YGF H
Sbjct  365   MIENYHPGLGDHRWPLVTHFVGCKPCAKFGDYSVERCLKQMDRAFNFGDNQILQMYGFTH  424

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             + L S  +KR RNET+ PL   D     H
Sbjct  425   KSLGSRRVKRTRNETSNPLEVNDELGLLH  453



>ref|XP_002314448.2| glycosyltransferase 2 family protein [Populus trichocarpa]
 gb|EEF00619.2| glycosyltransferase 2 family protein [Populus trichocarpa]
Length=432

 Score =   482 bits (1241),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 229/423 (54%), Positives = 294/423 (70%), Gaps = 28/423 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVG--------------NLASSDAEVENSF  310
             R     R   + K+T+LC F+T +VL GTIG G              N  SS    E   
Sbjct  10    RDHLFQRPMCHAKVTLLCLFMTAIVLLGTIGAGKFGTQEQHFNYLRNNFYSSRKRAEPQK  69

Query  311   LIDETNRILDEIRSDKDPDDPEGQSG-------------DRFLSPNETFSLGPKITGWDE  451
             ++ E  R      ++   DDP   +              D     ++ +SLGPKI  WD+
Sbjct  70    VVIELTRNNSRNDTNIKSDDPNSYASFDINKLFVDEGEDDENPDSDKPYSLGPKILDWDQ  129

Query  452   QRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIE  628
             +R  W   +P+FP+ V   KPRVLLVTGS P PCEN VGDHYLLK +KNKIDYCR+HGI+
Sbjct  130   KRAEWLGENPKFPNFVGPDKPRVLLVTGSSPKPCENRVGDHYLLKSIKNKIDYCRLHGID  189

Query  629   IVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHN  808
             I YN A +D EM G WAKLPLIR+L++S PEIE++WWMDSDA FTDMAFE+P  KY  +N
Sbjct  190   IFYNMALLDAEMAGFWAKLPLIRKLLVSQPEIEFLWWMDSDAMFTDMAFEVPWEKYKDYN  249

Query  809   LVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANL  988
             LV+HG++++++DQ++W  L+TGSF IRNCQW+LDLLD WAPMGPKG IR+E+GK L   L
Sbjct  250   LVMHGWKEMVYDQRNWIGLNTGSFFIRNCQWSLDLLDAWAPMGPKGKIRDEAGKLLAKEL  309

Query  989   KGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFG  1168
             KGRP FEADDQSA++YLL +++D+W DKV+LEN+YYLHGYW  LVDRYEE++EKYH G G
Sbjct  310   KGRPVFEADDQSAMVYLLATQRDKWGDKVYLENAYYLHGYWEILVDRYEEMIEKYHAGLG  369

Query  1169  DERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKR  1348
             D+RWP VTHFVGCK CG +GD+PVE+C+K M+RAFNF D+Q+L  YG+ H  L +  +++
Sbjct  370   DDRWPLVTHFVGCKPCGKAGDYPVERCLKQMDRAFNFGDDQILQKYGYAHTSLAAWRVRK  429

Query  1349  IRN  1357
               N
Sbjct  430   SSN  432



>emb|CDY70418.1| BnaA04g27220D [Brassica napus]
Length=460

 Score =   483 bits (1243),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 244/442 (55%), Positives = 312/442 (71%), Gaps = 31/442 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN-------SFLIDETNR  331
             R R++ R +   K+T+LC  +T++VLRGTIG G   + + ++E        S    ET+R
Sbjct  10    RLRRLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFYSRKRAETHR  69

Query  332   ILDEIRSDK---------------------DPDDPEGQSGD--RFLSPNETFSLGPKITG  442
             +L E+ S                       D        GD  + L  ++ +SLGPKI+ 
Sbjct  70    VLVELSSSSSKTTSSSAAGNSNNNNNYETFDFKKIFADEGDEEKALDRSKPYSLGPKISD  129

Query  443   WDEQRKVWFDRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIH  619
             WDEQR  W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIH
Sbjct  130   WDEQRIDWLKQNPSFPNFVAANKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYCRIH  189

Query  620   GIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYD  799
             GIEI YN A +D EM G WAKLPLIR+L+LSHPE+E++WWMDSDA FTDM FE+P  +Y+
Sbjct  190   GIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMVFELPWERYE  249

Query  800   SHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLT  979
              +NLV+HG++++++DQKSW  L+TGSFLIRN QWALDLLD WAPMGPKG IREE+GK LT
Sbjct  250   DYNLVMHGWKEMVYDQKSWIGLNTGSFLIRNSQWALDLLDAWAPMGPKGRIREEAGKVLT  309

Query  980   ANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHP  1159
               LK RP FEADDQSA++YLL +E+++W  KV+LE+ YYLHGYW  LVDRYEE++E + P
Sbjct  310   RELKDRPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILVDRYEEMIENHKP  369

Query  1160  GFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPN  1339
             GFGD RWP VTHFVGCK CG  GD+PVE+C++ M+RAFNF DNQ+L +YGF H+ L S +
Sbjct  370   GFGDHRWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILQVYGFTHKSLGSRS  429

Query  1340  IKRIRNETTLPLPNVDRYDFRH  1405
             +K  R++T  P+   D +   H
Sbjct  430   VKPTRSQTGRPVDVKDEFGLLH  451



>gb|EPS71488.1| hypothetical protein M569_03267 [Genlisea aurea]
Length=450

 Score =   482 bits (1241),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 217/358 (61%), Positives = 276/358 (77%), Gaps = 6/358 (2%)
 Frame = +2

Query  335   LDEIRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKG-KP  511
             +++I  D+D   PE +       P++ ++LGPKI+ WD+QR  W   +P FP+ + G KP
Sbjct  88    VNKIFKDEDDGIPEFKR-----DPSQPYTLGPKISDWDQQRGEWLKNNPDFPNFITGNKP  142

Query  512   RVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPL  691
             RVLLVTGS P PCENP+GDHYLLK +KNKIDYCR+H IEI YN A +D EM G WAKLPL
Sbjct  143   RVLLVTGSSPKPCENPIGDHYLLKSIKNKIDYCRLHAIEIFYNLALLDAEMSGFWAKLPL  202

Query  692   IRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALST  871
             IR+L+LSHPE+E++WWMDSDA FTDMAFE+P  +Y   NLV+HG+ ++++D+++W  L+T
Sbjct  203   IRKLLLSHPEVEFLWWMDSDAMFTDMAFELPWERYKDQNLVMHGWNEMVYDERNWIGLNT  262

Query  872   GSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSE  1051
             GSFL+RNCQW+LDLLD  APMGPKG  R+E+GK LT  LKGRP FEADDQSA++Y+L ++
Sbjct  263   GSFLLRNCQWSLDLLDTLAPMGPKGKTRDEAGKILTRELKGRPVFEADDQSAMVYILTTQ  322

Query  1052  KDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGD  1231
             +++W  KV+LEN+YYLHGYW  LVDRYEE++E YHPG GD RWP VTHFVGCK CG  GD
Sbjct  323   REKWGSKVYLENAYYLHGYWGILVDRYEEMIENYHPGLGDHRWPLVTHFVGCKPCGKFGD  382

Query  1232  FPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             +PVE+C+K M+RAFNF DNQ+L +YGF HR L S  + R RNET+ PL   D     H
Sbjct  383   YPVERCLKQMDRAFNFGDNQILQMYGFTHRSLTSRKVMRFRNETSKPLEVRDELGLLH  440



>dbj|BAK06777.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   482 bits (1241),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 241/432 (56%), Positives = 303/432 (70%), Gaps = 23/432 (5%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLIDETNRILDE  343
             R R+I R   N K+T++C  +TILVLRGT+G G   +      E+ + F I    R L E
Sbjct  12    RMREIQRFTRNAKLTVVCLMLTILVLRGTLGAGKFGTPQQDLIELRHRF-ISHPQRALAE  70

Query  344   -----------------IRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFD  472
                               RS     D E +   R L  +  ++LGPKI+ WDEQR  W  
Sbjct  71    HHDARSKASDAADAASDARSKAAARDDEPEPQPRSLR-DPPYTLGPKISDWDEQRAAWNR  129

Query  473   RHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSAN  649
             RHP  P  +   KPRV+LVTGS P PCENPVGDHYLLK +KNKIDYCRIHG+EI YN A 
Sbjct  130   RHPETPPFLNDVKPRVMLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRIHGLEIFYNMAL  189

Query  650   MDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQ  829
             +D E+ G WAKLPL+R L+L+HPE+E+ WWMDSDA FTDMAFE+P  +Y  +N ++HG+ 
Sbjct  190   LDAELAGFWAKLPLLRALLLAHPEVEFFWWMDSDAMFTDMAFELPWERYGPYNFILHGWD  249

Query  830   DLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFE  1009
             ++++D K+W  L+TGSFL+RNCQW+LD LD WAPMGPKGP+R E+GK LT  LK RP FE
Sbjct  250   EMVYDDKNWIGLNTGSFLLRNCQWSLDYLDTWAPMGPKGPVRIEAGKVLTKYLKDRPVFE  309

Query  1010  ADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFV  1189
             ADDQSA++Y+L +++++W +KV+LEN YYLHGYW  LVDRYEE++E Y PG GD RWP V
Sbjct  310   ADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILVDRYEEMLENYQPGLGDHRWPLV  369

Query  1190  THFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTL  1369
             THFVGCK C   GD+PVE+C+K M+RAFNF DNQVL++YGF+H+ L S  IKRIRNET+ 
Sbjct  370   THFVGCKPCSKFGDYPVERCLKQMDRAFNFGDNQVLHMYGFEHKSLASRRIKRIRNETSN  429

Query  1370  PLPNVDRYDFRH  1405
             PL   D Y   H
Sbjct  430   PLDMKDDYGLLH  441



>ref|XP_007224307.1| hypothetical protein PRUPE_ppa019851mg [Prunus persica]
 gb|EMJ25506.1| hypothetical protein PRUPE_ppa019851mg [Prunus persica]
Length=442

 Score =   481 bits (1237),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 234/438 (53%), Positives = 295/438 (67%), Gaps = 45/438 (10%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLID----ETNR  331
             R RQ+ R   +   T LC F+T++VLRGTIG G   + +    E+   F  +    E +R
Sbjct  10    RARQVQRMLRHGTTTFLCLFLTVVVLRGTIGAGKFGTPEQDYNEIREHFYSNNRRVEPHR  69

Query  332   ILDEIRS--DKDPDDP-----------------EGQSGDRFLSPNETFSLGPKITGWDEQ  454
             +L E  +  D+   DP                 E  S D    PN  +SLGPKI+ WDEQ
Sbjct  70    VLQEATTQPDQKEADPAQSNNYATFDISKILVDEPGSDDEKRDPNTPYSLGPKISDWDEQ  129

Query  455   RKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEI  631
             R  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYCRIHGIEI
Sbjct  130   RSDWLKKNPSFPNFLGPNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRIHGIEI  189

Query  632   VYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNL  811
              YN A +D EM                   +E++WWMDSDA FTDMAFE+P  +Y  HN 
Sbjct  190   FYNFALLDAEM------------------PVEFLWWMDSDAMFTDMAFEVPWERYKDHNF  231

Query  812   VIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLK  991
             V+HG+ ++++DQK+W  L+TGSFL+RNCQW+LD+LDVWAPMGPKG IR+E+GK LT  LK
Sbjct  232   VMHGWNEMVYDQKNWIGLNTGSFLLRNCQWSLDILDVWAPMGPKGKIRDEAGKVLTRELK  291

Query  992   GRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGD  1171
             GRP FEADDQSA++Y+L   ++ W +KV+LE++YYLHGYW  LVDRYEE++E YHPGFGD
Sbjct  292   GRPVFEADDQSAMVYILAKGRETWGEKVYLESAYYLHGYWGILVDRYEEMIESYHPGFGD  351

Query  1172  ERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRI  1351
              RWP VTHFVGCK CG  GD+PVE+C+K M+RA+NF DNQVL +YGF H+ L S  +KR+
Sbjct  352   HRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAYNFGDNQVLQMYGFTHKSLGSRRVKRV  411

Query  1352  RNETTLPLPNVDRYDFRH  1405
             RNE++ PL   D     H
Sbjct  412   RNESSNPLEVKDELGLLH  429



>ref|NP_001151451.1| glycosyltransferase 5 [Zea mays]
 gb|ACG42923.1| glycosyltransferase 5 [Zea mays]
Length=447

 Score =   480 bits (1235),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 232/427 (54%), Positives = 300/427 (70%), Gaps = 16/427 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEV--ENSFLIDETNRILDEI  346
             R RQI R   N K+T++C  +T++VLRGT+G G   +   ++       +   +R L E 
Sbjct  11    RMRQIQRFARNAKLTVVCLLLTVVVLRGTVGAGRFGTPQQDLIELRQHFVSHPHRALAEH  70

Query  347   RSDKDPDDPEGQSGDRFLSP-------------NETFSLGPKITGWDEQRKVWFDRHPRF  487
                +        S     +              +  ++LGPKI  WDEQR  W  RHP  
Sbjct  71    HDARSRASTTTTSSSSSSARRDDDPDPPPRSLRDPPYTLGPKIFDWDEQRAAWHRRHPET  130

Query  488   PSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREM  664
             P  +   KPRVLLVTGS P PCENPVGDHYLLK +KNK+DYCR+HGIE+ YN A +D EM
Sbjct  131   PPFLNDIKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKMDYCRVHGIEVFYNMALLDAEM  190

Query  665   DGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFD  844
              G WAKLPL+R L+L+HPE+E++WWMDSDA FTDMAFE+P  +Y  +NL++HG+ ++++D
Sbjct  191   AGFWAKLPLMRALLLAHPEVEFLWWMDSDAMFTDMAFELPWERYGPYNLIMHGWDEMVYD  250

Query  845   QKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQS  1024
              K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKGP+R E+GK LT +LK RP FEADDQS
Sbjct  251   DKNWIGLNTGSFLLRNCQWSLDMLDTWAPMGPKGPVRIEAGKVLTKSLKDRPVFEADDQS  310

Query  1025  ALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVG  1204
             A++Y+L +++++W DKV+LEN YYLHGYW  LVDRYEE++E Y PG GD RWP VTHFVG
Sbjct  311   AMVYILATQREKWGDKVYLENGYYLHGYWGILVDRYEEMLENYKPGLGDHRWPLVTHFVG  370

Query  1205  CKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNV  1384
             CK CG  GD+PVE+C+K+M+RAFNF DNQ+L +YGF H+ L S  +KRIRNET+ PL   
Sbjct  371   CKPCGKFGDYPVERCLKNMDRAFNFGDNQILQMYGFTHKSLASRRVKRIRNETSNPLETK  430

Query  1385  DRYDFRH  1405
             D     H
Sbjct  431   DELGLLH  437



>ref|XP_004229187.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Solanum lycopersicum]
Length=464

 Score =   481 bits (1237),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 243/449 (54%), Positives = 305/449 (68%), Gaps = 43/449 (10%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSFLI----DETNR  331
             R  Q+ R   N K+T LC F+T++VLRG +G G   +      E+  +F       E  R
Sbjct  10    RAWQVRRIMRNGKLTFLCLFLTVIVLRGNLGAGRFGTPGQDLKEIRETFSYYRKRVEPRR  69

Query  332   ILDE------------------------------IRSDKDPDDPEGQSGDRFLSPNETFS  421
             +L+E                              I  D+D  +PE +       PN+ ++
Sbjct  70    VLEEAQQVSSSSTVSDGGASSSDSNNYATFDLKKILVDEDDGEPEFKR-----DPNQPYA  124

Query  422   LGPKITGWDEQRKVWFDRHPRFPSSV-KGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNK  598
             LGPKI  WDEQR  W  ++P FP+ V   KPRVLLVTGS P PCENPVGDHYLLK +KNK
Sbjct  125   LGPKIIDWDEQRGEWLKKNPNFPNFVGTNKPRVLLVTGSSPKPCENPVGDHYLLKSIKNK  184

Query  599   IDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFE  778
             IDYCR+HGIEI YN A +D EM G WAKLPL+R+L+LSHPE+E++WWMDSDA FTDMAFE
Sbjct  185   IDYCRLHGIEIFYNMALLDAEMAGFWAKLPLLRKLLLSHPEVEFLWWMDSDAMFTDMAFE  244

Query  779   IPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIRE  958
             +P  +Y   NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLDV APMGPKG +RE
Sbjct  245   LPWERYKDANLVMHGWNEMVYDQKNWIGLNTGSFLLRNTQWALDLLDVLAPMGPKGKVRE  304

Query  959   ESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEE  1138
             E+G  LT  LK RP FEADDQSA++Y+L ++K+ W DKV+LEN+YYLHGYW  LVD+YEE
Sbjct  305   EAGALLTRELKDRPVFEADDQSAMVYILATQKEIWGDKVYLENAYYLHGYWGILVDKYEE  364

Query  1139  VMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKH  1318
             ++E YHPG GD RWP VTHFVGCK C   GD+ VE+C+K M+RAFNF DNQ+L +YGF H
Sbjct  365   MIENYHPGLGDHRWPLVTHFVGCKPCAKFGDYSVERCLKQMDRAFNFGDNQILQMYGFTH  424

Query  1319  RGLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
             + L S  +KR RNET+ PL   D     H
Sbjct  425   KSLGSRRVKRTRNETSNPLEVNDELGLLH  453



>gb|EMT04084.1| Xyloglucan 6-xylosyltransferase [Aegilops tauschii]
Length=451

 Score =   480 bits (1236),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 238/433 (55%), Positives = 301/433 (70%), Gaps = 25/433 (6%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVEN--SFLIDETNRILDEI  346
             R R+I R   N K+T++C  +TILVLRGT+G G   +   ++      LI    R L E 
Sbjct  12    RMREIQRFTRNAKLTVVCLMLTILVLRGTVGAGKFGTPQQDLTELRHRLISPPQRALSEH  71

Query  347   RSDKDP-------------------DDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWF  469
                +                     D+PE Q       P   ++LGPKI+ WDEQR  W 
Sbjct  72    HDARSKASDAQAQATKAAGKAAARDDEPEPQPRSLRDPP---YTLGPKISDWDEQRAAWN  128

Query  470   DRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSA  646
              RHP  P  +   KPRV+LVTGS P PCENPVGDHYLLK +KNKIDYCRIHG+EI YN A
Sbjct  129   RRHPETPPFLNDVKPRVMLVTGSSPKPCENPVGDHYLLKSIKNKIDYCRIHGLEIFYNMA  188

Query  647   NMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGY  826
              +D E+ G WAKLPL+R L+L+HPE+E+ WWMDSDA FTDMAFE+P  +Y  +N ++HG+
Sbjct  189   LLDAELAGFWAKLPLLRALLLAHPEVEFFWWMDSDAMFTDMAFELPWERYGPYNFILHGW  248

Query  827   QDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEF  1006
              ++++D ++W  L+TGSFL+RNCQW+LD LD WAPMGPKGP+R E+GK LT  LK RP F
Sbjct  249   DEMVYDDRNWIGLNTGSFLLRNCQWSLDYLDTWAPMGPKGPVRIEAGKVLTKYLKDRPVF  308

Query  1007  EADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPF  1186
             EADDQSA++Y+L +++++W +KV+LEN YYLHGYW  LVDRYEE++E Y PG GD RWP 
Sbjct  309   EADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILVDRYEEMLENYQPGLGDHRWPL  368

Query  1187  VTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETT  1366
             VTHFVGCK C   GD+PVE+C+K M+RAFNF DNQVL++YGF+H+ L S  IKRIRNET+
Sbjct  369   VTHFVGCKPCSKFGDYPVERCLKQMDRAFNFGDNQVLHMYGFEHKSLASRRIKRIRNETS  428

Query  1367  LPLPNVDRYDFRH  1405
              PL   D Y   H
Sbjct  429   DPLDMKDDYGLLH  441



>gb|ACN29046.1| unknown [Zea mays]
 tpg|DAA44931.1| TPA: glycosyltransferase 5 [Zea mays]
Length=447

 Score =   479 bits (1234),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 231/427 (54%), Positives = 300/427 (70%), Gaps = 16/427 (4%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEV--ENSFLIDETNRILDEI  346
             R RQI R   N K+T++C  +T++VLRGT+G G   +   ++       +   +R L E 
Sbjct  11    RMRQIQRFARNAKLTVVCLLLTVVVLRGTVGAGRFGTPQQDLIELRQHFVSHPHRALAEH  70

Query  347   RSDKDPDDPEGQSGDRFLSP-------------NETFSLGPKITGWDEQRKVWFDRHPRF  487
                +        S     +              +  ++LGPKI+ WDEQR  W  RHP  
Sbjct  71    HDARSRASTTTTSSSSSSARRDDDPDPPPRTLRDPPYTLGPKISDWDEQRAAWHRRHPET  130

Query  488   PSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREM  664
             P  +   KPRVLLVTGS P PCENPVGDHYLLK +KNK+DYCR+HGIE+ YN A +D EM
Sbjct  131   PPFLNDIKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKMDYCRVHGIEVFYNMALLDAEM  190

Query  665   DGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFD  844
              G WAKLPL+R L+L+HPE+E++WWMDSDA FTDMAFE+P  +Y  +NL++HG+ ++++D
Sbjct  191   AGFWAKLPLMRALLLAHPEVEFLWWMDSDAMFTDMAFELPWERYGPYNLIMHGWDEMVYD  250

Query  845   QKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQS  1024
              K+W  L+TGSFL+RNCQW+LD+LD WAPMGPKGP+R E+GK LT +LK RP FEADDQS
Sbjct  251   DKNWIGLNTGSFLLRNCQWSLDMLDTWAPMGPKGPVRIEAGKVLTKSLKDRPVFEADDQS  310

Query  1025  ALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVG  1204
             A++Y+L +++++W DKV+LEN YYLHGYW  LVDRYEE++E Y PG GD RWP VTHFVG
Sbjct  311   AMVYILATQREKWGDKVYLENGYYLHGYWGILVDRYEEMLENYKPGLGDHRWPLVTHFVG  370

Query  1205  CKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPLPNV  1384
             CK CG  GD+PVE+C+K+M+RAFNF DNQ+L +YGF H+ L S  +KR RNET+ PL   
Sbjct  371   CKPCGKFGDYPVERCLKNMDRAFNFGDNQILQMYGFTHKSLASRRVKRTRNETSNPLETK  430

Query  1385  DRYDFRH  1405
             D     H
Sbjct  431   DELGLLH  437



>gb|KFK30846.1| hypothetical protein AALP_AA6G033100 [Arabis alpina]
Length=1524

 Score =   508 bits (1309),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 314/445 (71%), Gaps = 38/445 (9%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAE-------VENSFLIDETNR  331
             R R+I R   ++K+TILC  +T++VLRGTIG G   + + +       V  S    E +R
Sbjct  1070  RCRRIQRALRHLKVTILCLVLTVVVLRGTIGAGKFGTPEQDFDEIRQLVHTSRKRGEPHR  1129

Query  332   ILDEIRSDKDP--------------------------DDPEGQSGDRFLSPNETFSLGPK  433
             +L+EI++  D                           D+ E +  D     ++ ++LGPK
Sbjct  1130  VLEEIQTGGDSSSGGNSGGGGGGSNNYETFDINKIFVDEGEEEKPD----TSKPYTLGPK  1185

Query  434   ITGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYC  610
             I+ W+EQR  W  ++P FP+ +   KPRVLLVTGS P PCENPVGDHYLLK +KNKIDYC
Sbjct  1186  ISDWNEQRSDWLAKNPSFPNFIGPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDYC  1245

Query  611   RIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLS  790
             R+HGIEI YN A +D EM G WAKLPLIR+L+LSHPEIE++WWMDSDA FTDMAFE+P  
Sbjct  1246  RLHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMAFELPWE  1305

Query  791   KYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGK  970
             +Y  +NLV+HG+ ++++DQK+W  L+TGSFL+RN QWALDLLD WAPMGPKG IREE+GK
Sbjct  1306  RYKDYNLVMHGWNEMVYDQKNWIGLNTGSFLLRNNQWALDLLDTWAPMGPKGKIREEAGK  1365

Query  971   TLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEK  1150
              LT  LK RP FEADDQSA++YLL ++++ W +KV+LE+ YYLHGYW  LVDRYEE++E 
Sbjct  1366  VLTRELKDRPVFEADDQSAMVYLLATQRETWGNKVYLESGYYLHGYWGILVDRYEEMIEN  1425

Query  1151  YHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLL  1330
             YHPG GD RWP VTHFVGCK CG  GD+PVE+C+K M+RAFNF DNQ+L +YGF H+ L 
Sbjct  1426  YHPGLGDHRWPLVTHFVGCKPCGKFGDYPVERCLKQMDRAFNFGDNQILQIYGFTHKSLA  1485

Query  1331  SPNIKRIRNETTLPLPNVDRYDFRH  1405
             S  +KR+RNET+ PL   D     H
Sbjct  1486  SRKVKRVRNETSNPLEMKDELGLLH  1510



>ref|XP_009600562.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nicotiana tomentosiformis]
Length=464

 Score =   475 bits (1223),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 239/448 (53%), Positives = 308/448 (69%), Gaps = 42/448 (9%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSD---AEVENSF-----------  310
             R  Q+ R   N K+T LC F+TI+VLRG +G G   +      E+ ++F           
Sbjct  10    RAWQVRRIVRNGKLTFLCLFLTIVVLRGNLGAGKFGTPGQDLKEIRDTFSYVRKRVEPRR  69

Query  311   LIDETNRI----------------------LDEIRSDKDPDDPEGQSGDRFLSPNETFSL  424
             +++E  ++                      L +I  D+D  +PE +       PNE +SL
Sbjct  70    VLEEAQQVDTATEGGGGATSSDSNNYATFDLKKILVDEDDGEPEFKR-----DPNEPYSL  124

Query  425   GPKITGWDEQRKVWFDRHPRFPSSVK-GKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKI  601
             GPKI+ WDEQR  W  ++  FP+ V   KPRVLLVTGS P PCENP+GDHYLLK +KNKI
Sbjct  125   GPKISDWDEQRAEWLKKNLNFPNFVGPNKPRVLLVTGSSPKPCENPIGDHYLLKSIKNKI  184

Query  602   DYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEI  781
             DYCR+HGIEI YN A +D EM G WAKLPL+R+L+LSHPEIE+IWWMDSDA FTDMAFE+
Sbjct  185   DYCRLHGIEIFYNMALLDAEMSGFWAKLPLLRKLLLSHPEIEFIWWMDSDAMFTDMAFEL  244

Query  782   PLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREE  961
             P  +Y   +LV+HG+ D+++++K+W  L+TGSFL+RN Q+ALDLLD  APMGPKG  R+E
Sbjct  245   PWERYKDVDLVMHGWNDMVYNEKNWIGLNTGSFLLRNTQFALDLLDTLAPMGPKGKTRDE  304

Query  962   SGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEV  1141
             +G  LT  LKGRP FEADDQSA++Y+L ++K++W DKV+LE++YYLHGYW  LVD+YEE+
Sbjct  305   AGAVLTRELKGRPVFEADDQSAMVYILATQKEKWGDKVYLESAYYLHGYWGILVDKYEEM  364

Query  1142  MEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHR  1321
             +E YHPG GD RWP VTHFVGCK C   GD+ VE+C+K M+RAFNF DNQ+L +YGF H+
Sbjct  365   IENYHPGLGDHRWPLVTHFVGCKPCAKFGDYSVERCLKQMDRAFNFGDNQILQMYGFTHK  424

Query  1322  GLLSPNIKRIRNETTLPLPNVDRYDFRH  1405
              L S  +KR RNET+ PL   D     H
Sbjct  425   SLGSRRVKRTRNETSNPLEVNDELGLLH  452



>ref|XP_001771886.1| predicted protein [Physcomitrella patens]
 gb|EDQ63315.1| predicted protein [Physcomitrella patens]
Length=404

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 224/405 (55%), Positives = 294/405 (73%), Gaps = 13/405 (3%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRS  352
             +GR + +T  N ++TILCG VTILVLRGTIG     SS  +    FL    N  +D +R 
Sbjct  2     KGRTMHKTMYNSRLTILCGLVTILVLRGTIG-----SSGVDKSPQFLRTNMNVNVDLVRK  56

Query  353   DKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTG  532
                 ++ +    D    P+  FSLGPKIT WDEQR +W  ++P    ++ GK R+LLVTG
Sbjct  57    TVVVEEEKEVEWD----PSIPFSLGPKITSWDEQRVLWNKKNPGAAKTLDGKDRMLLVTG  112

Query  533   SPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLS  712
             S PT C+NP+G   LLK +KNK+DYCR+H IEI YN A++D E+ G WAKLPL+R+LML 
Sbjct  113   SQPTKCDNPMGSFQLLKALKNKMDYCRLHDIEIFYNMAHLDVELAGFWAKLPLLRKLMLG  172

Query  713   HPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRN  892
             HPE+EWIWWMDSDA FTDM FEIP+ KY  +N+V+HG +  ++++KSW  L+TGSFL+RN
Sbjct  173   HPEVEWIWWMDSDALFTDMTFEIPIEKYKGYNMVLHGNEKDVYEKKSWLGLNTGSFLMRN  232

Query  893   CQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDK  1072
             CQW+LDLL++WA MGPKG +R E+GK LTA+L  RP FEADDQSAL+YLL +++ QW  K
Sbjct  233   CQWSLDLLEIWAIMGPKGAVRMEAGKLLTASLSERPAFEADDQSALVYLLATQRKQWSPK  292

Query  1073  VFLENSYYLHGYWAGLVDRYEEVMEKYHPGF--GDERWPFVTHFVGCKACGSSG--DFPV  1240
             V+LEN+Y LHGYW  + +RYEE+M +  PG   G+ +WPFVTHFVGCK CG  G   +  
Sbjct  293   VYLENNYCLHGYWVMITERYEELMARGRPGAVGGEFQWPFVTHFVGCKPCGKGGSSSYGT  352

Query  1241  EKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             ++C+  MERAFNFADNQ+LN YGF+H+ L + N++R+RN+T  PL
Sbjct  353   DRCLAHMERAFNFADNQILNKYGFRHKTLNTYNVRRVRNDTADPL  397



>ref|XP_004136173.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Cucumis sativus]
 ref|XP_004160566.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Cucumis sativus]
 gb|KGN44922.1| hypothetical protein Csa_7G396380 [Cucumis sativus]
Length=411

 Score =   469 bits (1207),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 218/398 (55%), Positives = 287/398 (72%), Gaps = 30/398 (8%)
 Frame = +2

Query  167   VPRGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEI  346
              PR R+I RT  N K+T+LC F+T++VLRGTIG     + D  + N  L++   +     
Sbjct  10    TPRLRRIHRTLRNFKLTVLCLFLTVVVLRGTIGPVQFGTPD--LRNRLLVEHQTKSFSG-  66

Query  347   RSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVK-GKPRVLL  523
             R++K                   + L P+++ WDE+R+ W   +  FP+ ++ GKPRVLL
Sbjct  67    RTEK------------------PYRLAPQVSDWDERRRKWLKDNRGFPNFIRPGKPRVLL  108

Query  524   VTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRL  703
             VTGS P  CENP+GDHYLLK +KNKIDYCR+HGIEI YN A +D EM G W KLPLIR+L
Sbjct  109   VTGSSPEKCENPIGDHYLLKSIKNKIDYCRLHGIEIFYNLAILDEEMTGFWGKLPLIRKL  168

Query  704   MLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFL  883
             +LSHPE+E+IWWMDSDA FTDM+FEIP  KY   N ++HG++++++DQ+SW  L+TGSFL
Sbjct  169   LLSHPEVEFIWWMDSDAMFTDMSFEIPWDKYKDFNFIMHGWKEMVYDQRSWIGLNTGSFL  228

Query  884   IRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQW  1063
             +RNCQW+LD+LD WAPMGPKG  R+E+GK LT  LK RP FEADDQSA++YLL +++++W
Sbjct  229   MRNCQWSLDILDAWAPMGPKGKTRDEAGKILTNELKDRPTFEADDQSAMVYLLATQREKW  288

Query  1064  MDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKACGSSGDFPVE  1243
               K++LENSY LHGYW  LVD++EE +         E WP VTHFVGCK CG +GD+PVE
Sbjct  289   GSKIYLENSYNLHGYWGILVDKFEETVR--------ENWPLVTHFVGCKPCGKAGDYPVE  340

Query  1244  KCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRN  1357
             KC+K+MERAFNF DNQ+L +YGF H+ L+S  I +IR+
Sbjct  341   KCLKAMERAFNFGDNQILEMYGFAHKSLMSRRIVKIRD  378



>emb|CAJ57381.1| alpha-1,6-xylosyltransferase [Physcomitrella patens]
Length=408

 Score =   468 bits (1205),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 230/401 (57%), Positives = 293/401 (73%), Gaps = 23/401 (6%)
 Frame = +2

Query  176   GRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDAEVENSFLIDETNRILDEIRSD  355
             G+ + +T +N +ITILCG VTILVLRGTIG G        V+ +  +D T  + D    +
Sbjct  16    GKMLQKTLHNSRITILCGVVTILVLRGTIGSG--------VDKTHFLDLTLDMDDIPDVE  67

Query  356   KDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDRHPRFPSSVKGKPRVLLVTGS  535
              DP  P              F LGP IT WDEQR  W  +HP    +++GK R+LLVTGS
Sbjct  68    WDPKVP--------------FKLGPTITNWDEQRAKWISKHPGANVNLQGKDRMLLVTGS  113

Query  536   PPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANMDREMDGNWAKLPLIRRLMLSH  715
              P  CENPVG+  LLK +KNKIDYCR+H I+I YN A++D EM G WAKLPL+R+L+L+H
Sbjct  114   QPRQCENPVGNFQLLKALKNKIDYCRLHDIDIFYNMAHLDIEMAGFWAKLPLLRKLLLAH  173

Query  716   PEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQDLLFDQKSWTALSTGSFLIRNC  895
             PE+EW+WWMDSDA FTDM+F++PL KY+++NLV+HG+ D ++ QK WT L+TGSF IRNC
Sbjct  174   PEMEWVWWMDSDALFTDMSFKVPLEKYNNYNLVLHGFDDKVYQQKLWTGLNTGSFFIRNC  233

Query  896   QWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEADDQSALIYLLMSEKDQWMDKV  1075
             QW+LDLLD WAPMGPKG IR  +G+ L+ +L GR  FEADDQSAL++LL++++ +W +KV
Sbjct  234   QWSLDLLDAWAPMGPKGVIRNRAGEMLSKSLVGRTNFEADDQSALVHLLIAQRQEWANKV  293

Query  1076  FLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVTHFVGCKAC-GSSGDFPVEKCV  1252
              LENSYYLHGYW  LV +YEE M K HPGFGD+RWPFVTHFVGCK C  + GD+PV+ C 
Sbjct  294   LLENSYYLHGYWVDLVGKYEENMAKSHPGFGDDRWPFVTHFVGCKPCVKNGGDYPVDTCF  353

Query  1253  KSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLPL  1375
             K M RAF FADNQ+L++ GF+HR L SP + RIR +T+ PL
Sbjct  354   KQMARAFTFADNQILDVLGFRHRKLGSPRVVRIREDTSHPL  394



>ref|XP_006479922.1| PREDICTED: putative glycosyltransferase 2-like isoform X2 [Citrus 
sinensis]
 gb|KDO87293.1| hypothetical protein CISIN_1g012077mg [Citrus sinensis]
Length=471

 Score =   469 bits (1208),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 228/435 (52%), Positives = 296/435 (68%), Gaps = 29/435 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI------DET  325
             R R+  R     K+T LC  +T++VLRG IG G   + +    E+ N           + 
Sbjct  10    RSRKFHRALRQCKVTALCLVLTVVVLRGIIGAGEFGTPEKDFYEIRNRLYFPSRKRGGDP  69

Query  326   NRILDEIRS------------DKDPDDP--------EGQSGDRFLSPNETFSLGPKITGW  445
             +R+L+E R+            +K+  D         +    D    PNE +S GPKI+ W
Sbjct  70    HRVLEERRTTSSSFATHDRNHNKNNYDEFNVKMFMEDNGEDDEKPDPNEPYSRGPKISNW  129

Query  446   DEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGI  625
             D QR  W + +P F + +  KPRVLLVTGS P  CENPVGDHYLLK +KNKIDYCR+HG+
Sbjct  130   DAQRAQWLNENPDFANFINKKPRVLLVTGSSPKACENPVGDHYLLKSIKNKIDYCRVHGL  189

Query  626   EIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSH  805
             EI Y++A +D EM G WAKLPLIR L+L HPE+E++WWMDSDA FTDM FE+P  +Y  +
Sbjct  190   EIFYSTALLDAEMAGFWAKLPLIRNLLLGHPEVEFLWWMDSDAMFTDMTFEVPWERYKDY  249

Query  806   NLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTAN  985
             NLV+HG+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+++GK LT  
Sbjct  250   NLVMHGWNEMVYDQKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDDAGKKLTKE  309

Query  986   LKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGF  1165
             LK RP FEADDQSA++Y L +E+D+W DKV+LE+ YYLH  WA LVDRYEE++EKY PG 
Sbjct  310   LKDRPAFEADDQSAMVYSLATERDKWGDKVYLESEYYLHVNWAILVDRYEEMIEKYRPGL  369

Query  1166  GDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIK  1345
             GD RWP VTHFVGCK C   GD   E+C++ M+RAF F DNQ+L  YGF H+ L S  +K
Sbjct  370   GDHRWPLVTHFVGCKPCAKFGDNLAERCLRQMDRAFTFGDNQILRTYGFTHKSLASGRVK  429

Query  1346  RIRNETTLPLPNVDR  1390
             R+RNET  PL   D+
Sbjct  430   RVRNETRNPLEVKDK  444



>ref|XP_006479923.1| PREDICTED: putative glycosyltransferase 2-like isoform X3 [Citrus 
sinensis]
Length=460

 Score =   469 bits (1206),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 228/435 (52%), Positives = 296/435 (68%), Gaps = 29/435 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI------DET  325
             R R+  R     K+T LC  +T++VLRG IG G   + +    E+ N           + 
Sbjct  10    RSRKFHRALRQCKVTALCLVLTVVVLRGIIGAGEFGTPEKDFYEIRNRLYFPSRKRGGDP  69

Query  326   NRILDEIRS------------DKDPDDP--------EGQSGDRFLSPNETFSLGPKITGW  445
             +R+L+E R+            +K+  D         +    D    PNE +S GPKI+ W
Sbjct  70    HRVLEERRTTSSSFATHDRNHNKNNYDEFNVKMFMEDNGEDDEKPDPNEPYSRGPKISNW  129

Query  446   DEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGI  625
             D QR  W + +P F + +  KPRVLLVTGS P  CENPVGDHYLLK +KNKIDYCR+HG+
Sbjct  130   DAQRAQWLNENPDFANFINKKPRVLLVTGSSPKACENPVGDHYLLKSIKNKIDYCRVHGL  189

Query  626   EIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSH  805
             EI Y++A +D EM G WAKLPLIR L+L HPE+E++WWMDSDA FTDM FE+P  +Y  +
Sbjct  190   EIFYSTALLDAEMAGFWAKLPLIRNLLLGHPEVEFLWWMDSDAMFTDMTFEVPWERYKDY  249

Query  806   NLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTAN  985
             NLV+HG+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+++GK LT  
Sbjct  250   NLVMHGWNEMVYDQKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDDAGKKLTKE  309

Query  986   LKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGF  1165
             LK RP FEADDQSA++Y L +E+D+W DKV+LE+ YYLH  WA LVDRYEE++EKY PG 
Sbjct  310   LKDRPAFEADDQSAMVYSLATERDKWGDKVYLESEYYLHVNWAILVDRYEEMIEKYRPGL  369

Query  1166  GDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIK  1345
             GD RWP VTHFVGCK C   GD   E+C++ M+RAF F DNQ+L  YGF H+ L S  +K
Sbjct  370   GDHRWPLVTHFVGCKPCAKFGDNLAERCLRQMDRAFTFGDNQILRTYGFTHKSLASGRVK  429

Query  1346  RIRNETTLPLPNVDR  1390
             R+RNET  PL   D+
Sbjct  430   RVRNETRNPLEVKDK  444



>gb|ABF95475.1| Glycosyltransferase 5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ43011.1| hypothetical protein OsJ_27597 [Oryza sativa Japonica Group]
Length=448

 Score =   468 bits (1204),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 242/433 (56%), Positives = 304/433 (70%), Gaps = 29/433 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLIDETNRILDE  343
             R R+I R   N K+T++C  +T++VLRGT+G G   +      E+ + F I   +R L E
Sbjct  12    RMREIQRFARNAKLTVVCLLLTVVVLRGTVGAGKFGTPQQDLIELRHRF-ISHPHRALAE  70

Query  344   ------------------IRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWF  469
                                + D +PD P     D        ++LGPKI+ WDEQR  W 
Sbjct  71    HHDALSRGGGSSSSSGRAAQRDDEPDPPPRTLRD------PPYTLGPKISDWDEQRAAWH  124

Query  470   DRHPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSA  646
              RHP  P  V   KPRVLLVTGS P PCENPVGDHYLLK +KNK+DYCR+HG+EI YN A
Sbjct  125   RRHPETPPFVNDVKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKMDYCRVHGLEIFYNMA  184

Query  647   NMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGY  826
              +D EM G WAKLPL+R L+L+HPEIE++WWMDSDA F+DMAFE+P  +Y  +NL++HG+
Sbjct  185   LLDAEMAGFWAKLPLLRALLLAHPEIEFLWWMDSDAMFSDMAFELPWERYGPYNLIMHGW  244

Query  827   QDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEF  1006
              ++++D K+W  L+TGSFL+RNCQW+LD LD WAPMGPKGP+R E+GK LT  LK RP F
Sbjct  245   DEMVYDDKNWIGLNTGSFLLRNCQWSLDFLDTWAPMGPKGPVRIEAGKVLTKYLKDRPVF  304

Query  1007  EADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPF  1186
             EADDQSA++Y+L +E+++W DKV+LEN YYLHGYW  LVDRYEE++E YHPG GD RWP 
Sbjct  305   EADDQSAMVYILATEREKWGDKVYLENGYYLHGYWGILVDRYEEMLENYHPGLGDHRWPL  364

Query  1187  VTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETT  1366
             VTHFVGCK CG  GD+PVE+C+K MERAFNF DNQ+L +YGF H+ L S  +KRIRNET+
Sbjct  365   VTHFVGCKPCGKFGDYPVERCLKQMERAFNFGDNQILQMYGFTHKSLGSRKVKRIRNETS  424

Query  1367  LPLPNVDRYDFRH  1405
              PL   D     H
Sbjct  425   NPLDVKDELGLLH  437



>gb|EAY89653.1| hypothetical protein OsI_11184 [Oryza sativa Indica Group]
Length=436

 Score =   467 bits (1202),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 241/431 (56%), Positives = 303/431 (70%), Gaps = 29/431 (7%)
 Frame = +2

Query  179   RQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLIDETNRILDE--  343
             R+I R   N K+T++C  +T++VLRGT+G G   +      E+ + F I   +R L E  
Sbjct  2     REIQRFARNAKLTVVCLLLTVVVLRGTVGAGKFGTPQQDLIELRHRF-ISHPHRALAEHH  60

Query  344   ----------------IRSDKDPDDPEGQSGDRFLSPNETFSLGPKITGWDEQRKVWFDR  475
                              + D +PD P     D        ++LGPKI+ WDEQR  W  R
Sbjct  61    DALSRGGGSSSSSGRAAQRDDEPDPPPRTLRD------PPYTLGPKISDWDEQRAAWHRR  114

Query  476   HPRFPSSVKG-KPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGIEIVYNSANM  652
             HP  P  V   KPRVLLVTGS P PCENPVGDHYLLK +KNK+DYCR+HG+EI YN A +
Sbjct  115   HPETPPFVNDVKPRVLLVTGSSPKPCENPVGDHYLLKSIKNKMDYCRVHGLEIFYNMALL  174

Query  653   DREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSHNLVIHGYQD  832
             D EM G WAKLPL+R L+L+HPEIE++WWMDSDA F+DMAFE+P  +Y  +NL++HG+ +
Sbjct  175   DAEMAGFWAKLPLLRALLLAHPEIEFLWWMDSDAMFSDMAFELPWERYGPYNLIMHGWDE  234

Query  833   LLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTANLKGRPEFEA  1012
             +++D K+W  L+TGSFL+RNCQW+LD LD WAPMGPKGP+R E+GK LT  LK RP FEA
Sbjct  235   MVYDDKNWIGLNTGSFLLRNCQWSLDFLDTWAPMGPKGPVRIEAGKVLTKYLKDRPVFEA  294

Query  1013  DDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGFGDERWPFVT  1192
             DDQSA++Y+L +E+++W DKV+LEN YYLHGYW  LVDRYEE++E YHPG GD RWP VT
Sbjct  295   DDQSAMVYILATEREKWGDKVYLENGYYLHGYWGILVDRYEEMLENYHPGLGDHRWPLVT  354

Query  1193  HFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIKRIRNETTLP  1372
             HFVGCK CG  GD+PVE+C+K MERAFNF DNQ+L +YGF H+ L S  +KRIRNET+ P
Sbjct  355   HFVGCKPCGKFGDYPVERCLKQMERAFNFGDNQILQMYGFTHKSLGSRKVKRIRNETSNP  414

Query  1373  LPNVDRYDFRH  1405
             L   D     H
Sbjct  415   LDVKDELGLLH  425



>ref|XP_006444290.1| hypothetical protein CICLE_v10020012mg [Citrus clementina]
 gb|ESR57530.1| hypothetical protein CICLE_v10020012mg [Citrus clementina]
Length=471

 Score =   468 bits (1205),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 228/435 (52%), Positives = 295/435 (68%), Gaps = 29/435 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI------DET  325
             R R+  R     K+T LC  +T++VLRG IG G   + +    E+ N           + 
Sbjct  10    RSRKFHRALRQCKVTALCLVLTVVVLRGIIGAGEFGTPEKDFYEIRNRLYFPSRKRGGDP  69

Query  326   NRILDEIRSD------------KDPDDP--------EGQSGDRFLSPNETFSLGPKITGW  445
             +R+L+E R+             K+  D         +    D    PNE +S GPKI+ W
Sbjct  70    HRVLEERRATSSSFATHDRNHYKNNYDEFNVKMFMEDNGEDDEKPDPNEPYSRGPKISNW  129

Query  446   DEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGI  625
             D QR  W + +P F + +  KPRVLLVTGS P  CENPVGDHYLLK +KNKIDYCR+HG+
Sbjct  130   DAQRAQWLNENPDFANFINKKPRVLLVTGSSPKACENPVGDHYLLKSIKNKIDYCRVHGL  189

Query  626   EIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSH  805
             EI Y++A +D EM G WAKLPLIR L+L HPE+E++WWMDSDA FTDM FE+P  +Y  +
Sbjct  190   EIFYSTALLDAEMAGFWAKLPLIRNLLLGHPEVEFLWWMDSDAMFTDMTFEVPWERYKDY  249

Query  806   NLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTAN  985
             NLV+HG+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+++GK LT  
Sbjct  250   NLVMHGWNEMVYDQKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDDAGKKLTKE  309

Query  986   LKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGF  1165
             LK RP FEADDQSA++Y L +E+D+W DKV+LE+ YYLH  WA LVDRYEE++EKY PG 
Sbjct  310   LKDRPAFEADDQSAMVYSLATERDKWGDKVYLESEYYLHVNWAILVDRYEEMIEKYRPGL  369

Query  1166  GDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIK  1345
             GD RWP VTHFVGCK C   GD   E+C++ M+RAF F DNQ+L  YGF H+ L S  +K
Sbjct  370   GDHRWPLVTHFVGCKPCAKFGDNLAERCLRQMDRAFTFGDNQILRTYGFTHKSLASGRVK  429

Query  1346  RIRNETTLPLPNVDR  1390
             R+RNET  PL   D+
Sbjct  430   RVRNETRNPLEVKDK  444



>ref|XP_006479921.1| PREDICTED: putative glycosyltransferase 2-like isoform X1 [Citrus 
sinensis]
Length=479

 Score =   469 bits (1206),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 228/435 (52%), Positives = 296/435 (68%), Gaps = 29/435 (7%)
 Frame = +2

Query  173   RGRQISRTFNNIKITILCGFVTILVLRGTIGVGNLASSDA---EVENSFLI------DET  325
             R R+  R     K+T LC  +T++VLRG IG G   + +    E+ N           + 
Sbjct  10    RSRKFHRALRQCKVTALCLVLTVVVLRGIIGAGEFGTPEKDFYEIRNRLYFPSRKRGGDP  69

Query  326   NRILDEIRS------------DKDPDDP--------EGQSGDRFLSPNETFSLGPKITGW  445
             +R+L+E R+            +K+  D         +    D    PNE +S GPKI+ W
Sbjct  70    HRVLEERRTTSSSFATHDRNHNKNNYDEFNVKMFMEDNGEDDEKPDPNEPYSRGPKISNW  129

Query  446   DEQRKVWFDRHPRFPSSVKGKPRVLLVTGSPPTPCENPVGDHYLLKGVKNKIDYCRIHGI  625
             D QR  W + +P F + +  KPRVLLVTGS P  CENPVGDHYLLK +KNKIDYCR+HG+
Sbjct  130   DAQRAQWLNENPDFANFINKKPRVLLVTGSSPKACENPVGDHYLLKSIKNKIDYCRVHGL  189

Query  626   EIVYNSANMDREMDGNWAKLPLIRRLMLSHPEIEWIWWMDSDAFFTDMAFEIPLSKYDSH  805
             EI Y++A +D EM G WAKLPLIR L+L HPE+E++WWMDSDA FTDM FE+P  +Y  +
Sbjct  190   EIFYSTALLDAEMAGFWAKLPLIRNLLLGHPEVEFLWWMDSDAMFTDMTFEVPWERYKDY  249

Query  806   NLVIHGYQDLLFDQKSWTALSTGSFLIRNCQWALDLLDVWAPMGPKGPIREESGKTLTAN  985
             NLV+HG+ ++++DQK+W  L+TGSFL+RNCQW+LD+LD WAPMGPKG +R+++GK LT  
Sbjct  250   NLVMHGWNEMVYDQKNWIGLNTGSFLLRNCQWSLDILDAWAPMGPKGKVRDDAGKKLTKE  309

Query  986   LKGRPEFEADDQSALIYLLMSEKDQWMDKVFLENSYYLHGYWAGLVDRYEEVMEKYHPGF  1165
             LK RP FEADDQSA++Y L +E+D+W DKV+LE+ YYLH  WA LVDRYEE++EKY PG 
Sbjct  310   LKDRPAFEADDQSAMVYSLATERDKWGDKVYLESEYYLHVNWAILVDRYEEMIEKYRPGL  369

Query  1166  GDERWPFVTHFVGCKACGSSGDFPVEKCVKSMERAFNFADNQVLNLYGFKHRGLLSPNIK  1345
             GD RWP VTHFVGCK C   GD   E+C++ M+RAF F DNQ+L  YGF H+ L S  +K
Sbjct  370   GDHRWPLVTHFVGCKPCAKFGDNLAERCLRQMDRAFTFGDNQILRTYGFTHKSLASGRVK  429

Query  1346  RIRNETTLPLPNVDR  1390
             R+RNET  PL   D+
Sbjct  430   RVRNETRNPLEVKDK  444



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5427396672374