BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c819_g1_i1 len=655 path=[679:0-60 739:61-61 24:62-654]

Length=655
                                                                      Score     E

ref|XP_009759349.1|  PREDICTED: uncharacterized transporter C5D6....    260   2e-81   
ref|XP_009759350.1|  PREDICTED: uncharacterized transporter C5D6....    260   2e-81   
ref|XP_009607642.1|  PREDICTED: uncharacterized transporter C5D6.04     260   3e-81   
gb|KHG10464.1|  Transporter protein                                     258   2e-80   
ref|XP_004232583.1|  PREDICTED: uncharacterized transporter C5D6....    255   1e-79   
gb|KDO71544.1|  hypothetical protein CISIN_1g013221mg                   249   7e-79   
ref|XP_009614500.1|  PREDICTED: uncharacterized protein LOC104107...    252   3e-78   
ref|XP_007046466.1|  Auxin efflux carrier family protein isoform 2      252   4e-78   
ref|XP_007046465.1|  Auxin efflux carrier family protein isoform 1      252   5e-78   
gb|KHG04809.1|  Transporter protein                                     251   5e-78   
ref|XP_009779996.1|  PREDICTED: uncharacterized protein LOC104229115    251   6e-78   
gb|KDO71541.1|  hypothetical protein CISIN_1g013221mg                   247   2e-77   
gb|KDO71543.1|  hypothetical protein CISIN_1g013221mg                   247   4e-77   
emb|CDP01772.1|  unnamed protein product                                249   6e-77   
ref|XP_006467106.1|  PREDICTED: uncharacterized transporter YBR28...    248   9e-77   
ref|XP_010029570.1|  PREDICTED: uncharacterized protein LOC104419566    248   9e-77   
ref|XP_006425253.1|  hypothetical protein CICLE_v10025741mg             248   9e-77   
ref|XP_002521739.1|  auxin:hydrogen symporter, putative                 248   1e-76   Ricinus communis
ref|XP_002306421.2|  auxin efflux carrier family protein                248   1e-76   Populus trichocarpa [western balsam poplar]
ref|XP_011096970.1|  PREDICTED: uncharacterized transporter C5D6....    246   2e-76   
ref|XP_011022138.1|  PREDICTED: uncharacterized transporter YBR28...    247   2e-76   
gb|KDO71539.1|  hypothetical protein CISIN_1g013221mg                   246   3e-76   
ref|XP_010317676.1|  PREDICTED: uncharacterized protein LOC101262895    246   3e-76   
ref|XP_011096969.1|  PREDICTED: uncharacterized transporter C5D6....    247   3e-76   
gb|KDO71532.1|  hypothetical protein CISIN_1g013221mg                   247   4e-76   
gb|KDO71540.1|  hypothetical protein CISIN_1g013221mg                   247   5e-76   
gb|KDO71534.1|  hypothetical protein CISIN_1g013221mg                   247   7e-76   
ref|XP_006388075.1|  hypothetical protein POPTR_0365s00230g             246   8e-76   
dbj|BAH19704.1|  AT2G17500                                              238   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010103240.1|  putative transporter                               243   1e-74   
ref|XP_010530989.1|  PREDICTED: uncharacterized transporter YBR287W     242   2e-74   
ref|XP_010270520.1|  PREDICTED: uncharacterized protein LOC104606828    242   2e-74   
ref|XP_010489377.1|  PREDICTED: uncharacterized transporter YBR28...    241   4e-74   
ref|XP_010467522.1|  PREDICTED: uncharacterized transporter YBR28...    241   5e-74   
ref|XP_010550503.1|  PREDICTED: uncharacterized transporter YBR28...    241   6e-74   
ref|XP_009121108.1|  PREDICTED: uncharacterized transporter YBR287W     240   6e-74   
emb|CDY24342.1|  BnaA07g02670D                                          240   7e-74   
ref|XP_010514952.1|  PREDICTED: uncharacterized transporter YBR28...    240   7e-74   
ref|XP_010266240.1|  PREDICTED: uncharacterized transporter YBR287W     241   8e-74   
ref|XP_006393787.1|  hypothetical protein EUTSA_v10005581mg             240   1e-73   
emb|CDY57767.1|  BnaC02g45080D                                          240   1e-73   
ref|XP_010548200.1|  PREDICTED: uncharacterized transporter YBR28...    240   1e-73   
emb|CDY55102.1|  BnaA02g34870D                                          239   1e-73   
ref|XP_009112263.1|  PREDICTED: uncharacterized transporter YBR287W     239   2e-73   
emb|CDY18579.1|  BnaA09g08160D                                          239   2e-73   
ref|XP_002866780.1|  predicted protein                                  239   2e-73   
ref|XP_011099928.1|  PREDICTED: uncharacterized transporter YBR28...    239   2e-73   
ref|NP_201399.1|  auxin efflux carrier family protein                   239   2e-73   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81425.1|  BnaC09g08360D                                          239   2e-73   
ref|XP_002884062.1|  auxin efflux carrier family protein                239   2e-73   
ref|XP_010466350.1|  PREDICTED: uncharacterized transporter YBR28...    239   3e-73   
ref|XP_010270517.1|  PREDICTED: uncharacterized protein LOC104606827    239   3e-73   
gb|KFK28259.1|  hypothetical protein AALP_AA8G493500                    239   3e-73   
ref|XP_006282359.1|  hypothetical protein CARUB_v10028656mg             238   4e-73   
emb|CDY26812.1|  BnaC09g09390D                                          238   5e-73   
ref|XP_009112433.1|  PREDICTED: uncharacterized transporter YBR28...    238   5e-73   
ref|XP_006299821.1|  hypothetical protein CARUB_v10016022mg             238   5e-73   
ref|XP_010550502.1|  PREDICTED: uncharacterized transporter YBR28...    239   6e-73   
ref|XP_010680628.1|  PREDICTED: uncharacterized transporter YBR28...    238   7e-73   
gb|KDP43785.1|  hypothetical protein JCGZ_22412                         238   9e-73   
ref|XP_007202341.1|  hypothetical protein PRUPE_ppa008223mg             236   1e-72   
ref|XP_002276744.2|  PREDICTED: uncharacterized transporter YBR287W     238   1e-72   Vitis vinifera
ref|NP_565417.1|  auxin efflux carrier family protein                   237   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAM60930.1|  unknown                                                 237   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242098.1|  PREDICTED: uncharacterized transporter YBR287W     237   3e-72   
ref|XP_006409300.1|  hypothetical protein EUTSA_v10022717mg             232   9e-71   
ref|XP_006343325.1|  PREDICTED: uncharacterized transporter YBR28...    231   2e-70   
gb|KDO71531.1|  hypothetical protein CISIN_1g013221mg                   229   1e-69   
gb|KGN55596.1|  hypothetical protein Csa_3G000690                       230   1e-69   
ref|XP_004159743.1|  PREDICTED: uncharacterized transporter YBR28...    229   2e-69   
ref|XP_009386671.1|  PREDICTED: uncharacterized transporter YBR28...    228   3e-69   
ref|XP_008393334.1|  PREDICTED: uncharacterized transporter YBR28...    229   3e-69   
ref|XP_004287713.1|  PREDICTED: uncharacterized transporter YBR28...    228   7e-69   
ref|XP_009369785.1|  PREDICTED: uncharacterized transporter YBR28...    227   2e-68   
ref|XP_008448449.1|  PREDICTED: uncharacterized transporter YBR28...    226   4e-68   
ref|XP_009130575.1|  PREDICTED: uncharacterized transporter YBR28...    224   1e-67   
ref|XP_010918345.1|  PREDICTED: uncharacterized protein LOC105042...    224   2e-67   
gb|EYU30838.1|  hypothetical protein MIMGU_mgv1a007822mg                223   3e-67   
ref|XP_006855674.1|  hypothetical protein AMTR_s00044p00126910          224   5e-67   
ref|XP_009418347.1|  PREDICTED: uncharacterized transporter YBR28...    223   6e-67   
ref|XP_004146179.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    223   1e-66   
ref|XP_009420837.1|  PREDICTED: uncharacterized protein LOC104000492    222   1e-66   
ref|XP_004146180.1|  PREDICTED: uncharacterized transporter YBR28...    221   4e-66   
ref|XP_008804451.1|  PREDICTED: uncharacterized transporter YBR28...    220   9e-66   
ref|XP_003612404.1|  Transporter, putative                              219   1e-65   
gb|EPS57973.1|  hypothetical protein M569_16844                         218   7e-65   
ref|XP_008448455.1|  PREDICTED: uncharacterized transporter C5D6....    217   2e-64   
gb|ABR18184.1|  unknown                                                 217   4e-64   Picea sitchensis
ref|XP_007158024.1|  hypothetical protein PHAVU_002G117700g             216   4e-64   
ref|XP_003537691.1|  PREDICTED: uncharacterized transporter YBR28...    216   4e-64   
gb|KEH27632.1|  auxin efflux carrier family protein                     212   5e-64   
ref|XP_010935349.1|  PREDICTED: uncharacterized transporter YBR28...    214   1e-63   
ref|XP_003517128.1|  PREDICTED: uncharacterized transporter YBR28...    213   4e-63   
gb|KEH27633.1|  auxin efflux carrier family protein                     212   6e-63   
ref|XP_003612402.1|  Transporter, putative                              211   2e-62   
gb|EMT16972.1|  Putative transporter                                    210   7e-62   
ref|XP_003578612.1|  PREDICTED: uncharacterized protein LOC100833440    209   1e-61   
ref|XP_004146216.1|  PREDICTED: uncharacterized transporter YBR28...    208   2e-61   
ref|XP_004159761.1|  PREDICTED: uncharacterized transporter YBR28...    208   3e-61   
ref|XP_004512284.1|  PREDICTED: uncharacterized transporter YBR28...    207   6e-61   
gb|AES95354.2|  auxin efflux carrier family protein                     200   6e-61   
ref|NP_001063887.1|  Os09g0554300                                       207   1e-60   Oryza sativa Japonica Group [Japonica rice]
emb|CAN62432.1|  hypothetical protein VITISV_012649                     207   1e-60   Vitis vinifera
ref|NP_001280772.1|  uncharacterized transporter YBR287W-like           206   1e-60   
dbj|BAK01989.1|  predicted protein                                      205   4e-60   
ref|XP_009420836.1|  PREDICTED: uncharacterized transporter YBR28...    205   4e-60   
ref|XP_004509460.1|  PREDICTED: uncharacterized transporter YBR28...    205   4e-60   
ref|XP_009359620.1|  PREDICTED: uncharacterized transporter YBR287W     205   5e-60   
ref|XP_008448451.1|  PREDICTED: uncharacterized transporter YBR28...    204   6e-60   
ref|XP_008448450.1|  PREDICTED: uncharacterized transporter YBR28...    204   7e-60   
ref|XP_004957592.1|  PREDICTED: uncharacterized transporter YBR28...    204   8e-60   
ref|XP_006660956.1|  PREDICTED: uncharacterized transporter YBR28...    203   3e-59   
gb|AET03577.2|  auxin efflux carrier family protein                     201   4e-59   
gb|EMS54288.1|  Uncharacterized transporter C5D6.04                     202   9e-59   
ref|XP_003629101.1|  Transporter, putative                              201   1e-58   
ref|XP_009401008.1|  PREDICTED: uncharacterized transporter YBR28...    201   1e-58   
ref|XP_003612396.1|  hypothetical protein MTR_5g024580                  194   1e-58   
ref|XP_007156259.1|  hypothetical protein PHAVU_003G271200g             199   6e-58   
gb|ABR16386.1|  unknown                                                 199   2e-57   Picea sitchensis
ref|XP_003562144.1|  PREDICTED: uncharacterized protein LOC100832109    197   6e-57   
ref|XP_003533405.1|  PREDICTED: uncharacterized transporter YBR28...    197   6e-57   
gb|KGN55594.1|  hypothetical protein Csa_3G000180                       190   9e-55   
ref|XP_002468584.1|  hypothetical protein SORBIDRAFT_01g048490          188   2e-54   Sorghum bicolor [broomcorn]
ref|XP_003612433.1|  Auxin efflux carrier protein                       183   2e-53   
gb|AET03524.2|  auxin efflux carrier family protein                     186   4e-53   
ref|XP_003629048.1|  Transporter, putative                              186   4e-53   
ref|XP_003612432.1|  Auxin efflux carrier protein                       183   4e-53   
ref|XP_004509473.1|  PREDICTED: uncharacterized transporter YBR28...    185   1e-52   
ref|XP_009614501.1|  PREDICTED: uncharacterized protein LOC104107...    184   1e-52   
ref|XP_006304763.1|  hypothetical protein CARUB_v10012230mg             185   1e-52   
gb|AES95391.2|  auxin efflux carrier family protein                     183   2e-52   
gb|KEH27638.1|  auxin efflux carrier family protein                     182   2e-52   
ref|XP_006382981.1|  hypothetical protein POPTR_0005s10230g             184   2e-52   
ref|NP_001147841.1|  auxin Efflux Carrier family protein                184   4e-52   Zea mays [maize]
gb|AFK32350.1|  putative auxin efflux carrier-like protein PINX         184   4e-52   
gb|AES95390.2|  auxin efflux carrier family protein                     182   1e-51   
ref|XP_007156270.1|  hypothetical protein PHAVU_003G272300g             183   1e-51   
ref|XP_006660957.1|  PREDICTED: uncharacterized transporter YBR28...    182   2e-51   
ref|NP_001063888.2|  Os09g0555100                                       182   2e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EEE70196.1|  hypothetical protein OsJ_30282                          182   3e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EEC85032.1|  hypothetical protein OsI_32336                          182   3e-51   Oryza sativa Indica Group [Indian rice]
gb|KDO85260.1|  hypothetical protein CISIN_1g015164mg                   178   5e-51   
ref|XP_003612431.1|  Auxin efflux carrier protein                       181   6e-51   
ref|XP_006435462.1|  hypothetical protein CICLE_v10001325mg             178   6e-51   
ref|XP_006435465.1|  hypothetical protein CICLE_v10001325mg             178   9e-51   
emb|CDP01745.1|  unnamed protein product                                181   9e-51   
ref|XP_006416347.1|  hypothetical protein EUTSA_v10009415mg             180   9e-51   
emb|CDY31514.1|  BnaC05g16230D                                          182   1e-50   
emb|CDY57768.1|  BnaC02g45090D                                          172   2e-50   
ref|XP_008786677.1|  PREDICTED: uncharacterized transporter YBR28...    180   2e-50   
ref|XP_002317029.1|  hypothetical protein POPTR_0011s14860g             179   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002890416.1|  auxin efflux carrier family protein                179   2e-50   
ref|XP_006377867.1|  hypothetical protein POPTR_0011s14860g             179   3e-50   
ref|XP_003573172.1|  PREDICTED: uncharacterized transporter YBR28...    180   3e-50   
ref|NP_683316.2|  auxin efflux carrier-like protein                     181   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KDO85259.1|  hypothetical protein CISIN_1g015164mg                   178   5e-50   
gb|ACU18030.1|  unknown                                                 174   1e-49   Glycine max [soybeans]
ref|XP_011100009.1|  PREDICTED: uncharacterized protein LOC105178...    176   1e-49   
ref|XP_004515365.1|  PREDICTED: uncharacterized protein LOC101492...    176   1e-49   
gb|EYU41206.1|  hypothetical protein MIMGU_mgv1a018588mg                176   1e-49   
ref|XP_009149573.1|  PREDICTED: uncharacterized transporter YBR287W     177   1e-49   
gb|KDO85258.1|  hypothetical protein CISIN_1g015164mg                   177   2e-49   
gb|ABK92888.1|  unknown                                                 177   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_006473865.1|  PREDICTED: uncharacterized transporter YBR28...    177   2e-49   
emb|CDY29492.1|  BnaA06g14780D                                          176   2e-49   
ref|XP_006435464.1|  hypothetical protein CICLE_v10001325mg             177   2e-49   
ref|XP_003534224.1|  PREDICTED: uncharacterized protein LOC100810...    177   3e-49   
ref|XP_006370751.1|  hypothetical protein POPTR_0001s46060g             176   3e-49   
ref|XP_009798616.1|  PREDICTED: uncharacterized transporter YBR28...    177   3e-49   
gb|ACJ85428.1|  unknown                                                 176   4e-49   Medicago truncatula
ref|NP_001242102.1|  uncharacterized protein LOC100791609               176   4e-49   
ref|XP_006599266.1|  PREDICTED: uncharacterized protein LOC100817...    176   4e-49   
gb|KGN55542.1|  hypothetical protein Csa_4G664490                       176   4e-49   
ref|XP_003520432.1|  PREDICTED: uncharacterized transporter YBR28...    176   5e-49   
ref|XP_006590301.1|  PREDICTED: uncharacterized protein LOC100791...    176   5e-49   
gb|KHN41796.1|  Putative transporter                                    176   5e-49   
ref|XP_007010159.1|  Auxin efflux carrier family protein                176   5e-49   
ref|XP_011038091.1|  PREDICTED: uncharacterized transporter YBR28...    176   5e-49   
ref|XP_011038089.1|  PREDICTED: uncharacterized transporter YBR28...    176   6e-49   
ref|XP_008453020.1|  PREDICTED: uncharacterized transporter YBR28...    176   9e-49   
ref|XP_010270584.1|  PREDICTED: uncharacterized protein LOC104606...    175   9e-49   
ref|XP_010270583.1|  PREDICTED: uncharacterized transporter YBR28...    175   9e-49   
ref|XP_006370750.1|  hypothetical protein POPTR_0001s46060g             175   9e-49   
ref|XP_008786678.1|  PREDICTED: uncharacterized protein LOC103704...    174   9e-49   
ref|XP_004515364.1|  PREDICTED: uncharacterized protein LOC101492...    176   9e-49   
ref|XP_006370747.1|  hypothetical protein POPTR_0001s46060g             175   9e-49   
ref|XP_010033614.1|  PREDICTED: uncharacterized transporter C5D6....    176   1e-48   
ref|XP_010270585.1|  PREDICTED: uncharacterized protein LOC104606...    174   1e-48   
ref|XP_011099988.1|  PREDICTED: uncharacterized transporter YBR28...    175   1e-48   
gb|KHN44555.1|  Putative transporter C5D6.04                            176   1e-48   
ref|XP_011100000.1|  PREDICTED: uncharacterized transporter YBR28...    175   1e-48   
ref|XP_009592191.1|  PREDICTED: uncharacterized transporter YBR28...    175   1e-48   
ref|XP_008237902.1|  PREDICTED: uncharacterized transporter YBR28...    175   1e-48   
ref|NP_565133.1|  auxin efflux carrier family protein                   174   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300096.1|  PREDICTED: uncharacterized transporter YBR28...    175   1e-48   
gb|AAM62517.1|  unknown                                                 174   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007018644.1|  Auxin efflux carrier family protein, putative      175   2e-48   
dbj|BAH57041.1|  AT1G76520                                              171   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006437711.1|  hypothetical protein CICLE_v10031658mg             170   2e-48   
ref|XP_010270580.1|  PREDICTED: uncharacterized transporter C5D6....    174   2e-48   
ref|XP_008787017.1|  PREDICTED: uncharacterized transporter YBR28...    175   2e-48   
ref|XP_007209188.1|  hypothetical protein PRUPE_ppa006413mg             174   2e-48   
gb|KDO70039.1|  hypothetical protein CISIN_1g014841mg                   170   2e-48   
ref|XP_007211270.1|  hypothetical protein PRUPE_ppa017924mg             174   2e-48   
ref|XP_007134485.1|  hypothetical protein PHAVU_010G051100g             174   2e-48   
ref|XP_003517114.1|  PREDICTED: uncharacterized protein LOC100785...    174   2e-48   
gb|KHN28298.1|  Putative transporter C5D6.04                            174   2e-48   
ref|XP_007134484.1|  hypothetical protein PHAVU_010G051100g             174   3e-48   
ref|XP_007046429.1|  Auxin:hydrogen symporter, putative isoform 1       174   3e-48   
gb|KDP36734.1|  hypothetical protein JCGZ_08025                         174   3e-48   
ref|XP_002887644.1|  hypothetical protein ARALYDRAFT_895536             174   3e-48   
ref|XP_006342188.1|  PREDICTED: uncharacterized transporter YBR28...    174   3e-48   
ref|XP_003570731.1|  PREDICTED: uncharacterized transporter YBR28...    174   4e-48   
ref|XP_004231634.1|  PREDICTED: uncharacterized protein LOC101264385    173   4e-48   
gb|KEH17832.1|  auxin efflux carrier family protein                     174   4e-48   
gb|KHN30729.1|  hypothetical protein glysoja_034072                     166   6e-48   
emb|CDP01746.1|  unnamed protein product                                173   6e-48   
dbj|BAJ86794.1|  predicted protein                                      174   7e-48   
emb|CDX87589.1|  BnaA07g32840D                                          172   7e-48   
ref|XP_009106321.1|  PREDICTED: uncharacterized transporter YBR28...    172   7e-48   
gb|KDO70038.1|  hypothetical protein CISIN_1g014841mg                   170   8e-48   
emb|CDP07249.1|  unnamed protein product                                166   8e-48   
ref|XP_008786672.1|  PREDICTED: uncharacterized transporter YBR28...    173   9e-48   
ref|XP_006437713.1|  hypothetical protein CICLE_v10031658mg             170   1e-47   
gb|KDP24915.1|  hypothetical protein JCGZ_24293                         171   1e-47   
ref|XP_004238466.1|  PREDICTED: uncharacterized transporter YBR28...    172   1e-47   
ref|XP_004300092.1|  PREDICTED: uncharacterized transporter YBR28...    172   1e-47   
gb|KDO70035.1|  hypothetical protein CISIN_1g014841mg                   169   1e-47   
ref|XP_006465068.1|  PREDICTED: uncharacterized protein LOC102630978    167   1e-47   
ref|XP_006350447.1|  PREDICTED: uncharacterized transporter YBR28...    172   2e-47   
ref|NP_001241160.1|  uncharacterized protein LOC100807081               171   2e-47   
ref|XP_010471808.1|  PREDICTED: uncharacterized transporter YBR28...    172   2e-47   
ref|XP_010033618.1|  PREDICTED: uncharacterized transporter C5D6....    172   2e-47   
ref|XP_010266292.1|  PREDICTED: uncharacterized transporter YBR28...    172   2e-47   
ref|XP_009390658.1|  PREDICTED: uncharacterized transporter YBR28...    172   3e-47   
ref|XP_010094502.1|  Uncharacterized transporter                        172   3e-47   
ref|XP_010428718.1|  PREDICTED: uncharacterized transporter YBR28...    171   5e-47   
ref|XP_009128182.1|  PREDICTED: uncharacterized transporter YBR28...    170   5e-47   
ref|XP_008373348.1|  PREDICTED: uncharacterized protein LOC103436679    164   6e-47   
ref|XP_002317634.2|  hypothetical protein POPTR_0011s14870g             170   6e-47   Populus trichocarpa [western balsam poplar]
emb|CDY20402.1|  BnaC02g24140D                                          170   6e-47   
ref|XP_006589306.1|  PREDICTED: uncharacterized transporter YBR28...    170   6e-47   
gb|EPS71464.1|  hypothetical protein M569_03295                         165   7e-47   
ref|XP_009600852.1|  PREDICTED: uncharacterized protein LOC104096...    169   9e-47   
emb|CDP01747.1|  unnamed protein product                                170   9e-47   
gb|KEH17833.1|  auxin efflux carrier family protein                     168   1e-46   
ref|XP_007158042.1|  hypothetical protein PHAVU_002G119300g             170   1e-46   
ref|XP_010932122.1|  PREDICTED: uncharacterized transporter YBR28...    170   1e-46   
ref|XP_008373331.1|  PREDICTED: uncharacterized transporter YBR28...    169   2e-46   
ref|XP_009372647.1|  PREDICTED: uncharacterized transporter YBR28...    169   2e-46   
ref|XP_008364468.1|  PREDICTED: uncharacterized transporter YBR28...    169   2e-46   
gb|KDP24916.1|  hypothetical protein JCGZ_24294                         170   2e-46   
ref|XP_009600851.1|  PREDICTED: uncharacterized protein LOC104096...    169   2e-46   
ref|XP_006370746.1|  hypothetical protein POPTR_0001s46050g             169   3e-46   
gb|KHN38844.1|  hypothetical protein glysoja_014836                     164   3e-46   
ref|XP_002301894.1|  auxin efflux carrier family protein                168   4e-46   Populus trichocarpa [western balsam poplar]
ref|XP_006437709.1|  hypothetical protein CICLE_v10031658mg             168   4e-46   
ref|XP_006849937.1|  hypothetical protein AMTR_s00022p00124760          165   4e-46   
gb|KDO70033.1|  hypothetical protein CISIN_1g014841mg                   168   4e-46   
ref|XP_011038092.1|  PREDICTED: uncharacterized transporter YBR28...    168   6e-46   
ref|XP_006390184.1|  hypothetical protein EUTSA_v10018685mg             167   7e-46   
ref|XP_010416572.1|  PREDICTED: uncharacterized transporter YBR28...    167   8e-46   
ref|XP_009762862.1|  PREDICTED: uncharacterized protein LOC104214...    166   1e-45   
ref|XP_011034783.1|  PREDICTED: uncharacterized transporter YBR28...    167   1e-45   
ref|XP_010681116.1|  PREDICTED: uncharacterized transporter C5D6....    167   1e-45   
ref|XP_010681118.1|  PREDICTED: uncharacterized protein LOC104896...    166   1e-45   
emb|CDP01744.1|  unnamed protein product                                167   2e-45   
gb|KEH27639.1|  auxin efflux carrier family protein                     167   2e-45   
ref|XP_010094503.1|  Uncharacterized transporter                        166   2e-45   
ref|XP_010428717.1|  PREDICTED: uncharacterized transporter YBR28...    166   2e-45   
ref|XP_006432166.1|  hypothetical protein CICLE_v10001450mg             166   2e-45   
ref|XP_008373350.1|  PREDICTED: uncharacterized transporter YBR28...    166   3e-45   
ref|XP_011004410.1|  PREDICTED: uncharacterized transporter YBR28...    166   3e-45   
ref|XP_010649328.1|  PREDICTED: uncharacterized protein LOC100249...    166   3e-45   
gb|KHG24871.1|  Transporter protein                                     166   3e-45   
ref|XP_009104669.1|  PREDICTED: uncharacterized transporter YBR28...    165   3e-45   
gb|KHG24872.1|  putative transporter C5D6.04                            166   3e-45   
ref|XP_007010169.1|  Auxin efflux carrier family protein                166   4e-45   
ref|XP_010471806.1|  PREDICTED: uncharacterized transporter YBR28...    165   4e-45   
ref|XP_009762861.1|  PREDICTED: uncharacterized protein LOC104214...    166   4e-45   
ref|XP_010428716.1|  PREDICTED: uncharacterized transporter YBR28...    164   7e-45   
ref|XP_011030710.1|  PREDICTED: uncharacterized transporter YBR28...    165   1e-44   
ref|XP_011027947.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    164   2e-44   
ref|XP_010680488.1|  PREDICTED: uncharacterized transporter YBR28...    164   2e-44   
ref|XP_010103231.1|  Uncharacterized transporter                        164   3e-44   
ref|XP_004253114.1|  PREDICTED: uncharacterized transporter C5D6....    163   4e-44   
ref|XP_008805481.1|  PREDICTED: uncharacterized transporter YBR28...    162   5e-44   
ref|NP_001175916.1|  Os09g0491740                                       162   5e-44   
ref|XP_011027948.1|  PREDICTED: uncharacterized transporter C5D6....    163   5e-44   
gb|EEC84799.1|  hypothetical protein OsI_31863                          162   7e-44   
gb|KDO70034.1|  hypothetical protein CISIN_1g014841mg                   162   9e-44   
ref|XP_009372645.1|  PREDICTED: uncharacterized transporter YBR28...    162   9e-44   
gb|EEE69960.1|  hypothetical protein OsJ_29847                          162   1e-43   
ref|XP_002462580.1|  hypothetical protein SORBIDRAFT_02g028520          162   1e-43   
ref|XP_011004415.1|  PREDICTED: uncharacterized transporter YBR28...    162   1e-43   
ref|XP_008237904.1|  PREDICTED: uncharacterized transporter YBR28...    162   1e-43   
ref|XP_011030712.1|  PREDICTED: uncharacterized transporter YBR28...    162   1e-43   
dbj|BAJ99434.1|  predicted protein                                      161   1e-43   
ref|XP_006584228.1|  PREDICTED: uncharacterized protein LOC100807965    163   1e-43   
ref|XP_010029546.1|  PREDICTED: uncharacterized protein LOC104419...    161   2e-43   
ref|XP_007010173.1|  Auxin efflux carrier family protein                161   2e-43   
gb|AAD30600.1|AC007369_10  Hypothetical protein                         160   2e-43   
ref|XP_002982798.1|  hypothetical protein SELMODRAFT_117190             161   3e-43   
ref|XP_002981829.1|  hypothetical protein SELMODRAFT_115659             160   3e-43   
gb|EMS57690.1|  hypothetical protein TRIUR3_00891                       160   3e-43   
ref|XP_004957210.1|  PREDICTED: uncharacterized protein LOC101771023    160   3e-43   
ref|NP_177779.1|  auxin efflux carrier family protein                   160   3e-43   
gb|AES95349.2|  auxin efflux carrier family protein                     159   4e-43   
ref|XP_008358580.1|  PREDICTED: uncharacterized protein LOC103422308    155   4e-43   
gb|KEH17831.1|  auxin efflux carrier family protein                     160   4e-43   
ref|XP_003612391.1|  hypothetical protein MTR_5g024520                  159   5e-43   
dbj|BAK04863.1|  predicted protein                                      160   6e-43   
gb|KCW56460.1|  hypothetical protein EUGRSUZ_I02196                     159   6e-43   
ref|XP_010029545.1|  PREDICTED: uncharacterized transporter C5D6....    160   6e-43   
ref|XP_010913879.1|  PREDICTED: uncharacterized transporter YBR28...    159   8e-43   
ref|XP_007134489.1|  hypothetical protein PHAVU_010G051500g             160   8e-43   
ref|XP_002528529.1|  auxin:hydrogen symporter, putative                 160   9e-43   
ref|XP_002528527.1|  auxin:hydrogen symporter, putative                 159   9e-43   
ref|XP_010029544.1|  PREDICTED: uncharacterized transporter C5D6....    160   1e-42   
gb|EMT00616.1|  Putative transporter                                    159   1e-42   
ref|XP_011099968.1|  PREDICTED: uncharacterized transporter C5D6....    159   1e-42   
ref|XP_010679878.1|  PREDICTED: uncharacterized transporter YBR28...    158   3e-42   
ref|XP_002462579.1|  hypothetical protein SORBIDRAFT_02g028510          158   3e-42   
ref|XP_010679877.1|  PREDICTED: uncharacterized transporter YBR28...    158   4e-42   
ref|XP_007209181.1|  hypothetical protein PRUPE_ppa006339mg             158   4e-42   
gb|AFW58767.1|  hypothetical protein ZEAMMB73_122963                    158   5e-42   
ref|XP_004145562.1|  PREDICTED: uncharacterized protein LOC101208244    156   1e-41   
ref|XP_002462581.1|  hypothetical protein SORBIDRAFT_02g028530          156   1e-41   
gb|KHG29771.1|  SPAC5D6.04: Uncharacterized transporter C5D6.04         156   2e-41   
gb|KHG29772.1|  SPAC5D6.04: Uncharacterized transporter C5D6.04         156   2e-41   
ref|XP_002263531.1|  PREDICTED: uncharacterized transporter YBR28...    155   2e-41   
tpg|DAA62056.1|  TPA: hypothetical protein ZEAMMB73_195263              156   3e-41   
ref|XP_008663364.1|  PREDICTED: uncharacterized protein LOC103641814    155   3e-41   
emb|CBI37491.3|  unnamed protein product                                155   3e-41   
ref|XP_004234500.1|  PREDICTED: uncharacterized transporter YBR28...    155   3e-41   
ref|XP_006343315.1|  PREDICTED: uncharacterized transporter YBR28...    155   3e-41   
ref|XP_002264606.1|  PREDICTED: uncharacterized transporter C5D6....    155   4e-41   
ref|XP_006661381.1|  PREDICTED: uncharacterized protein LOC102707339    154   1e-40   
ref|XP_008652869.1|  PREDICTED: uncharacterized protein LOC103632939    154   1e-40   
ref|XP_003578336.1|  PREDICTED: uncharacterized protein LOC100826810    153   2e-40   
ref|XP_001766817.1|  predicted protein                                  152   3e-40   
ref|XP_002528528.1|  auxin:hydrogen symporter, putative                 152   5e-40   
ref|XP_007010166.1|  Auxin efflux carrier family protein                152   6e-40   
gb|KHN01043.1|  Putative transporter C5D6.04                            152   6e-40   
gb|KCW56462.1|  hypothetical protein EUGRSUZ_I02197                     149   1e-39   
ref|XP_002526514.1|  auxin:hydrogen symporter, putative                 152   1e-39   
ref|XP_003555504.2|  PREDICTED: uncharacterized transporter YBR28...    152   1e-39   
ref|XP_009600925.1|  PREDICTED: uncharacterized transporter C5D6....    150   1e-39   
ref|XP_009772486.1|  PREDICTED: uncharacterized transporter YBR28...    151   1e-39   
ref|XP_009366044.1|  PREDICTED: uncharacterized transporter YBR28...    149   3e-39   
dbj|BAG92093.1|  unnamed protein product                                148   7e-39   
ref|XP_007134486.1|  hypothetical protein PHAVU_010G051200g             148   1e-38   
ref|XP_010029548.1|  PREDICTED: uncharacterized transporter YBR28...    148   1e-38   
gb|KCW76787.1|  hypothetical protein EUGRSUZ_D01141                     145   5e-38   
ref|XP_007144117.1|  hypothetical protein PHAVU_007G130200g             146   7e-38   
ref|XP_010649334.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    145   2e-37   
ref|XP_010550501.1|  PREDICTED: uncharacterized transporter YBR28...    145   2e-37   
ref|XP_010052720.1|  PREDICTED: uncharacterized transporter YBR28...    145   3e-37   
gb|KDO71535.1|  hypothetical protein CISIN_1g013221mg                   143   4e-37   
ref|XP_010681117.1|  PREDICTED: uncharacterized transporter C5D6....    144   4e-37   
ref|XP_010550500.1|  PREDICTED: uncharacterized transporter YBR28...    144   8e-37   
ref|XP_007010162.1|  Auxin efflux carrier family protein isoform 5      141   2e-36   
ref|XP_006382976.1|  hypothetical protein POPTR_0005s10230g             140   3e-36   
ref|XP_007010163.1|  Auxin efflux carrier family protein isoform 6      141   4e-36   
ref|XP_007010160.1|  Auxin efflux carrier family protein isoform 1      141   7e-36   
ref|XP_007010161.1|  Auxin efflux carrier family protein isoform 2      141   9e-36   
gb|KHN33198.1|  hypothetical protein glysoja_043233                     138   1e-35   
emb|CBI37490.3|  unnamed protein product                                140   1e-35   
ref|XP_004515379.1|  PREDICTED: uncharacterized protein LOC101498835    139   2e-35   
ref|XP_006588038.1|  PREDICTED: uncharacterized protein LOC100788582    139   2e-35   
ref|XP_006485670.1|  PREDICTED: uncharacterized transporter YBR28...    139   4e-35   
ref|XP_006451737.1|  hypothetical protein CICLE_v10010809mg             139   4e-35   
ref|XP_006599263.1|  PREDICTED: uncharacterized protein LOC100804...    137   9e-35   
ref|XP_003548795.1|  PREDICTED: uncharacterized protein LOC100804...    137   1e-34   
ref|XP_010918350.1|  PREDICTED: uncharacterized protein LOC105042...    134   8e-34   
ref|XP_009592390.1|  PREDICTED: uncharacterized transporter YBR28...    134   1e-33   
ref|XP_007010168.1|  Auxin efflux carrier family protein, putative      134   2e-33   
ref|XP_002960250.1|  hypothetical protein SELMODRAFT_73552              132   1e-32   
ref|XP_002967465.1|  hypothetical protein SELMODRAFT_87119              132   1e-32   
ref|XP_010680630.1|  PREDICTED: uncharacterized protein LOC104895...    130   2e-32   
ref|XP_001784737.1|  predicted protein                                  131   3e-32   
ref|XP_010918363.1|  PREDICTED: uncharacterized protein LOC105042753    124   4e-32   
ref|XP_010649330.1|  PREDICTED: uncharacterized protein LOC100249...    130   8e-32   
ref|XP_010649326.1|  PREDICTED: uncharacterized protein LOC100249...    129   2e-31   
ref|XP_001785659.1|  predicted protein                                  128   3e-31   
ref|XP_011018693.1|  PREDICTED: uncharacterized protein LOC105121661    128   1e-30   
ref|XP_006302565.1|  hypothetical protein CARUB_v10020672mg             125   1e-30   
gb|KCW53293.1|  hypothetical protein EUGRSUZ_J02550                     124   3e-30   
ref|XP_003533648.1|  PREDICTED: uncharacterized transporter YBR28...    125   3e-30   
gb|KHN29468.1|  Putative transporter C5D6.04                            125   4e-30   
ref|XP_003612434.1|  Auxin efflux carrier protein                       123   1e-29   
ref|XP_006485673.1|  PREDICTED: uncharacterized transporter YBR28...    123   2e-29   
gb|KHG08318.1|  putative transporter C5D6.04                            121   3e-29   
ref|XP_010086711.1|  hypothetical protein L484_016141                   118   3e-29   
ref|XP_004512294.1|  PREDICTED: uncharacterized protein LOC101507...    121   6e-29   
ref|XP_009772093.1|  PREDICTED: uncharacterized protein LOC104222551    121   7e-29   
ref|XP_009589511.1|  PREDICTED: uncharacterized protein LOC104086873    121   8e-29   
ref|XP_005651741.1|  auxin efflux carrier                               121   9e-29   
ref|XP_009397962.1|  PREDICTED: uncharacterized transporter YBR28...    120   9e-29   
ref|XP_010922814.1|  PREDICTED: uncharacterized protein LOC105046029    121   1e-28   
ref|XP_004172586.1|  PREDICTED: uncharacterized LOC101208244            120   2e-28   
ref|XP_009370868.1|  PREDICTED: uncharacterized protein LOC103960175    120   3e-28   
ref|XP_009798619.1|  PREDICTED: uncharacterized transporter YBR28...    118   7e-28   
ref|XP_007207474.1|  hypothetical protein PRUPE_ppa006242mg             118   1e-27   
ref|XP_008244422.1|  PREDICTED: uncharacterized transporter YBR287W     118   1e-27   
ref|XP_011006245.1|  PREDICTED: uncharacterized protein LOC105112293    118   1e-27   
ref|XP_002323690.1|  hypothetical protein POPTR_0016s14840g             118   1e-27   
ref|XP_002531815.1|  auxin:hydrogen symporter, putative                 118   1e-27   
ref|XP_009592449.1|  PREDICTED: uncharacterized transporter YBR28...    117   2e-27   
ref|XP_006435466.1|  hypothetical protein CICLE_v10001325mg             114   2e-27   
ref|XP_002870888.1|  auxin efflux carrier family protein                117   2e-27   
emb|CDX85953.1|  BnaC06g21810D                                          117   2e-27   
gb|KGN54477.1|  hypothetical protein Csa_4G337340                       116   2e-27   
ref|XP_010543136.1|  PREDICTED: uncharacterized protein LOC104816...    117   3e-27   
ref|XP_006842607.1|  hypothetical protein AMTR_s00077p00171470          116   5e-27   
ref|XP_004142666.1|  PREDICTED: uncharacterized transporter YBR28...    116   5e-27   
ref|NP_195819.1|  auxin efflux carrier family protein                   116   5e-27   
ref|XP_008370296.1|  PREDICTED: uncharacterized transporter YBR28...    116   5e-27   
ref|XP_010649335.1|  PREDICTED: uncharacterized transporter C5D6....    115   7e-27   
ref|XP_006300110.1|  hypothetical protein CARUB_v10016338mg             116   7e-27   
emb|CAN63214.1|  hypothetical protein VITISV_002064                     115   8e-27   
ref|XP_004512295.1|  PREDICTED: uncharacterized protein LOC101507...    115   8e-27   
ref|XP_010496816.1|  PREDICTED: uncharacterized protein LOC104773846    115   9e-27   
gb|EPS68823.1|  auxin efflux carrier component, auxin transport p...    115   9e-27   
emb|CBI37493.3|  unnamed protein product                                115   9e-27   
gb|AIC32551.1|  PH                                                      115   1e-26   
emb|CDY01222.1|  BnaC05g25100D                                          115   1e-26   
ref|XP_007010164.1|  Auxin efflux carrier family protein, putative      114   1e-26   
gb|AFK47877.1|  unknown                                                 115   1e-26   
ref|NP_001242551.1|  uncharacterized protein LOC100819622               115   1e-26   
emb|CDY70057.1|  BnaA05g35770D                                          115   1e-26   
ref|XP_009144903.1|  PREDICTED: uncharacterized protein LOC103868570    115   1e-26   
ref|XP_006435463.1|  hypothetical protein CICLE_v10001325mg             114   2e-26   
ref|XP_002267734.1|  PREDICTED: uncharacterized protein LOC100246780    114   2e-26   
ref|XP_010066648.1|  PREDICTED: uncharacterized transporter YBR287W     114   2e-26   
ref|XP_002985541.1|  hypothetical protein SELMODRAFT_269010             114   2e-26   
ref|XP_010113048.1|  Uncharacterized transporter                        114   2e-26   
ref|XP_010278930.1|  PREDICTED: uncharacterized protein LOC104612960    114   4e-26   
ref|XP_002987028.1|  hypothetical protein SELMODRAFT_235164             114   4e-26   
ref|XP_009337818.1|  PREDICTED: uncharacterized protein LOC103930244    114   5e-26   
gb|KDO70040.1|  hypothetical protein CISIN_1g014841mg                   113   5e-26   
ref|XP_006437710.1|  hypothetical protein CICLE_v10031658mg             113   5e-26   
emb|CDY03621.1|  BnaC03g68800D                                          113   6e-26   
ref|XP_009107207.1|  PREDICTED: uncharacterized protein LOC103832859    113   6e-26   
emb|CDY58937.1|  BnaAnng15560D                                          113   6e-26   
tpg|DAA57098.1|  TPA: hypothetical protein ZEAMMB73_854946              112   7e-26   
ref|XP_004302505.1|  PREDICTED: uncharacterized transporter YBR28...    113   7e-26   
ref|XP_004302506.1|  PREDICTED: uncharacterized transporter YBR28...    113   8e-26   
gb|KFK24696.1|  hypothetical protein AALP_AA8G013000                    112   9e-26   
ref|XP_006398552.1|  hypothetical protein EUTSA_v10013614mg             112   1e-25   
ref|XP_008467142.1|  PREDICTED: uncharacterized transporter YBR287W     112   1e-25   
ref|XP_006390183.1|  hypothetical protein EUTSA_v10018685mg             111   1e-25   
gb|EPS61063.1|  hypothetical protein M569_13736                         112   2e-25   
gb|EMS45676.1|  Uncharacterized transporter C5D6.04                     112   2e-25   
ref|XP_004150856.1|  PREDICTED: uncharacterized transporter C5D6....    112   2e-25   
gb|EMT23880.1|  Putative transporter                                    112   2e-25   
dbj|BAJ88273.1|  predicted protein                                      112   2e-25   
ref|XP_003564484.1|  PREDICTED: uncharacterized protein LOC100836625    112   2e-25   
ref|XP_009391659.1|  PREDICTED: uncharacterized protein LOC103977...    111   2e-25   
ref|XP_008674893.1|  PREDICTED: uncharacterized transporter YBR287W     111   2e-25   
emb|CDM84752.1|  unnamed protein product                                111   3e-25   
ref|XP_002887344.1|  auxin efflux carrier family protein                111   3e-25   
ref|XP_010543135.1|  PREDICTED: uncharacterized protein LOC104816...    111   4e-25   
ref|XP_009391660.1|  PREDICTED: uncharacterized protein LOC103977...    110   6e-25   
ref|XP_010327698.1|  PREDICTED: uncharacterized protein LOC101257...    109   6e-25   
ref|XP_010253023.1|  PREDICTED: uncharacterized protein LOC104594440    109   7e-25   
ref|XP_008463302.1|  PREDICTED: uncharacterized transporter YBR28...    110   8e-25   
ref|XP_008389230.1|  PREDICTED: uncharacterized protein LOC103451597    110   9e-25   
gb|EAY76281.1|  hypothetical protein OsI_04215                          110   1e-24   
gb|KHG02404.1|  hypothetical protein F383_24041                         109   1e-24   
ref|XP_009356165.1|  PREDICTED: uncharacterized transporter YBR28...    110   1e-24   
gb|EEE55582.1|  hypothetical protein OsJ_03876                          109   1e-24   
ref|XP_003623663.1|  Auxin efflux carrier component auxin transpo...    109   1e-24   
dbj|BAD73344.1|  auxin efflux carrier family protein-like               109   1e-24   
ref|NP_001044627.1|  Os01g0818000                                       109   1e-24   
ref|NP_565011.1|  auxin efflux carrier family protein                   109   1e-24   
ref|XP_004249020.1|  PREDICTED: uncharacterized protein LOC101257...    109   2e-24   
ref|XP_007217108.1|  hypothetical protein PRUPE_ppa005828m1g            105   2e-24   
ref|XP_002454155.1|  hypothetical protein SORBIDRAFT_04g025630          109   2e-24   
emb|CBI31149.3|  unnamed protein product                                108   2e-24   
ref|XP_006362331.1|  PREDICTED: uncharacterized transporter YBR28...    109   2e-24   
ref|XP_010649331.1|  PREDICTED: uncharacterized protein LOC100249...    108   2e-24   
ref|XP_006644905.1|  PREDICTED: uncharacterized transporter YBR28...    108   2e-24   
gb|KFK41534.1|  hypothetical protein AALP_AA2G141800                    109   2e-24   
ref|XP_003614516.1|  Transporter, putative                              108   3e-24   
ref|XP_004492601.1|  PREDICTED: uncharacterized transporter YBR28...    108   3e-24   
ref|XP_006599270.1|  PREDICTED: uncharacterized protein LOC100817...    108   3e-24   
ref|XP_006659197.1|  PREDICTED: uncharacterized protein LOC102712836    108   3e-24   
ref|XP_004297348.1|  PREDICTED: uncharacterized transporter C5D6....    108   4e-24   
gb|KDP34975.1|  hypothetical protein JCGZ_09263                         108   4e-24   
ref|XP_006587541.1|  PREDICTED: uncharacterized protein LOC100810...    107   4e-24   
ref|XP_010916317.1|  PREDICTED: uncharacterized protein LOC105041163    107   7e-24   
ref|NP_001148375.1|  LOC100281987                                       107   7e-24   
ref|XP_011099494.1|  PREDICTED: uncharacterized protein LOC105177905    107   8e-24   
ref|XP_004953056.1|  PREDICTED: uncharacterized protein LOC101773408    107   8e-24   
ref|XP_004516425.1|  PREDICTED: uncharacterized protein LOC101511322    107   8e-24   
ref|XP_006300471.1|  hypothetical protein CARUB_v10020273mg             107   9e-24   
ref|XP_010029547.1|  PREDICTED: uncharacterized transporter YBR28...    106   1e-23   
ref|NP_001061169.1|  Os08g0191000                                       107   1e-23   
ref|XP_006654553.1|  PREDICTED: uncharacterized transporter YBR28...    106   2e-23   



>ref|XP_009759349.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Nicotiana sylvestris]
Length=415

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMPILQ+LIIS LGA +ATDY+K+LPADAR+ LNK+VFVAFTPSL FASL
Sbjct  1    MGFWTLLEVASMPILQVLIISVLGAVMATDYLKLLPADARKSLNKIVFVAFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A +V  +DIISWWFMPVN+GLTFL G ILGWI +K+LKPKPHLEGLI+A+C++GNLGNL 
Sbjct  61   AESVTFQDIISWWFMPVNVGLTFLFGGILGWIAVKILKPKPHLEGLIIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ SPFGD  +C+ +GLSY SFSMALGGFY
Sbjct  121  LIVIPAICKEDGSPFGDHRVCASVGLSYASFSMALGGFY  159



>ref|XP_009759350.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X2 
[Nicotiana sylvestris]
Length=414

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMPILQ+LIIS LGA +ATDY+K+LPADAR+ LNK+VFVAFTPSL FASL
Sbjct  1    MGFWTLLEVASMPILQVLIISVLGAVMATDYLKLLPADARKSLNKIVFVAFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A +V  +DIISWWFMPVN+GLTFL G ILGWI +K+LKPKPHLEGLI+A+C++GNLGNL 
Sbjct  61   AESVTFQDIISWWFMPVNVGLTFLFGGILGWIAVKILKPKPHLEGLIIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ SPFGD  +C+ +GLSY SFSMALGGFY
Sbjct  121  LIVIPAICKEDGSPFGDHRVCASVGLSYASFSMALGGFY  159



>ref|XP_009607642.1| PREDICTED: uncharacterized transporter C5D6.04 [Nicotiana tomentosiformis]
 ref|XP_009607643.1| PREDICTED: uncharacterized transporter C5D6.04 [Nicotiana tomentosiformis]
Length=414

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMPILQ+LIIS LGA +ATDY+K+LPADAR+ LNK+VFVAFTPSL FASL
Sbjct  1    MGFWTLLEVASMPILQVLIISVLGAVMATDYLKLLPADARKSLNKIVFVAFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A +V  +DIISWWFMPVN+GLTFL G ILGWI +K+LKPKPHLEGLI+A+C++GNLGNL 
Sbjct  61   AESVTFQDIISWWFMPVNVGLTFLFGGILGWIAVKILKPKPHLEGLIIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ SPFGD  +C+ +GLSY SFSMALGGFY
Sbjct  121  LIVIPAICKEDGSPFGDHRVCASVGLSYASFSMALGGFY  159



>gb|KHG10464.1| Transporter protein [Gossypium arboreum]
Length=407

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPILQ+LIIS LGA +ATDY K+LP D RR LN++VFV FTPSL FASL
Sbjct  1    MGFWTLFEVASMPILQVLIISLLGAFMATDYCKLLPVDIRRSLNRIVFVVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMPVNIGLTFLVG ILGWIV+K+LKPKP+LEGLI+A+C++GNLGNL 
Sbjct  61   AKTVTLQDIISWWFMPVNIGLTFLVGIILGWIVVKILKPKPYLEGLIIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC E+ SPFGD  +C+R+GLSY SFSMALGGFY
Sbjct  121  LIVVPAICNEDGSPFGDTNVCTRIGLSYASFSMALGGFY  159



>ref|XP_004232583.1| PREDICTED: uncharacterized transporter C5D6.04-like [Solanum 
lycopersicum]
Length=405

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPILQ+LI+SGLGA +ATDY+K+LPADAR+YLN++VFV FTP+L FASL
Sbjct  1    MGFMTLLEVASMPILQVLIVSGLGAVMATDYLKLLPADARKYLNRIVFVIFTPALMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A +V  +DII+WWFMPVN+GLTFL G ILGWI +K+LKPKPHLEGLI+A+C++GNLGNL 
Sbjct  61   AESVTFQDIITWWFMPVNVGLTFLFGGILGWIAMKILKPKPHLEGLIIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ SPFGD   C+ +GLSY SFSMALGGFY
Sbjct  121  LIVIPAICKEDGSPFGDHKTCASVGLSYASFSMALGGFY  159



>gb|KDO71544.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
 gb|KDO71545.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=278

 Score =   249 bits (636),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW   EVASMPI+Q+L+IS LGA +AT Y  +L ADARR LNK+VF  FTPSL FASL
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LE+IISWWFMPVN+ +TFL+G ILGWIV+KLL+PKPHLEGL++A+CA+GNLGNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG+R +CS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMALGGFF  159



>ref|XP_009614500.1| PREDICTED: uncharacterized protein LOC104107409 isoform X1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPILQ+L+IS LGA +ATDY+K+L +DARR LNK+VFV FTPSL FASL
Sbjct  1    MGFWTLFEVASMPILQVLLISILGALMATDYLKLLHSDARRSLNKIVFVIFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+NIGLTFLVG ILGW+V+K+LKP+ HLEGLI+A+C+AGNLGNL 
Sbjct  61   AKTVTLDDIISWWFMPINIGLTFLVGGILGWLVVKILKPELHLEGLIIATCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ SPFGD  IC+ +GLSY SFSMA+GGFY
Sbjct  121  LIVIPAICKEKGSPFGDHGICASVGLSYASFSMAVGGFY  159



>ref|XP_007046466.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
 gb|EOX90623.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao]
Length=421

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW L EVASMPILQ+LIIS LGA +ATD+ K+L AD RR LNK+VFV FTPSL FASL
Sbjct  1    MSFWTLFEVASMPILQVLIISVLGAFMATDHCKLLSADTRRSLNKLVFVVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMPVNIG+TFLVG I+GWIV+K+L+PKPHLEGLI+A+C++GNLGNL 
Sbjct  61   AKTVTLQDIISWWFMPVNIGITFLVGGIVGWIVVKILRPKPHLEGLIIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C E+ SPFG+R +CS +GLSY SFSMALGGFY
Sbjct  121  LIVVPAVCNEDGSPFGNRNVCSSVGLSYASFSMALGGFY  159



>ref|XP_007046465.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
 gb|EOX90622.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao]
Length=420

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW L EVASMPILQ+LIIS LGA +ATD+ K+L AD RR LNK+VFV FTPSL FASL
Sbjct  1    MSFWTLFEVASMPILQVLIISVLGAFMATDHCKLLSADTRRSLNKLVFVVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMPVNIG+TFLVG I+GWIV+K+L+PKPHLEGLI+A+C++GNLGNL 
Sbjct  61   AKTVTLQDIISWWFMPVNIGITFLVGGIVGWIVVKILRPKPHLEGLIIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C E+ SPFG+R +CS +GLSY SFSMALGGFY
Sbjct  121  LIVVPAVCNEDGSPFGNRNVCSSVGLSYASFSMALGGFY  159



>gb|KHG04809.1| Transporter protein [Gossypium arboreum]
Length=420

 Score =   251 bits (642),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPILQ+LIIS LGA LATDY K+ P D RR LNK+VFV FTPSL FASL
Sbjct  1    MGFWTLFEVASMPILQVLIISLLGAFLATDYCKLFPEDTRRSLNKLVFVVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMPVN+G+TFLVG I+GW V+K+L+PKPHLEGLI+A+C+AGN+GNL 
Sbjct  61   AKTVTLQDIISWWFMPVNMGITFLVGGIVGWFVVKILRPKPHLEGLIIATCSAGNVGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C E+ SPFG+R +C+ +GLSY SFSMALGGFY
Sbjct  121  LILVPAVCNEDRSPFGNRDVCNSVGLSYASFSMALGGFY  159



>ref|XP_009779996.1| PREDICTED: uncharacterized protein LOC104229115 [Nicotiana sylvestris]
 ref|XP_009779997.1| PREDICTED: uncharacterized protein LOC104229115 [Nicotiana sylvestris]
Length=419

 Score =   251 bits (642),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPILQ+L+IS LGA +ATDY+K+L +DARR LNK+VFV FTPSL FASL
Sbjct  1    MGFWTLFEVASMPILQVLLISILGALMATDYLKLLHSDARRSLNKIVFVVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+NIGLTFLVG ILGW+V+K+LKP  HLEGLI+A+C+AGNLGNL 
Sbjct  61   AKTVTLDDIISWWFMPINIGLTFLVGGILGWLVVKILKPDLHLEGLIIATCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ SPFGD  IC+ +GLSY SFSMA+GGFY
Sbjct  121  LIVIPAICKEKRSPFGDHGICASVGLSYASFSMAVGGFY  159



>gb|KDO71541.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
 gb|KDO71542.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=332

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW   EVASMPI+Q+L+IS LGA +AT Y  +L ADARR LNK+VF  FTPSL FASL
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LE+IISWWFMPVN+ +TFL+G ILGWIV+KLL+PKPHLEGL++A+CA+GNLGNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG+R +CS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMALGGFF  159



>gb|KDO71543.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=356

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW   EVASMPI+Q+L+IS LGA +AT Y  +L ADARR LNK+VF  FTPSL FASL
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LE+IISWWFMPVN+ +TFL+G ILGWIV+KLL+PKPHLEGL++A+CA+GNLGNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG+R +CS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMALGGFF  159



>emb|CDP01772.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMPI+Q+L+IS LGA +AT+++ +LPADAR+ LNK+VF+ FTPSL FASL
Sbjct  1    MGFWTLLEVASMPIIQVLLISVLGAVMATEHLNLLPADARKSLNKIVFMVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMPVNIGLTF+ G ILGWI +KL+KP+PHLEGL++A+C++GNLGNL 
Sbjct  61   AKTVTLDDIISWWFMPVNIGLTFVFGGILGWIAVKLVKPRPHLEGLVIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFGD   CS +GLSY SFSMALGG Y
Sbjct  121  LIIVPAICKEDGSPFGDHNTCSTIGLSYASFSMALGGIY  159



>ref|XP_006467106.1| PREDICTED: uncharacterized transporter YBR287W-like [Citrus sinensis]
Length=423

 Score =   248 bits (634),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPI+Q+L+IS LGA +AT Y  +L ADARR LNK+VF  FTPSL FASL
Sbjct  1    MGFWTLFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LE+IISWWFMPVN+ +TFL+G ILGWIV+KLL+PKPHLEGL++A+CA+GNLGNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG+R +CS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMALGGFF  159



>ref|XP_010029570.1| PREDICTED: uncharacterized protein LOC104419566 [Eucalyptus grandis]
 gb|KCW56488.1| hypothetical protein EUGRSUZ_I02215 [Eucalyptus grandis]
Length=420

 Score =   248 bits (634),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPILQ+L+ISGLGA +AT+Y  +L ADAR+ LNK+VF+ FTPSL FA L
Sbjct  1    MGFWTLFEVASMPILQVLLISGLGAFMATEYCGLLTADARKSLNKIVFMVFTPSLMFAGL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ARTV  +DIISWWFMPVNI +TFL+G +LGWIV+KLLKPKP+LEGL++A+CA+GNLGNL 
Sbjct  61   ARTVTFQDIISWWFMPVNIAVTFLIGGMLGWIVVKLLKPKPYLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFGD++ CS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICNEDNSPFGDKSACSSVGLSYASFSMALGGFF  159



>ref|XP_006425253.1| hypothetical protein CICLE_v10025741mg [Citrus clementina]
 gb|ESR38493.1| hypothetical protein CICLE_v10025741mg [Citrus clementina]
Length=407

 Score =   248 bits (633),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPI+Q+L+IS LGA +AT Y  +L ADARR LNK+VF  FTPSL FASL
Sbjct  1    MGFWTLFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LE+IISWWFMPVN+ +TFL+G ILGWIV+KLL+PKPHLEGL++A+CA+GNLGNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG+R +CS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMALGGFF  159



>ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis]
 gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis]
Length=406

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPI+Q+L+ISGLGA +AT+Y  +L +DAR+ LNK+VFV FTPSL FASL
Sbjct  1    MGFWTLFEVASMPIIQVLLISGLGAFMATNYCNLLTSDARKSLNKIVFVVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMPVN+GLTFL+G ILGW+++K+LKPKP+LEGL++A+C++GNLGNL 
Sbjct  61   AQTVTLQDIISWWFMPVNVGLTFLIGGILGWVLVKVLKPKPYLEGLVIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC E  SPFGDR  C  +GLSY SFSMA+GGFY
Sbjct  121  LIVVPAICNENGSPFGDRETCKSIGLSYASFSMAIGGFY  159



>ref|XP_002306421.2| auxin efflux carrier family protein [Populus trichocarpa]
 ref|XP_006382977.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 ref|XP_006382978.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 ref|XP_006382979.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 gb|EEE93417.2| auxin efflux carrier family protein [Populus trichocarpa]
 gb|ERP60774.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 gb|ERP60775.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 gb|ERP60776.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
Length=418

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVAS+PI+Q+L+IS  GA +AT+Y+ +LP DAR+ LNK+VF+ FTPSL FASL
Sbjct  1    MGFWTLFEVASLPIIQVLLISFFGALMATEYLNLLPKDARKSLNKLVFMVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LEDIISWWFMPVNIGLTFL+G ILGWI++K+L+PKP+LEGL++A+C++GNLGNL 
Sbjct  61   AKTVTLEDIISWWFMPVNIGLTFLIGGILGWILVKILRPKPYLEGLVIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFGD +IC+ +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICTEDGSPFGDSSICTSVGLSYASFSMALGGFF  159



>ref|XP_011096970.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X2 
[Sesamum indicum]
Length=386

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLE++SMPILQ+LIIS LGA +ATDY+K+LP DARR LNK+VFV FTPSL FASL
Sbjct  1    MGFWSLLEISSMPILQVLIISVLGAFMATDYLKLLPPDARRSLNKIVFVVFTPSLIFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV+ +DII+WWFMPVN+G+TFL+G  LGW+ +K+L+P+PHL+ LI+A CA GNLGN+ 
Sbjct  61   AKTVRFQDIIAWWFMPVNVGITFLIGGGLGWVAVKILRPQPHLQDLIIAICATGNLGNIL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PAIC E+ +PFG+ A+C+R+GLSYVSFSMALG FY
Sbjct  121  LIIIPAICKEDGNPFGEEAVCTRVGLSYVSFSMALGSFY  159



>ref|XP_011022138.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
 ref|XP_011022139.1| PREDICTED: uncharacterized transporter YBR287W-like [Populus 
euphratica]
Length=418

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVAS+PI+Q+L+IS LGA +AT+Y+ +LP DARR LNK+VF+ FTPSL FASL
Sbjct  1    MGFWTLFEVASLPIIQVLLISFLGALMATEYMNLLPKDARRSLNKLVFMVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LEDIISWWFMPVNIG TFL+G  LGWI++K+L+PKP+LEGL++A+C++GNLGNL 
Sbjct  61   AKTVTLEDIISWWFMPVNIGFTFLIGGTLGWILVKILRPKPYLEGLVIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFGD +ICS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICNEDGSPFGDSSICSSVGLSYASFSMALGGFF  159



>gb|KDO71539.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=398

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW   EVASMPI+Q+L+IS LGA +AT Y  +L ADARR LNK+VF  FTPSL FASL
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LE+IISWWFMPVN+ +TFL+G ILGWIV+KLL+PKPHLEGL++A+CA+GNLGNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG+R +CS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMALGGFF  159



>ref|XP_010317676.1| PREDICTED: uncharacterized protein LOC101262895 [Solanum lycopersicum]
Length=395

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW L EVASMPILQ+L+IS LGA +AT+Y  IL +D R+ LNK+VFV FTPS+TFASL
Sbjct  1    MEFWTLFEVASMPILQMLLISVLGALMATNYFNILHSDTRKSLNKIVFVVFTPSITFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
             RTV L DIISWWFMP+NIG+TFL+G ILGW+V+K+LKP+ HLEGLI+A+C+ GNLGNLP
Sbjct  61   TRTVTLNDIISWWFMPINIGITFLIGGILGWLVVKILKPELHLEGLIIATCSTGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ SPFGD+  C+ LGLSYVSFSMA+GGFY
Sbjct  121  LIVIPAICKEDGSPFGDQKNCASLGLSYVSFSMAVGGFY  159



>ref|XP_011096969.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Sesamum indicum]
Length=411

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLE++SMPILQ+LIIS LGA +ATDY+K+LP DARR LNK+VFV FTPSL FASL
Sbjct  1    MGFWSLLEISSMPILQVLIISVLGAFMATDYLKLLPPDARRSLNKIVFVVFTPSLIFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV+ +DII+WWFMPVN+G+TFL+G  LGW+ +K+L+P+PHL+ LI+A CA GNLGN+ 
Sbjct  61   AKTVRFQDIIAWWFMPVNVGITFLIGGGLGWVAVKILRPQPHLQDLIIAICATGNLGNIL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PAIC E+ +PFG+ A+C+R+GLSYVSFSMALG FY
Sbjct  121  LIIIPAICKEDGNPFGEEAVCTRVGLSYVSFSMALGSFY  159



>gb|KDO71532.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
 gb|KDO71533.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=423

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW   EVASMPI+Q+L+IS LGA +AT Y  +L ADARR LNK+VF  FTPSL FASL
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LE+IISWWFMPVN+ +TFL+G ILGWIV+KLL+PKPHLEGL++A+CA+GNLGNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG+R +CS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMALGGFF  159



>gb|KDO71540.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=422

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW   EVASMPI+Q+L+IS LGA +AT Y  +L ADARR LNK+VF  FTPSL FASL
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LE+IISWWFMPVN+ +TFL+G ILGWIV+KLL+PKPHLEGL++A+CA+GNLGNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG+R +CS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMALGGFF  159



>gb|KDO71534.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=447

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW   EVASMPI+Q+L+IS LGA +AT Y  +L ADARR LNK+VF  FTPSL FASL
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LE+IISWWFMPVN+ +TFL+G ILGWIV+KLL+PKPHLEGL++A+CA+GNLGNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG+R +CS +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYASFSMALGGFF  159



>ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa]
 gb|ERP46989.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa]
Length=428

 Score =   246 bits (628),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVAS+PI+Q+L+IS  GA +AT+Y+ +LP DAR+ LNK+VF+ FTPSL FASL
Sbjct  1    MGFWTLFEVASLPIIQVLLISFFGALMATEYLNLLPKDARKSLNKLVFMVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LEDIISWWFMPVNIG TFL+G ILGWI++K+L+PKP+LEGL++A+C++GNLGNL 
Sbjct  61   AKTVTLEDIISWWFMPVNIGFTFLIGGILGWILVKILRPKPYLEGLVIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFGD +IC+ +GLSY SFSMALGGF+
Sbjct  121  LIIVPAICTEDGSPFGDSSICTSVGLSYASFSMALGGFF  159



>dbj|BAH19704.1| AT2G17500 [Arabidopsis thaliana]
Length=210

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+L +S +GA +A+D  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLFMSLVGAFMASDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LEDIISWWFMPVN+GLTFL+G +LGW+V+K+LKP P+LEGLI+A+C+AGN+GNLP
Sbjct  61   AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPYLEGLIVATCSAGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_010103240.1| putative transporter [Morus notabilis]
 gb|EXB95111.1| putative transporter [Morus notabilis]
Length=426

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF+ LLEVASMPILQ+LI+  LGA +AT Y  +LPAD+R+ LNK+VF  FTPSL FASL
Sbjct  1    MGFFTLLEVASMPILQVLIVGMLGAFMATSYWNLLPADSRKSLNKIVFAVFTPSLVFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+ V LEDIISWWFMPVN+G TFL G ILGWI++K+L+PKPHLEGLI+A+C++GNLGNL 
Sbjct  61   AKAVTLEDIISWWFMPVNVGFTFLFGGILGWILVKILRPKPHLEGLIIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFGD  +CS  GLSYVSFSMALGGF+
Sbjct  121  LIIVPAICKEDGSPFGDSQVCSTTGLSYVSFSMALGGFF  159



>ref|XP_010530989.1| PREDICTED: uncharacterized transporter YBR287W [Tarenaya hassleriana]
 ref|XP_010530990.1| PREDICTED: uncharacterized transporter YBR287W [Tarenaya hassleriana]
Length=401

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+LI+S +GA +A DY K+L  +AR  +NKVVFVAF P L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLIMSLVGAFMAADYCKLLTVEARNSMNKVVFVAFAPCLMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LED++SWWFMPVN+GLTFL+G ILGWI++KLLKP P+LEGL++A+C++GN+GNLP
Sbjct  61   AKTVTLEDMVSWWFMPVNMGLTFLIGGILGWILVKLLKPVPYLEGLVIAACSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC+E+ SPFG+R++C  LGLSY SFSMALGGFY
Sbjct  121  VILVPAICSEDKSPFGNRSVCRSLGLSYASFSMALGGFY  159



>ref|XP_010270520.1| PREDICTED: uncharacterized protein LOC104606828 [Nelumbo nucifera]
Length=410

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKIL-PADARRYLNKVVFVAFTPSLTFAS  303
            MGFW L +VASMP+L++L+I  LGA +ATDY  +L  ADARRYLNK+VFV F PSL FAS
Sbjct  1    MGFWTLFQVASMPVLEVLLIGVLGAFMATDYCSLLLNADARRYLNKIVFVVFAPSLVFAS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
            LA+TV LEDIISWWFMPVNIGL FL+G ILGWIV+K+LKP+PHLEGLI+A+C+AGNLGNL
Sbjct  61   LAKTVTLEDIISWWFMPVNIGLIFLIGGILGWIVVKILKPEPHLEGLIIAACSAGNLGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
             LI+VPAIC E+ SPF D   CS  GLSY SFSMALGGF+
Sbjct  121  MLIVVPAICDEDGSPFADNKFCSSAGLSYASFSMALGGFF  160



>ref|XP_010489377.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010489378.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010489379.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010489380.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   241 bits (614),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+LI+S +GA LA+D  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLIMSLVGAFLASDRCKLFPIEARNTMNKVVFVLFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ARTV LEDIISWWFMPVN+GLTFL+G +LGWIV+K+LKP P+LEGLI+A+C++GN+GNLP
Sbjct  61   ARTVTLEDIISWWFMPVNMGLTFLIGGLLGWIVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_010467522.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010467523.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=393

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+LI+S +GA LA+D  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLIMSIVGAFLASDRCKLFPIEARNSMNKVVFVLFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ARTV LEDIISWWFMPVN+GLTFL+G +LGWIV+K+LKP P+LEGLI+A+C++GN+GNLP
Sbjct  61   ARTVTLEDIISWWFMPVNMGLTFLIGGLLGWIVVKILKPPPYLEGLIIATCSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_010550503.1| PREDICTED: uncharacterized transporter YBR287W isoform X4 [Tarenaya 
hassleriana]
Length=396

 Score =   241 bits (614),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L A+ RR LNK+VFV FTP L FASL
Sbjct  1    MGFLALLEVASMPIVQVLLISVLGAFLATDYCSLLSAETRRSLNKLVFVVFTPCLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG +LGW+V+K+LKPKP L GLI+A+CA+GN+GNL 
Sbjct  61   AKTVTLQDIISWWFMPLNVGITFLVGGVLGWLVVKVLKPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC EE SPFG R++C  +GLSY SFSMALGGFY
Sbjct  121  LILVPAICDEEGSPFGSRSVCRSIGLSYASFSMALGGFY  159



>ref|XP_009121108.1| PREDICTED: uncharacterized transporter YBR287W [Brassica rapa]
Length=393

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+L IS +GA LATD  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLFISVVGAFLATDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LED+ISWWFMPVN+GLTFL+G ILGWIV+K+LKP P+LEGLI+A+C++GN+GNLP
Sbjct  61   AQTVTLEDMISWWFMPVNMGLTFLIGGILGWIVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>emb|CDY24342.1| BnaA07g02670D [Brassica napus]
Length=393

 Score =   240 bits (613),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+L IS +GA LATD  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLFISVVGAFLATDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LED+ISWWFMPVN+GLTFL+G ILGWIV+K+LKP P+LEGLI+A+C++GN+GNLP
Sbjct  61   AQTVTLEDMISWWFMPVNMGLTFLIGGILGWIVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_010514952.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010514959.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010514966.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=387

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+LI+S +GA LA+D  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLIMSLVGAFLASDRCKLFPIEARNTMNKVVFVLFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ARTV LEDIISWWFMPVN+GLTFL+G +LGWIV+K+LKP P+LEGLI+A+C++GN+GNLP
Sbjct  61   ARTVTLEDIISWWFMPVNMGLTFLIGGLLGWIVVKILKPPPYLEGLIIATCSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ +PFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKNPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_010266240.1| PREDICTED: uncharacterized transporter YBR287W [Nelumbo nucifera]
 ref|XP_010266241.1| PREDICTED: uncharacterized transporter YBR287W [Nelumbo nucifera]
 ref|XP_010266242.1| PREDICTED: uncharacterized transporter YBR287W [Nelumbo nucifera]
Length=417

 Score =   241 bits (614),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPI+Q+L++S LGA +AT+Y  +L ADARRY+NKVVFV FTPSL FA L
Sbjct  1    MGFWTLFEVASMPIMQVLLVSILGALMATEYFNLLNADARRYINKVVFVVFTPSLMFACL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMPVNIGLTFL+G +LGWI++K+LKPKPHLEGL++A+C+AGNLGNL 
Sbjct  61   AQTVTLQDIISWWFMPVNIGLTFLIGGVLGWILVKILKPKPHLEGLVIATCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VP IC+++ SPF    IC+ + LSYVSFSMALGGF+
Sbjct  121  LIVVPEICSQDGSPF-SHGICNSVALSYVSFSMALGGFF  158



>ref|XP_006393787.1| hypothetical protein EUTSA_v10005581mg [Eutrema salsugineum]
 gb|ESQ31073.1| hypothetical protein EUTSA_v10005581mg [Eutrema salsugineum]
Length=395

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG ILGW+V+KLL PKP L GLI+A+CA+GN+GNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFY  159



>emb|CDY57767.1| BnaC02g45080D [Brassica napus]
Length=395

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG ILGW+V+KLL PKP L GLI+A+CA+GN+GNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFY  159



>ref|XP_010548200.1| PREDICTED: uncharacterized transporter YBR287W-like [Tarenaya 
hassleriana]
Length=399

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+LIIS  GA +A+DY K+L  +AR  +NKVVFVAF P L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLIISLGGAFMASDYCKLLTVEARNSMNKVVFVAFAPCLMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LEDI+SWWFMPVN+GLTFL+G ILGWIV+KLLKP P+LEGL++A+C++GN+GNLP
Sbjct  61   AKTVTLEDIVSWWFMPVNMGLTFLIGGILGWIVVKLLKPVPYLEGLVIAACSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC ++ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  VILVPAICDDDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>emb|CDY55102.1| BnaA02g34870D [Brassica napus]
Length=395

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG ILGW+V+KLL PKP L GLI+A+CA+GN+GNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFY  159



>ref|XP_009112263.1| PREDICTED: uncharacterized transporter YBR287W [Brassica rapa]
Length=393

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG ILGW+V+KLL PKP L GLI+A+CA+GN+GNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFY  159



>emb|CDY18579.1| BnaA09g08160D [Brassica napus]
Length=394

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG ILGW+V+KLL PKP L GLI+A+CA+GN+GNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFY  159



>ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43039.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=395

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV L+DIISWWFMP+N+G+TFLVG ILGW+V+KLL PKP L GLI+A+CA+GN+GNL 
Sbjct  61   AETVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFY  159



>ref|XP_011099928.1| PREDICTED: uncharacterized transporter YBR287W-like [Sesamum 
indicum]
Length=407

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL+VASMPILQ+LIIS LGA +ATDYIK+LP+DARR LNK+VF  FTP+L F SL
Sbjct  1    MGFLSLLKVASMPILQMLIISILGAFMATDYIKLLPSDARRSLNKIVFAVFTPALAFTSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV+L+DIISWWFMP+NIG+TFLVG ILGWI ++++KP+PH+  L++A C++GNLGN+ 
Sbjct  61   AKTVRLQDIISWWFMPINIGITFLVGGILGWISVQIIKPEPHIRALVIAMCSSGNLGNIL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E  SPFGD+ +C+ +GLSYVSFSMALG F+
Sbjct  121  LILIPAICKENGSPFGDKYVCASVGLSYVSFSMALGAFF  159



>ref|NP_201399.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 dbj|BAB10403.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED98134.1| auxin efflux carrier family protein [Arabidopsis thaliana]
Length=395

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV L+DIISWWFMP+N+G+TFLVG ILGW+V+KLL PKP L GLI+A+CA+GN+GNL 
Sbjct  61   AETVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFY  159



>emb|CDX81425.1| BnaC09g08360D [Brassica napus]
Length=393

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG ILGW+V+KLL PKP L GLI+A+CA+GN+GNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFY  159



>ref|XP_002884062.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60321.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+L++S +GA LA+D  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLVMSLVGAFLASDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LEDIISWWFMPVN+GLTFL+G +LGW+V+K+LKP P+LEGLI+A+C+AGN+GNLP
Sbjct  61   AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSAGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_010466350.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010444860.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
 ref|XP_010484705.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=395

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG ILGW+++KLL PKP L GLI+A+CA+GN+GNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLMVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  LILVPAICDEEGSPFGNRSVCRSIGLSYASFSMALGGFY  159



>ref|XP_010270517.1| PREDICTED: uncharacterized protein LOC104606827 [Nelumbo nucifera]
 ref|XP_010270519.1| PREDICTED: uncharacterized protein LOC104606827 [Nelumbo nucifera]
Length=419

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L +VASMP+LQ+L+IS LGA +AT+Y  +L ADARR++NK+VF+ FTPSL FA L
Sbjct  1    MGFWTLFQVASMPVLQVLLISILGAFMATNYCNLLNADARRHMNKIVFITFTPSLMFACL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  +DIISWWFMPVNIGLTFL+G ILGWI++K+LKP+P+LEGL++A+C+AGNLGNL 
Sbjct  61   AKTVTFQDIISWWFMPVNIGLTFLIGGILGWILVKILKPEPYLEGLVIATCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC E+ SPFGD  +C  +GLSY S SMALGGF+
Sbjct  121  LIVVPAICNEDGSPFGDHNVCGSVGLSYASMSMALGGFF  159



>gb|KFK28259.1| hypothetical protein AALP_AA8G493500 [Arabis alpina]
Length=395

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + F++L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG ILGW+V+K+L PKP L GLI+A+CA+GNLGNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWVVVKVLNPKPQLHGLIIATCASGNLGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  LILVPAICDEEGSPFGNRSVCRSVGLSYASFSMALGGFY  159



>ref|XP_006282359.1| hypothetical protein CARUB_v10028656mg [Capsella rubella]
 gb|EOA15257.1| hypothetical protein CARUB_v10028656mg [Capsella rubella]
Length=395

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG ILGW+++KLL PKP L GLI+A+CA+GN+GNL 
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLLVKLLNPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC EE SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  LILVPAICDEEGSPFGNRSVCRSVGLSYASFSMALGGFY  159



>emb|CDY26812.1| BnaC09g09390D [Brassica napus]
Length=393

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+LIIS +GA LATD  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLIISLVGAYLATDRCKLFPVEARNSMNKVVFVIFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+D++SWWFMPVN+GLTFL+G +LGW+V+K+LKP P+LEGLI+A+C++GN+GNLP
Sbjct  61   AQTVTLQDMVSWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_009112433.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 ref|XP_009112434.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
 emb|CDY30361.1| BnaA09g09160D [Brassica napus]
Length=393

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+LIIS +GA LATD  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLIISLVGAYLATDRCKLFPVEARNSMNKVVFVIFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+D++SWWFMPVN+GLTFL+G +LGW+V+K+LKP P+LEGLI+A+C++GN+GNLP
Sbjct  61   AQTVTLQDMVSWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_006299821.1| hypothetical protein CARUB_v10016022mg [Capsella rubella]
 gb|EOA32719.1| hypothetical protein CARUB_v10016022mg [Capsella rubella]
Length=393

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+LI+S +GA LA+D  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLIMSLVGAFLASDRCKLFPIEARNTMNKVVFVLFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LEDIISWWFMPVN+GLTFL+G +LGW+V+K+LKP P+LEGLI+A+C++GN+GNLP
Sbjct  61   AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWMVVKILKPPPYLEGLIVATCSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_010550502.1| PREDICTED: uncharacterized transporter YBR287W isoform X3 [Tarenaya 
hassleriana]
Length=437

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L A+ RR LNK+VFV FTP L FASL
Sbjct  1    MGFLALLEVASMPIVQVLLISVLGAFLATDYCSLLSAETRRSLNKLVFVVFTPCLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+G+TFLVG +LGW+V+K+LKPKP L GLI+A+CA+GN+GNL 
Sbjct  61   AKTVTLQDIISWWFMPLNVGITFLVGGVLGWLVVKVLKPKPQLHGLIIATCASGNMGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC EE SPFG R++C  +GLSY SFSMALGGFY
Sbjct  121  LILVPAICDEEGSPFGSRSVCRSIGLSYASFSMALGGFY  159



>ref|XP_010680628.1| PREDICTED: uncharacterized transporter YBR287W isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680629.1| PREDICTED: uncharacterized transporter YBR287W isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=403

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L EVASMPILQ+LIISGLGA +AT+Y  +L ADARR LNK+V+V FTP+L FASL
Sbjct  1    MGFLSLFEVASMPILQVLIISGLGAFMATEYCNLLTADARRSLNKIVYVVFTPALMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+N+GLTF++G  LGWI +KLLKP  HLEGL++ASC+A NLGNL 
Sbjct  61   AKTVTLQDIISWWFMPINVGLTFIIGGALGWIAVKLLKPGLHLEGLVIASCSAANLGNLV  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC E+ SPFG D A CS +GLSY SFSMALGGFY
Sbjct  121  LIVVPAICHEDGSPFGDDHAACSSIGLSYASFSMALGGFY  160



>gb|KDP43785.1| hypothetical protein JCGZ_22412 [Jatropha curcas]
Length=408

 Score =   238 bits (606),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPILQ+L+IS LGA +AT Y  IL  DAR+ LNK+VF+ FTPSL FASL
Sbjct  1    MGFWTLFEVASMPILQVLLISILGAFMATSYCNILTTDARKSLNKIVFIVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  +D+ISWWFMPVNIGLTFL+G ILGWIV+KLLKP+PHLEGL++A+C++GNLGNL 
Sbjct  61   AKTVTFQDVISWWFMPVNIGLTFLIGGILGWIVVKLLKPQPHLEGLVIATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ SPF DR  C  +GLSY SF MALGGF+
Sbjct  121  LIVIPAICNEDGSPF-DRDTCRSVGLSYASFYMALGGFF  158



>ref|XP_007202341.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica]
 ref|XP_007202342.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica]
 ref|XP_007202343.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica]
 gb|EMJ03540.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica]
 gb|EMJ03541.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica]
 gb|EMJ03542.1| hypothetical protein PRUPE_ppa008223mg [Prunus persica]
Length=340

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVA MP  Q+LIIS LGA +AT+Y  +LP DARR +NKVVFV FTPSL FAS+
Sbjct  1    MGFWTLLEVACMPTFQVLIISVLGAFMATEYWNLLPVDARRSMNKVVFVVFTPSLVFASV  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  EDIIS WFM VN+GLTFL G ILGWI++K+++PKP+ EGL++A+C++ NLGNLP
Sbjct  61   AKTITFEDIISMWFMIVNVGLTFLFGGILGWILVKIVRPKPYQEGLVMAACSSANLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ +PFGD ++C R+GLSYVSFSMALGGF+
Sbjct  121  LILIPAICEEDGNPFGDHSVCKRVGLSYVSFSMALGGFF  159



>ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR287W [Vitis vinifera]
 emb|CBI21570.3| unnamed protein product [Vitis vinifera]
Length=421

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPILQ+LII  +GA LAT Y  ILPADAR+ +NK+VFVAFTPSL FA L
Sbjct  1    MGFWTLFEVASMPILQVLIIGSVGAFLATGYCNILPADARKSVNKIVFVAFTPSLMFAGL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+D+ISWWFMPVNIGLTFL G ILGW+V+K+LKPK HLEGLI+A+C++GNLGNL 
Sbjct  61   AQTVTLQDMISWWFMPVNIGLTFLFGGILGWLVVKILKPKQHLEGLIMATCSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ SPFGD A C   GLSY S S ALGG +
Sbjct  121  LIVIPAICEEDGSPFGDHASCGASGLSYASLSTALGGIF  159



>ref|NP_565417.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 ref|NP_849964.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 ref|NP_973479.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 ref|NP_001031363.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AAD32907.1| expressed protein [Arabidopsis thaliana]
 dbj|BAE98473.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06634.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AEC06635.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AEC06636.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AEC06637.1| auxin efflux carrier family protein [Arabidopsis thaliana]
Length=396

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+L +S +GA +A+D  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLFMSLVGAFMASDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LEDIISWWFMPVN+GLTFL+G +LGW+V+K+LKP P+LEGLI+A+C+AGN+GNLP
Sbjct  61   AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPYLEGLIVATCSAGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>gb|AAM60930.1| unknown [Arabidopsis thaliana]
Length=396

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVASMP++Q+L +S +GA +A+D  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFWSLLEVASMPVIQVLFMSLVGAFMASDRCKLFPVEARNSMNKVVFVLFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LEDIISWWFMPVN+GLTFL+G +LGW+V+K+LKP P+LEGLI+A+C+AGN+GNLP
Sbjct  61   AQTVTLEDIISWWFMPVNMGLTFLIGGLLGWLVVKILKPPPYLEGLIVATCSAGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_008242098.1| PREDICTED: uncharacterized transporter YBR287W [Prunus mume]
 ref|XP_008242099.1| PREDICTED: uncharacterized transporter YBR287W [Prunus mume]
Length=413

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVA MP  Q+LIIS LGA +AT+Y  +LPADARR +NKVVFV FTPSL FAS+
Sbjct  1    MGFWTLLEVACMPTFQVLIISLLGAFMATEYWNLLPADARRSMNKVVFVVFTPSLVFASV  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  EDIIS WFM VN+GLTFL G ILGWI++K+++PKP+ EGL++A+C++ NLGNLP
Sbjct  61   AKTITFEDIISMWFMIVNVGLTFLFGGILGWILVKIVRPKPYQEGLVMAACSSANLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ +PFGD ++C R+GLSYVSFSMALGGF+
Sbjct  121  LILIPAICEEDGNPFGDHSVCKRVGLSYVSFSMALGGFF  159



>ref|XP_006409300.1| hypothetical protein EUTSA_v10022717mg [Eutrema salsugineum]
 gb|ESQ50753.1| hypothetical protein EUTSA_v10022717mg [Eutrema salsugineum]
Length=397

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF+ LLEVASMP++Q+LIIS +GA LATD  K+ P +AR  +NKVVFV F P+L FA+L
Sbjct  1    MGFFSLLEVASMPVIQVLIISLVGAFLATDRCKLFPVEARNSMNKVVFVIFAPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+D+ISWWFMPVN+GLTFL+G ILGW+V+K+LKP P+LEGLI+A+ ++GN+GNLP
Sbjct  61   AQTVTLQDMISWWFMPVNMGLTFLIGGILGWMVVKILKPPPYLEGLIVATSSSGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPAIC E+ SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  IILVPAICDEDKSPFGNRSVCRTVGLSYASFSMALGGFY  159



>ref|XP_006343325.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
tuberosum]
Length=395

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMPILQ+L+IS LGA +AT+Y  IL +D RR LNK+VFV FTPS+TFASL
Sbjct  1    MGFWTLFEVASMPILQMLLISVLGALMATNYFNILHSDTRRSLNKIVFVVFTPSITFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
             +TV L+DIISWWFMP+NIGLTFLVG ILGW+V+K+LKP+ HLEGLI+A+C+ GNLGNL 
Sbjct  61   TKTVTLDDIISWWFMPINIGLTFLVGGILGWLVVKILKPEVHLEGLIIATCSTGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            L+++PAIC E+ SPFGD  IC+ +GLSYVSFSMA+GGFY
Sbjct  121  LLVIPAICKEDGSPFGDHGICASVGLSYVSFSMAVGGFY  159



>gb|KDO71531.1| hypothetical protein CISIN_1g013221mg [Citrus sinensis]
Length=396

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW   EVASMPI+Q+L+IS LGA +AT Y  +L ADARR LNK+VF  FTPSL FASL
Sbjct  1    MGFWTFFEVASMPIVQVLLISVLGALMATQYWNLLTADARRSLNKMVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LE+IISWWFMPVN+ +TFL+G ILGWIV+KLL+PKPHLEGL++A+CA+GNLGNL 
Sbjct  61   AKTVTLEEIISWWFMPVNVAMTFLIGGILGWIVVKLLRPKPHLEGLVIATCASGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMA  18
            LIIVPAIC E+ SPFG+R +CS +GLSY + + A
Sbjct  121  LIIVPAICHEQGSPFGNRDVCSSVGLSYKALAQA  154



>gb|KGN55596.1| hypothetical protein Csa_3G000690 [Cucumis sativus]
Length=423

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   LLEVA MP LQ+L+I  +GA LATDY  +LPA AR  LNK+VF  FTP L FA+L
Sbjct  1    MGLLSLLEVALMPNLQVLLICLVGALLATDYCNLLPAHARTSLNKIVFTVFTPCLMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  +DI+SWWFMPVNIGLTFL G ILGWIV+K+LKPKP+LEGL++A+ ++GNLGNL 
Sbjct  61   AKTVTFQDIVSWWFMPVNIGLTFLFGGILGWIVVKILKPKPYLEGLVIAASSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFGDR  C+ LGLSY SFSMALGGFY
Sbjct  121  LIIVPAICDEDGSPFGDRDTCTSLGLSYASFSMALGGFY  159



>ref|XP_004159743.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis 
sativus]
Length=412

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   LLEVA MP LQ+L+I  +GA LATDY  +LPA AR  LNK+VF  FTP L FA+L
Sbjct  1    MGLLSLLEVALMPNLQVLLICLVGALLATDYCNLLPAHARTSLNKIVFTVFTPCLMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  +DI+SWWFMPVNIGLTFL G ILGWIV+K+LKPKP+LEGL++A+ ++GNLGNL 
Sbjct  61   AKTVTFQDIVSWWFMPVNIGLTFLFGGILGWIVVKILKPKPYLEGLVIAASSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFGDR  C+ LGLSY SFSMALGGFY
Sbjct  121  LIIVPAICDEDGSPFGDRDTCTSLGLSYASFSMALGGFY  159



>ref|XP_009386671.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L  VAS P LQ L+I  LGA LA+ Y  +L ADARR +NKVVF  FTPSL FASL
Sbjct  1    MGFWSLFLVASEPNLQFLLIGTLGAYLASSYSNVLLADARRDMNKVVFAVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  E IISWWFMPVNIG+TFLVG ILGWI +K+L+P  HLEGL++AS +AGNLGNL 
Sbjct  61   AKTVTFEQIISWWFMPVNIGITFLVGGILGWIAVKILRPPKHLEGLVIASTSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PAIC E  +PFGD+ ICS  GLSYVSFSMALGGFY
Sbjct  121  LIIIPAICEENGNPFGDKNICSSRGLSYVSFSMALGGFY  159



>ref|XP_008393334.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
 ref|XP_008354605.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
Length=412

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVA MPI Q+LIIS LGA +AT+Y  +LP+ ARR +NKVVFV FTPSL FA++
Sbjct  1    MGFWTLLEVACMPIFQVLIISVLGALMATEYWNLLPSGARRSMNKVVFVVFTPSLVFANV  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+   DI+SWWFM VN+ LTF+VG ILGWIV+K+ KPKP+ EG+I+A+ ++ NLGNLP
Sbjct  61   AKTITFGDIVSWWFMIVNVALTFVVGGILGWIVVKIFKPKPYQEGVIIAAVSSANLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC E+ +PFG+ ++CS +GLSYVSFSMALGGF+
Sbjct  121  LILVPAICNEDGNPFGNHSVCSTIGLSYVSFSMALGGFF  159



>ref|XP_004287713.1| PREDICTED: uncharacterized transporter YBR287W-like [Fragaria 
vesca subsp. vesca]
Length=411

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L EVASMP+LQ+LIIS LGA +AT+Y  +LP  ARR LNK+VFV FTPSL FAS+
Sbjct  1    MGFWTLFEVASMPVLQVLIISLLGAYMATEYCNLLPLGARRSLNKIVFVVFTPSLMFASV  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV  +DIISWWFM VN+ LTF +G+ILGW+V+K+LKPKP+ EG+++ASC++ NLGNL 
Sbjct  61   AETVTFDDIISWWFMIVNVALTFFIGSILGWLVVKILKPKPYQEGVVIASCSSANLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA C E  +PFGD  +CS +GL+Y SFSMALGGF+
Sbjct  121  LILVPATCHEAGNPFGDHEVCSAVGLAYASFSMALGGFF  159



>ref|XP_009369785.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
 ref|XP_009369786.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
Length=412

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVA MPI Q+LIIS LGA +AT++  +LP+ ARR +NKVVFV FTPSL FA++
Sbjct  1    MGFWTLLEVACMPIFQVLIISVLGALMATEHWNLLPSGARRSMNKVVFVVFTPSLVFANV  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+   DI+SWWFM VN+ LTF+VG ILGWIV+K+ KPKP+ EG+I+A+ ++ NLGNLP
Sbjct  61   AKTITFGDIVSWWFMIVNVALTFVVGGILGWIVVKIFKPKPYQEGVIIAAVSSANLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC E+ +PFGD ++C  +GLSYVSFSMALGGF+
Sbjct  121  LILVPAICNEDGNPFGDHSVCRTIGLSYVSFSMALGGFF  159



>ref|XP_008448449.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Cucumis melo]
Length=428

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   LLEVA +P LQ+L++  +GA LATDY  +LPA AR  LNK+VF  FTP L FA+L
Sbjct  1    MGLLSLLEVAFIPNLQVLLMCSVGAFLATDYSNLLPAHARISLNKIVFTVFTPCLIFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  +DI+SWWFMPVNIGLTFL G ILGWIV+K+LKPKP+LEGL++A+ ++GNLGNL 
Sbjct  61   AKTVTFQDIVSWWFMPVNIGLTFLFGGILGWIVVKILKPKPYLEGLVIAASSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PAIC E+ SPFGDR  C+ LGLSY SFSMALGGFY
Sbjct  121  LIIIPAICDEDGSPFGDRDTCTSLGLSYASFSMALGGFY  159



>ref|XP_009130575.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
Length=384

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -3

Query  446  MPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLARTVKLEDIIS  267
            MPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+LA+TV L+DIIS
Sbjct  1    MPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANLAQTVTLQDIIS  60

Query  266  WWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPLIIVPAICAEE  87
            WWFMP+N+G+TFLVG ILGW+V+KLL PKP L GLI+A+CA+GN+GNL LI+VPAIC EE
Sbjct  61   WWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNMGNLMLILVPAICDEE  120

Query  86   ASPFGDRAICSRLGLSYVSFSMALGGFY  3
             SPFG+R++C  +GLSY SFSMALGGFY
Sbjct  121  GSPFGNRSVCRSIGLSYASFSMALGGFY  148



>ref|XP_010918345.1| PREDICTED: uncharacterized protein LOC105042744 isoform X1 [Elaeis 
guineensis]
 ref|XP_010918346.1| PREDICTED: uncharacterized protein LOC105042744 isoform X1 [Elaeis 
guineensis]
 ref|XP_010918348.1| PREDICTED: uncharacterized protein LOC105042744 isoform X1 [Elaeis 
guineensis]
 ref|XP_010918349.1| PREDICTED: uncharacterized protein LOC105042744 isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L  VASMP LQ L++  LGA LA+ YI IL  +A R +NK+VFV F+P+L FASL
Sbjct  1    MGFWSLFIVASMPNLQFLLVGLLGAFLASGYINILSTNALRDMNKIVFVVFSPALVFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV L+DI+SWWFMP+NIGLTFL+G ILGWIV+K+LKP+ HLEGL++ASC+AGNLGNLP
Sbjct  61   AETVTLQDILSWWFMPINIGLTFLIGGILGWIVVKILKPEHHLEGLVIASCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PAIC E+ +PFG+ + C  +GLSYVSFSMAL  F+
Sbjct  121  LIIIPAICNEDENPFGESSECKTIGLSYVSFSMALAAFF  159



>gb|EYU30838.1| hypothetical protein MIMGU_mgv1a007822mg [Erythranthe guttata]
Length=394

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL+VASMPI+Q+LII  LGA +ATDY+ +L +DAR+ LNK+VFVAFTPSL F SL
Sbjct  1    MGFLSLLKVASMPIVQVLIIGILGAFMATDYLNLLSSDARKSLNKIVFVAFTPSLVFGSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV L+DIISWWFMPVNI +TFLVG I GWI  K+LKP+P+L+ LI+A C+ GNLGN+ 
Sbjct  61   AETVTLQDIISWWFMPVNIAITFLVGGIFGWIAAKILKPEPYLQDLIVAICSGGNLGNIL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +IIVPA+C E  +PFGD+ +C+ + LSYVSFSMALG  Y
Sbjct  121  IIIVPAMCKENGNPFGDKDVCATMALSYVSFSMALGALY  159



>ref|XP_006855674.1| hypothetical protein AMTR_s00044p00126910 [Amborella trichopoda]
 gb|ERN17141.1| hypothetical protein AMTR_s00044p00126910 [Amborella trichopoda]
Length=429

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VASMPIL++L+IS LGA LAT Y  +L  DARRY+NKVVF+ FTPSL FASL
Sbjct  1    MGFSSLFVVASMPILEVLLISCLGAFLATGYCNVLTPDARRYINKVVFIVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
             ++V LEDI+SWWFMPVNIGL+   G +LGWI +K+ KP+ +LEGLI+ASC++GNLGNL 
Sbjct  61   VKSVTLEDIVSWWFMPVNIGLSVFFGAVLGWIAVKITKPERYLEGLIVASCSSGNLGNLM  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC E+ SPFG++++CS  G+SY SFSMALGGFY
Sbjct  121  IIIIPAICNEDGSPFGEQSVCSVRGISYASFSMALGGFY  159



>ref|XP_009418347.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   223 bits (568),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L  VAS PI+Q+L+I  LGA LA+ Y  +L   ARR +NKVVF  FTPSL FASL
Sbjct  1    MGFWSLFLVASEPIVQVLLIGLLGAYLASGYSNVLSPSARRDMNKVVFSVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  E+IISWWFMP+NIG+TFLVG +LGWIV+K+L P  HLEGL++A+ +AGNLGNL 
Sbjct  61   AKTVTFEEIISWWFMPINIGITFLVGGVLGWIVVKILGPPRHLEGLVIATSSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E  +PFGD+ ICS  GLSYVSFSMALGGFY
Sbjct  121  LIIIPAVCEENGNPFGDQQICSARGLSYVSFSMALGGFY  159



>ref|XP_004146179.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized transporter YBR287W-like 
[Cucumis sativus]
Length=420

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 130/167 (78%), Gaps = 8/167 (5%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTP-------  321
            MG   LLEVA MP LQ+L+I  +GA LATDY  +LPA AR  LNK+VF  FTP       
Sbjct  1    MGLLSLLEVALMPNLQVLLICLVGALLATDYCNLLPAHARTSLNKIVFTVFTPCLMFANL  60

Query  320  -SLTFASLARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCA  144
              L FA+LA+TV  +DI+SWWFMPVNIGLTFL G ILGWIV+K+LKPKP+LEGL++A+ +
Sbjct  61   PKLMFANLAKTVTFQDIVSWWFMPVNIGLTFLFGGILGWIVVKILKPKPYLEGLVIAASS  120

Query  143  AGNLGNLPLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +GNLGNL LIIVPAIC E+ SPFGDR  C+ LGLSY SFSMALGGFY
Sbjct  121  SGNLGNLLLIIVPAICDEDGSPFGDRDTCTSLGLSYASFSMALGGFY  167



>ref|XP_009420837.1| PREDICTED: uncharacterized protein LOC104000492 [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LL VAS P++Q+L+I  LGA LA+ Y  +L   ARR +NKVVF  FTP+L FASL
Sbjct  1    MGFWSLLLVASTPVVQVLLIGLLGAYLASGYSNVLLPGARRDMNKVVFTVFTPALMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  ++IISWWFMPVNIG+TFL+G ILGWIV+K+L+P  H+EGL++A+C+AGNLGNL 
Sbjct  61   AKTVTFQEIISWWFMPVNIGITFLIGGILGWIVVKILRPPNHIEGLVIAACSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PAIC E+ +PFGD  ICS  G+SYVSFSMALG FY
Sbjct  121  LIIIPAICEEDGNPFGDYKICSARGISYVSFSMALGAFY  159



>ref|XP_004146180.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis 
sativus]
 ref|XP_004159745.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis 
sativus]
 gb|KGN55593.1| hypothetical protein Csa_3G000170 [Cucumis sativus]
Length=434

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   LLEVASMP +QLL+IS LGA LATDY  ILP  A + LNK+VF  FTP L FA+L
Sbjct  1    MGLLSLLEVASMPNIQLLLISLLGAFLATDYCNILPPHATKSLNKIVFAVFTPCLMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ++TV  +DIIS WFMPVNIG TFL G +LGW ++K+LKPKP+LEGLI+AS A GNLGNL 
Sbjct  61   SKTVTFQDIISLWFMPVNIGFTFLFGGMLGWTIVKILKPKPYLEGLIVASSATGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PAIC +E +PFGDR  C+  GLSY SFSMALGGFY
Sbjct  121  LIIIPAICGDEGNPFGDRETCTSRGLSYASFSMALGGFY  159



>ref|XP_008804451.1| PREDICTED: uncharacterized transporter YBR287W-like [Phoenix 
dactylifera]
Length=420

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  +AS PI+Q+L+I  LGA LA+ Y  IL A AR+ +N+VVF  FTP+L FASL
Sbjct  1    MGFLSLFLLASEPIIQVLLIGSLGAYLASGYSNILTASARKDMNRVVFAVFTPALMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L+DIISWWFMP+NIG+TFLVG ILGWI +K+L+P  HLE L++A+C+AGNLGNL 
Sbjct  61   AKTVTLKDIISWWFMPINIGITFLVGGILGWITVKILRPPRHLENLVIATCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C EE +PFG  +IC   GLSYVSFSMALGGFY
Sbjct  121  LIIVPAVCDEEGNPFGQHSICRSRGLSYVSFSMALGGFY  159



>ref|XP_003612404.1| Transporter, putative [Medicago truncatula]
 gb|AES95362.1| auxin efflux carrier family protein [Medicago truncatula]
Length=420

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIK-ILPADARRYLNKVVFVAFTPSLTFAS  303
            MGF +LLEVASMP++Q+L+IS LGA +AT Y   +L  D R+ LNKVVF+ FTPSL FAS
Sbjct  1    MGFLQLLEVASMPVIQVLLISALGAFMATQYFNNLLSPDFRKSLNKVVFIVFTPSLVFAS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V LED+ISWWFMPVN+GLTFL+G ILGWI++KLL+P   +EGLI+ASC++GN+GNL
Sbjct  61   FAKSVSLEDMISWWFMPVNVGLTFLIGGILGWILVKLLRPNLKVEGLIIASCSSGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC E+  PFG R +C    LSY SFSMALGG +
Sbjct  121  PIVIIPAICNEKGGPFGARDVCHSNALSYASFSMALGGIF  160



>gb|EPS57973.1| hypothetical protein M569_16844, partial [Genlisea aurea]
Length=425

 Score =   218 bits (555),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  464  LLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLARTVK  285
            LLEV+SMP+L+LL+I  LGA LATD+IK+L AD R+ LNK+VF  FTPSL FASL +TV+
Sbjct  4    LLEVSSMPMLELLLICFLGALLATDHIKLLSADTRKSLNKIVFAVFTPSLLFASLLKTVR  63

Query  284  LEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPLIIVP  105
            +EDIISWWFMPVNI +TF+VG   GWI +K+++PKP+++ +I+A CA+GNLGN+ LII+P
Sbjct  64   IEDIISWWFMPVNIAITFIVGGSFGWIAMKIIRPKPYIQNVIIAMCASGNLGNILLIIIP  123

Query  104  AICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +IC E+ SPFGDR +CS +GLSY SFSMALG F+
Sbjct  124  SICKEKGSPFGDRDVCSTVGLSYASFSMALGAFF  157



>ref|XP_008448455.1| PREDICTED: uncharacterized transporter C5D6.04-like [Cucumis 
melo]
 ref|XP_008448456.1| PREDICTED: uncharacterized transporter C5D6.04-like [Cucumis 
melo]
 ref|XP_008448457.1| PREDICTED: uncharacterized transporter C5D6.04-like [Cucumis 
melo]
Length=435

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   LLEVASMP +QLL+IS LGA LATDY  +LP  A   LNK+VF  FTP L FA+L
Sbjct  1    MGLLSLLEVASMPNIQLLLISLLGAFLATDYCNVLPPHATSSLNKIVFTVFTPCLMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ++TV  +DIISWWFMPVNIG TFL G ILGW+++K+ KPKP+LEGLI+AS A GNLGNL 
Sbjct  61   SKTVTFQDIISWWFMPVNIGFTFLFGGILGWMIVKVFKPKPYLEGLIVASSATGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PAIC +  +PFG++  C+  GLSY SFSMALGGFY
Sbjct  121  LIIIPAICGDVGNPFGNQDTCTSRGLSYASFSMALGGFY  159



>gb|ABR18184.1| unknown [Picea sitchensis]
Length=455

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = -3

Query  503  ISKEDQRKMGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFT  324
            +SK+D+  M F  LLEVASMP+L++L+ISGLGA LAT Y+ +L AD R+++NKVVF+ FT
Sbjct  31   VSKKDRSIMAFLALLEVASMPVLRILLISGLGAFLATSYVDVLTADVRKHVNKVVFIVFT  90

Query  323  PSLTFASLARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCA  144
            P+L FASL+++V L++I+SWW+MPVN+ LTFL+G   GWIV+K+ +   HL GL++ +CA
Sbjct  91   PALMFASLSKSVTLDNIVSWWYMPVNLLLTFLIGGFCGWIVVKITRTPRHLSGLVIGNCA  150

Query  143  AGNLGNLPLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            AGN+GNL LII+PAIC ++ASPFGD  +C   G++Y SFSMA+G  Y
Sbjct  151  AGNVGNLLLIIIPAICEQKASPFGDAGVCMDYGMAYASFSMAIGAIY  197



>ref|XP_007158024.1| hypothetical protein PHAVU_002G117700g [Phaseolus vulgaris]
 gb|ESW30018.1| hypothetical protein PHAVU_002G117700g [Phaseolus vulgaris]
Length=418

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYI-KILPADARRYLNKVVFVAFTPSLTFAS  303
            MGF  LLEVASMPI+Q+L+IS LGA +AT Y   +L +D R+ LNK+VF  FTPSL FAS
Sbjct  1    MGFVELLEVASMPIIQVLLISALGALMATRYFDHLLSSDIRKALNKIVFFIFTPSLIFAS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V LED+ISWWFMPVN+GLTFL+G I+GWI++KLLKP   +EGLI+A+C++GN+GNL
Sbjct  61   FAKSVSLEDMISWWFMPVNVGLTFLIGGIIGWILVKLLKPNLKVEGLIIAACSSGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC E+  PFG R +C    LSY SFSMALGG +
Sbjct  121  PIVIIPAICDEKGGPFGARDVCRNNALSYASFSMALGGIF  160



>ref|XP_003537691.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Glycine max]
 ref|XP_006590759.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Glycine max]
Length=419

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYI-KILPADARRYLNKVVFVAFTPSLTFAS  303
            MGF  LLEVASMP++Q+L+IS LGA +AT +   IL  D R+ LNK+VFV FTPSL F+S
Sbjct  1    MGFLELLEVASMPVIQVLLISALGALMATQFFDNILSPDIRKALNKIVFVIFTPSLVFSS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V L+D+ISWWFMPVN+GLTFL+G I+GWI++KLLKP   +EGLI+A+C++GN+GNL
Sbjct  61   FAKSVSLDDMISWWFMPVNVGLTFLIGGIIGWILVKLLKPNLKVEGLIIAACSSGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC E+  PFG R IC    LSY SFSMALGG +
Sbjct  121  PIVIIPAICDEKGGPFGARDICRNNALSYASFSMALGGIF  160



>gb|KEH27632.1| auxin efflux carrier family protein [Medicago truncatula]
Length=303

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIK-ILPADARRYLNKVVFVAFTPSLTFAS  303
            MGF +LLEVASMP++Q+L++S LGA +AT Y   +L  D R+ LNKVVF  FTPSL F+S
Sbjct  1    MGFVQLLEVASMPVIQVLLVSALGAFMATQYFNNLLSPDFRKSLNKVVFFIFTPSLIFSS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V L+D+ISWWFMPVN+GLTFL+G ILGW+++KLL+P   +EGLI+A+C++GN+GNL
Sbjct  61   FAKSVSLQDMISWWFMPVNVGLTFLIGGILGWLLVKLLRPNLKVEGLIIAACSSGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC E+  PFG R +C    LSY SFSMALGG +
Sbjct  121  PIVIIPAICDEKGGPFGARDVCRSNALSYASFSMALGGIF  160



>ref|XP_010935349.1| PREDICTED: uncharacterized transporter YBR287W-like [Elaeis guineensis]
Length=420

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L  +AS P++Q+L+I  LGA LA+ Y  IL A AR+ +N+VVF  FTP+L FA+L
Sbjct  1    MGFWSLFLLASEPVIQVLLIGSLGAYLASGYSNILTASARKDMNRVVFSVFTPALMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L DIISWWFMPVN+G+ FL+G ILGWI +K+L+P  HLE L++A+C+AGNLGNL 
Sbjct  61   AKTVTLRDIISWWFMPVNVGIIFLIGGILGWIAVKILRPPRHLENLVIATCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C +E +PFG  +IC    LSYVSFSMALGGFY
Sbjct  121  LIVVPAVCDDEGNPFGQHSICRSRALSYVSFSMALGGFY  159



>ref|XP_003517128.1| PREDICTED: uncharacterized transporter YBR287W-like isoformX2 
[Glycine max]
 ref|XP_006573516.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X3 
[Glycine max]
 gb|KHN35945.1| Putative transporter [Glycine soja]
Length=419

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYI-KILPADARRYLNKVVFVAFTPSLTFAS  303
            MGF  LLEVAS+P++Q+L+IS LGA +AT Y   +L  D R+ LNK+VF+ FTPSL F+S
Sbjct  1    MGFLELLEVASLPVIQVLLISALGALMATQYFDNLLSPDIRKALNKIVFLIFTPSLVFSS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V L+D+ISWWFMPVN+GLTFL+G I+GWI++KLLKP   +EGLI+A+C++GN+GNL
Sbjct  61   FAKSVSLDDMISWWFMPVNVGLTFLIGGIIGWILVKLLKPNLKVEGLIIAACSSGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC E+  PFG R IC    LSY SFSMALGG +
Sbjct  121  PIVIIPAICDEKGGPFGARDICRNNALSYASFSMALGGIF  160



>gb|KEH27633.1| auxin efflux carrier family protein [Medicago truncatula]
Length=381

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIK-ILPADARRYLNKVVFVAFTPSLTFAS  303
            MGF +LLEVASMP++Q+L++S LGA +AT Y   +L  D R+ LNKVVF  FTPSL F+S
Sbjct  1    MGFVQLLEVASMPVIQVLLVSALGAFMATQYFNNLLSPDFRKSLNKVVFFIFTPSLIFSS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V L+D+ISWWFMPVN+GLTFL+G ILGW+++KLL+P   +EGLI+A+C++GN+GNL
Sbjct  61   FAKSVSLQDMISWWFMPVNVGLTFLIGGILGWLLVKLLRPNLKVEGLIIAACSSGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC E+  PFG R +C    LSY SFSMALGG +
Sbjct  121  PIVIIPAICDEKGGPFGARDVCRSNALSYASFSMALGGIF  160



>ref|XP_003612402.1| Transporter, putative [Medicago truncatula]
 gb|AES95360.1| auxin efflux carrier family protein [Medicago truncatula]
Length=421

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIK-ILPADARRYLNKVVFVAFTPSLTFAS  303
            MGF +LLEVASMP++Q+L++S LGA +AT Y   +L  D R+ LNKVVF  FTPSL F+S
Sbjct  1    MGFVQLLEVASMPVIQVLLVSALGAFMATQYFNNLLSPDFRKSLNKVVFFIFTPSLIFSS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V L+D+ISWWFMPVN+GLTFL+G ILGW+++KLL+P   +EGLI+A+C++GN+GNL
Sbjct  61   FAKSVSLQDMISWWFMPVNVGLTFLIGGILGWLLVKLLRPNLKVEGLIIAACSSGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC E+  PFG R +C    LSY SFSMALGG +
Sbjct  121  PIVIIPAICDEKGGPFGARDVCRSNALSYASFSMALGGIF  160



>gb|EMT16972.1| Putative transporter [Aegilops tauschii]
Length=428

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VASMPI+Q+L+I  +GA LA+ Y K+L A ARR +NKVVF  FTPSL FA+L
Sbjct  1    MGFLSLLVVASMPIVQVLLIGVIGAFLASGYSKVLTASARRDMNKVVFTVFTPSLIFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L D+ISWWFMPVNI +TFLVG+ LGW+  K+LKP PH  GLI+A C+AGNLGNL 
Sbjct  61   AKTVTLSDVISWWFMPVNIAITFLVGSALGWLACKILKPPPHFRGLIMAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C E+ +PFG DR+ C   GLSY S SMALGG +
Sbjct  121  LIVVPAVCDEDGNPFGNDRSQCRSRGLSYSSLSMALGGLF  160



>ref|XP_003578612.1| PREDICTED: uncharacterized protein LOC100833440 [Brachypodium 
distachyon]
Length=423

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VASMPI+Q+L+I  +GA LA+ Y  +L   ARR +NKVVF  FTPSL FASL
Sbjct  1    MGFMSLLLVASMPIVQVLLIGVIGAFLASGYSNVLTVSARRDMNKVVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L D+ISWWFMPVNIG+TFLVG  LGWIV K+LKP PH  GLI++ C+AGNLGNL 
Sbjct  61   AKTVTLSDVISWWFMPVNIGITFLVGGALGWIVCKILKPPPHFRGLIISFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ SPFG DR+ C    LSY S SMALGG +
Sbjct  121  LIIVPAVCDEDGSPFGEDRSRCRSRALSYSSLSMALGGLF  160



>ref|XP_004146216.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis 
sativus]
Length=395

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   LLEVA +P LQ+L++  +GA LATDY  +LPA AR  LNK+VF  FTP L FA+L
Sbjct  1    MGLLSLLEVAFIPNLQVLLMCSVGAFLATDYSNLLPAHARISLNKIVFAVFTPCLMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  +DI+SWWFMP+NI  TFL G +LGWIVIKLLKPKP+LEGL++A  + GNLG L 
Sbjct  61   AKTVTFQDIVSWWFMPLNIAFTFLFGGLLGWIVIKLLKPKPYLEGLVMAVSSTGNLGYLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGF  6
            LII+PAIC E  SPFG+ + C+ LGLSY SFSMAL GF
Sbjct  121  LIIIPAICYENGSPFGNHSTCASLGLSYASFSMALSGF  158



>ref|XP_004159761.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis 
sativus]
Length=395

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   LLEVA +P LQ+L++  +GA LATDY  +LPA AR  LNK+VF  FTP L FA+L
Sbjct  1    MGLLSLLEVAFIPNLQVLLMCSVGAFLATDYSNLLPAHARISLNKIVFAVFTPCLMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  +DI+SWWFMP+NI  TFL G +LGWIVIKLLKPKP+LEGL++A  + GNLG L 
Sbjct  61   AKTVTFQDIVSWWFMPLNIAFTFLFGGLLGWIVIKLLKPKPYLEGLVMAVSSTGNLGYLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGF  6
            LII+PAIC E  SPFG+ + C+ LGLSY SFSMAL GF
Sbjct  121  LIIIPAICYENGSPFGNHSTCASLGLSYASFSMALSGF  158



>ref|XP_004512284.1| PREDICTED: uncharacterized transporter YBR287W-like [Cicer arietinum]
Length=420

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 126/160 (79%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIK-ILPADARRYLNKVVFVAFTPSLTFAS  303
            M F  LLEVASMP++Q+L+IS LGA +AT Y   +L  D R+ LNKVVF+ FTPSL FAS
Sbjct  1    MTFVELLEVASMPVIQVLLISALGAFMATSYFNNLLSPDFRKSLNKVVFILFTPSLVFAS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V LED+ SWWFMPVN+GLTFL+G ILGWI++KLL+P   ++GLI+ASC++GNLGNL
Sbjct  61   FAKSVSLEDMKSWWFMPVNVGLTFLIGGILGWILVKLLRPNLKVKGLIIASCSSGNLGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC ++  PFG   +C    LSY SFSMALGG +
Sbjct  121  PIVIIPAICDQKGGPFGAHDVCRSNALSYASFSMALGGIF  160



>gb|AES95354.2| auxin efflux carrier family protein [Medicago truncatula]
Length=169

 Score =   200 bits (508),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 124/156 (79%), Gaps = 1/156 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIK-ILPADARRYLNKVVFVAFTPSLTFAS  303
            MGF +LLEVASMP++Q+L++S LGA +AT Y   +L  D R+ LNKV F  FTPSL F+S
Sbjct  1    MGFVQLLEVASMPVIQVLLVSALGAFMATQYFNNLLSPDFRKSLNKVAFFIFTPSLIFSS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V L+D+ISWWFMPVN+GLTFL+G ILGW+++KLL+P   +EGLI+A+C++GN+G L
Sbjct  61   FAKSVSLQDMISWWFMPVNVGLTFLIGGILGWLLVKLLRPNLKVEGLIIAACSSGNMGGL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMAL  15
            P++I+PAIC E+  PFG R +C    LSY SFSMA+
Sbjct  121  PVVIIPAICNEKGGPFGARDVCHSNALSYASFSMAV  156



>ref|NP_001063887.1| Os09g0554300 [Oryza sativa Japonica Group]
 dbj|BAF25801.1| Os09g0554300 [Oryza sativa Japonica Group]
 gb|EEC85029.1| hypothetical protein OsI_32333 [Oryza sativa Indica Group]
 gb|EEE70194.1| hypothetical protein OsJ_30279 [Oryza sativa Japonica Group]
Length=428

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 124/160 (78%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VASMPI+Q+L+I  +GA LA+ Y KIL + A R +NKVVF  FTPSL FASL
Sbjct  1    MGFLSLLLVASMPIVQVLLIGVIGAFLASGYSKILTSSALRDMNKVVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L D+ISWWFMPVNIG+TF+VG  LGWI  K+LKP  H  G+I+A C+AGNLGNL 
Sbjct  61   AKTVTLSDVISWWFMPVNIGITFIVGGTLGWIACKILKPPQHFRGMIIAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ +PFG DR++C   GLSY S SMALGG +
Sbjct  121  LIIVPAVCDEDGNPFGKDRSLCRSRGLSYSSLSMALGGLF  160



>emb|CAN62432.1| hypothetical protein VITISV_012649 [Vitis vinifera]
Length=436

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  416  GLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLARTVKLEDIISWWFMPVNIGL  237
            G+GA LAT Y  ILPADAR+ +NK+VFVAFTPSL FA LA+TV L+D+ISWWFMPVNIGL
Sbjct  37   GVGAFLATGYCNILPADARKSVNKIVFVAFTPSLMFAGLAQTVTLQDMISWWFMPVNIGL  96

Query  236  TFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPLIIVPAICAEEASPFGDRAIC  57
            TFL G ILGW+V+K+LKPK HLEGLI+A+C++GNLGNL LI++PAIC E+ SPFGD A C
Sbjct  97   TFLFGGILGWLVVKILKPKQHLEGLIMATCSSGNLGNLLLIVIPAICEEDGSPFGDHASC  156

Query  56   SRLGLSYVSFSMALGGFY  3
               GLSY S S ALGG +
Sbjct  157  GASGLSYASLSTALGGIF  174



>ref|NP_001280772.1| uncharacterized transporter YBR287W-like [Malus domestica]
 gb|ABQ95657.1| auxin hydrogen symporter [Malus domestica]
Length=412

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVA MPI Q+LIIS LGA +AT+Y  +LP DAR+ +NKVVFV FTP+L F+++
Sbjct  1    MGFWTLLEVACMPIFQVLIISVLGALMATEYWNLLPLDARKSINKVVFVVFTPALVFSNV  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+   DI+SWWFM VNIGLTFLVG ILGWIV+K+ KPKP+ EG+++A+ ++GNLGNL 
Sbjct  61   AKTITFGDIVSWWFMVVNIGLTFLVGGILGWIVVKIFKPKPYQEGVVIATVSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC E+ +PFGD ++C   GL+YVSFSMALG F+
Sbjct  121  LILVPAICNEDGNPFGDHSVCKTTGLAYVSFSMALGNFF  159



>dbj|BAK01989.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=416

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VASMPI+Q+L+I  +GA LA+ Y K+  A ARR +NKVVF  FTPSL FA+L
Sbjct  1    MGFLSLLVVASMPIVQVLLIGVIGAFLASGYSKVFTASARRDMNKVVFTVFTPSLIFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L D+ISWWFMPVNI +TFLVG+ LGW+  K+LKP  H  GLI+A C+AGNLGNL 
Sbjct  61   AKTVTLSDVISWWFMPVNIAITFLVGSALGWLACKILKPPQHFRGLIMAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C E+ +PFG DR+ C   GLSY S SMALGG +
Sbjct  121  LIVVPAVCDEDGNPFGNDRSQCRSRGLSYSSLSMALGGLF  160



>ref|XP_009420836.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
Length=411

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 126/159 (79%), Gaps = 2/159 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW L  VAS PI+Q+L+I  LGA LA+ Y  +LP  ARR +NKVVF  FTPSL FASL
Sbjct  1    MGFWSLFPVASTPIVQVLLIGLLGAYLASGYSNLLPHSARRDMNKVVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L++IISWWFMPVN+G+TFL+G ILGWIV+++L+P  HLEGL++A+C+AGN+GNL 
Sbjct  61   AKTVTLKEIISWWFMPVNLGITFLIGGILGWIVVRILRPPRHLEGLVIATCSAGNMGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
             II+PAIC ++ +PFG+  +    GL+  SFSMA+GG Y
Sbjct  121  WIIIPAICEQDGNPFGNDKVSGARGLA--SFSMAIGGIY  157



>ref|XP_004509460.1| PREDICTED: uncharacterized transporter YBR287W-like [Cicer arietinum]
Length=406

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 124/160 (78%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIK-ILPADARRYLNKVVFVAFTPSLTFAS  303
            M FW  LEVAS PI+Q+L+IS +GA +AT+Y   IL  D R+ LNK+VF AFTPSL F+S
Sbjct  1    MDFWDELEVASAPIIQVLLISAVGAYMATEYCNNILSPDFRKSLNKIVFTAFTPSLIFSS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V LED+ISWWFMPVNIGL FL+G  LGWI++KLLKP   +EGLI+ASC++GN+GNL
Sbjct  61   FAKSVSLEDMISWWFMPVNIGLGFLIGGFLGWIIVKLLKPNMKVEGLIIASCSSGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC ++ +PFG    C    LSY  FS+A+GG Y
Sbjct  121  PIVIIPAICNQKGAPFGTHDACRTRALSYSFFSLAIGGVY  160



>ref|XP_009359620.1| PREDICTED: uncharacterized transporter YBR287W [Pyrus x bretschneideri]
Length=412

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LLEVA MPI Q+LIIS LGA +AT+Y  +LP DAR+ +N++VFV FTP+L FA++
Sbjct  1    MGFWTLLEVACMPIFQVLIISVLGAFMATEYWNLLPLDARKSINRIVFVVFTPALVFANV  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+   DI+SWWFM VNIGLTFLVG ILGWIV+K+ KPKP+ EG+++A+ ++GNLGNL 
Sbjct  61   AKTITFGDIVSWWFMVVNIGLTFLVGGILGWIVVKIFKPKPYQEGVVIATVSSGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC E+ +PFGD ++C   GL+YVSFSMALG F+
Sbjct  121  LILVPAICNEDGNPFGDHSVCKTTGLAYVSFSMALGNFF  159



>ref|XP_008448451.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X3 
[Cucumis melo]
Length=381

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   LLEVA +P LQ+L++  +GA LATDY  +LPA AR  LNK+VF  FTP L FA+L
Sbjct  1    MGLLSLLEVAFIPNLQVLLMCSVGAFLATDYSNLLPAHARISLNKIVFAVFTPCLMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  +DI+SWWFMP+NI  TFL G +LGWIVIKLLKPK +LEGL++A  + GNLG L 
Sbjct  61   AKTVTFQDIVSWWFMPLNIAFTFLFGGLLGWIVIKLLKPKSYLEGLVMAVSSTGNLGYLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGF  6
            LII+PAIC E  SPFG+   C+ LGLSY SFSMAL GF
Sbjct  121  LIIIPAICYENGSPFGNHNTCASLGLSYASFSMALSGF  158



>ref|XP_008448450.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Cucumis melo]
Length=391

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   LLEVA +P LQ+L++  +GA LATDY  +LPA AR  LNK+VF  FTP L FA+L
Sbjct  1    MGLLSLLEVAFIPNLQVLLMCSVGAFLATDYSNLLPAHARISLNKIVFAVFTPCLMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  +DI+SWWFMP+NI  TFL G +LGWIVIKLLKPK +LEGL++A  + GNLG L 
Sbjct  61   AKTVTFQDIVSWWFMPLNIAFTFLFGGLLGWIVIKLLKPKSYLEGLVMAVSSTGNLGYLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGF  6
            LII+PAIC E  SPFG+   C+ LGLSY SFSMAL GF
Sbjct  121  LIIIPAICYENGSPFGNHNTCASLGLSYASFSMALSGF  158



>ref|XP_004957592.1| PREDICTED: uncharacterized transporter YBR287W-like [Setaria 
italica]
Length=418

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF+    VASMPI+Q+L+I  +GA LA+ +  +L   ARR +NKVVF  FTPSL FASL
Sbjct  1    MGFFSFFLVASMPIVQVLLIGVVGAYLASGFSNVLTTSARRDMNKVVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV LED+ISWWFMPVNIG+TF +G  LGWI   +LKP  H  GLI+A C+AGNLGNL 
Sbjct  61   AKTVTLEDVISWWFMPVNIGITFFIGGSLGWIACNILKPPQHFRGLIMAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ +PFG DR+IC   GLSY S SMALGG +
Sbjct  121  LIIVPAVCDEDGNPFGKDRSICRSRGLSYSSLSMALGGLF  160



>ref|XP_006660956.1| PREDICTED: uncharacterized transporter YBR287W-like [Oryza brachyantha]
Length=425

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VASMP +Q+L+I  +GA LA+ Y KIL + A R +NKVVF  FTPSL FASL
Sbjct  1    MGFLSLLLVASMPNIQVLLIGVIGAYLASGYSKILTSSALRDMNKVVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L D+ISWWFMPVNIG+TF+VG  LGWI  ++LKP  H  G+I+A C+AGNLGNL 
Sbjct  61   AKTVTLSDVISWWFMPVNIGITFIVGGTLGWIACQILKPPQHFRGMIIAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ +PFG DR++C   GLSY S SMALGG +
Sbjct  121  LIIVPAVCDEDGNPFGKDRSLCRSRGLSYSSLSMALGGLF  160



>gb|AET03577.2| auxin efflux carrier family protein [Medicago truncatula]
Length=379

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDY-IKILPADARRYLNKVVFVAFTPSLTFAS  303
            M F   L+VAS PI+Q+L+IS +GA +AT++   +L AD R+ LNK+VF AFTP+L FAS
Sbjct  1    MSFLEQLKVASAPIIQVLLISAVGAYMATEHGNNLLAADFRKSLNKIVFTAFTPALIFAS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V L+D+ISWWFMPVNIGLTFL G ILGWI++KLLKP   +EGLI+ASC++GN+GNL
Sbjct  61   FAKSVSLDDMISWWFMPVNIGLTFLFGGILGWIIVKLLKPNMKVEGLIIASCSSGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC ++ +PFG    C    LSY  FS+ALGG Y
Sbjct  121  PVVIIPAICNQKVTPFGTHDACRTRALSYSFFSLALGGIY  160



>gb|EMS54288.1| Uncharacterized transporter C5D6.04 [Triticum urartu]
Length=440

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 124/169 (73%), Gaps = 10/169 (6%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VASMPI+Q+L+I  +GA LA+ Y K+L A ARR +NKVVF  FTPSL FA+L
Sbjct  1    MGFLSLLVVASMPIVQVLLIGVIGAFLASGYSKVLTASARRDMNKVVFTVFTPSLIFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAA-------  141
            A+TV L D+ISWWFMPVNI +TFLVG+ LGW+  K+LKP PH  GLI+A C+A       
Sbjct  61   AKTVTLSDVISWWFMPVNIAITFLVGSALGWLACKILKPPPHFRGLIMAFCSAVSGIDQT  120

Query  140  --GNLGNLPLIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
              GNLGNL LI+VPA+C E+ +PFG DR  C   GLSY S SMALGG +
Sbjct  121  NVGNLGNLLLIVVPAVCDEDGNPFGSDRNQCRSRGLSYSSLSMALGGLF  169



>ref|XP_003629101.1| Transporter, putative [Medicago truncatula]
Length=410

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDY-IKILPADARRYLNKVVFVAFTPSLTFAS  303
            M F   L+VAS PI+Q+L+IS +GA +AT++   +L AD R+ LNK+VF AFTP+L FAS
Sbjct  1    MSFLEQLKVASAPIIQVLLISAVGAYMATEHGNNLLAADFRKSLNKIVFTAFTPALIFAS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V L+D+ISWWFMPVNIGLTFL G ILGWI++KLLKP   +EGLI+ASC++GN+GNL
Sbjct  61   FAKSVSLDDMISWWFMPVNIGLTFLFGGILGWIIVKLLKPNMKVEGLIIASCSSGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC ++ +PFG    C    LSY  FS+ALGG Y
Sbjct  121  PVVIIPAICNQKVTPFGTHDACRTRALSYSFFSLALGGIY  160



>ref|XP_009401008.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401009.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401010.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW LL VAS P+LQ+L++  +GA LA+ Y+ IL ++ARR +NK+VFV F P+L FASL
Sbjct  1    MEFWSLLMVASRPVLQVLLVGLIGAFLASGYVNILSSNARRDVNKIVFVVFIPALVFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  +DIISWWFMPVNIG+TFL+G ILGW   K+LK + HL+ L++ASC+AGNLG +P
Sbjct  61   AKTVTAKDIISWWFMPVNIGITFLIGGILGWAAAKMLKLEHHLQALVIASCSAGNLGAMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ +PFG   IC   G+SY SFSM +G  +
Sbjct  121  LIIVPAICDEDGNPFGLSKICRVQGISYASFSMVVGNLF  159



>ref|XP_003612396.1| hypothetical protein MTR_5g024580 [Medicago truncatula]
Length=172

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 124/159 (78%), Gaps = 4/159 (3%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIK-ILPADARRYLNKVVFVAFTPSLTFAS  303
            MGF +LLEVASMP++Q+L++S LGA +AT Y   +L  D R+ LNKV F  FTPSL F+S
Sbjct  1    MGFVQLLEVASMPVIQVLLVSALGAFMATQYFNNLLSPDFRKSLNKVAFFIFTPSLIFSS  60

Query  302  LARTVKLEDIISW---WFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNL  132
             A++V L+D+ISW   WFMPVN+GLTFL+G ILGW+++KLL+P   +EGLI+A+C++GN+
Sbjct  61   FAKSVSLQDMISWYIWWFMPVNVGLTFLIGGILGWLLVKLLRPNLKVEGLIIAACSSGNM  120

Query  131  GNLPLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMAL  15
            G LP++I+PAIC E+  PFG R +C    LSY SFSMA+
Sbjct  121  GGLPVVIIPAICNEKGGPFGARDVCHSNALSYASFSMAV  159



>ref|XP_007156259.1| hypothetical protein PHAVU_003G271200g [Phaseolus vulgaris]
 gb|ESW28253.1| hypothetical protein PHAVU_003G271200g [Phaseolus vulgaris]
Length=409

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIK-ILPADARRYLNKVVFVAFTPSLTFAS  303
            MGFW +LEVAS P++Q+L+IS +G  +ATD    +L AD R+ LNKVVF+AFTPSL FAS
Sbjct  1    MGFWEMLEVASAPVIQVLLISAVGVFMATDSCNNLLSADFRKSLNKVVFIAFTPSLIFAS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             A++V L+++I WWFMPVNIGLTFL+G ILGW+++K+LKP   ++GLI+ASC+ GN+GNL
Sbjct  61   FAKSVSLDEMILWWFMPVNIGLTFLIGGILGWMIVKVLKPNLKVQGLIIASCSTGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC E+  PFG+   C    LSY   S+ALGG +
Sbjct  121  PIVIIPAICDEKGGPFGEPDDCRHRALSYSFCSLALGGVF  160



>gb|ABR16386.1| unknown [Picea sitchensis]
Length=426

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW LL VASMP++++L+ISGLGA L+T Y  +L  D+ +++NKV+FV FTP+L FASL
Sbjct  1    MAFWDLLIVASMPVVKILLISGLGAVLSTRYAGVLTEDSLKHVNKVIFVVFTPALMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A++V  ED+ISWW MP N+ LTFL G ILGWI++K+ KP  +L G+++A+C AGN+GNL 
Sbjct  61   AQSVTFEDLISWWSMPFNVFLTFLFGAILGWIIVKITKPPEYLNGIVVANCCAGNMGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C E+ SPFG+ ++C   G++Y SFSMALG  +
Sbjct  121  LIVVPALCHEKGSPFGEPSVCKLNGIAYASFSMALGSVF  159



>ref|XP_003562144.1| PREDICTED: uncharacterized protein LOC100832109 [Brachypodium 
distachyon]
Length=409

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW LL VA MP+LQ+L+   LGA LA+    +L +DARR++NKVV+V F PSL F+SL
Sbjct  1    MRFWSLLAVAWMPVLQVLLAGLLGACLASSRFNVLTSDARRHINKVVYVVFVPSLVFSSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV L+DI+SWWFMPVN+G+ FL+G  LGW+ +K+L+P  H++GLI+A  +AGN G +P
Sbjct  61   AGTVTLKDIVSWWFMPVNMGIIFLIGAALGWLAVKVLRPGEHMQGLIVACSSAGNWGTIP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            L+IVPAIC EE SPFGD + C+ LGLSYVS SMALG FY
Sbjct  121  LMIVPAICNEEDSPFGDASTCNSLGLSYVSLSMALGNFY  159



>ref|XP_003533405.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Glycine max]
 ref|XP_006587548.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Glycine max]
 ref|XP_006587549.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X3 
[Glycine max]
Length=409

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 124/160 (78%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYI-KILPADARRYLNKVVFVAFTPSLTFAS  303
            MGF +LLEVAS P++Q+L+IS +GA +ATDY   +L A+ R+ LNK+VF AFTPSL FAS
Sbjct  1    MGFLQLLEVASAPVIQVLLISAVGAFMATDYCDNLLSAEFRKSLNKIVFFAFTPSLIFAS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
             ++ V LED+ISWWFMPVNIG TFL+G ILGWI++K+LKP   ++GLI+ASC+ GN+GNL
Sbjct  61   FSKNVSLEDMISWWFMPVNIGCTFLIGGILGWILVKVLKPNLKVQGLIIASCSTGNMGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            P++I+PAIC ++  PFG    C    LSY   S+ALGG +
Sbjct  121  PVVIIPAICDQKGGPFGAPDDCRNRALSYSFCSLALGGVF  160



>gb|KGN55594.1| hypothetical protein Csa_3G000180 [Cucumis sativus]
Length=376

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = -3

Query  413  LGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLARTVKLEDIISWWFMPVNIGLT  234
            +GA LATDY  +LPA AR  LNK+VF  FTP L FA+LA+TV  +DI+SWWFMP+NI  T
Sbjct  4    VGAFLATDYSNLLPAHARISLNKIVFAVFTPCLMFANLAKTVTFQDIVSWWFMPLNIAFT  63

Query  233  FLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPLIIVPAICAEEASPFGDRAICS  54
            FL G +LGWIVIKLLKPKP+LEGL++A  + GNLG L LII+PAIC E  SPFG+ + C+
Sbjct  64   FLFGGLLGWIVIKLLKPKPYLEGLVMAVSSTGNLGYLLLIIIPAICYENGSPFGNHSTCA  123

Query  53   RLGLSYVSFSMALGGF  6
             LGLSY SFSMAL GF
Sbjct  124  SLGLSYASFSMALSGF  139



>ref|XP_002468584.1| hypothetical protein SORBIDRAFT_01g048490 [Sorghum bicolor]
 gb|EER95582.1| hypothetical protein SORBIDRAFT_01g048490 [Sorghum bicolor]
Length=342

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW LL VA +P+LQ+L++  LGA LA+  + +L +DARR +NKVV++ F PSL F+SL
Sbjct  1    MRFWSLLVVAWLPVLQVLLVGLLGALLASSRLDVLTSDARRNINKVVYIVFVPSLVFSSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            + TV L+DI+SWWFMPVN+G+ FL+G +LGW+ +K+ +P+ HL+GL++A C++GN G +P
Sbjct  61   SSTVTLKDIVSWWFMPVNMGIVFLIGAVLGWVSVKVFRPEEHLQGLVIACCSSGNWGTIP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            L+IVPAIC EE SPFGD + C+ LGLSYVS SMALG FY
Sbjct  121  LMIVPAICNEEGSPFGDASTCNSLGLSYVSLSMALGNFY  159



>ref|XP_003612433.1| Auxin efflux carrier protein [Medicago truncatula]
 gb|KEH27641.1| auxin efflux carrier family protein [Medicago truncatula]
Length=264

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VAS P++++L+++G+G  LA D I +L  DAR   N +V   F P L   +L
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ L++++S WFMPVNI +TFL+G+ LGWI+IKL KP  H+EGLI+  C+AGNLGNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  +
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAIGAVF  159



>gb|AET03524.2| auxin efflux carrier family protein [Medicago truncatula]
Length=404

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF +LL VAS+P++++L+IS LG  LA D + +L ADAR+ +N +VF  F PSL  ++L
Sbjct  1    MGFMQLLYVASLPVMKVLLISALGLFLAIDQVDVLGADARKRVNNLVFYVFNPSLVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  +++++ WFMPVN+  TF++G+ L WIVIK+ +P  HLEGLIL  C+AGNLGNLP
Sbjct  61   AETLTSDNVLTLWFMPVNVLATFILGSALAWIVIKITRPPKHLEGLILGCCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGG  9
            +II+PAIC E+ SPFGD  +C + G++YVS SMA+G 
Sbjct  121  IIIIPAICKEKGSPFGDPVLCHKYGMAYVSLSMAIGA  157



>ref|XP_003629048.1| Transporter, putative [Medicago truncatula]
Length=403

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF +LL VAS+P++++L+IS LG  LA D + +L ADAR+ +N +VF  F PSL  ++L
Sbjct  1    MGFMQLLYVASLPVMKVLLISALGLFLAIDQVDVLGADARKRVNNLVFYVFNPSLVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  +++++ WFMPVN+  TF++G+ L WIVIK+ +P  HLEGLIL  C+AGNLGNLP
Sbjct  61   AETLTSDNVLTLWFMPVNVLATFILGSALAWIVIKITRPPKHLEGLILGCCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGG  9
            +II+PAIC E+ SPFGD  +C + G++YVS SMA+G 
Sbjct  121  IIIIPAICKEKGSPFGDPVLCHKYGMAYVSLSMAIGA  157



>ref|XP_003612432.1| Auxin efflux carrier protein [Medicago truncatula]
 gb|KEH27640.1| auxin efflux carrier family protein [Medicago truncatula]
Length=275

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VAS P++++L+++G+G  LA D I +L  DAR   N +V   F P L   +L
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ L++++S WFMPVNI +TFL+G+ LGWI+IKL KP  H+EGLI+  C+AGNLGNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  +
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAIGAVF  159



>ref|XP_004509473.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Cicer arietinum]
 ref|XP_004509474.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Cicer arietinum]
Length=392

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VAS+P++++L+I+ LG  LA D + +L ADAR+ +N +VF  F PSL  ++L
Sbjct  1    MGFIELLYVASLPVIKVLLITALGLFLAIDQVDVLGADARKRMNNLVFYVFNPSLVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E++++ WFMPVNI  TF++G+ L WIVIK+ +P  HL+GLIL  C+AGNLGNLP
Sbjct  61   AETLTSENVLTLWFMPVNILSTFILGSALAWIVIKITRPPKHLQGLILGCCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC E+ SPFGD  +C + G++YVS SMA+G  +
Sbjct  121  IIIIPAICKEKGSPFGDPDLCHKYGMAYVSLSMAIGAVF  159



>ref|XP_009614501.1| PREDICTED: uncharacterized protein LOC104107409 isoform X2 [Nicotiana 
tomentosiformis]
Length=370

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -3

Query  341  VFVAFTPSLTFASLARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGL  162
            +FV FTPSL FASLA+TV L+DIISWWFMP+NIGLTFLVG ILGW+V+K+LKP+ HLEGL
Sbjct  1    MFVIFTPSLMFASLAKTVTLDDIISWWFMPINIGLTFLVGGILGWLVVKILKPELHLEGL  60

Query  161  ILASCAAGNLGNLPLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            I+A+C+AGNLGNL LI++PAIC E+ SPFGD  IC+ +GLSY SFSMA+GGFY
Sbjct  61   IIATCSAGNLGNLLLIVIPAICKEKGSPFGDHGICASVGLSYASFSMAVGGFY  113



>ref|XP_006304763.1| hypothetical protein CARUB_v10012230mg [Capsella rubella]
 gb|EOA37661.1| hypothetical protein CARUB_v10012230mg [Capsella rubella]
Length=384

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = -3

Query  467  RLLEV---ASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLA  297
            RLL++   +S+P+ ++L+I+G+G  LA D + IL  DAR+ LN +VF  F+PSL  +SLA
Sbjct  2    RLLDLFITSSIPVAKILMITGIGFYLAMDRVNILNQDARKQLNNIVFYVFSPSLVASSLA  61

Query  296  RTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPL  117
             T+  E ++  WFMP+N+ LTF++G+ LGW+VIK+ KP PHL G+I+  CAAGNLGN+PL
Sbjct  62   ATITYESMVKMWFMPINVLLTFIIGSFLGWVVIKITKPPPHLRGIIVGCCAAGNLGNMPL  121

Query  116  IIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            II+PAIC E+ SPFGD   C + GL YV+ SMA+G  Y
Sbjct  122  IIIPAICNEKGSPFGDSESCQKFGLGYVALSMAIGAIY  159



>gb|AES95391.2| auxin efflux carrier family protein [Medicago truncatula]
Length=329

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VAS P++++L+++G+G  LA D I +L  DAR   N +V   F P L   +L
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ L++++S WFMPVNI +TFL+G+ LGWI+IKL KP  H+EGLI+  C+AGNLGNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  +
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAIGAVF  159



>gb|KEH27638.1| auxin efflux carrier family protein [Medicago truncatula]
Length=319

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VAS P++++L+++G+G  LA D I +L  DAR   N +V   F P L   +L
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ L++++S WFMPVNI +TFL+G+ LGWI+IKL KP  H+EGLI+  C+AGNLGNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  +
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAIGAVF  159



>ref|XP_006382981.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
 gb|ERP60778.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa]
Length=370

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -3

Query  335  VAFTPSLTFASLARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLIL  156
            + FTPSL FASLA+TV LEDIISWWFMPVNIGLTFL+G ILGWI++K+L+PKP+LEGL++
Sbjct  1    MVFTPSLMFASLAKTVTLEDIISWWFMPVNIGLTFLIGGILGWILVKILRPKPYLEGLVI  60

Query  155  ASCAAGNLGNLPLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            A+C++GNLGNL LIIVPAIC E+ SPFGD +IC+ +GLSY SFSMALGGF+
Sbjct  61   ATCSSGNLGNLLLIIVPAICTEDGSPFGDSSICTSVGLSYASFSMALGGFF  111



>ref|NP_001147841.1| auxin Efflux Carrier family protein [Zea mays]
 gb|ACG28874.1| auxin Efflux Carrier family protein [Zea mays]
Length=424

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 118/160 (74%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF+ L  VASMPI+Q+L+I  +GA LA+ +  +L   ARR +NKVVF  FTPSL FASL
Sbjct  1    MGFFSLFLVASMPIIQVLLIGVIGAYLASGFSNVLTTSARRDMNKVVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L D+ISWWFMPVNI +TF++G  LGWI   +LKP  H  GLI+A C+AGNLGNL 
Sbjct  61   AKTVTLADVISWWFMPVNIAITFMIGGTLGWIACNILKPPQHFRGLIMAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ +PFG D + C    LSY S SMALGG +
Sbjct  121  LIIVPAVCDEDGNPFGDDSSTCRSRSLSYSSLSMALGGLF  160



>gb|AFK32350.1| putative auxin efflux carrier-like protein PINX [Zea mays]
Length=428

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 118/160 (74%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF+ L  VASMPI+Q+L+I  +GA LA+ +  +L   ARR +NKVVF  FTPSL FASL
Sbjct  1    MGFFSLFLVASMPIIQVLLIGVIGAYLASGFSNVLTTSARRDMNKVVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L D+ISWWFMPVNI +TF++G  LGWI   +LKP  H  GLI+A C+AGNLGNL 
Sbjct  61   AKTVTLADVISWWFMPVNIAITFMIGGTLGWIACNILKPPQHFRGLIMAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ +PFG D + C    LSY S SMALGG +
Sbjct  121  LIIVPAVCDEDGNPFGDDSSTCRSRSLSYSSLSMALGGLF  160



>gb|AES95390.2| auxin efflux carrier family protein [Medicago truncatula]
Length=379

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VAS P++++L+++G+G  LA D I +L  DAR   N +V   F P L   +L
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ L++++S WFMPVNI +TFL+G+ LGWI+IKL KP  H+EGLI+  C+AGNLGNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  +
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAIGAVF  159



>ref|XP_007156270.1| hypothetical protein PHAVU_003G272300g [Phaseolus vulgaris]
 gb|ESW28264.1| hypothetical protein PHAVU_003G272300g [Phaseolus vulgaris]
Length=414

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF +LL VAS P++++L+I+ +G  LA D I IL  DAR+ +N++VF  F PSL   +L
Sbjct  1    MGFLQLLSVASFPVIKVLLITAVGLFLALDDISILAEDARKKVNQLVFYVFNPSLVGTNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ LE ++  WFMP NI +TF++G+ LGWI+IK+ +P   LEGLIL  C+AGNLGNLP
Sbjct  61   AKTITLESVVQLWFMPFNILITFVLGSALGWILIKITRPPKQLEGLILGCCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PA+C +  SPFGD  +C   G++Y S SMA+G  Y
Sbjct  121  IIIIPAMCTQSGSPFGDSDVCYEYGMAYASLSMAIGAVY  159



>ref|XP_006660957.1| PREDICTED: uncharacterized transporter YBR287W-like [Oryza brachyantha]
Length=416

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VASMP++Q+L+I  +GA LA+ Y KIL + A   +NK+VF  FTPSL F SL
Sbjct  1    MGFLALLLVASMPVVQVLLIGVVGAFLASGYSKILTSSALSDMNKIVFTVFTPSLMFVSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV L D+ISWWFMP+NIG+TF+ G  LGWI  K+LKP  H  G+I+A C+AGNLGNL 
Sbjct  61   AKTVTLSDVISWWFMPINIGITFMAGGTLGWIACKILKPPQHFRGMIIAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C E+ +PFG D + C  LGLSY S SMALGG Y
Sbjct  121  LIVVPAVCDEDGNPFGKDSSRCRSLGLSYSSLSMALGGLY  160



>ref|NP_001063888.2| Os09g0555100 [Oryza sativa Japonica Group]
 dbj|BAF25802.2| Os09g0555100 [Oryza sativa Japonica Group]
Length=387

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VASMP++Q+L+I  +GA LA+ Y  IL + A   +NKVVF  FTPSL FASL
Sbjct  1    MGFLALLLVASMPVVQVLLIGVVGAFLASGYSNILTSSALSDMNKVVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ARTV   D+ISWWFMP+NIG+TF+ G  LGWI  ++LKP  H  G+I+A C+AGNLGNL 
Sbjct  61   ARTVTFSDVISWWFMPINIGITFMAGGTLGWIACRILKPPQHFRGMIIAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C E+ +PFG D + C  LGLSY S SMALGG Y
Sbjct  121  LIVVPAVCDEDGNPFGKDSSRCRSLGLSYSSLSMALGGLY  160



>gb|EEE70196.1| hypothetical protein OsJ_30282 [Oryza sativa Japonica Group]
Length=423

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VASMP++Q+L+I  +GA LA+ Y  IL + A   +NKVVF  FTPSL FASL
Sbjct  1    MGFLALLLVASMPVVQVLLIGVVGAFLASGYSNILTSSALSDMNKVVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ARTV   D+ISWWFMP+NIG+TF+ G  LGWI  ++LKP  H  G+I+A C+AGNLGNL 
Sbjct  61   ARTVTFSDVISWWFMPINIGITFMAGGTLGWIACRILKPPQHFRGMIIAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C E+ +PFG D + C  LGLSY S SMALGG Y
Sbjct  121  LIVVPAVCDEDGNPFGKDSSRCRSLGLSYSSLSMALGGLY  160



>gb|EEC85032.1| hypothetical protein OsI_32336 [Oryza sativa Indica Group]
Length=423

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VASMP++Q+L+I  +GA LA+ Y  IL + A   +NKVVF  FTPSL FASL
Sbjct  1    MGFLALLLVASMPVVQVLLIGVVGAFLASGYSNILTSSALSDMNKVVFTVFTPSLMFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ARTV   D+ISWWFMP+NIG+TF+ G  LGWI  ++LKP  H  G+I+A C+AGNLGNL 
Sbjct  61   ARTVTFSDVISWWFMPINIGITFMAGGTLGWIACRILKPPQHFRGMIIAFCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFG-DRAICSRLGLSYVSFSMALGGFY  3
            LI+VPA+C E+ +PFG D + C  LGLSY S SMALGG Y
Sbjct  121  LIVVPAVCDEDGNPFGKDSSRCRSLGLSYSSLSMALGGLY  160



>gb|KDO85260.1| hypothetical protein CISIN_1g015164mg [Citrus sinensis]
Length=302

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   +S+P+L++L+I+ LG+ LA D++ IL  DAR+++N +VF  F P+L  ++L
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E ++  WFMP N+ +TFLVG+ILGWIV++  +P  H  GLI+  CAAGNLGN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG    C   GL+YVS SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAVGAIY  159



>ref|XP_003612431.1| Auxin efflux carrier protein [Medicago truncatula]
 gb|AES95389.1| auxin efflux carrier family protein [Medicago truncatula]
Length=417

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VAS P++++L+++G+G  LA D I +L  DAR   N +V   F P L   +L
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARNQTNHLVHYVFNPGLIGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ L++++S WFMPVNI +TFL+G+ LGWI+IKL KP  H+EGLI+  C+AGNLGNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  +
Sbjct  121  IIIIPAICKDKGSPFGDPDVCYQFGMAYASLSMAIGAVF  159



>ref|XP_006435462.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
 gb|ESR48702.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
Length=302

 Score =   178 bits (452),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   +S+P+L++L+I+ LG+ LA D++ IL  DAR+++N +VF  F P+L  ++L
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E ++  WFMP N+ +TFLVG+ILGWIV++  +P  HL GLI+  CAAGNLGN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHLRGLIVGCCAAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG    C   GL+Y S SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYASLSMAVGAIY  159



>ref|XP_006435465.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
 gb|ESR48705.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
Length=310

 Score =   178 bits (451),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   +S+P+L++L+I+ LG+ LA D++ IL  DAR+++N +VF  F P+L  ++L
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E ++  WFMP N+ +TFLVG+ILGWIV++  +P  HL GLI+  CAAGNLGN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHLRGLIVGCCAAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG    C   GL+Y S SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYASLSMAVGAIY  159



>emb|CDP01745.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   181 bits (458),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L  VAS+P++++L+I GLG+ LA D+I IL   AR+ +N VVF  F P+L  ++L
Sbjct  1    MGLLDLFMVASVPVMKVLLICGLGSFLALDHIDILGESARKQINNVVFFVFNPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ LE+I+S WFMPVNI LTF++G   GW++ K+ K   HL+GL++ SCAAGNLGNLP
Sbjct  61   AQTITLENIVSLWFMPVNILLTFILGLFFGWVLGKITKAPQHLKGLVIGSCAAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC E+ SPFG    C   G++YVS SMA+G  Y
Sbjct  121  LILVPAICREKGSPFGAPDSCHMYGMAYVSLSMAIGAIY  159



>ref|XP_006416347.1| hypothetical protein EUTSA_v10009415mg, partial [Eutrema salsugineum]
 gb|ESQ34700.1| hypothetical protein EUTSA_v10009415mg, partial [Eutrema salsugineum]
Length=401

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = -3

Query  482  KMGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFAS  303
            +M    L   +S+P++++L+I+ +G  LA D + IL  DAR++LN +VF  F+PSL  +S
Sbjct  18   EMKLLDLFITSSIPVVKILVITAIGFYLALDRVNILNQDARKHLNNIVFYVFSPSLVGSS  77

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
            L+ T+  E ++  WFMP+N+ LTF++G+ LGWIVIK+ KP  HL G+I+  CAAGNLGN+
Sbjct  78   LSETITYESMVKMWFMPINVLLTFIIGSFLGWIVIKITKPPSHLHGIIVGCCAAGNLGNM  137

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            PLII+PAIC E+ SPFGD   C + GL Y++ SMA+G  Y
Sbjct  138  PLIIIPAICNEKGSPFGDPETCEKYGLGYIALSMAVGAIY  177



>emb|CDY31514.1| BnaC05g16230D [Brassica napus]
Length=478

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 115/162 (71%), Gaps = 0/162 (0%)
 Frame = -3

Query  497  KEDQRKMGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPS  318
              D+ +M    L   +S+P+ ++L+I+G+G  LA D + IL  DAR+ LN +VF  F+PS
Sbjct  90   SSDETRMKLLDLFITSSIPVGKILVITGIGFYLALDRVNILNQDARKQLNNIVFYVFSPS  149

Query  317  LTFASLARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAG  138
            L  +SLA T+  E ++  WFMP+N+ LTF++G+ LGW+VIK+ KP  HL G+I+  CAAG
Sbjct  150  LVASSLAETITYESLVKMWFMPLNVVLTFIIGSFLGWLVIKITKPPYHLRGIIVGCCAAG  209

Query  137  NLGNLPLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALG  12
            NLGN+PLII+PAIC E+ SPFGD   C + GL YV+ SMA+G
Sbjct  210  NLGNMPLIIIPAICNEKGSPFGDPETCEKYGLGYVALSMAIG  251



>emb|CDY57768.1| BnaC02g45090D [Brassica napus]
Length=134

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LLEVASMPI+Q+L+IS LGA LATDY  +L AD RR +NK+VFV FTP + FA+L
Sbjct  1    MGFLELLEVASMPIVQVLLISVLGAFLATDYCSLLSADTRRSVNKLVFVVFTPCIMFANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNL  132
            A+TV L+DIISWWFMP+N+G+TFLVG ILGW+V+KLL PKP L GLI+A+CA+GN+
Sbjct  61   AQTVTLQDIISWWFMPINVGITFLVGGILGWLVVKLLNPKPQLHGLIIATCASGNI  116



>ref|XP_008786677.1| PREDICTED: uncharacterized transporter YBR287W isoform X2 [Phoenix 
dactylifera]
Length=421

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LL VASMP LQ+L++  LGA LA+ YI IL  +A R +NK+VFV F+P+L FASL
Sbjct  1    MGFWSLLMVASMPNLQVLLVGLLGAFLASGYINILSTNALRDVNKIVFVVFSPALVFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            + T+ L+DI+SWWFMP+NIG+ F +G ILGW+V+K+LKP+ HLEGL++ASC+AGNLG L 
Sbjct  61   SETITLQDILSWWFMPINIGIIFSIGGILGWVVVKILKPEHHLEGLVIASCSAGNLGTLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PAIC E+ +PFG+ + C  LGLSY SFSMALG F+
Sbjct  121  LIIIPAICNEDGNPFGESSDCKTLGLSYASFSMALGNFF  159



>ref|XP_002317029.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
 gb|EEE97641.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
Length=388

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L   A MP+L++L+I+GLG  LA D I +L A+AR Y+N +VF  F P+L  + L
Sbjct  1    MGFLDLFVAALMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFGPALVVSQL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
              T+  + + + WFMPVNI LTF++G+IL WI+IK+ K  PHL+GL++  C+AGNLGNL 
Sbjct  61   GETITFQSLNTLWFMPVNILLTFMIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD  ICS  G +Y S SMA+G  Y
Sbjct  121  LIIVPAVCMESNSPFGDSTICSTNGTTYASLSMAVGAIY  159



>ref|XP_002890416.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66675.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 116/158 (73%), Gaps = 3/158 (2%)
 Frame = -3

Query  467  RLLEV---ASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLA  297
            RLL++   +S+P+ ++L+I+G+G  LA D + IL  DAR+ LN +VF  F+PSL  +SL+
Sbjct  4    RLLDLFITSSIPVAKILLITGIGFYLALDQVNILNQDARKQLNNIVFYVFSPSLVASSLS  63

Query  296  RTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPL  117
             T+  E ++  WFMP+N+ LTF++G+ LGWIVIK+ KP  HL G+I+  CAAGNLGN+PL
Sbjct  64   ETITYESMVKMWFMPLNVLLTFIIGSFLGWIVIKITKPPSHLRGIIVGCCAAGNLGNMPL  123

Query  116  IIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            II+PAIC E+ SPFGD   C + GL Y++ SMA+G  Y
Sbjct  124  IIIPAICNEKGSPFGDPESCEKYGLGYIALSMAIGAIY  161



>ref|XP_006377867.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
 gb|ERP55664.1| hypothetical protein POPTR_0011s14860g [Populus trichocarpa]
Length=405

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L   A MP+L++L+I+GLG  LA D I +L A+AR Y+N +VF  F P+L  + L
Sbjct  1    MGFLDLFVAALMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFGPALVVSQL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
              T+  + + + WFMPVNI LTF++G+IL WI+IK+ K  PHL+GL++  C+AGNLGNL 
Sbjct  61   GETITFQSLNTLWFMPVNILLTFMIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD  ICS  G +Y S SMA+G  Y
Sbjct  121  LIIVPAVCMESNSPFGDSTICSTNGTTYASLSMAVGAIY  159



>ref|XP_003573172.1| PREDICTED: uncharacterized transporter YBR287W-like [Brachypodium 
distachyon]
Length=455

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIK--ILPADARRYLNKVVFVAFTPSLTFA  306
            MGF  LL VAS P++++L+I+ LGA LA+ +    +L A AR  +N+VV+  FTP+L  +
Sbjct  1    MGFVSLLLVASSPVVEVLLIAVLGAYLASGHGHKVLLGASARTDINRVVYAVFTPALMLS  60

Query  305  SLARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGN  126
            SLARTV L D +SWWFMPVNIG+ FL G +LGW  + LL+P  HL GL++ASC+A N GN
Sbjct  61   SLARTVTLRDAVSWWFMPVNIGIIFLAGGLLGWAAVFLLRPPQHLRGLVVASCSAANFGN  120

Query  125  LPLIIVPAICAEEASPF---GDRAICSRLGLSYVSFSMALGGFY  3
            L LI++PA+C EE +PF   G   +C+  GLSY SFSMALGG Y
Sbjct  121  LLLIMIPAVCREEGNPFAEDGGAGVCTDRGLSYASFSMALGGLY  164



>ref|NP_683316.2| auxin efflux carrier-like protein [Arabidopsis thaliana]
 gb|AEE30042.1| auxin efflux carrier-like protein [Arabidopsis thaliana]
Length=472

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = -3

Query  482  KMGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFAS  303
            +M    L   +S+P+ ++L+I+G+G  LA D + IL  DAR+ LN +VF  F+PSL  +S
Sbjct  88   RMRLLDLFITSSIPVAKILLITGIGFYLALDQVNILNHDARKQLNNIVFYVFSPSLVASS  147

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
            L+ T+  E ++  WFMP+N+ LTF++G+ LGWIVIK+ KP  HL G+I+  CAAGNLGN+
Sbjct  148  LSETITYESMVKMWFMPLNVLLTFIIGSFLGWIVIKITKPPSHLRGIIVGCCAAGNLGNM  207

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            PLII+PAIC E+ SPFGD   C + GL Y++ SMA+G  Y
Sbjct  208  PLIIIPAICNEKGSPFGDPESCEKFGLGYIALSMAIGAIY  247



>gb|KDO85259.1| hypothetical protein CISIN_1g015164mg [Citrus sinensis]
Length=381

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   +S+P+L++L+I+ LG+ LA D++ IL  DAR+++N +VF  F P+L  ++L
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E ++  WFMP N+ +TFLVG+ILGWIV++  +P  H  GLI+  CAAGNLGN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG    C   GL+YVS SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAVGAIY  159



>gb|ACU18030.1| unknown [Glycine max]
Length=274

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L  +ASMP++++L+I+ +G  LA D + +L  DAR  +N +V   F P+L   +L
Sbjct  1    MGLVELFGMASMPVIKVLLITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E+++  WFMPVNI LTF++G+ LGWI+IKL +   HLEGLI+  C+AGNLGNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLIMGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  Y
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVY  159



>ref|XP_011100009.1| PREDICTED: uncharacterized protein LOC105178246 isoform X3 [Sesamum 
indicum]
Length=349

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L   +S+P+L++L+++GLG+ LA D I IL  DAR++LN +VF  F+P+L  ++L
Sbjct  1    MSLLDLFRASSIPVLKVLLVTGLGSYLARDRIDILGDDARKHLNNIVFFVFSPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  + ++  WFMP+NI LTF++GTILGW VI++ +   HL GL++  CAAGNLGNL 
Sbjct  61   AKTITYDSMVKLWFMPINILLTFIIGTILGWGVIQITRTPFHLRGLVIGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E ASPFG+  +C   G++Y S SMA+G  Y
Sbjct  121  LIIIPAVCKERASPFGNADVCYEHGMAYASLSMAIGAIY  159



>ref|XP_004515365.1| PREDICTED: uncharacterized protein LOC101492524 isoform X2 [Cicer 
arietinum]
Length=332

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW+L  VA MP+L++L+I+ LG  L+ D   IL   A + LN +VF  F+P+L  +SL
Sbjct  1    MEFWKLFVVALMPVLKVLLITALGTFLSLDRFDILKETASKNLNTIVFFVFSPALVCSSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+    II+ WFMP+N+ LTF++G  LGW+++KL+K   HL+GL L  CAAGNLGNLP
Sbjct  61   AETITSRSIITLWFMPLNVLLTFIIGAALGWLLVKLIKVPYHLQGLALGCCAAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C ++ +PFGD  IC R GL+Y S SMA+   Y
Sbjct  121  LIIVPAVCKQKGNPFGDLDICHRNGLAYASLSMAIASIY  159



>gb|EYU41206.1| hypothetical protein MIMGU_mgv1a018588mg [Erythranthe guttata]
Length=341

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   +++P+L++L+++GLG+ LA D++ IL  DAR++LN + F  F+P+L +++L
Sbjct  1    MGLVDLFIASTIPVLKVLLVTGLGSYLAFDHVGILGDDARKHLNNITFFVFSPALVYSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  + +   WFMP+NI +TF+VG++LGW+VI++ +   HL GLI+  CAAGNLGNL 
Sbjct  61   AKTITYDSMAKLWFMPLNILITFIVGSVLGWVVIQITRAPSHLRGLIIGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFGD  +C   G+SY S SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGDPDVCQTYGMSYASLSMAIGAIY  159



>ref|XP_009149573.1| PREDICTED: uncharacterized transporter YBR287W [Brassica rapa]
Length=383

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 112/156 (72%), Gaps = 0/156 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L   +S+P+ ++L+I+G+G  LA D + IL  DAR+ LN +VF  F+PSL  +SL
Sbjct  1    MKLLDLFITSSIPVGKILVITGIGFYLALDRVNILNQDARKQLNNIVFYVFSPSLVASSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E ++  WFMP+N+ LTF++G+ LGW+VIK+ KP  HL G+I+  CAAGNLGN+P
Sbjct  61   AETITYESLVKMWFMPLNVVLTFIIGSFLGWLVIKITKPPSHLRGIIVGCCAAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALG  12
            LII+PAIC E+ SPFGD   C + GL YV+ SMA+G
Sbjct  121  LIIIPAICNEKGSPFGDPETCEKYGLGYVALSMAIG  156



>gb|KDO85258.1| hypothetical protein CISIN_1g015164mg [Citrus sinensis]
Length=412

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   +S+P+L++L+I+ LG+ LA D++ IL  DAR+++N +VF  F P+L  ++L
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E ++  WFMP N+ +TFLVG+ILGWIV++  +P  H  GLI+  CAAGNLGN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG    C   GL+YVS SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAVGAIY  159



>gb|ABK92888.1| unknown [Populus trichocarpa]
Length=405

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L     MP+L++L+I+GLG  LA D I +L A+AR Y+N +VF  F P+L  + L
Sbjct  1    MGFLDLFVAPLMPVLKVLLITGLGLFLALDRIDLLGANARHYMNNLVFYLFGPALVVSQL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
              T+  + + + WFMPVNI LTF++G+IL WI+IK+ K  PHL+GL++  C+AGNLGNL 
Sbjct  61   GETITFQSLNTLWFMPVNILLTFMIGSILAWILIKITKTPPHLQGLVIGCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD  ICS  G +Y S SMA+G  Y
Sbjct  121  LIIVPAVCMESNSPFGDSTICSTNGTTYASLSMAVGAIY  159



>ref|XP_006473865.1| PREDICTED: uncharacterized transporter YBR287W-like [Citrus sinensis]
Length=412

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   +S+P+L++L+I+ LG+ LA D++ IL  DAR+++N +VF  F P+L  ++L
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E ++  WFMP N+ +TFLVG+ILGWIV++  +P  H  GLI+  CAAGNLGN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHFRGLIVGCCAAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG    C   GL+YVS SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYVSLSMAVGAIY  159



>emb|CDY29492.1| BnaA06g14780D [Brassica napus]
Length=383

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 112/156 (72%), Gaps = 0/156 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L   +S+P+ ++L+I+G+G  LA D + IL  DAR+ LN +VF  F+PSL  +SL
Sbjct  1    MKLLDLFITSSIPVGKILVITGIGFYLALDRVNILNQDARKQLNNIVFYVFSPSLVASSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E ++  WFMP+N+ LTF++G+ LGW+VIK+ KP  HL G+I+  CAAGNLGN+P
Sbjct  61   AETITYESLVKMWFMPLNVVLTFIIGSFLGWLVIKVTKPPSHLRGIIVGCCAAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALG  12
            LII+PAIC E+ SPFGD   C + GL YV+ SMA+G
Sbjct  121  LIIIPAICNEKGSPFGDPETCEKYGLGYVALSMAIG  156



>ref|XP_006435464.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
 gb|ESR48704.1| hypothetical protein CICLE_v10001325mg [Citrus clementina]
Length=412

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   +S+P+L++L+I+ LG+ LA D++ IL  DAR+++N +VF  F P+L  ++L
Sbjct  1    MGALDLFIASSIPVLKVLLITALGSYLALDHVNILGEDARKHINNLVFYVFNPALVASNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E ++  WFMP N+ +TFLVG+ILGWIV++  +P  HL GLI+  CAAGNLGN+P
Sbjct  61   ANTITYESMLKLWFMPFNVLITFLVGSILGWIVVQFTRPPSHLRGLIVGCCAAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG    C   GL+Y S SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGSPDTCQTYGLAYASLSMAVGAIY  159



>ref|XP_003534224.1| PREDICTED: uncharacterized protein LOC100810166 isoform X1 [Glycine 
max]
Length=414

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF +L  VAS P++++L+I+ LG  LA D I IL  DAR+ +N++VF  F PSL  ++L
Sbjct  1    MGFIKLFSVASFPVIKVLLITALGLFLALDNISILGEDARKKVNQLVFYVFNPSLVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  E ++  WFMPVNI  TF++G+ LGWI+IK+ +P   +EGLIL  C+AGNLGNLP
Sbjct  61   AKTITFESVVKLWFMPVNILGTFILGSALGWILIKMTRPPKRMEGLILGCCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+ AIC +E SPFG+  +C++ G++Y + SMA+G  +
Sbjct  121  MIIIAAICKQEGSPFGEPDLCNQYGMAYAALSMAIGAVF  159



>ref|XP_006370751.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67320.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
Length=376

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VA +P+L++L+I+ +G  LA D I +L + AR YLN ++F  F+P+L  + L
Sbjct  1    MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+ L+ + S WFMPVNI LTF++G++L WI+IK+ +  PHL+GL++  C+AGNLGNL 
Sbjct  61   AGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD  +CS  G++Y S SMA+G  Y
Sbjct  121  LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIY  159



>ref|XP_009798616.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009798617.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009798618.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana sylvestris]
Length=418

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   ASMP+L++L+I+ LG  LA D I +L  DAR++LN +VF  F P+L  ++L
Sbjct  1    MGLLDLFIAASMPVLKVLLITALGLVLALDRIDLLGEDARKHLNNIVFFVFNPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  E +   WFMP+NI  TF++G+ILGW VI++ +P  HL GL++  CAAGNLGN+ 
Sbjct  61   AKTITSESMKKLWFMPINILFTFIIGSILGWAVIQITRPPQHLRGLVVGCCAAGNLGNML  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFGD  IC   G+ Y S SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGDPGICHTYGMGYASLSMAVGAIY  159



>gb|ACJ85428.1| unknown [Medicago truncatula]
 gb|AFK36849.1| unknown [Medicago truncatula]
 gb|AFK46985.1| unknown [Medicago truncatula]
Length=417

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VAS P++++L+++G+G  LA D I +L  DAR   N +V   F P L   +L
Sbjct  1    MGFLELFSVASFPVIKVLLVTGIGLLLALDNINLLGKDARSQTNHLVHYVFNPGLIGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ L++++S WFMPVNI +TFL+G+ LGWI+IKL KP  H+EGLI+  C+AGNLGNLP
Sbjct  61   AQTITLDNVVSLWFMPVNILVTFLLGSALGWIIIKLTKPPRHIEGLIVGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAI  ++ SPFGD  +C + G++Y S SMA+G  +
Sbjct  121  IIIIPAIRKDKGSPFGDPDVCYQFGMAYASLSMAIGAVF  159



>ref|NP_001242102.1| uncharacterized protein LOC100791609 [Glycine max]
 gb|ACU17889.1| unknown [Glycine max]
Length=415

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L  VASMP++++LII+ +G  LA D + +L  DAR  +N +V   F P+L   +L
Sbjct  1    MGLVELFGVASMPVIKVLIITAIGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E+++  WFMPVNI LTF++G+ LGWI+IKL +   HLEGLIL  C+AGNLGNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLILGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  Y
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVY  159



>ref|XP_006599266.1| PREDICTED: uncharacterized protein LOC100817605 isoform X1 [Glycine 
max]
 ref|XP_006599267.1| PREDICTED: uncharacterized protein LOC100817605 isoform X2 [Glycine 
max]
 ref|XP_006599268.1| PREDICTED: uncharacterized protein LOC100817605 isoform X3 [Glycine 
max]
 ref|XP_006599269.1| PREDICTED: uncharacterized protein LOC100817605 isoform X4 [Glycine 
max]
 gb|KHN39763.1| Putative transporter C5D6.04 [Glycine soja]
Length=414

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF +LL VAS P++++L+++ +G  LA D I IL  D+R+ +N++VF  F PSL  ++L
Sbjct  1    MGFIQLLSVASFPVIKVLLVTAIGLFLALDDISILGEDSRKKVNQLVFYVFNPSLVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  E I+  WFMP+NI  TF++G+ LGWI+IK+ +P  H+EGLIL  C+AGNLGNL 
Sbjct  61   AKTITFESIVQLWFMPLNILCTFILGSALGWILIKMTRPPKHMEGLILGCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            ++I+PAIC E  +PFGD  +C + G++Y + SMA+G  +
Sbjct  121  IVIIPAICKESGNPFGDSDVCYQYGMAYAALSMAIGAVF  159



>gb|KGN55542.1| hypothetical protein Csa_4G664490 [Cucumis sativus]
Length=421

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M F  LL +AS+P+L++L+I+GLG+ LA   I IL  +AR++LN VVF  F P+L  ++L
Sbjct  3    MKFLSLLILASIPVLKVLLITGLGSFLALPSIDILGQEARKHLNGVVFYVFNPALVSSNL  62

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+   +++  WFMP NI +TF+VG++ GWIVI+  KP PHL GLIL  C+AGNLGN+ 
Sbjct  63   AETITYSNMVKMWFMPFNILITFIVGSLFGWIVIQWTKPPPHLRGLILGCCSAGNLGNIL  122

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ SPFGD   C+  G++YVS SMA+G  +
Sbjct  123  LIIVPAVCQEKGSPFGDSDKCTTYGMAYVSLSMAIGAIF  161



>ref|XP_003520432.1| PREDICTED: uncharacterized transporter YBR287W-like [Glycine 
max]
Length=424

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW+L  VA +P+L++L+I+ +G  LA + + IL   AR+ LN +VF  F+P+L  +SL
Sbjct  1    MDFWKLFIVALLPVLKVLLITAVGTILAINRLNILGETARKNLNTMVFYVFSPTLVCSSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+ LE+++  WFMPVNI LTF++G++LG +V+KL +   HL+GL+L  CAAGNLGNLP
Sbjct  61   AETITLENVLILWFMPVNILLTFVIGSVLGLLVVKLTRVPHHLQGLVLGCCAAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPA+C +  SPFGD  +C +  L+Y S SMALG  Y
Sbjct  121  IILVPAVCKQSGSPFGDVNVCYKNALAYASLSMALGSVY  159



>ref|XP_006590301.1| PREDICTED: uncharacterized protein LOC100791609 isoform X1 [Glycine 
max]
 ref|XP_006590302.1| PREDICTED: uncharacterized protein LOC100791609 isoform X2 [Glycine 
max]
Length=415

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L  VASMP++++LII+ +G  LA D + +L  DAR  +N +V   F P+L   +L
Sbjct  1    MGLVELFGVASMPVIKVLIITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E+++  WFMPVNI LTF++G+ LGWI+IKL +   HLEGLIL  C+AGNLGNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLILGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  Y
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVY  159



>gb|KHN41796.1| Putative transporter [Glycine soja]
Length=416

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L  VASMP++++LII+ +G  LA D + +L  DAR  +N +V   F P+L   +L
Sbjct  1    MGLVELFGVASMPVIKVLIITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E+++  WFMPVNI LTF++G+ LGWI+IKL +   HLEGLIL  C+AGNLGNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLILGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  Y
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVY  159



>ref|XP_007010159.1| Auxin efflux carrier family protein [Theobroma cacao]
 gb|EOY18969.1| Auxin efflux carrier family protein [Theobroma cacao]
Length=407

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VA MP+L++L+++G+G  LATD I +L  +AR YLNK+VF  F PSL  ++L
Sbjct  1    MGFLDLFVVAVMPVLKVLLVTGVGLFLATDGINLLGPEARNYLNKIVFYLFGPSLVVSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV LE +++ WFMPVNI LTF++G+ LGWI+IK+ K   HL G+++  C+AGNLGNL 
Sbjct  61   AETVTLESLVTMWFMPVNIFLTFIIGSALGWILIKITKTPEHLRGMVIGCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  +PFGD   CS    +Y S SMA+G  +
Sbjct  121  LIIVPAVCTESNTPFGDS--CSTYAEAYASLSMAVGAIF  157



>ref|XP_011038091.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Populus euphratica]
Length=405

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VA +P+L++L+I+ +G  LA D I +L + AR YLN ++F  F+P+L  + L
Sbjct  1    MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+ L+ + S WFMPVNI LTF+VG++L WI+IK+ +  PHL+GL++  C+AGNLGNL 
Sbjct  61   AGTITLQSLASLWFMPVNILLTFIVGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD  +CS  G++Y S SMA+G  Y
Sbjct  121  LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIY  159



>ref|XP_011038089.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Populus euphratica]
 ref|XP_011038090.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Populus euphratica]
Length=406

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VA +P+L++L+I+ +G  LA D I +L + AR YLN ++F  F+P+L  + L
Sbjct  1    MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+ L+ + S WFMPVNI LTF+VG++L WI+IK+ +  PHL+GL++  C+AGNLGNL 
Sbjct  61   AGTITLQSLASLWFMPVNILLTFIVGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD  +CS  G++Y S SMA+G  Y
Sbjct  121  LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIY  159



>ref|XP_008453020.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis 
melo]
Length=421

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M F  LL +AS+P+L++L+I+GLG+ LA  YI IL  +AR++LN VVF  F P+L  ++L
Sbjct  3    MKFLSLLILASIPVLKVLLITGLGSFLALPYIDILGQEARKHLNGVVFYVFNPALVASNL  62

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+   +++  WFMP NI +TF+VG++ GWIVI+  KP PHL GLIL   +AGNLGN+ 
Sbjct  63   AETITYNNMVKMWFMPFNILITFIVGSLFGWIVIQWTKPPPHLRGLILGCSSAGNLGNIL  122

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFGD   C+  G++YVS SMA+G  +
Sbjct  123  LIIIPAVCKEKGSPFGDSDNCTTYGMAYVSLSMAIGAIF  161



>ref|XP_010270584.1| PREDICTED: uncharacterized protein LOC104606871 isoform X3 [Nelumbo 
nucifera]
Length=380

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   ASMP+L++L+++ +G+ LA D I IL  DAR++LN++V+  FTP+L  + L
Sbjct  1    MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ LE +   WFMPVNI +T+++G+ILGWIVI++ +P  HL+GLIL  C+AGN+GN+ 
Sbjct  61   AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I +PA+C E+ +PFG   IC   GL+Y S SMA+G  Y
Sbjct  121  IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAIGAVY  159



>ref|XP_010270583.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Nelumbo nucifera]
Length=385

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   ASMP+L++L+++ +G+ LA D I IL  DAR++LN++V+  FTP+L  + L
Sbjct  1    MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ LE +   WFMPVNI +T+++G+ILGWIVI++ +P  HL+GLIL  C+AGN+GN+ 
Sbjct  61   AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I +PA+C E+ +PFG   IC   GL+Y S SMA+G  Y
Sbjct  121  IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAIGAVY  159



>ref|XP_006370750.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67319.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
Length=406

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VA +P+L++L+I+ +G  LA D I +L + AR YLN ++F  F+P+L  + L
Sbjct  1    MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+ L+ + S WFMPVNI LTF++G++L WI+IK+ +  PHL+GL++  C+AGNLGNL 
Sbjct  61   AGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD  +CS  G++Y S SMA+G  Y
Sbjct  121  LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIY  159



>ref|XP_008786678.1| PREDICTED: uncharacterized protein LOC103704931 isoform X3 [Phoenix 
dactylifera]
Length=358

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LL VASMP LQ+L++  LGA LA+ YI IL  +A R +NK+VFV F+P+L FASL
Sbjct  1    MGFWSLLMVASMPNLQVLLVGLLGAFLASGYINILSTNALRDVNKIVFVVFSPALVFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            + T+ L+DI+SWWFMP+NIG+ F +G ILGW+V+K+LKP+ HLEGL++ASC+AGNLG L 
Sbjct  61   SETITLQDILSWWFMPINIGIIFSIGGILGWVVVKILKPEHHLEGLVIASCSAGNLGTLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMAL  15
            LII+PAIC E+ +PFG+ + C  LGLSY SFSMA+
Sbjct  121  LIIIPAICNEDGNPFGESSDCKTLGLSYASFSMAV  155



>ref|XP_004515364.1| PREDICTED: uncharacterized protein LOC101492524 isoform X1 [Cicer 
arietinum]
Length=419

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW+L  VA MP+L++L+I+ LG  L+ D   IL   A + LN +VF  F+P+L  +SL
Sbjct  1    MEFWKLFVVALMPVLKVLLITALGTFLSLDRFDILKETASKNLNTIVFFVFSPALVCSSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+    II+ WFMP+N+ LTF++G  LGW+++KL+K   HL+GL L  CAAGNLGNLP
Sbjct  61   AETITSRSIITLWFMPLNVLLTFIIGAALGWLLVKLIKVPYHLQGLALGCCAAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C ++ +PFGD  IC R GL+Y S SMA+   Y
Sbjct  121  LIIVPAVCKQKGNPFGDLDICHRNGLAYASLSMAIASIY  159



>ref|XP_006370747.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 ref|XP_006370748.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 ref|XP_006370749.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67316.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67317.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
 gb|ERP67318.1| hypothetical protein POPTR_0001s46060g [Populus trichocarpa]
Length=405

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VA +P+L++L+I+ +G  LA D I +L + AR YLN ++F  F+P+L  + L
Sbjct  1    MGFLDLFVVAMVPVLKVLLITLVGLFLALDRIDLLGSTARPYLNNLIFYVFSPALVSSQL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+ L+ + S WFMPVNI LTF++G++L WI+IK+ +  PHL+GL++  C+AGNLGNL 
Sbjct  61   AGTITLQSLASLWFMPVNILLTFIIGSVLAWILIKITRTPPHLQGLVIGCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD  +CS  G++Y S SMA+G  Y
Sbjct  121  LIIVPAVCNESNSPFGDSTVCSSYGMAYASLSMAVGAIY  159



>ref|XP_010033614.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 ref|XP_010033615.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 ref|XP_010033616.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 ref|XP_010033617.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 gb|KCW53315.1| hypothetical protein EUGRSUZ_J02568 [Eucalyptus grandis]
Length=418

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M F  L  VASMP+L++L+++ LG  LA + + I+    RR +N+V F  F P+L  ++L
Sbjct  1    MAFLDLFLVASMPVLKVLLVTALGLYLALESVDIMGESTRRQMNRVAFFVFNPALVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ARTV  E+I+  WFMP+NI +TF++G+ LGWI++K+ +   H++GLIL  CA+GNLGNLP
Sbjct  61   ARTVTSENIVQLWFMPINILITFIIGSALGWILVKVTRAPQHVKGLILGCCASGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG+  +C + G++Y S SMA+G  Y
Sbjct  121  LIIIPAVCKEQGSPFGEPDVCYKYGMAYASISMAIGAVY  159



>ref|XP_010270585.1| PREDICTED: uncharacterized protein LOC104606871 isoform X4 [Nelumbo 
nucifera]
Length=369

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   ASMP+L++L+++ +G+ LA D I IL  DAR++LN++V+  FTP+L  + L
Sbjct  1    MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ LE +   WFMPVNI +T+++G+ILGWIVI++ +P  HL+GLIL  C+AGN+GN+ 
Sbjct  61   AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I +PA+C E+ +PFG   IC   GL+Y S SMA+G  Y
Sbjct  121  IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAIGAVY  159



>ref|XP_011099988.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Sesamum indicum]
Length=417

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L   +S+P+L++L+++GLG+ LA D I IL  DAR++LN +VF  F+P+L  ++L
Sbjct  1    MSLLDLFRASSIPVLKVLLVTGLGSYLARDRIDILGDDARKHLNNIVFFVFSPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  + ++  WFMP+NI LTF++GTILGW VI++ +   HL GL++  CAAGNLGNL 
Sbjct  61   AKTITYDSMVKLWFMPINILLTFIIGTILGWGVIQITRTPFHLRGLVIGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E ASPFG+  +C   G++Y S SMA+G  Y
Sbjct  121  LIIIPAVCKERASPFGNADVCYEHGMAYASLSMAIGAIY  159



>gb|KHN44555.1| Putative transporter C5D6.04 [Glycine soja]
Length=424

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW+L  VA +P+L++L+I+ +G  LA +   IL   AR+ LN +VF  F+P+L  +SL
Sbjct  1    MDFWKLFIVALLPVLKVLLITAVGTILAINRFNILGETARKNLNTMVFYVFSPTLVCSSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+ LE+++  WFMPVNI LTF++G++LG +V+KL +   HL+GL+L  CAAGNLGNLP
Sbjct  61   AETITLENVLILWFMPVNILLTFVIGSVLGLLVVKLTRVPHHLQGLVLGCCAAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I+VPA+C +  SPFGD  +C +  L+Y S SMALG  Y
Sbjct  121  IILVPAVCKQSGSPFGDVNVCYKNALAYASLSMALGSVY  159



>ref|XP_011100000.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Sesamum indicum]
Length=416

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L   +S+P+L++L+++GLG+ LA D I IL  DAR++LN +VF  F+P+L  ++L
Sbjct  1    MSLLDLFRASSIPVLKVLLVTGLGSYLARDRIDILGDDARKHLNNIVFFVFSPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  + ++  WFMP+NI LTF++GTILGW VI++ +   HL GL++  CAAGNLGNL 
Sbjct  61   AKTITYDSMVKLWFMPINILLTFIIGTILGWGVIQITRTPFHLRGLVIGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E ASPFG+  +C   G++Y S SMA+G  Y
Sbjct  121  LIIIPAVCKERASPFGNADVCYEHGMAYASLSMAIGAIY  159



>ref|XP_009592191.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009592265.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009592327.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Nicotiana tomentosiformis]
Length=418

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   ASMP+L++L+I+ LG  LA D I +L  DAR++LN +VF  F P+L  ++L
Sbjct  1    MGLLDLFIAASMPVLKVLLITALGLVLALDRIDLLGEDARKHLNNIVFFVFNPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  E +   WFMP+NI  TF++G+ILGW VI++ +P  HL GL++  CAAGNLGN+ 
Sbjct  61   AKTITSESMKKLWFMPLNILFTFIIGSILGWAVIQITRPPQHLRGLVVGCCAAGNLGNML  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFGD  +C   G+ Y S SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGDPGVCHTYGMGYASLSMAVGAIY  159



>ref|XP_008237902.1| PREDICTED: uncharacterized transporter YBR287W-like [Prunus mume]
 ref|XP_008237903.1| PREDICTED: uncharacterized transporter YBR287W-like [Prunus mume]
Length=413

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M   +L   AS+P+L++L+I+ LG+ LA D + IL  D R++LN VVF    P+L  ++L
Sbjct  1    MEVLQLFITASIPVLKVLLITALGSYLALDSVNILGEDTRKHLNTVVFYVLNPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ART+  E I+  WFMPVNI +TF+VG+ILGWI++ L +P  HL GL+L  CAAGNLGNL 
Sbjct  61   ARTITYESIVKLWFMPVNILITFIVGSILGWILLLLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ SPFG   +C   GL+Y S SMA+G  Y
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCRTYGLAYASLSMAIGAIY  159



>ref|NP_565133.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 ref|NP_849892.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AAG51955.1|AC015450_16 unknown protein; 51686-53591 [Arabidopsis thaliana]
 gb|AAM20576.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15614.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98969.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35854.1| auxin efflux carrier family protein [Arabidopsis thaliana]
 gb|AEE35855.1| auxin efflux carrier family protein [Arabidopsis thaliana]
Length=390

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = -3

Query  467  RLLEV---ASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLA  297
            +LLE+   +S P++++L+I+ +G  +A D + +L  DAR+YLN +VF  F+PSL  + LA
Sbjct  3    KLLELFITSSKPVVEILLITSVGFYMALDGVNLLGHDARKYLNNIVFYVFSPSLIGSRLA  62

Query  296  RTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPL  117
             +V  E ++  WFMPVN+ LTF++G++LGWIVI + KP  HL GLIL  CAAGNLGN+PL
Sbjct  63   DSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNMPL  122

Query  116  IIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            II+PA+C E+  PFGD   C + G+ YV+ SMA+G  Y
Sbjct  123  IIIPAVCKEKGGPFGDPESCQKYGMGYVALSMAMGSIY  160



>ref|XP_004300096.1| PREDICTED: uncharacterized transporter YBR287W-like [Fragaria 
vesca subsp. vesca]
Length=406

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 108/159 (68%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M  W L   AS+P+L+  +I+ LG+ LA D + +L  D+R +LN ++F   TP+L  A+L
Sbjct  1    MNLWTLFVTASIPVLESFLITALGSYLALDRVNLLGPDSRNHLNTILFYVCTPALIGANL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E ++  WFMPVNI LTF+VG+I GWI++KL +  PHL GL+L  CAAGNLGNL 
Sbjct  61   AETITYESLVKLWFMPVNIFLTFMVGSIFGWILMKLTRTPPHLRGLVLGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E  SPFGD   C   G +Y S SMA+G  Y
Sbjct  121  LIIIPAVCEESGSPFGDADTCDTTGTTYASLSMAIGAIY  159



>gb|AAM62517.1| unknown [Arabidopsis thaliana]
Length=390

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = -3

Query  467  RLLEV---ASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLA  297
            +LLE+   +S P++++L+I+ +G  +A D + +L  DAR+YLN +VF  F+PSL  + LA
Sbjct  3    KLLELFITSSKPVVEILLITSVGFYMALDGVNLLGHDARKYLNNIVFYVFSPSLIGSRLA  62

Query  296  RTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPL  117
             +V  E ++  WFMPVN+ LTF++G++LGWIVI + KP  HL GLIL  CAAGNLGN+PL
Sbjct  63   DSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNMPL  122

Query  116  IIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            II+PA+C E+  PFGD   C + G+ YV+ SMA+G  Y
Sbjct  123  IIIPAVCKEKGGPFGDPESCQKYGMGYVALSMAMGSIY  160



>ref|XP_007018644.1| Auxin efflux carrier family protein, putative [Theobroma cacao]
 gb|EOY15869.1| Auxin efflux carrier family protein, putative [Theobroma cacao]
Length=436

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 112/165 (68%), Gaps = 0/165 (0%)
 Frame = -3

Query  497  KEDQRKMGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPS  318
            ++    M    L   A++P+L++L+I+ LG  LA D++ IL  D R+++N VVF  F P+
Sbjct  13   EDSDENMVLLDLFIAATIPVLKVLLITALGLYLALDHVNILGEDTRKHMNNVVFYVFNPA  72

Query  317  LTFASLARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAG  138
            L  ++LA T+  E ++  WFMP N+ LTF++G+ILGWIVI+  +P  HL GLIL  CAAG
Sbjct  73   LVASNLAETITYESMVKLWFMPFNVLLTFVIGSILGWIVIQFTRPPSHLRGLILGCCAAG  132

Query  137  NLGNLPLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            N+GN+ LII+PA+C E+ SPFG   +C   G+ YVS SMA+G  Y
Sbjct  133  NMGNMLLIIIPAVCKEKGSPFGSPEVCHSYGMGYVSLSMAIGAIY  177



>dbj|BAH57041.1| AT1G76520 [Arabidopsis thaliana]
Length=255

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  467  RLLEV---ASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLA  297
            +LLE+   +S P++++L+I+ +G  +A D + +L  DAR+YLN +VF  F+PSL  + LA
Sbjct  3    KLLELFITSSKPVVEILLITSVGFYMALDGVNLLGHDARKYLNNIVFYVFSPSLIGSRLA  62

Query  296  RTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPL  117
             +V  E ++  WFMPVN+ LTF++G++LGWIVI + KP  HL GLIL  CAAGNLGN+PL
Sbjct  63   DSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNMPL  122

Query  116  IIVPAICAEEASPFGDRAICSRLGLSYVSFSMA  18
            II+PA+C E+  PFGD   C + G+ YV+ SMA
Sbjct  123  IIIPAVCKEKGGPFGDPESCQKYGMGYVALSMA  155



>ref|XP_006437711.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
 gb|ESR50951.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
Length=240

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L EVA MPIL++L+++ LG  LA D I +L       LN +VF  F P+L  ++L
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  + +IS WFMPVNI L+FL+G+ L WI+IK+ +  PHL+GL++  C+AGN+GNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD ++CS  G +Y S SMA+G  Y
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAVGAIY  159



>ref|XP_010270580.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010270581.1| PREDICTED: uncharacterized transporter C5D6.04-like isoform X1 
[Nelumbo nucifera]
Length=416

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   ASMP+L++L+++ +G+ LA D I IL  DAR++LN++V+  FTP+L  + L
Sbjct  1    MGLLDLFITASMPVLKVLLVTLIGSLLALDQIDILGEDARKHLNQIVYFVFTPALVGSYL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ LE +   WFMPVNI +T+++G+ILGWIVI++ +P  HL+GLIL  C+AGN+GN+ 
Sbjct  61   AKTITLERMAMLWFMPVNILITYIIGSILGWIVIRITRPPSHLKGLILGCCSAGNMGNMF  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +I +PA+C E+ +PFG   IC   GL+Y S SMA+G  Y
Sbjct  121  IIFIPAVCKEKGNPFGAHEICHTYGLAYASLSMAIGAVY  159



>ref|XP_008787017.1| PREDICTED: uncharacterized transporter YBR287W-like [Phoenix 
dactylifera]
 ref|XP_008787018.1| PREDICTED: uncharacterized transporter YBR287W-like [Phoenix 
dactylifera]
Length=421

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L   A++P++ +L+++G+G+ LAT  + IL  DAR++LN VVF  F P+L   +L
Sbjct  1    MGFLELFITATVPVMNVLLVTGVGSFLATSNVGILSEDARKHLNNVVFFVFNPALVSTNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ART+ +E ++  WFMP+NI LTF+VG++ GW+VI++ +   +L GLIL  CAAGNLGN+ 
Sbjct  61   ARTITMESMVLLWFMPINILLTFIVGSLFGWLVIQITRAPTNLRGLILGCCAAGNLGNML  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG   +C   GL+Y S SMA+G  +
Sbjct  121  LIIVPAICKEKGSPFGASDVCHTYGLAYASLSMAIGAIF  159



>ref|XP_007209188.1| hypothetical protein PRUPE_ppa006413mg [Prunus persica]
 gb|EMJ10387.1| hypothetical protein PRUPE_ppa006413mg [Prunus persica]
Length=413

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M   +L   AS+P+L++L+I+ LG+ LA D + IL  D+R++LN VVF    P+L  ++L
Sbjct  1    MEVLQLFITASIPVLKVLLITALGSYLALDSVNILGEDSRKHLNTVVFYVLNPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ART+  E ++  WFMPVNI +TF+VG+ILGWI++ L +P  HL GL+L  CAAGNLGNL 
Sbjct  61   ARTITYESMVKLWFMPVNILITFIVGSILGWILLLLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ SPFG   +C   GL+Y S SMA+G  Y
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCRTYGLAYASLSMAIGAIY  159



>gb|KDO70039.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=240

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L EVA MPIL++L+++ LG  LA D I +L       LN +VF  F P+L  ++L
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  + +IS WFMPVNI L+FL+G+ L WI+IK+ +  PHL+GL++  C+AGN+GNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD ++CS  G +Y S SMA+G  Y
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAVGAIY  159



>ref|XP_007211270.1| hypothetical protein PRUPE_ppa017924mg [Prunus persica]
 gb|EMJ12469.1| hypothetical protein PRUPE_ppa017924mg [Prunus persica]
Length=423

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M   +L   AS+P+L++L+I+ LG+ LA D + IL  D R++LN VVF   +P+L  ++L
Sbjct  1    MEVLQLFITASIPVLKVLLITALGSYLALDSVNILGEDTRKHLNTVVFYVLSPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ART+  E ++  WFMPVNI +TF+VG+ILGWI++ L +P  HL GL+L  CAAGNLGNL 
Sbjct  61   ARTITYESMVKLWFMPVNILITFIVGSILGWILLLLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ SPFG   +C   GL+Y S SMA+G  Y
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCRTYGLAYASLSMAIGAIY  159



>ref|XP_007134485.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
 gb|ESW06479.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
Length=394

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW+L  VA MP+L++L+I+ LG  LA +   IL  + R+ LN +V+  F+P+L  +SL
Sbjct  1    MEFWKLFVVALMPVLKVLLITALGTILAINRFHILGENTRKNLNTLVYFVFSPALVCSSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+ L  ++  WFMPVNI LTF++G++LG++++KL K   HL+GL+L  CA+GNLGNLP
Sbjct  61   AETITLRSVVILWFMPVNILLTFVIGSLLGFLLVKLTKVPHHLQGLVLGCCASGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +IIVPA+C +  +PFGD  +CS+  L+Y S SMALG  Y
Sbjct  121  IIIVPALCKQSGNPFGDVNVCSKNALAYASLSMALGSVY  159



>ref|XP_003517114.1| PREDICTED: uncharacterized protein LOC100785182 isoformX1 [Glycine 
max]
 ref|XP_006573505.1| PREDICTED: uncharacterized protein LOC100785182 isoform X2 [Glycine 
max]
 ref|XP_006573506.1| PREDICTED: uncharacterized protein LOC100785182 isoform X3 [Glycine 
max]
Length=415

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L  VASMP++++L+I+ +G  LA D + +L  DAR  +N +V   F P+L   +L
Sbjct  1    MGLVELFGVASMPVIKVLLITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E+++  WFMPVNI LTF++G+ LGWI+IKL +   HLEGLI+  C+AGNLGNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLIMGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  Y
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVY  159



>gb|KHN28298.1| Putative transporter C5D6.04 [Glycine soja]
Length=416

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L  VASMP++++L+I+ +G  LA D + +L  DAR  +N +V   F P+L   +L
Sbjct  1    MGLVELFGVASMPVIKVLLITAVGLLLALDNVNLLGKDARIQVNHLVHYVFNPALVGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E+++  WFMPVNI LTF++G+ LGWI+IKL +   HLEGLI+  C+AGNLGNLP
Sbjct  61   ADTITFENVVLLWFMPVNILLTFIIGSALGWILIKLTRAPKHLEGLIMGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  Y
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVY  159



>ref|XP_007134484.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
 gb|ESW06478.1| hypothetical protein PHAVU_010G051100g [Phaseolus vulgaris]
Length=425

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW+L  VA MP+L++L+I+ LG  LA +   IL  + R+ LN +V+  F+P+L  +SL
Sbjct  1    MEFWKLFVVALMPVLKVLLITALGTILAINRFHILGENTRKNLNTLVYFVFSPALVCSSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+ L  ++  WFMPVNI LTF++G++LG++++KL K   HL+GL+L  CA+GNLGNLP
Sbjct  61   AETITLRSVVILWFMPVNILLTFVIGSLLGFLLVKLTKVPHHLQGLVLGCCASGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +IIVPA+C +  +PFGD  +CS+  L+Y S SMALG  Y
Sbjct  121  IIIVPALCKQSGNPFGDVNVCSKNALAYASLSMALGSVY  159



>ref|XP_007046429.1| Auxin:hydrogen symporter, putative isoform 1 [Theobroma cacao]
 gb|EOX90586.1| Auxin:hydrogen symporter, putative isoform 1 [Theobroma cacao]
Length=419

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M F  L  VASMP+L++L+++ LG+ LA D I ++  DAR+ LN VVF  F P++  ++L
Sbjct  1    MRFLDLFVVASMPVLKVLLLTALGSFLALDRIDVMGEDARKQLNNVVFYVFNPAVVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  E I+  WFMP NI  TF++G+ +GW+++K+ K   HL GLIL+ CAAGN+G+LP
Sbjct  61   AKTITFESIVLLWFMPFNILNTFIIGSAMGWVLVKITKAPQHLRGLILSCCAAGNMGHLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VPAIC E+ SPFG   IC + G++Y S SMA+G  Y
Sbjct  121  LIVVPAICTEKGSPFGTPDICHKYGMAYASLSMAIGAIY  159



>gb|KDP36734.1| hypothetical protein JCGZ_08025 [Jatropha curcas]
Length=402

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L   +S+P+L++L+I+GLG  LA D + IL  DAR+++N VVF  F+P+L    L
Sbjct  1    MALLDLFIASSIPVLKVLMITGLGTFLALDRVDILKGDARKHVNNVVFYVFSPALVGTKL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E I+  WFMP+NI +TF++G++LGWI+++L +P  HL GLI+  CAAGNLGN+ 
Sbjct  61   AETITYESIVKMWFMPLNILITFIIGSMLGWILVQLTRPPSHLRGLIVGCCAAGNLGNML  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PAIC E+ SPFG   +C   GL+YVS SMA+G  Y
Sbjct  121  LIMIPAICKEKGSPFGAPDVCQSYGLAYVSLSMAIGAVY  159



>ref|XP_002887644.1| hypothetical protein ARALYDRAFT_895536 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63903.1| hypothetical protein ARALYDRAFT_895536 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = -3

Query  467  RLLEV---ASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLA  297
            +LLE+   +S P++++L+I+ +G  +A D + +L  DAR+YLN +VF  F PSL  + LA
Sbjct  3    KLLELFITSSKPVVEILLITSVGFYMALDGVNLLGQDARKYLNNIVFYVFGPSLIGSRLA  62

Query  296  RTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPL  117
             +V  E ++  WFMPVN+ LTF++G++LGWIVI + KP  HL GLIL  CAAGNLGN+PL
Sbjct  63   DSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLILGCCAAGNLGNMPL  122

Query  116  IIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            II+PA+C E+  PFGD   C + G+ YV+ SMA+G  Y
Sbjct  123  IIIPAVCKEKGGPFGDPESCQKYGMGYVALSMAMGSIY  160



>ref|XP_006342188.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 
[Solanum tuberosum]
 ref|XP_006342189.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Solanum tuberosum]
Length=407

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   ASMP+L++L+I+ LG  LA D I +L  DAR++LN +VF    P+L  ++L
Sbjct  1    MGLLDLFITASMPVLKVLLITALGLILALDRIDLLGQDARKHLNNIVFFVLNPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  E +   WFMP NI  TF+VG+ILGW V+++ +P  HL GL++  CAAGNLGN+ 
Sbjct  61   AKTITYESLKKLWFMPFNILFTFIVGSILGWAVLQITRPPQHLRGLVVGCCAAGNLGNML  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFGD  +C   G+SY S SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGDPGVCHTYGMSYASLSMAVGAIY  159



>ref|XP_003570731.1| PREDICTED: uncharacterized transporter YBR287W-like [Brachypodium 
distachyon]
Length=439

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 119/166 (72%), Gaps = 7/166 (4%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLAT--DYIKILPADARRYLNKVVFVAFTPSLTFA  306
            MGF  LL +AS P++++L+I+ +GA LA+      +L   AR ++N+VV+  FTP+L  +
Sbjct  1    MGFMSLLLLASSPVVEVLLIALVGAYLASPSHGHGLLTPTARTHINRVVYAVFTPALMIS  60

Query  305  SLARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGN  126
            SL+RTV L D +SWWFMPVNIG+ FL G +LGW  + LL+P  HL GL++ASC+A N GN
Sbjct  61   SLSRTVTLRDAVSWWFMPVNIGIIFLAGGLLGWAAVFLLRPPQHLRGLVVASCSAANFGN  120

Query  125  LPLIIVPAICAEEASPF----GDR-AICSRLGLSYVSFSMALGGFY  3
            L LI++PA+C EE +PF    GD+  +C+  GLSY SFSMALGG Y
Sbjct  121  LLLIMIPAVCQEEGNPFVVHHGDQEGVCTDRGLSYASFSMALGGLY  166



>ref|XP_004231634.1| PREDICTED: uncharacterized protein LOC101264385 [Solanum lycopersicum]
Length=396

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M F  L  VA MP+L+ LII+ +G  LA + + +L + AR +LN +VF  FTP+L  +SL
Sbjct  1    MAFVELFVVALMPVLKTLIITAVGLLLALEPVNLLGSTARHHLNNLVFYIFTPALVASSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV   +I+S WFMPVNI LTF++G+ILGWI++K+ K   HL GL+++ C+AGNLGNL 
Sbjct  61   AETVTSSNIVSLWFMPVNILLTFIIGSILGWILVKITKTPIHLHGLVISCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFGD   CS  G +Y S SMA+G  Y
Sbjct  121  LIIIPAVCEEKNSPFGDSITCSTNGKAYASLSMAVGAVY  159



>gb|KEH17832.1| auxin efflux carrier family protein [Medicago truncatula]
Length=410

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPAD-ARRYLNKVVFVAFTPSLTFAS  303
            M F +L  VA MP+L++L+I+ LG  LA D   IL  + AR+ LN +VF  F P+L   S
Sbjct  1    MEFLKLFIVALMPVLKVLLITVLGTFLALDRFDILSRETARKNLNTIVFFVFAPALVCGS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
            LA TV  + I++ WFMP+N+ LTF++G  LGW+V+KL++   HL+GL+L  CAAGNLGNL
Sbjct  61   LAETVTSKSIVTLWFMPLNVLLTFIIGAALGWLVVKLMRVPHHLQGLVLGCCAAGNLGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            PLIIVPA+C +  +PFGD  IC R GL+Y S SMA+G  Y
Sbjct  121  PLIIVPAVCKQTGNPFGDADICHRNGLAYASLSMAIGTIY  160



>gb|KHN30729.1| hypothetical protein glysoja_034072 [Glycine soja]
Length=162

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M  W+L   A MP+L++L+I+ +G  LA     IL   AR++LN +V+  FTP+L  + L
Sbjct  1    MELWKLFVTALMPVLKVLLITAVGTFLALHRFNILRESARKHLNTIVYFVFTPALVCSIL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T   + +++ WFMP+NI LTF++GT LGW+ +K+ K  P ++GL+L  CAAGNLGNLP
Sbjct  61   AKTTTFKSLVAVWFMPLNILLTFIIGTTLGWLFMKITKAPPDMQGLVLGCCAAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMAL  15
            LIIVPA+C E +SPFG   +C++ G++Y S SMA+
Sbjct  121  LIIVPAVCKESSSPFGAVDVCNKKGMAYASLSMAV  155



>emb|CDP01746.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VA MP+L+ LI++ +G  LA + + IL A AR +LN +VF  FTP+L  ++L
Sbjct  1    MGFLALFIVALMPVLKTLIVTAVGLFLALEKVDILGATARHHLNNLVFFVFTPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+ +  +I  WFMPVNI LTFL+G+ LGW+++K+L+   HL GL++  CAAGNLGNL 
Sbjct  61   AETITMSSLIKLWFMPVNILLTFLIGSALGWVLVKVLRTPQHLHGLVIGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E  SPFGD + CS  G +Y S SMA+G  +
Sbjct  121  LIIIPAVCEENDSPFGDSSTCSTNGEAYASLSMAIGAVF  159



>dbj|BAJ86794.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=433

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL VA+ P++++L+++ LGA LA+    +L   AR  LN+VV+  FTP+L  ASL
Sbjct  1    MGFVSLLAVATTPVVEVLLVALLGAYLASPRCGLLAPSARADLNRVVYAVFTPALLLASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV L+D +SWWFMPVNIG+ F  G +LGW+ + +L+P PHL GL++ASC+A N GNL 
Sbjct  61   ASTVTLQDALSWWFMPVNIGIVFFAGGVLGWLAVLVLRPPPHLRGLVVASCSAANFGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI++PA+C E+ +PFG    C+ +GLSY SFSMALGG Y
Sbjct  121  LIVIPAVCREDGNPFGGD--CTGIGLSYASFSMALGGLY  157



>emb|CDX87589.1| BnaA07g32840D [Brassica napus]
Length=389

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L   +S P++++L+I+ +G  LA D + +L  DAR+YLN +VF  F+PSL  + L
Sbjct  2    MKLLNLFITSSKPVVEILLITIVGFYLALDGVNLLGQDARKYLNNIVFYVFSPSLIGSRL  61

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A +V  E ++  WFMPVN+ LTF++G++LGWIVI + KP  HL GLI+  CAAGNLGN+P
Sbjct  62   ADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLIVGCCAAGNLGNMP  121

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E   PFGD   C + G+ YV+ SMA+G  Y
Sbjct  122  LIIVPAICKERGGPFGDPENCQKYGMGYVALSMAMGSVY  160



>ref|XP_009106321.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
Length=389

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L   +S P++++L+I+ +G  LA D + +L  DAR+YLN +VF  F+PSL  + L
Sbjct  2    MKLLNLFITSSKPVVEILLITIVGFYLALDGVNLLGQDARKYLNNIVFYVFSPSLIGSRL  61

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A +V  E ++  WFMPVN+ LTF++G++LGWIVI + KP  HL GLI+  CAAGNLGN+P
Sbjct  62   ADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPPSHLRGLIVGCCAAGNLGNMP  121

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E   PFGD   C + G+ YV+ SMA+G  Y
Sbjct  122  LIIVPAICKERGGPFGDPENCQKYGMGYVALSMAMGSVY  160



>gb|KDO70038.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=292

 Score =   170 bits (430),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L EVA MPIL++L+++ LG  LA D I +L       LN +VF  F P+L  ++L
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  + +IS WFMPVNI L+FL+G+ L WI+IK+ +  PHL+GL++  C+AGN+GNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD ++CS  G +Y S SMA+G  Y
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAVGAIY  159



>emb|CDP07249.1| unnamed protein product [Coffea canephora]
Length=172

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   AS+P+L++L+++ LG+ LA D + IL  DAR++LN +VF  F P++  ++L
Sbjct  1    MGLLDLFSAASIPVLKVLLVTALGSYLALDRVNILGEDARKHLNSIVFYVFNPAIVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  + ++  WFMP NI +TFLVG++LGW+VI++ +   HL GL++  CAAGNLGN+ 
Sbjct  61   AKTITYDSMVKLWFMPFNILITFLVGSVLGWLVIQMTRAPRHLHGLVIGCCAAGNLGNML  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMAL  15
            LII+PA+C E+ SPFG   +C   G++Y S SMA+
Sbjct  121  LIIIPAVCKEKGSPFGAPDVCHSYGMAYASLSMAV  155



>ref|XP_008786672.1| PREDICTED: uncharacterized transporter YBR287W isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786673.1| PREDICTED: uncharacterized transporter YBR287W isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786674.1| PREDICTED: uncharacterized transporter YBR287W isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786675.1| PREDICTED: uncharacterized transporter YBR287W isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786676.1| PREDICTED: uncharacterized transporter YBR287W isoform X1 [Phoenix 
dactylifera]
Length=436

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGFW LL VASMP LQ+L++  LGA LA+ YI IL  +A R +NK+VFV F+P+L FASL
Sbjct  1    MGFWSLLMVASMPNLQVLLVGLLGAFLASGYINILSTNALRDVNKIVFVVFSPALVFASL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            + T+ L+DI+SWWFMP+NIG+ F +G ILGW+V+K+LKP+ HLEGL++ASC+AGNLG L 
Sbjct  61   SETITLQDILSWWFMPINIGIIFSIGGILGWVVVKILKPEHHLEGLVIASCSAGNLGTLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMAL  15
            LII+PAIC E+ +PFG+ + C  LGLSY SFSMA+
Sbjct  121  LIIIPAICNEDGNPFGESSDCKTLGLSYASFSMAV  155



>ref|XP_006437713.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
 gb|ESR50953.1| hypothetical protein CICLE_v10031658mg [Citrus clementina]
Length=297

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L EVA MPIL++L+++ LG  LA D I +L       LN +VF  F P+L  ++L
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  + +IS WFMPVNI L+FL+G+ L WI+IK+ +  PHL+GL++  C+AGN+GNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD ++CS  G +Y S SMA+G  Y
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAVGAIY  159



>gb|KDP24915.1| hypothetical protein JCGZ_24293 [Jatropha curcas]
Length=334

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   A MP+L++L+I+ LG+ LATD + +L  DAR++LN VVF  F P+L  ++L
Sbjct  1    MGLLDLFTAALMPVLKVLLITALGSFLATDRLGVLGVDARKHLNNVVFFIFNPALVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A  + L+ + + WFMP NI +TF+VG+ILGW++I+  +    L GL+L  C+AGNLGN+P
Sbjct  61   ATYITLKSMETLWFMPFNILITFIVGSILGWLLIRSTRAPHDLRGLVLGCCSAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E  SPFGD  +C + GL+Y S SMA+G  Y
Sbjct  121  LIIIPAVCKERGSPFGDVDVCYKHGLAYASLSMAIGAVY  159



>ref|XP_004238466.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
 ref|XP_010320486.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
 ref|XP_010320487.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
lycopersicum]
Length=407

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   ASMP+L++L+I+ LG  LA D I +L  DAR++LN +VF    P+L  ++L
Sbjct  1    MGLLDLFITASMPVLKVLLITALGLILALDRIDLLGQDARKHLNNIVFFVLNPALVSSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+TV  E +   WFMP NI  TF+ G+ILGW V+++ +P  HL GL++  CAAGNLGN+ 
Sbjct  61   AKTVTYESLKKLWFMPFNILFTFVAGSILGWAVLQVTRPPQHLRGLVVGCCAAGNLGNML  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFGD  +C   G+SY S SMA+G  Y
Sbjct  121  LIIIPAVCKEKGSPFGDPGVCHTYGMSYASLSMAVGAIY  159



>ref|XP_004300092.1| PREDICTED: uncharacterized transporter YBR287W-like [Fragaria 
vesca subsp. vesca]
Length=413

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M   +L   AS+P+L++L I+ LG+ LA + I IL  + R+ LN VVF  F+P+L   +L
Sbjct  1    MAVLQLFITASIPVLKVLFITALGSYLALERINILGEETRKNLNTVVFYVFSPALVGTNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  + +I  WFMPVNI +TFLVG++LGWI+I+L +P PHL GLIL  CAAGNLGNL 
Sbjct  61   AQTITYDSMIKLWFMPVNILVTFLVGSLLGWILIQLARPPPHLRGLILGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG   +C   G++Y S SMA G  Y
Sbjct  121  LIIIPAVCKEKGSPFGAPDVCHTYGMAYASLSMATGAIY  159



>gb|KDO70035.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
 gb|KDO70036.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
 gb|KDO70037.1| hypothetical protein CISIN_1g014841mg [Citrus sinensis]
Length=297

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L EVA MPIL++L+++ LG  LA D I +L       LN +VF  F P+L  ++L
Sbjct  1    MEILDLFEVALMPILKVLLVTALGLVLAIDRIDLLGHSVTHSLNNLVFYVFNPALIGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  + +IS WFMPVNI L+FL+G+ L WI+IK+ +  PHL+GL++  C+AGN+GNL 
Sbjct  61   AETITYQSLISLWFMPVNILLSFLIGSALAWILIKITRTPPHLQGLVIGCCSAGNMGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E  SPFGD ++CS  G +Y S SMA+G  Y
Sbjct  121  LIIVPAVCEESNSPFGDTSVCSSYGKAYASLSMAVGAIY  159



>ref|XP_006465068.1| PREDICTED: uncharacterized protein LOC102630978 [Citrus sinensis]
Length=218

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 116/159 (73%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L  VASMP+L+ L+++ LG+ LA D + ++  +AR+ LN VVF  F+P++  ++L
Sbjct  1    MQISDLFFVASMPVLKTLLLTTLGSFLALDRVGVMGENARKQLNSVVFFVFSPAIVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ LE I+  WFMP+NI  TF++G++L WI+IK+ +   HL+GL+L  CAAGNLGNLP
Sbjct  61   AKTITLESIVLMWFMPINILCTFIIGSVLAWILIKVTRAPRHLKGLVLGCCAAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PAIC E+ SPFGD  IC + G++YVS SMA G  Y
Sbjct  121  LIIIPAICREKNSPFGDPEICHKYGMTYVSLSMATGVVY  159



>ref|XP_006350447.1| PREDICTED: uncharacterized transporter YBR287W-like [Solanum 
tuberosum]
Length=396

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M F  L  VA +P+L+ LII+ +G  LA + I +L + AR +LN +VF  FTP+L  +SL
Sbjct  1    MAFVELFVVALVPVLKTLIITAVGLFLALERINLLGSTARHHLNNLVFYIFTPALVASSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV   +I+S WFMPVNI LTF++G++LGWI++K+ K   HL GL+++ C+AGNLGNL 
Sbjct  61   AETVTSSNIVSLWFMPVNILLTFIIGSVLGWILVKITKTPIHLHGLVISCCSAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFGD   CS  G +Y S SMA+G  Y
Sbjct  121  LIIIPAVCEEKNSPFGDSITCSTNGKAYASLSMAVGAVY  159



>ref|NP_001241160.1| uncharacterized protein LOC100807081 [Glycine max]
 gb|ACU24249.1| unknown [Glycine max]
Length=386

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M FW+L   + M IL+LL+I+ LGA LA D   IL  +AR++LN +V+  FTP+L ++S+
Sbjct  1    MNFWKLYIASFMSILKLLLITALGAFLAHDRFNILRENARKHLNAMVYFVFTPALIYSSM  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            + T+    ++  WFMP++I LT++ GT+LGWI+IK ++   HL GL+L  CAAGNL +LP
Sbjct  61   SNTLTFRSMVMLWFMPLSILLTYIAGTVLGWILIKTIRVPHHLHGLVLGCCAAGNLASLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LI+VP IC ++ SPFGD  +C + GL+Y S SMA+G  Y
Sbjct  121  LIVVPTICKDKNSPFGDEVVCHKNGLAYASLSMAIGYTY  159



>ref|XP_010471808.1| PREDICTED: uncharacterized transporter YBR287W-like [Camelina 
sativa]
Length=445

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 122/179 (68%), Gaps = 4/179 (2%)
 Frame = -3

Query  527  KHETKENYISKEDQRKMGF-WRLLEV---ASMPILQLLIISGLGATLATDYIKILPADAR  360
            +H + +  ++ ED +K+    +LLE+   +S P+++ L+I+ +G  LA D + +L  DAR
Sbjct  28   RHTSYKKILALEDYKKLEVEMKLLELFIASSKPVVETLLITSVGFYLALDRVNLLGPDAR  87

Query  359  RYLNKVVFVAFTPSLTFASLARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPK  180
            ++LN +VF  F+PSL  + LA +V  E ++  WFMPVN+ LTF++G++LGWIVI + KP 
Sbjct  88   KHLNNIVFYVFSPSLIGSRLADSVTYESLVKMWFMPVNVLLTFIIGSLLGWIVIVITKPP  147

Query  179  PHLEGLILASCAAGNLGNLPLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
             HL GLI+  CA+GNLG +PLII+PAIC E+  PFGD   C + G+ YV+ SM +G  Y
Sbjct  148  SHLRGLIICCCASGNLGTMPLIIIPAICKEKGGPFGDPESCEKYGMGYVTLSMTMGTVY  206



>ref|XP_010033618.1| PREDICTED: uncharacterized transporter C5D6.04-like [Eucalyptus 
grandis]
 gb|KCW53316.1| hypothetical protein EUGRSUZ_J02569 [Eucalyptus grandis]
Length=418

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  LL +ASMP+L+ L+++ LG  LA + + ++   AR+ LN+V +  F+P+L  ++L
Sbjct  1    MGFLDLLMIASMPVLKTLLVTALGLYLALESVDVMGESARKQLNRVGYFVFSPALVGSTL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ARTV  E+I   WFMPVNI +TF++G+ LGWI++K  +   H++GLIL  CAAGNLG+LP
Sbjct  61   ARTVTSENIAQLWFMPVNILITFIIGSALGWILVKFTRAPHHVKGLILGCCAAGNLGHLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG   +C + G++Y S +MA+G  Y
Sbjct  121  LIIIPALCKEQGSPFGVPDVCQKYGMAYASITMAVGAVY  159



>ref|XP_010266292.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266293.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266294.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266295.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266296.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
 ref|XP_010266297.1| PREDICTED: uncharacterized transporter YBR287W-like [Nelumbo 
nucifera]
Length=418

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L  VA++P+L++LI++G+G+ LA D I IL  DAR++LN+VVF  F P+L   +L
Sbjct  1    MELLDLFVVATIPVLKVLIVTGVGSFLAIDRIDILGEDARKHLNRVVFFVFNPALVAINL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ART+  E ++  WFMP NI LTF++G+ LGW+VI++ K   +L GLIL  C+AGNLGN+ 
Sbjct  61   ARTITFESMVMLWFMPFNILLTFIIGSALGWMVIQITKAPSNLRGLILGCCSAGNLGNML  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFG   +C + G++Y S SMA+G  Y
Sbjct  121  LIIIPAVCREKGSPFGANDVCYKYGMAYSSLSMAIGAVY  159



>ref|XP_009390658.1| PREDICTED: uncharacterized transporter YBR287W-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG  +L   AS+P+L++L+++G+G+ LAT  + IL  +AR++LN VVF  F P+L   +L
Sbjct  1    MGLLKLFVTASVPVLKVLLVTGVGSFLATGQVGILCHEARKHLNNVVFYVFNPALVSTNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            +RT+ +E ++  WFMP+NI LTF++G   GW+VI++     HL+GL+L  CAAGNLGN+ 
Sbjct  61   SRTITMESLVLLWFMPINILLTFIIGFAFGWVVIQITNAPSHLKGLVLGCCAAGNLGNML  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E  SPFG   +C+  GL+Y S SMA+G  +
Sbjct  121  LIIVPAICKERGSPFGASDVCTTYGLAYASLSMAIGAIF  159



>ref|XP_010094502.1| Uncharacterized transporter [Morus notabilis]
 gb|EXB56256.1| Uncharacterized transporter [Morus notabilis]
Length=420

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -3

Query  464  LLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLARTVK  285
            LL  AS+P+L++L+I+ LG+ LA D + I P DA ++LN +VF  F P+L  ++LA T+ 
Sbjct  6    LLVTASIPVLKVLLITALGSYLALDRVGIFPEDAIKHLNTIVFYVFNPALVASNLASTIT  65

Query  284  LEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPLIIVP  105
             + +I  WFMPVNI +TF+VG+ILGWIVI+  +P  HL GLIL   AAGNLGN+ L+I+P
Sbjct  66   YQSMIKLWFMPVNILITFIVGSILGWIVIQFTRPPQHLHGLILGCSAAGNLGNMLLVIIP  125

Query  104  AICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            A+C E  SPFGD  +C   G++Y S SMA+G  Y
Sbjct  126  ALCKERGSPFGDPDVCYTYGMAYSSLSMAIGAIY  159



>ref|XP_010428718.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 
[Camelina sativa]
Length=398

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = -3

Query  467  RLLEV---ASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASLA  297
            +LLE+   +S P+++ L+I+ +G  LA D + +L  DAR++LN +VF  F+PSL  + LA
Sbjct  2    KLLELFIASSKPVVETLLITSVGFYLALDRVNLLGPDARKHLNNIVFYVFSPSLIGSRLA  61

Query  296  RTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLPL  117
             +V  E ++  WFMPVN+ LTF++G++LGWIVI + KP  HL GLI++SCA+GNLG +PL
Sbjct  62   DSVTYESLVKMWFMPVNVMLTFIIGSLLGWIVIVITKPPSHLRGLIISSCASGNLGTMPL  121

Query  116  IIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            II+PAIC E+  PFGD   C + G+ YV+ SM +G  Y
Sbjct  122  IIIPAICKEKGGPFGDAESCEKYGMGYVTLSMTMGTVY  159



>ref|XP_009128182.1| PREDICTED: uncharacterized transporter YBR287W-like [Brassica 
rapa]
Length=387

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L   +S P++++L+I+ +G  +A D + +L  DAR++LN +VF  F+PSL  + L
Sbjct  2    MKLLHLFITSSKPVVEILLITTVGFYMALDGVNLLGQDARKFLNNIVFYVFSPSLIGSRL  61

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A +V  E ++  WFMPVN+ LTF++G+ LGWIVI + KP  HL GLI+  CAAGNLGN+P
Sbjct  62   ANSVTYESLMQMWFMPVNVLLTFIIGSFLGWIVILITKPPSHLRGLIVGCCAAGNLGNMP  121

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+  PFGD   C + G+ YV+ SMA+G  Y
Sbjct  122  LIIVPAVCKEKGGPFGDPENCQKYGVGYVALSMAMGSIY  160



>ref|XP_008373348.1| PREDICTED: uncharacterized protein LOC103436679 [Malus domestica]
 ref|XP_008373349.1| PREDICTED: uncharacterized protein LOC103436679 [Malus domestica]
Length=182

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M   +L   AS+P+L++L+I+ LG+ LA D + IL    R+ LN VVF  F+P+L  ++L
Sbjct  1    MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNLNTVVFYVFSPALVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  E ++  WFMPVNI +TF++G++LGWI+I+L +P  HL GL+L  CAAGNLGNL 
Sbjct  61   AKTITYESMVKMWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMAL  15
            LIIVPA+C E+ SPFG   +C    ++Y S SMA+
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAV  155



>ref|XP_002317634.2| hypothetical protein POPTR_0011s14870g [Populus trichocarpa]
 gb|EEE98246.2| hypothetical protein POPTR_0011s14870g [Populus trichocarpa]
Length=390

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG W+L  VA MP++++L+I+ +G  LAT+ + IL  DAR++LN +VF    P+L  ++L
Sbjct  1    MGLWQLFVVALMPVVKVLLITAVGVFLATERMDILGTDARKHLNSLVFYVLNPALVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+ + L+ I+  WFMP+NI +TF+ G+ LGW++IK+ K   HL GLIL  CAAGNLGN+P
Sbjct  61   AKFITLKSIVMLWFMPLNILITFIAGSALGWLLIKITKAPIHLRGLILGCCAAGNLGNMP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALG  12
            LII+PA C E+ +PFGD +IC   GL+Y + S+A+G
Sbjct  121  LIIIPAACEEKGNPFGDASICKMHGLAYATLSLAIG  156



>emb|CDY20402.1| BnaC02g24140D [Brassica napus]
Length=387

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    L   +S P++++L+I+ +G  +A D + +L  DAR++LN +VF  F+PSL  + L
Sbjct  2    MKLLHLFITSSKPVVEILLITTVGFYMALDGVNLLGQDARKFLNNIVFYVFSPSLIGSRL  61

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A +V  E ++  WFMPVN+ LTF++G+ LGWIVI + KP  HL GLI+  CAAGNLGN+P
Sbjct  62   ANSVTYESLMQMWFMPVNVLLTFIIGSFLGWIVILITKPPSHLRGLIVGCCAAGNLGNMP  121

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+  PFGD   C + G+ YV+ SMA+G  Y
Sbjct  122  LIIVPAVCKEKGGPFGDPENCQKYGVGYVALSMAMGSIY  160



>ref|XP_006589306.1| PREDICTED: uncharacterized transporter YBR287W-like [Glycine 
max]
Length=400

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M  W+L   A MP+L++L+I+ +G  LA     IL   AR++LN +V+  FTP+L  + L
Sbjct  1    MELWKLFVTALMPVLKVLLITAVGTFLALHRFNILRESARKHLNTIVYFVFTPALVCSIL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T   + +++ WFMP+NI LTF++GT LGW+ +K+ K  P ++GL+L  CAAGNLGNLP
Sbjct  61   AKTTTFKSLVAVWFMPLNILLTFIIGTTLGWLFMKITKAPPDMQGLVLGCCAAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E +SPFG   +C++ G++Y S SMA+G  Y
Sbjct  121  LIIVPAVCKESSSPFGAVDVCNKKGMAYASLSMAVGHIY  159



>gb|EPS71464.1| hypothetical protein M569_03295, partial [Genlisea aurea]
Length=225

 Score =   165 bits (418),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   L   +S+P+L+LL+++ LG+ LA D++ IL  DAR++ N V F  F+P+L +++L
Sbjct  1    MGLMDLFITSSIPVLKLLLLTALGSYLALDHVNILGDDARKHWNNVTFFVFSPALVYSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            ARTV  + ++  WFMP NI  TF++G+I GW++I + +  PHL GL++ SCAAGNLGNL 
Sbjct  61   ARTVTYDSMVKLWFMPFNILCTFIIGSIFGWMIIHVTRAPPHLRGLVIGSCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PA+C E  SPFG+  +C  LG++Y S SMA+G  Y
Sbjct  121  VIIIPAVCKERGSPFGNPEVCHTLGMAYASLSMAIGAIY  159



>ref|XP_009600852.1| PREDICTED: uncharacterized protein LOC104096217 isoform X2 [Nicotiana 
tomentosiformis]
Length=351

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L  VA +P+L+ LII+ +G  LA + + +L + AR YLN +VF  FTP+L  +SL
Sbjct  1    MGFVDLFVVALVPVLKTLIITAVGLFLALERVNLLGSAARHYLNNLVFYIFTPALVASSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A TV   +I+S WFMPVNI LTF++G+ LGW+++K+      L GL+++ CAAGNLGNL 
Sbjct  61   AETVTSSNIVSLWFMPVNILLTFIIGSALGWVLVKITTTPIQLHGLVISCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LII+PA+C E+ SPFGD   CS  G +Y S SMA+G  Y
Sbjct  121  LIIIPAVCVEKNSPFGDSITCSTNGKAYASLSMAIGAVY  159



>emb|CDP01747.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MG   LL VA MP+L+ L+I+ +G  LA D+I IL A AR +LN +V+  F PSL  +SL
Sbjct  1    MGIDELLMVALMPVLKTLLIAVVGLFLAVDHISILSATARHHLNNLVYYVFFPSLLASSL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
              ++   +IIS WF PV+I LTF++G+ LGWI++++ K    L GL++ SCAAGN+GNLP
Sbjct  61   VDSISATNIISLWFTPVSILLTFIIGSALGWILVRITKTPQQLHGLVIGSCAAGNMGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAICAE+ +PFGD   CSR G++YVS SM++G  +
Sbjct  121  VIIIPAICAEKNNPFGDSFSCSRNGMAYVSLSMSIGAVF  159



>gb|KEH17833.1| auxin efflux carrier family protein [Medicago truncatula]
Length=340

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 111/156 (71%), Gaps = 1/156 (1%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPAD-ARRYLNKVVFVAFTPSLTFAS  303
            M F +L  VA MP+L++L+I+ LG  LA D   IL  + AR+ LN +VF  F P+L   S
Sbjct  1    MEFLKLFIVALMPVLKVLLITVLGTFLALDRFDILSRETARKNLNTIVFFVFAPALVCGS  60

Query  302  LARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNL  123
            LA TV  + I++ WFMP+N+ LTF++G  LGW+V+KL++   HL+GL+L  CAAGNLGNL
Sbjct  61   LAETVTSKSIVTLWFMPLNVLLTFIIGAALGWLVVKLMRVPHHLQGLVLGCCAAGNLGNL  120

Query  122  PLIIVPAICAEEASPFGDRAICSRLGLSYVSFSMAL  15
            PLIIVPA+C +  +PFGD  IC R GL+Y S SMA+
Sbjct  121  PLIIVPAVCKQTGNPFGDADICHRNGLAYASLSMAV  156



>ref|XP_007158042.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
 ref|XP_007158043.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
 gb|ESW30036.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
 gb|ESW30037.1| hypothetical protein PHAVU_002G119300g [Phaseolus vulgaris]
Length=412

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M    LL VASMP++++L+I+ +G  LA   I +L  DAR  +N +V     P+L   +L
Sbjct  1    MALMELLWVASMPVIKVLLITAVGLVLALGNINLLGKDARIQVNNLVHYVLYPALVGGNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A T+  E+++S WFMPVNI LTF++G+ LGWI++KL +   HLEGLI+  C+AGNLGNLP
Sbjct  61   ADTITSENVVSLWFMPVNILLTFIIGSALGWILVKLTRAPKHLEGLIVGVCSAGNLGNLP  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            +II+PAIC ++ SPFGD  +C + G++Y S SMA+G  Y
Sbjct  121  IIIIPAICKDKGSPFGDSNVCYQYGMAYASLSMAVGAVY  159



>ref|XP_010932122.1| PREDICTED: uncharacterized transporter YBR287W-like [Elaeis guineensis]
Length=418

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 113/159 (71%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            MGF  L   A++P++ +L+++ +G+ LAT Y+ IL   AR++LN VVF  F P+L   +L
Sbjct  1    MGFLELFITATVPVMNVLLVTAVGSFLATSYVGILSEAARKHLNNVVFFVFNPALVSTNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+ +E ++  WFMP+NI LTF++G++ GW+VI++ +   +L GLIL  CAAGNLGN+ 
Sbjct  61   AQTITMESMVLLWFMPINILLTFIIGSLFGWLVIQITRAPTNLRGLILGCCAAGNLGNML  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPAIC E+ SPFG   +C   GL+Y S SMA+G  +
Sbjct  121  LIIVPAICKEKGSPFGAPVVCHTYGLAYASLSMAIGAIF  159



>ref|XP_008373331.1| PREDICTED: uncharacterized transporter YBR287W-like [Malus domestica]
Length=414

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M   +L   AS+P+L++L+I+ LG+ LA D + IL    R+ LN VVF  F+P+L  ++L
Sbjct  1    MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNLNTVVFYVFSPALVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  E ++  WFMPVNI +TF++G++LGWI+I+L +P  HL GL+L  CAAGNLGNL 
Sbjct  61   AKTITYESMVKMWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ SPFG   +C    ++Y S SMA+G  Y
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAIGAVY  159



>ref|XP_009372647.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
 ref|XP_009372648.1| PREDICTED: uncharacterized transporter YBR287W-like [Pyrus x 
bretschneideri]
Length=414

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = -3

Query  479  MGFWRLLEVASMPILQLLIISGLGATLATDYIKILPADARRYLNKVVFVAFTPSLTFASL  300
            M   +L   AS+P+L++L+I+ LG+ LA D + IL    R+ LN VVF  F+P+L  ++L
Sbjct  1    MELLQLFVTASIPVLKVLLITALGSYLALDRVDILGEVTRKNLNTVVFYVFSPALVGSNL  60

Query  299  ARTVKLEDIISWWFMPVNIGLTFLVGTILGWIVIKLLKPKPHLEGLILASCAAGNLGNLP  120
            A+T+  E ++  WFMPVNI +TF++G++LGWI+I+L +P  HL GL+L  CAAGNLGNL 
Sbjct  61   AKTITYESMVKMWFMPVNILITFIIGSVLGWILIQLTRPPAHLRGLVLGCCAAGNLGNLL  120

Query  119  LIIVPAICAEEASPFGDRAICSRLGLSYVSFSMALGGFY  3
            LIIVPA+C E+ SPFG   +C    ++Y S SMA+G  Y
Sbjct  121  LIIVPAVCKEKGSPFGAPDVCHTYAMAYASLSMAIGAVY  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 935048050050