BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81989_g1_i1 len=999 path=[1:0-998]

Length=999
                                                                      Score     E

gb|ABQ42002.1|  gibberellin induced protein                             162   1e-45   Sonneratia caseolaris
gb|ABQ42001.1|  gibberellin induced protein                             162   2e-45   Sonneratia alba
gb|ABQ42003.1|  gibberellin induced protein                             162   2e-45   Sonneratia ovata
gb|ABQ42004.1|  gibberellin induced protein                             161   4e-45   Sonneratia apetala
gb|KDP22135.1|  hypothetical protein JCGZ_25966                         160   6e-45   
ref|XP_008240742.1|  PREDICTED: protein GAST1                           159   4e-44   
emb|CDP08494.1|  unnamed protein product                                158   4e-44   
ref|XP_011080381.1|  PREDICTED: protein GAST1-like                      157   9e-44   
ref|XP_006491553.1|  PREDICTED: protein GAST1-like                      156   3e-43   
ref|XP_009775224.1|  PREDICTED: protein GAST1-like                      155   7e-43   
ref|XP_007216796.1|  hypothetical protein PRUPE_ppa023616mg             155   8e-43   
ref|XP_006421229.1|  hypothetical protein CICLE_v10006243mg             154   2e-42   
gb|AEC10958.1|  gibberellin induced protein                             153   3e-42   
ref|XP_008344997.1|  PREDICTED: protein GAST1-like                      152   9e-42   
ref|XP_008244953.1|  PREDICTED: protein GAST1-like                      152   1e-41   
ref|XP_011045379.1|  PREDICTED: protein GAST1-like                      152   1e-41   
ref|XP_009337038.1|  PREDICTED: protein GAST1-like                      152   1e-41   
ref|XP_010558231.1|  PREDICTED: protein GAST1                           152   1e-41   
ref|XP_008392374.1|  PREDICTED: protein GAST1 isoform X2                151   2e-41   
gb|AAW83819.1|  GASA2-like protein                                      151   3e-41   Pelargonium zonale
ref|XP_008392373.1|  PREDICTED: protein GAST1 isoform X1                150   4e-41   
ref|XP_002298301.2|  hypothetical protein POPTR_0001s26100g             151   4e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011075384.1|  PREDICTED: protein GAST1-like                      150   6e-41   
ref|XP_008464949.1|  PREDICTED: protein GAST1-like                      150   7e-41   
gb|AAG43509.1|AF210049_1  gibberellin-induced protein 1                 149   9e-41   Petunia x hybrida [garden petunia]
ref|XP_006470710.1|  PREDICTED: protein GAST1-like                      149   9e-41   
ref|XP_009347627.1|  PREDICTED: protein GAST1-like                      149   1e-40   
gb|AFH57279.1|  GASA-like protein                                       149   1e-40   
emb|CAD10104.1|  gibberellin induced protein 3                          149   2e-40   Petunia x hybrida [garden petunia]
ref|XP_006446220.1|  hypothetical protein CICLE_v10017244mg             149   2e-40   
gb|KDO50409.1|  hypothetical protein CISIN_1g033715mg                   148   4e-40   
ref|XP_004493436.1|  PREDICTED: protein GAST1-like                      148   5e-40   
ref|XP_003554146.1|  PREDICTED: protein GAST1-like isoform 1            148   6e-40   
emb|CAA60677.1|  gip1                                                   147   1e-39   Petunia x hybrida [garden petunia]
ref|XP_003632726.1|  PREDICTED: protein GAST1                           145   6e-39   
gb|ACS68670.1|  gibberellin induced protein                             144   6e-39   Sonneratia alba
ref|XP_004158330.1|  PREDICTED: protein GAST1-like                      145   7e-39   
gb|EYU18662.1|  hypothetical protein MIMGU_mgv1a016553mg                144   1e-38   
ref|XP_007028593.1|  Gibberellin-regulated family protein               144   1e-38   
ref|XP_010246225.1|  PREDICTED: protein GAST1-like                      144   1e-38   
ref|XP_009414177.1|  PREDICTED: gibberellin-regulated protein 5-l...    144   1e-38   
emb|CBI30071.3|  unnamed protein product                                143   2e-38   
ref|XP_009414179.1|  PREDICTED: gibberellin-regulated protein 5-l...    143   3e-38   
ref|XP_002530088.1|  GAST1 protein precursor, putative                  143   3e-38   Ricinus communis
gb|KDP26211.1|  hypothetical protein JCGZ_22457                         142   4e-38   
ref|XP_010673717.1|  PREDICTED: protein GAST1-like isoform X1           142   5e-38   
ref|XP_010273304.1|  PREDICTED: uncharacterized protein LOC104608...    153   8e-38   
ref|XP_009619459.1|  PREDICTED: protein GAST1-like                      142   8e-38   
ref|XP_010273303.1|  PREDICTED: uncharacterized protein LOC104608...    154   9e-38   
gb|KHG09441.1|  Protein GAST1                                           142   9e-38   
ref|XP_007212837.1|  hypothetical protein PRUPE_ppa020764mg             140   1e-37   
ref|XP_003625068.1|  Gibberellin induced protein                        141   1e-37   
ref|XP_009123090.1|  PREDICTED: gibberellin-regulated protein 13-...    141   2e-37   
gb|KGN59726.1|  hypothetical protein Csa_3G841990                       140   2e-37   
ref|XP_007162142.1|  hypothetical protein PHAVU_001G127700g             141   3e-37   
emb|CDP14204.1|  unnamed protein product                                140   4e-37   
gb|AFK49188.1|  unknown                                                 140   4e-37   
ref|XP_010481166.1|  PREDICTED: gibberellin-regulated protein 13-...    140   5e-37   
emb|CDY22221.1|  BnaC01g38800D                                          140   5e-37   
ref|XP_010673718.1|  PREDICTED: protein GAST1-like isoform X2           139   6e-37   
ref|XP_011027306.1|  PREDICTED: protein GAST1-like                      139   8e-37   
ref|XP_010464684.1|  PREDICTED: gibberellin-regulated protein 13-...    139   2e-36   
ref|NP_001235028.1|  uncharacterized protein LOC100500485 precursor     139   3e-36   
ref|XP_002308912.2|  hypothetical protein POPTR_0006s04300g             137   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010056457.1|  PREDICTED: protein GAST1                           137   3e-36   
ref|XP_010045037.1|  PREDICTED: protein GAST1-like                      137   4e-36   
ref|XP_010481220.1|  PREDICTED: gibberellin-regulated protein 13-...    137   5e-36   
ref|XP_006338319.1|  PREDICTED: protein GAST1-like                      137   7e-36   
ref|XP_004232126.1|  PREDICTED: protein GAST1                           136   1e-35   
ref|XP_009793969.1|  PREDICTED: protein GAST1-like                      136   1e-35   
ref|XP_006421227.1|  hypothetical protein CICLE_v10006243mg             135   2e-35   
ref|XP_010938633.1|  PREDICTED: protein GAST1-like                      135   2e-35   
ref|XP_010486614.1|  PREDICTED: gibberellin-regulated protein 13        135   2e-35   
ref|XP_009787829.1|  PREDICTED: protein GAST1-like                      135   3e-35   
gb|AAC32128.1|  GASA5-like protein                                      135   3e-35   Picea mariana [black spruce]
gb|EEC79111.1|  hypothetical protein OsI_19744                          136   4e-35   Oryza sativa Indica Group [Indian rice]
emb|CDY41324.1|  BnaA01g31950D                                          134   7e-35   
ref|XP_009589707.1|  PREDICTED: protein GAST1-like                      134   1e-34   
ref|XP_004513859.1|  PREDICTED: gibberellin-regulated protein 14-...    135   1e-34   
ref|XP_004513860.1|  PREDICTED: gibberellin-regulated protein 14-...    135   1e-34   
gb|KFK38405.1|  hypothetical protein AALP_AA3G108800                    133   2e-34   
ref|XP_006655260.1|  PREDICTED: gibberellin-regulated protein 14-...    134   3e-34   
ref|XP_006358036.1|  PREDICTED: protein GAST1-like                      132   6e-34   
ref|XP_010672958.1|  PREDICTED: gibberellin-regulated protein 13-...    131   7e-34   
ref|XP_002441006.1|  hypothetical protein SORBIDRAFT_09g018790          132   8e-34   Sorghum bicolor [broomcorn]
ref|NP_001055385.1|  Os05g0376800                                       132   9e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004236562.1|  PREDICTED: protein GAST1-like                      131   1e-33   
emb|CDY00909.1|  BnaC05g42910D                                          131   1e-33   
ref|XP_008800232.1|  PREDICTED: protein GAST1-like                      130   1e-33   
ref|XP_010672957.1|  PREDICTED: gibberellin-regulated protein 13-...    130   1e-33   
ref|XP_009146866.1|  PREDICTED: gibberellin-regulated protein 13-...    130   4e-33   
emb|CDY60168.1|  BnaAnng16620D                                          129   4e-33   
ref|XP_003519099.2|  PREDICTED: protein GAST1-like                      129   7e-33   
gb|ABK22391.1|  unknown                                                 127   2e-32   Picea sitchensis
ref|XP_003617836.1|  Gibberellin induced protein                        129   2e-32   
gb|EPS65179.1|  hypothetical protein M569_09600                         128   2e-32   
ref|XP_010108998.1|  hypothetical protein L484_027195                   127   2e-32   
gb|AET00795.2|  GASA/GAST/Snakin                                        128   3e-32   
ref|XP_006843409.1|  hypothetical protein AMTR_s00053p00132370          125   3e-32   
emb|CBL95259.1|  gasa5 like protein                                     126   5e-32   
ref|XP_003598155.1|  Gibberellin induced protein                        128   6e-32   
ref|XP_003544991.1|  PREDICTED: protein RSI-1-like                      125   6e-32   
gb|AES68406.2|  GASA/GAST/Snakin                                        127   7e-32   
gb|KHN48768.1|  Protein GAST1                                           124   1e-31   
gb|ADX36135.1|  gibberellic acid-stimulated protein 1                   125   1e-31   
ref|NP_001150577.1|  LOC100284210 precursor                             126   1e-31   Zea mays [maize]
ref|XP_010510284.1|  PREDICTED: gibberellin-regulated protein 12-...    124   3e-31   
ref|XP_004962265.1|  PREDICTED: protein GAST1-like isoform X2           125   3e-31   
ref|XP_004962264.1|  PREDICTED: protein GAST1-like isoform X1           125   4e-31   
ref|NP_001063170.1|  Os09g0414900                                       122   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148171.1|  GAST1 protein precursor                            124   1e-30   Zea mays [maize]
emb|CDY71845.1|  BnaAnng38970D                                          122   2e-30   
ref|XP_009128056.1|  PREDICTED: gibberellin-regulated protein 6         121   3e-30   
ref|NP_001235155.1|  uncharacterized protein LOC100306189 precursor     121   3e-30   
gb|AFK43939.1|  unknown                                                 120   6e-30   
gb|ACG30820.1|  GAST1 protein precursor                                 122   6e-30   Zea mays [maize]
ref|XP_010062256.1|  PREDICTED: gibberellin-regulated protein 5-like    120   8e-30   
ref|XP_010510285.1|  PREDICTED: gibberellin-regulated protein 12-...    120   8e-30   
ref|XP_004490815.1|  PREDICTED: protein RSI-1-like                      120   8e-30   
ref|XP_010471557.1|  PREDICTED: gibberellin-regulated protein 6-like    120   9e-30   
ref|XP_009587065.1|  PREDICTED: gibberellin-regulated protein 6-like    120   9e-30   
gb|KDP27148.1|  hypothetical protein JCGZ_19847                         120   1e-29   
ref|XP_010258349.1|  PREDICTED: gibberellin-regulated protein 6 i...    120   1e-29   
ref|XP_007151230.1|  hypothetical protein PHAVU_004G028800g             120   1e-29   
ref|XP_006440597.1|  hypothetical protein CICLE_v10023012mg             120   1e-29   
ref|NP_001235994.1|  uncharacterized protein LOC100305480 precursor     120   1e-29   
ref|XP_010414214.1|  PREDICTED: gibberellin-regulated protein 12-...    120   1e-29   
ref|XP_008649585.1|  PREDICTED: gibberellin-regulated protein 6-like    121   1e-29   
ref|XP_008460555.1|  PREDICTED: protein RSI-1-like                      119   1e-29   
ref|XP_002442726.1|  hypothetical protein SORBIDRAFT_08g001840          120   2e-29   Sorghum bicolor [broomcorn]
ref|XP_003613454.1|  Gibberellin induced protein                        119   2e-29   
ref|XP_010908421.1|  PREDICTED: protein RSI-1-like                      119   2e-29   
ref|XP_008788455.1|  PREDICTED: protein RSI-1-like                      119   2e-29   
ref|XP_010428457.1|  PREDICTED: gibberellin-regulated protein 6-like    119   2e-29   
ref|XP_009419112.1|  PREDICTED: gibberellin-regulated protein 5-like    118   3e-29   
gb|AGE15498.1|  GA-stimulated transcript-like protein 2                 119   3e-29   
ref|XP_007215189.1|  hypothetical protein PRUPE_ppa013959mg             118   3e-29   
ref|XP_002881134.1|  gibberellin-regulated family protein               119   3e-29   
gb|AFK42462.1|  unknown                                                 119   4e-29   
ref|XP_009781826.1|  PREDICTED: gibberellin-regulated protein 6-like    118   4e-29   
ref|XP_004236040.1|  PREDICTED: gibberellin-regulated protein 6         118   5e-29   
ref|XP_004978479.1|  PREDICTED: gibberellin-regulated protein 6-like    119   5e-29   
ref|XP_006364599.1|  PREDICTED: gibberellin-regulated protein 6-like    118   6e-29   
ref|XP_010416324.1|  PREDICTED: gibberellin-regulated protein 6         117   8e-29   
gb|AFW77815.1|  hypothetical protein ZEAMMB73_495748                    116   9e-29   
ref|XP_004489396.1|  PREDICTED: gibberellin-regulated protein 4-like    117   9e-29   
gb|EPS67879.1|  hypothetical protein M569_06897                         116   1e-28   
ref|XP_003618498.1|  Gibberellin-regulated protein                      117   1e-28   
emb|CDP01621.1|  unnamed protein product                                117   1e-28   
ref|XP_007138184.1|  hypothetical protein PHAVU_009G187400g             117   1e-28   
ref|XP_007139576.1|  hypothetical protein PHAVU_008G041200g             117   1e-28   
ref|XP_011098626.1|  PREDICTED: gibberellin-regulated protein 4-like    117   1e-28   
ref|XP_004241582.1|  PREDICTED: gibberellin-regulated protein 6-like    117   1e-28   
ref|XP_010469795.1|  PREDICTED: gibberellin-regulated protein 12-...    117   1e-28   
ref|XP_006390402.1|  hypothetical protein EUTSA_v10019355mg             117   1e-28   
ref|XP_006354781.1|  PREDICTED: gibberellin-regulated protein 6-like    117   2e-28   
gb|AGE15501.1|  GA-stimulated transcript-like protein 5                 117   2e-28   
ref|NP_177605.2|  gibberellin-regulated protein 6                       116   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ57667.2|  Gasa4-like protein                                      116   2e-28   Pelargonium zonale
ref|NP_001149114.1|  GAST1 protein precursor                            117   3e-28   Zea mays [maize]
ref|NP_001240084.1|  uncharacterized protein LOC100787539 precursor     116   3e-28   
ref|XP_010469794.1|  PREDICTED: gibberellin-regulated protein 12-...    116   3e-28   
ref|XP_003613435.1|  GAST1                                              115   3e-28   
ref|XP_007215190.1|  hypothetical protein PRUPE_ppa013959mg             115   4e-28   
ref|XP_004491797.1|  PREDICTED: gibberellin-regulated protein 4-like    116   4e-28   
emb|CAD10105.1|  Gip1-like protein                                      115   4e-28   Petunia x hybrida [garden petunia]
ref|NP_001235467.1|  uncharacterized protein LOC100500003 precursor     115   4e-28   
ref|XP_010257391.1|  PREDICTED: gibberellin-regulated protein 6-like    115   5e-28   
ref|XP_009614794.1|  PREDICTED: gibberellin-regulated protein 6         115   6e-28   
ref|XP_008229202.1|  PREDICTED: protein RSI-1                           115   6e-28   
ref|XP_008800752.1|  PREDICTED: protein RSI-1-like                      115   6e-28   
ref|XP_006828424.1|  hypothetical protein AMTR_s00060p00095260          115   7e-28   
ref|XP_006477453.1|  PREDICTED: gibberellin-regulated protein 6-like    115   7e-28   
ref|XP_009761199.1|  PREDICTED: gibberellin-regulated protein 4         115   8e-28   
emb|CDP19133.1|  unnamed protein product                                115   8e-28   
gb|AGL92232.1|  GASA-like protein GEG2                                  115   8e-28   
ref|XP_003616284.1|  GASA5-like protein                                 114   9e-28   
gb|ACF74297.1|  gibberellin-regulated protein                           115   9e-28   Arachis hypogaea [goober]
ref|XP_010538071.1|  PREDICTED: gibberellin-regulated protein 6         114   1e-27   
ref|XP_006295413.1|  hypothetical protein CARUB_v10024510mg             115   1e-27   
gb|AAC32170.1|  GASA5-like protein                                      113   1e-27   Picea mariana [black spruce]
ref|XP_009383413.1|  PREDICTED: gibberellin-regulated protein 12        113   1e-27   
gb|AFK34043.1|  unknown                                                 114   1e-27   
gb|AAV84588.1|  Gip1-like protein                                       114   1e-27   Populus tomentosa [Chinese white poplar]
gb|AFW55883.1|  GAST1 protein                                           115   2e-27   
ref|XP_009410001.1|  PREDICTED: gibberellin-regulated protein 6-like    114   2e-27   
ref|XP_007141900.1|  hypothetical protein PHAVU_008G235300g             113   3e-27   
gb|AGL92234.1|  GASA-like protein GEG4                                  113   3e-27   
gb|AGM20679.1|  GASA5                                                   113   3e-27   
ref|XP_006383339.1|  gibberellin-regulated protein 5                    113   3e-27   
ref|XP_010248044.1|  PREDICTED: gibberellin-regulated protein 6-like    113   4e-27   
gb|KDP31251.1|  hypothetical protein JCGZ_11627                         113   5e-27   
ref|XP_011021371.1|  PREDICTED: protein RSI-1                           112   6e-27   
ref|NP_001237498.1|  uncharacterized protein LOC100306354 precursor     112   6e-27   
gb|KFK41905.1|  hypothetical protein AALP_AA2G187500                    112   6e-27   
ref|XP_004489937.1|  PREDICTED: gibberellin-regulated protein 12-...    112   6e-27   
ref|XP_010937130.1|  PREDICTED: gibberellin-regulated protein 6         112   7e-27   
gb|AAT42201.1|  gibberellin-stimulated protein                          112   7e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002284937.1|  PREDICTED: gibberellin-regulated protein 6         112   7e-27   Vitis vinifera
ref|XP_009383268.1|  PREDICTED: gibberellin-regulated protein 12-...    113   8e-27   
gb|AAG52379.1|AC011765_31  GAST1-like protein; 109761-110213            111   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792485.1|  PREDICTED: gibberellin-regulated protein 5-like    112   8e-27   
gb|EAZ36571.1|  hypothetical protein OsJ_20910                          112   9e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003621217.1|  Gibberellin-regulated protein                      112   9e-27   
gb|EAZ00446.1|  hypothetical protein OsI_22466                          112   9e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001234666.1|  protein RSI-1 precursor                            111   1e-26   
ref|XP_009339293.1|  PREDICTED: gibberellin-regulated protein 6-like    112   1e-26   
ref|XP_008393156.1|  PREDICTED: gibberellin-regulated protein 6         112   1e-26   
ref|NP_001057346.1|  Os06g0266800                                       111   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004517034.1|  PREDICTED: gibberellin-regulated protein 12-...    111   1e-26   
ref|XP_002887551.1|  hypothetical protein ARALYDRAFT_895333             111   1e-26   
ref|XP_004517033.1|  PREDICTED: gibberellin-regulated protein 12-...    111   1e-26   
ref|XP_006364638.1|  PREDICTED: protein RSI-1-like                      111   2e-26   
ref|XP_006299108.1|  hypothetical protein CARUB_v10015247mg             110   2e-26   
ref|XP_011035751.1|  PREDICTED: gibberellin-regulated protein 4         111   2e-26   
ref|XP_008807353.1|  PREDICTED: gibberellin-regulated protein 6-like    111   2e-26   
ref|XP_010258350.1|  PREDICTED: gibberellin-regulated protein 6 i...    110   2e-26   
ref|XP_010091518.1|  hypothetical protein L484_015945                   111   2e-26   
ref|XP_003523021.1|  PREDICTED: gibberellin-regulated protein 4         111   3e-26   
ref|XP_010931460.1|  PREDICTED: gibberellin-regulated protein 6-like    110   3e-26   
ref|XP_009410471.1|  PREDICTED: gibberellin-regulated protein 6-like    112   3e-26   
ref|XP_002460210.1|  hypothetical protein SORBIDRAFT_02g024660          111   3e-26   Sorghum bicolor [broomcorn]
ref|XP_008784232.1|  PREDICTED: gibberellin-regulated protein 6         110   4e-26   
ref|XP_004299361.1|  PREDICTED: gibberellin-regulated protein 6-like    110   4e-26   
ref|XP_004140359.1|  PREDICTED: protein RSI-1-like                      110   4e-26   
dbj|BAF00966.1|  GAST1-like protein                                     109   5e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ACM47319.1|  Gasa4-like protein                                      110   5e-26   Rosa x damascena [damask rose]
ref|XP_010274082.1|  PREDICTED: gibberellin-regulated protein 12        110   5e-26   
ref|XP_006407600.1|  hypothetical protein EUTSA_v10021857mg             109   5e-26   
ref|XP_007145559.1|  hypothetical protein PHAVU_007G248900g             111   6e-26   
gb|AGM38075.1|  putative gibberellin-regulated GAST1-like protein       109   7e-26   
ref|XP_007209788.1|  hypothetical protein PRUPE_ppa013704mg             110   7e-26   
ref|XP_010922895.1|  PREDICTED: gibberellin-regulated protein 6-like    110   7e-26   
ref|XP_009106131.1|  PREDICTED: gibberellin-regulated protein 12-...    109   7e-26   
ref|XP_010037169.1|  PREDICTED: gibberellin-regulated protein 6         109   8e-26   
ref|XP_006421228.1|  hypothetical protein CICLE_v10006243mg             108   9e-26   
ref|XP_009348406.1|  PREDICTED: gibberellin-regulated protein 12-...    109   1e-25   
ref|XP_004304306.1|  PREDICTED: gibberellin-regulated protein 4-like    109   1e-25   
gb|EYU34071.1|  hypothetical protein MIMGU_mgv1a016830mg                109   1e-25   
ref|XP_010922909.1|  PREDICTED: gibberellin-regulated protein 12-...    109   1e-25   
ref|XP_010678520.1|  PREDICTED: gibberellin-regulated protein 6-like    108   1e-25   
ref|XP_010038994.1|  PREDICTED: gibberellin-regulated protein 12        108   2e-25   
ref|XP_006827240.1|  hypothetical protein AMTR_s00010p00261380          108   2e-25   
ref|XP_006601874.1|  PREDICTED: gibberellin-regulated protein 12-...    108   2e-25   
ref|XP_009108078.1|  PREDICTED: gibberellin-regulated protein 12-...    107   4e-25   
gb|AGL92233.1|  GASA-like protein GEG3                                  107   6e-25   
ref|XP_007163897.1|  hypothetical protein PHAVU_L007200g                107   6e-25   
gb|EPS67539.1|  gibberellin-regulated protein                           106   6e-25   
gb|KFK25767.1|  hypothetical protein AALP_AA8G157100                    107   6e-25   
emb|CDY27104.1|  BnaA08g07420D                                          107   6e-25   
emb|CDP12304.1|  unnamed protein product                                107   7e-25   
ref|XP_008658598.1|  PREDICTED: LOC100282417 isoform X1                 107   7e-25   
ref|XP_003541683.1|  PREDICTED: gibberellin-regulated protein 12-...    106   7e-25   
emb|CDY46336.1|  BnaC01g30340D                                          107   8e-25   
ref|XP_006655989.1|  PREDICTED: gibberellin-regulated protein 6-like    107   8e-25   
ref|XP_008239947.1|  PREDICTED: gibberellin-regulated protein 6         106   1e-24   
ref|XP_002438216.1|  hypothetical protein SORBIDRAFT_10g009640          106   1e-24   Sorghum bicolor [broomcorn]
ref|XP_003613442.1|  GAST1                                              105   2e-24   
ref|XP_009403172.1|  PREDICTED: gibberellin-regulated protein 6-like    105   3e-24   
ref|XP_010524331.1|  PREDICTED: gibberellin-regulated protein 4         105   3e-24   
gb|ACG32788.1|  GAST1 protein precursor                                 105   3e-24   Zea mays [maize]
gb|ACG27426.1|  GAST1 protein precursor                                 105   3e-24   Zea mays [maize]
gb|ACG24561.1|  GAST1 protein precursor                                 105   3e-24   Zea mays [maize]
ref|NP_001148800.1|  LOC100282417 precursor                             105   3e-24   Zea mays [maize]
gb|EMT22883.1|  hypothetical protein F775_27923                         105   3e-24   
ref|XP_004978341.1|  PREDICTED: gibberellin-regulated protein 6-like    104   4e-24   
ref|XP_006296776.1|  hypothetical protein CARUB_v10015821mg             104   4e-24   
ref|XP_008224510.1|  PREDICTED: gibberellin-regulated protein 12-...    105   4e-24   
ref|XP_003578115.1|  PREDICTED: gibberellin-regulated protein 12-...    105   5e-24   
emb|CDX70601.1|  BnaC03g06850D                                          104   5e-24   
ref|XP_007227095.1|  hypothetical protein PRUPE_ppa025589mg             103   6e-24   
ref|XP_002871654.1|  hypothetical protein ARALYDRAFT_488368             104   6e-24   
ref|XP_009131454.1|  PREDICTED: gibberellin-regulated protein 4         104   6e-24   
ref|NP_197027.1|  gibberellin-regulated protein 4                       104   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004147472.1|  PREDICTED: gibberellin-regulated protein 4-like    104   7e-24   
ref|XP_009802479.1|  PREDICTED: protein RSI-1                           103   7e-24   
gb|KDO41153.1|  hypothetical protein CISIN_1g041400mg                   103   8e-24   
ref|XP_006493084.1|  PREDICTED: gibberellin-regulated protein 12-...    103   8e-24   
ref|XP_003613456.1|  Gibberellin-regulated protein                      103   9e-24   
gb|AAA74480.1|  gibberellin-regulated                                   103   1e-23   
ref|XP_009126040.1|  PREDICTED: gibberellin-regulated protein 4-like    103   1e-23   
ref|XP_007034357.1|  Gibberellin-regulated family protein               104   1e-23   
ref|XP_004986740.1|  PREDICTED: gibberellin-regulated protein 12-...    103   1e-23   
ref|XP_004959452.1|  PREDICTED: gibberellin-regulated protein 6-like    103   1e-23   
ref|XP_008659198.1|  PREDICTED: gibberellin-regulated protein 12        103   1e-23   
ref|XP_006482090.1|  PREDICTED: gibberellin-regulated protein 5-like    102   2e-23   
ref|XP_008443413.1|  PREDICTED: gibberellin-regulated protein 6         101   4e-23   
ref|XP_010236530.1|  PREDICTED: gibberellin-regulated protein 5-like    102   5e-23   
ref|XP_006400040.1|  hypothetical protein EUTSA_v10015100mg             101   6e-23   
ref|XP_009615077.1|  PREDICTED: protein RSI-1                           101   6e-23   
ref|XP_006395777.1|  hypothetical protein EUTSA_v10005321mg             101   7e-23   
ref|XP_010469793.1|  PREDICTED: gibberellin-regulated protein 12-...    101   9e-23   
ref|XP_010685022.1|  PREDICTED: gibberellin-regulated protein 12-...    100   1e-22   
emb|CDX78620.1|  BnaA03g05320D                                          102   1e-22   
ref|XP_006420919.1|  hypothetical protein CICLE_v10006668mg           99.8    1e-22   
gb|AFK37530.1|  unknown                                                 100   1e-22   
ref|XP_007163834.1|  hypothetical protein PHAVU_001G268100g             100   1e-22   
gb|KHF97238.1|  Protein RSI-1                                           100   1e-22   
ref|NP_180639.2|  gibberellin-regulated protein 12                      100   2e-22   
ref|XP_006430565.1|  hypothetical protein CICLE_v10013200mg           99.8    3e-22   
ref|XP_009590514.1|  PREDICTED: protein RSI-1-like                    99.4    3e-22   
emb|CAJ77893.1|  GASA                                                 99.8    3e-22   
ref|XP_002264339.1|  PREDICTED: gibberellin-regulated protein 4       99.4    4e-22   
ref|XP_002977665.1|  hypothetical protein SELMODRAFT_417581           99.4    4e-22   
gb|AES96393.2|  GASA/GAST/Snakin                                      98.6    5e-22   
ref|XP_002979611.1|  hypothetical protein SELMODRAFT_419248           99.0    6e-22   
ref|XP_004965196.1|  PREDICTED: uncharacterized protein LOC101757...    102   6e-22   
ref|XP_004965195.1|  PREDICTED: uncharacterized protein LOC101757...    102   6e-22   
ref|XP_009797632.1|  PREDICTED: protein RSI-1-like                    98.2    9e-22   
ref|XP_007032998.1|  GAST1                                            98.2    1e-21   
gb|ACG45047.1|  GAST1 protein precursor                               98.6    1e-21   
ref|XP_009369404.1|  PREDICTED: gibberellin-regulated protein 6       98.2    1e-21   
ref|NP_001078587.1|  gibberellin-regulated protein 4                  97.1    2e-21   
ref|XP_007163594.1|  hypothetical protein PHAVU_001G247600g           97.4    2e-21   
ref|XP_010646211.1|  PREDICTED: gibberellin-regulated protein 12-...  97.4    2e-21   
gb|EMT27427.1|  hypothetical protein F775_24525                       97.8    2e-21   
ref|NP_001078130.1|  Gibberellin-regulated family protein             97.4    2e-21   
ref|XP_002467388.1|  hypothetical protein SORBIDRAFT_01g026925        98.2    2e-21   
ref|XP_010532783.1|  PREDICTED: gibberellin-regulated protein 12      97.4    2e-21   
ref|XP_006662142.1|  PREDICTED: gibberellin-regulated protein 12-...  97.1    3e-21   
gb|EMS62293.1|  hypothetical protein TRIUR3_16527                     97.1    3e-21   
ref|XP_010420181.1|  PREDICTED: gibberellin-regulated protein 4-like  97.1    4e-21   
ref|XP_006298867.1|  hypothetical protein CARUB_v10014986mg           96.7    4e-21   
ref|XP_006288945.1|  hypothetical protein CARUB_v10002309mg           96.7    5e-21   
ref|XP_008355724.1|  PREDICTED: gibberellin-regulated protein 12-...  95.9    6e-21   
ref|XP_011099948.1|  PREDICTED: protein RSI-1-like                    95.5    7e-21   
ref|XP_007034358.1|  Gibberellin-regulated family protein             96.7    7e-21   
gb|ADE76246.1|  unknown                                               95.9    9e-21   
ref|XP_002518090.1|  Gibberellin-regulated protein 4 precursor, p...  94.4    1e-20   
ref|XP_006416022.1|  hypothetical protein EUTSA_v10009582mg           95.1    1e-20   
ref|XP_010502522.1|  PREDICTED: gibberellin-regulated protein 5       94.7    1e-20   
ref|XP_010558610.1|  PREDICTED: gibberellin-regulated protein 5       95.1    1e-20   
ref|XP_006416023.1|  hypothetical protein EUTSA_v10009207mg           94.4    2e-20   
ref|XP_002884344.1|  hypothetical protein ARALYDRAFT_317170           93.6    4e-20   
gb|EYU30907.1|  hypothetical protein MIMGU_mgv1a017014mg              93.2    6e-20   
ref|XP_003629688.1|  Gibberellin induced protein                      93.2    6e-20   
ref|NP_566186.1|  gibberellin-regulated protein 5                     92.8    7e-20   
gb|EYU46338.1|  hypothetical protein MIMGU_mgv1a020071mg              92.4    8e-20   
ref|XP_006649745.1|  PREDICTED: gibberellin-regulated protein 12-...  92.4    1e-19   
ref|XP_008367840.1|  PREDICTED: gibberellin-regulated protein 12-...  92.4    1e-19   
gb|AAA98520.1|  GASA5                                                 92.0    1e-19   
gb|AAC20716.1|  putative gibberellin-regulated protein                92.0    2e-19   
ref|XP_002885614.1|  hypothetical protein ARALYDRAFT_898961           93.6    2e-19   
ref|XP_006482595.1|  PREDICTED: gibberellin-regulated protein 4-like  92.0    2e-19   
ref|XP_002323857.1|  hypothetical protein POPTR_0017s11940g           92.0    2e-19   
ref|XP_006431148.1|  hypothetical protein CICLE_v10013454mg           92.0    2e-19   
ref|XP_008348072.1|  PREDICTED: gibberellin-regulated protein 6-like  92.0    2e-19   
ref|XP_010678522.1|  PREDICTED: gibberellin-regulated protein 6       90.9    3e-19   
ref|XP_002870319.1|  predicted protein                                91.3    3e-19   
ref|XP_008224511.1|  PREDICTED: gibberellin-regulated protein 12-...  90.9    4e-19   
gb|KDO72569.1|  hypothetical protein CISIN_1g040854mg                 90.9    5e-19   
ref|XP_002531185.1|  RSI-1 protein precursor, putative                90.1    7e-19   
ref|XP_010467977.1|  PREDICTED: gibberellin-regulated protein 5-like  90.5    8e-19   
gb|KHN24017.1|  Protein GAST1                                         88.6    1e-18   
gb|ABF94978.1|  GAST1 protein precursor, putative                     89.4    1e-18   
gb|ABK93160.1|  unknown                                               89.4    2e-18   
gb|ABO43961.1|  GAST1                                                 87.4    2e-18   
emb|CBI25690.3|  unnamed protein product                              89.0    2e-18   
gb|EMT22213.1|  hypothetical protein F775_13483                       88.2    2e-18   
ref|NP_001176009.1|  Os10g0115550                                     89.0    3e-18   
ref|XP_003563973.1|  PREDICTED: gibberellin-regulated protein 5-like  88.2    3e-18   
ref|XP_009376270.1|  PREDICTED: gibberellin-regulated protein 4-like  88.6    3e-18   
ref|XP_011071640.1|  PREDICTED: gibberellin-regulated protein 4-like  88.2    4e-18   
ref|XP_011071641.1|  PREDICTED: gibberellin-regulated protein 4-like  88.2    4e-18   
ref|XP_009118631.1|  PREDICTED: gibberellin-regulated protein 5       87.8    5e-18   
gb|KFK37735.1|  hypothetical protein AALP_AA3G022800                  87.8    5e-18   
gb|EMS56456.1|  hypothetical protein TRIUR3_28594                     87.0    9e-18   
gb|ABW89001.1|  GA-induced protein                                    87.0    1e-17   
ref|XP_006493083.1|  PREDICTED: gibberellin-regulated protein 12-...  86.7    1e-17   
emb|CAD10106.1|  Gip1-like protein                                    87.0    1e-17   
emb|CDY14668.1|  BnaC05g19250D                                        85.9    1e-17   
gb|AHM24217.1|  GASR7                                                 86.7    1e-17   
dbj|BAJ89479.1|  predicted protein                                    86.7    1e-17   
ref|XP_009607999.1|  PREDICTED: gibberellin-regulated protein 5-like  86.7    2e-17   
gb|EEC74871.1|  hypothetical protein OsI_10763                        86.7    2e-17   
gb|EEE58704.1|  hypothetical protein OsJ_10147                        86.3    3e-17   
ref|XP_002283517.1|  PREDICTED: gibberellin-regulated protein 4       85.9    3e-17   
ref|XP_002298694.2|  hypothetical protein POPTR_0001s32270g           84.7    3e-17   
ref|XP_007224623.1|  hypothetical protein PRUPE_ppa026867mg           84.7    3e-17   
ref|XP_006420917.1|  hypothetical protein CICLE_v10006931mg           84.7    3e-17   
ref|XP_009394865.1|  PREDICTED: gibberellin-regulated protein 12-...  85.5    4e-17   
ref|XP_008380555.1|  PREDICTED: gibberellin-regulated protein 12-...  85.5    4e-17   
ref|XP_011074928.1|  PREDICTED: gibberellin-regulated protein 9       85.1    7e-17   
ref|XP_009341013.1|  PREDICTED: gibberellin-regulated protein 4-like  84.7    7e-17   
ref|XP_009592386.1|  PREDICTED: gibberellin-regulated protein 5-like  84.7    8e-17   
ref|XP_008341575.1|  PREDICTED: gibberellin-regulated protein 4       84.7    8e-17   
ref|XP_009394866.1|  PREDICTED: gibberellin-regulated protein 12-...  84.3    1e-16   
ref|XP_004250385.1|  PREDICTED: snakin-2-like                         85.1    1e-16   
ref|XP_009762897.1|  PREDICTED: gibberellin-regulated protein 5-like  84.0    2e-16   
ref|XP_009803055.1|  PREDICTED: gibberellin-regulated protein 5-l...  84.0    2e-16   
ref|XP_009803054.1|  PREDICTED: gibberellin-regulated protein 5-l...  83.6    2e-16   
ref|XP_007215172.1|  hypothetical protein PRUPE_ppa013692mg           83.6    2e-16   
ref|XP_006418799.1|  hypothetical protein EUTSA_v10003002mg           82.8    2e-16   
ref|XP_009374587.1|  PREDICTED: gibberellin-regulated protein 12-...  83.6    2e-16   
ref|XP_008380554.1|  PREDICTED: gibberellin-regulated protein 12-...  83.6    2e-16   
gb|ABK21133.1|  unknown                                               83.6    2e-16   
ref|XP_010274741.1|  PREDICTED: protein RSI-1-like                    83.2    2e-16   
ref|XP_009616241.1|  PREDICTED: gibberellin-regulated protein 5-like  83.6    2e-16   
emb|CDP17256.1|  unnamed protein product                              83.2    3e-16   
gb|EYU22941.1|  hypothetical protein MIMGU_mgv1a022909mg              82.4    4e-16   
ref|XP_002973082.1|  hypothetical protein SELMODRAFT_99264            81.6    5e-16   
ref|XP_008230767.1|  PREDICTED: gibberellin-regulated protein 6-like  82.4    5e-16   
gb|EYU29122.1|  hypothetical protein MIMGU_mgv1a017256mg              81.3    7e-16   
ref|XP_009797080.1|  PREDICTED: gibberellin-regulated protein 5-like  81.6    1e-15   
ref|XP_002986081.1|  hypothetical protein SELMODRAFT_123391           80.1    1e-15   
ref|XP_006434614.1|  hypothetical protein CICLE_v10002796mg           81.6    2e-15   
ref|XP_004499015.1|  PREDICTED: snakin-1-like                         80.1    2e-15   
ref|XP_006351146.1|  PREDICTED: gibberellin-regulated protein 9-like  80.5    3e-15   
ref|XP_006473195.1|  PREDICTED: gibberellin-regulated protein 9-l...  81.3    3e-15   
ref|XP_003635031.1|  PREDICTED: gibberellin-regulated protein 12-...  80.1    3e-15   
gb|EYU22850.1|  hypothetical protein MIMGU_mgv1a016408mg              80.1    5e-15   
emb|CDP17251.1|  unnamed protein product                              79.3    6e-15   
emb|CDP03885.1|  unnamed protein product                              78.2    6e-15   
ref|XP_009613810.1|  PREDICTED: gibberellin-regulated protein 5-like  79.0    7e-15   
gb|KCW49802.1|  hypothetical protein EUGRSUZ_K03283                   78.6    8e-15   
ref|XP_008237395.1|  PREDICTED: gibberellin-regulated protein 9       79.3    8e-15   
ref|XP_002982001.1|  hypothetical protein SELMODRAFT_115445           77.8    1e-14   
ref|XP_002524960.1|  conserved hypothetical protein                   78.6    1e-14   
ref|XP_008381340.1|  PREDICTED: protein RSI-1                         78.2    1e-14   
ref|XP_009798156.1|  PREDICTED: gibberellin-regulated protein 9-like  79.3    1e-14   
gb|KDO83921.1|  hypothetical protein CISIN_1g033656mg                 78.6    2e-14   
ref|XP_002272568.1|  PREDICTED: gibberellin-regulated protein 9       78.2    2e-14   
gb|ADE77851.1|  unknown                                               78.2    2e-14   
ref|XP_004290947.1|  PREDICTED: peamaclein-like                       77.4    2e-14   
ref|XP_008780246.1|  PREDICTED: gibberellin-regulated protein 2-like  77.0    2e-14   
ref|XP_010673449.1|  PREDICTED: peamaclein-like                       77.8    2e-14   
ref|XP_008353837.1|  PREDICTED: protein RSI-1-like                    77.4    3e-14   
ref|XP_002973289.1|  hypothetical protein SELMODRAFT_99234            76.6    3e-14   
ref|XP_009354124.1|  PREDICTED: peamaclein-like isoform X2            76.6    4e-14   
gb|ABK25287.1|  unknown                                               77.4    4e-14   
ref|XP_006846942.1|  hypothetical protein AMTR_s00017p00002980        77.4    4e-14   
gb|ABK22434.1|  unknown                                               77.4    4e-14   
ref|XP_011069570.1|  PREDICTED: peamaclein                            76.6    4e-14   
ref|XP_010678521.1|  PREDICTED: gibberellin-regulated protein 6-like  76.6    5e-14   
ref|XP_006374850.1|  hypothetical protein POPTR_0014s02030g           76.3    6e-14   
ref|XP_010066166.1|  PREDICTED: peamaclein-like                       76.3    6e-14   
ref|XP_011029030.1|  PREDICTED: peamaclein-like                       76.3    6e-14   
ref|XP_002526823.1|  Gibberellin-regulated protein 2 precursor, p...  76.3    6e-14   
ref|XP_008377985.1|  PREDICTED: peamaclein                            76.3    7e-14   
ref|XP_002976786.1|  hypothetical protein SELMODRAFT_105504           75.5    8e-14   
gb|KHN21405.1|  Snakin-1                                              75.9    9e-14   
gb|KCW68672.1|  hypothetical protein EUGRSUZ_F02269                   75.9    1e-13   
gb|AFT92001.1|  gibberellin-regulated protein                         75.5    1e-13   
ref|NP_001236984.1|  uncharacterized protein LOC100500113             76.3    1e-13   
ref|XP_006346334.1|  PREDICTED: snakin-1-like                         75.5    1e-13   
ref|XP_011074384.1|  PREDICTED: peamaclein-like                       75.5    1e-13   
ref|XP_010315202.1|  PREDICTED: peamaclein                            75.5    1e-13   
ref|XP_010677814.1|  PREDICTED: gibberellin-regulated protein 2-like  75.9    1e-13   
gb|ADE77769.1|  unknown                                               75.9    1e-13   
ref|XP_010271646.1|  PREDICTED: peamaclein-like                       75.1    2e-13   
ref|XP_009354123.1|  PREDICTED: peamaclein-like isoform X1            75.1    2e-13   
ref|XP_010062007.1|  PREDICTED: gibberellin-regulated protein 9       75.9    2e-13   
ref|XP_007223838.1|  hypothetical protein PRUPE_ppa014086mg           75.1    2e-13   
ref|XP_003550315.1|  PREDICTED: snakin-1                              75.1    2e-13   
gb|ACU13365.1|  unknown                                               74.7    2e-13   
gb|AFT92002.1|  gibberellin-regulated protein                         74.7    3e-13   
gb|EYU36786.1|  hypothetical protein MIMGU_mgv1a016861mg              75.1    3e-13   
ref|XP_008360977.1|  PREDICTED: peamaclein                            74.7    3e-13   
ref|XP_010492350.1|  PREDICTED: gibberellin-regulated protein 4-like  75.1    3e-13   
ref|XP_004252296.1|  PREDICTED: peamaclein-like                       74.3    3e-13   
ref|XP_009360284.1|  PREDICTED: peamaclein                            74.3    3e-13   
ref|XP_009415913.1|  PREDICTED: gibberellin-regulated protein 11-...  74.3    3e-13   
gb|KHG20586.1|  Snakin-1                                              74.3    4e-13   
sp|P86888.1|PMLN_PRUPE  RecName: Full=Peamaclein; AltName: Allerg...  73.6    4e-13   
ref|XP_008801807.1|  PREDICTED: gibberellin-regulated protein 6-like  73.6    5e-13   
ref|XP_010256372.1|  PREDICTED: gibberellin-regulated protein 9-like  74.3    5e-13   
ref|XP_004961979.1|  PREDICTED: gibberellin-regulated protein 3-like  73.6    6e-13   
ref|XP_002285141.1|  PREDICTED: peamaclein                            73.6    6e-13   
ref|XP_010260041.1|  PREDICTED: gibberellin-regulated protein 9-like  74.3    6e-13   
ref|XP_007143086.1|  hypothetical protein PHAVU_007G042400g           73.6    6e-13   
ref|XP_006654443.1|  PREDICTED: gibberellin-regulated protein 2-like  73.6    7e-13   
ref|XP_010460030.1|  PREDICTED: gibberellin-regulated protein 9-l...  73.9    8e-13   
gb|ABK22062.1|  unknown                                               73.6    9e-13   
ref|XP_010491469.1|  PREDICTED: gibberellin-regulated protein 8-like  73.2    9e-13   
ref|XP_010443767.1|  PREDICTED: gibberellin-regulated protein 10-...  73.2    9e-13   
ref|XP_006472264.1|  PREDICTED: snakin-1-like                         73.2    9e-13   
ref|XP_006433597.1|  hypothetical protein CICLE_v10002979mg           73.2    9e-13   
ref|XP_003536595.1|  PREDICTED: snakin-1                              73.2    1e-12   
ref|XP_009404981.1|  PREDICTED: peamaclein-like                       73.2    1e-12   
ref|XP_011038137.1|  PREDICTED: gibberellin-regulated protein 2       73.2    1e-12   
ref|NP_001240204.1|  uncharacterized protein LOC100788586 precursor   73.2    1e-12   
ref|XP_010467274.1|  PREDICTED: gibberellin-regulated protein 7-like  73.2    1e-12   
ref|NP_001288532.1|  uncharacterized protein LOC103630300             74.3    1e-12   
gb|EYU25492.1|  hypothetical protein MIMGU_mgv1a017072mg              72.8    1e-12   
ref|XP_010517902.1|  PREDICTED: gibberellin-regulated protein 7       73.2    2e-12   
ref|XP_004496906.1|  PREDICTED: snakin-1-like                         72.4    2e-12   
ref|XP_010063765.1|  PREDICTED: gibberellin-regulated protein 2-like  72.8    2e-12   
ref|XP_010458411.1|  PREDICTED: gibberellin-regulated protein 8-like  72.4    2e-12   
ref|XP_002510126.1|  GAST1 protein precursor, putative                72.4    2e-12   
ref|XP_002965632.1|  hypothetical protein SELMODRAFT_84095            71.6    2e-12   
emb|CDX71072.1|  BnaC03g11560D                                        72.4    2e-12   
ref|NP_001055630.1|  Os05g0432200                                     72.4    2e-12   
gb|ABK22904.1|  unknown                                               72.8    2e-12   
ref|XP_006346618.1|  PREDICTED: snakin-1-like                         72.0    2e-12   
ref|XP_010556423.1|  PREDICTED: peamaclein                            72.4    2e-12   
ref|XP_010314649.1|  PREDICTED: gibberellin-regulated protein 1-like  72.8    2e-12   
ref|XP_006417449.1|  hypothetical protein EUTSA_v10009615mg           72.0    2e-12   
gb|ACJ68116.1|  hypothetical protein                                  72.0    2e-12   
gb|ACG25489.1|  gibberellin-regulated protein 2 precursor             72.4    2e-12   
ref|XP_008656256.1|  PREDICTED: uncharacterized protein LOC100286041  74.3    2e-12   



>gb|ABQ42002.1| gibberellin induced protein [Sonneratia caseolaris]
Length=117

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 95/118 (81%), Gaps = 6/118 (5%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQ----NQASMAAHSSTPQPLGNNRMYGVTEGSLRPQEC  606
            MAK+A++L +  F+ F+FV++      + + +AA+    Q    N+MYG++EGSLRPQEC
Sbjct  2    MAKLASILIL--FAAFLFVLLLDETKASSSGVAANELQLQGRDINKMYGISEGSLRPQEC  59

Query  605  SPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             P+C+ RCS T++KKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  60   GPRCTRRCSATSYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  117



>gb|ABQ42001.1| gibberellin induced protein [Sonneratia alba]
Length=117

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 95/118 (81%), Gaps = 6/118 (5%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQAS----MAAHSSTPQPLGNNRMYGVTEGSLRPQEC  606
            MAK+A++L +  F+ F+FV++ +   +    +AA+    Q    N+MYG++EGSLRPQEC
Sbjct  2    MAKLASILIL--FAAFLFVLLLEETEASSSVVAANELQLQGRDINKMYGISEGSLRPQEC  59

Query  605  SPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             P+C+ RCS T++KKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  60   GPRCTRRCSATSYKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  117



>gb|ABQ42003.1| gibberellin induced protein [Sonneratia ovata]
Length=117

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 94/118 (80%), Gaps = 6/118 (5%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQAS----MAAHSSTPQPLGNNRMYGVTEGSLRPQEC  606
            MAK+A++L +  F+ F+FV++     +    +AA+    Q    N+MYG++EGSLRPQEC
Sbjct  2    MAKLASILIL--FAAFLFVLLLDETKASSSVVAANELQLQGRDINKMYGISEGSLRPQEC  59

Query  605  SPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             P+C+ RCS T+FKKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  60   GPRCTRRCSATSFKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  117



>gb|ABQ42004.1| gibberellin induced protein [Sonneratia apetala]
Length=117

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 94/118 (80%), Gaps = 6/118 (5%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQAS----MAAHSSTPQPLGNNRMYGVTEGSLRPQEC  606
            MAK+A++L +  F+ F+FV++     +    +AA+    Q    N+MYG++EGSLRPQEC
Sbjct  2    MAKLASILIL--FAAFLFVLLLDETKASSSVVAANELQLQGRDINKMYGISEGSLRPQEC  59

Query  605  SPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             P+C+ RCS T++KKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  60   GPRCTRRCSATSYKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  117



>gb|KDP22135.1| hypothetical protein JCGZ_25966 [Jatropha curcas]
Length=115

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = -2

Query  761  ATMLTILKFSIFIFVIMFQNQASMAAH--SSTPQPLGNNRMYGVTEGSLRPQECSPKCSF  588
            A  + +L F++ + V++ +NQA   A   +S PQ  G N MYG T+GSLRPQEC P+C+ 
Sbjct  4    AISIVMLCFALIMLVLLEENQAFNTAGILASQPQGKGKNAMYGATQGSLRPQECGPRCTT  63

Query  587  RCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            RCS TA+KKPC+FFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  64   RCSATAYKKPCMFFCQKCCAKCLCVPPGTYGNKQYCPCYNNWKTKRGGPKCP  115



>ref|XP_008240742.1| PREDICTED: protein GAST1 [Prunus mume]
Length=116

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 87/116 (75%), Gaps = 2/116 (2%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNR--MYGVTEGSLRPQECSP  600
            M  MA  L I+   + +  ++ +N A+    +  PQP G+N   M G+TEGSL+PQEC P
Sbjct  1    MMAMARTLRIVLSLVMLHFLIVENHATTITEAPAPQPQGSNNHTMNGITEGSLQPQECGP  60

Query  599  KCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +CS RCS T +KKPCLFFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   RCSTRCSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  116



>emb|CDP08494.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHS-STPQPLG-NNRMYGVTEGSLRPQECSPKCS  591
            MAT  T L    F+ +I+ QNQAS    S S  QP   N R YG+ EGSLRPQEC  +C 
Sbjct  1    MATKATFLLCLAFVLLILAQNQASSVGLSISQHQPKALNARQYGIIEGSLRPQECGARCD  60

Query  590  FRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             RCSKTA+KKPC+ FCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  61   TRCSKTAYKKPCMSFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  113



>ref|XP_011080381.1| PREDICTED: protein GAST1-like [Sesamum indicum]
Length=112

 Score =   157 bits (398),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 3/113 (3%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQ--PLGNNRMYGVTEGSLRPQECSPKCS  591
            MAT L  L + +F+  I+ Q QAS AA  ++ Q  P G+ + YG +EGSLRPQ+C  KC+
Sbjct  1    MATKLAFLFYLLFVATILAQKQASSAAVPASDQLHPQGSLQ-YGTSEGSLRPQDCPSKCT  59

Query  590  FRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +RCSKT+FKKPC+ FCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  60   YRCSKTSFKKPCMLFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  112



>ref|XP_006491553.1| PREDICTED: protein GAST1-like [Citrus sinensis]
 gb|KDO41045.1| hypothetical protein CISIN_1g033495mg [Citrus sinensis]
Length=118

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 90/118 (76%), Gaps = 7/118 (6%)
 Frame = -2

Query  764  MATMLTILKFS-IFIFVIMFQNQASMAAHSSTPQPL------GNNRMYGVTEGSLRPQEC  606
            MA+ L+++ FS + IF+ + +N A+    + TPQP       GN+  YG T+GSL+PQEC
Sbjct  1    MASKLSVVAFSLVLIFLFLVENHATSIVEAPTPQPAESSGRNGNHSTYGTTQGSLQPQEC  60

Query  605  SPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             P+C+ RCSKT ++KPCLFFCQKCCAKCLCVP G YGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   GPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP  118



>ref|XP_009775224.1| PREDICTED: protein GAST1-like [Nicotiana sylvestris]
Length=112

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 3/113 (3%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTP--QPLGNNRMYGVTEGSLRPQECSPKCS  591
            MA  L+I+ F I + V + QNQ S A     P  Q   NN+MYGV++GSL PQ+C PKC+
Sbjct  1    MAGKLSIVLFVILV-VFLAQNQVSRAKLVLDPKLQTQRNNQMYGVSQGSLHPQDCLPKCT  59

Query  590  FRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +RCS+T+FKKPC+FFCQKCC+KCLCVPPGTYGNKQ CPCYNNWKTK GGPKCP
Sbjct  60   YRCSQTSFKKPCMFFCQKCCSKCLCVPPGTYGNKQTCPCYNNWKTKEGGPKCP  112



>ref|XP_007216796.1| hypothetical protein PRUPE_ppa023616mg [Prunus persica]
 gb|EMJ17995.1| hypothetical protein PRUPE_ppa023616mg [Prunus persica]
Length=114

 Score =   155 bits (391),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = -2

Query  758  TMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNR--MYGVTEGSLRPQECSPKCSFR  585
            T+  ++   + +  ++ +N A+  A +  PQP G+N   M G+TEGSL+PQEC P+CS R
Sbjct  4    TLRIVMLCLVMLHFLIVENHATTIAEAPAPQPQGSNNHTMSGITEGSLQPQECGPRCSTR  63

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T +KKPCLFFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  64   CSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  114



>ref|XP_006421229.1| hypothetical protein CICLE_v10006243mg [Citrus clementina]
 gb|ESR34469.1| hypothetical protein CICLE_v10006243mg [Citrus clementina]
Length=118

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 7/118 (6%)
 Frame = -2

Query  764  MATMLTILKFS-IFIFVIMFQNQASMAAHSSTPQPL------GNNRMYGVTEGSLRPQEC  606
            MA+ L+++ FS + IF+ + +N A+    + TPQP       GN+  YG T+GSL+PQEC
Sbjct  1    MASKLSVVAFSLVLIFLFLVENHATSIVEAPTPQPAESSGRNGNHSTYGTTQGSLQPQEC  60

Query  605  SPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             P+C+ RCSKT ++KPCL FCQKCCAKCLCVP G YGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   GPRCTTRCSKTQYRKPCLVFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP  118



>gb|AEC10958.1| gibberellin induced protein [Camellia sinensis]
Length=113

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -2

Query  749  TILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTA  570
             IL F + + ++    QAS        Q  GNN+MYGVT+GSLRPQEC  +C+ RC+KTA
Sbjct  8    AILCFVLMLGLLAENLQASFELQLQVFQLQGNNQMYGVTQGSLRPQECGARCTGRCAKTA  67

Query  569  FKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +KKPC+ FCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  68   YKKPCMSFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  113



>ref|XP_008344997.1| PREDICTED: protein GAST1-like [Malus domestica]
Length=115

 Score =   152 bits (384),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 90/115 (78%), Gaps = 4/115 (3%)
 Frame = -2

Query  764  MAT-MLTILKFSI-FIFVIMFQNQASMAAHSST--PQPLGNNRMYGVTEGSLRPQECSPK  597
            MAT +L+I+   +  I V++  N+ +    +S    Q  GN + YG T+GSLRPQEC+P+
Sbjct  1    MATKLLSIVMLCVALILVLLEPNRGASTVETSAFQQQRQGNYQPYGTTQGSLRPQECAPR  60

Query  596  CSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            C+ RCS TA+KKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  61   CTSRCSATAYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  115



>ref|XP_008244953.1| PREDICTED: protein GAST1-like [Prunus mume]
Length=112

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = -2

Query  764  MATMLTILKFSI--FIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCS  591
            MA  L+I  F +   + V++  NQAS    S+  Q   N + YG T+GSLRPQEC P+C+
Sbjct  1    MAFKLSIFMFCVAALMLVLLEGNQASTVEISALQQ-QENYQPYGTTQGSLRPQECGPRCT  59

Query  590  FRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             RCS TA+KKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  60   TRCSATAYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  112



>ref|XP_011045379.1| PREDICTED: protein GAST1-like [Populus euphratica]
Length=113

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = -2

Query  707  QNQA-SMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCC  531
            QNQA      +S PQ  GN+ MYG T+GSLRPQEC+P+C+ RCS TA+KKPCLFFCQKCC
Sbjct  21   QNQALKTPISASQPQRQGNHAMYGATQGSLRPQECAPRCTTRCSATAYKKPCLFFCQKCC  80

Query  530  AKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            AKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  81   AKCLCVPPGTYGNKQSCPCYNNWKTKRGGPKCP  113



>ref|XP_009337038.1| PREDICTED: protein GAST1-like [Pyrus x bretschneideri]
Length=115

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = -2

Query  755  MLTILKFSI-FIFVIMFQNQASMAAHSST--PQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            +L+I    +  I V +  NQ +    +S    Q  GN++ YG T+GSLRPQEC+P+C+ R
Sbjct  5    LLSIFMLCVALILVFLEPNQGASTVETSAFQQQRQGNHQPYGTTQGSLRPQECAPRCTSR  64

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS TA+KKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  65   CSATAYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  115



>ref|XP_010558231.1| PREDICTED: protein GAST1 [Tarenaya hassleriana]
Length=119

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPL--------GNNRMYGVTEGSLRPQE  609
            MAT L    FS+ +F+++   Q     HS  P P          NN  YG T+GSL+PQE
Sbjct  1    MATKLQTSVFSVAVFMLLMLVQTHATDHSEAPSPQLLQPPQSNTNNSQYGTTQGSLQPQE  60

Query  608  CSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            C  +C  RCS+T +KKPCLFFC KCC KCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  61   CRGRCEGRCSRTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  119



>ref|XP_008392374.1| PREDICTED: protein GAST1 isoform X2 [Malus domestica]
Length=116

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 82/116 (71%), Gaps = 8/116 (7%)
 Frame = -2

Query  755  MLTILKFSIFIFVIMF--------QNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSP  600
            M   L F +F  VI+F         N     A +  PQ   N+ M G+TEGSL+PQEC P
Sbjct  1    MARALNFVMFFLVILFFALTVENHANATGTEAPAPQPQSSNNHTMNGITEGSLQPQECGP  60

Query  599  KCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +C+ RCS T +KKPCLFFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   RCTTRCSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  116



>gb|AAW83819.1| GASA2-like protein [Pelargonium zonale]
Length=117

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = -2

Query  761  ATMLTILKFSIFIFVIMFQNQ---ASMAAHSSTPQP--LGNNRMYGVTEGSLRPQECSPK  597
            A  L I+ F + I  ++ Q+    +S    + +PQP    N+ MYG+TEGSL+PQEC P+
Sbjct  3    AKKLCIVIFPLVIMFLLLQDNFATSSSITEAPSPQPHSQSNHTMYGITEGSLQPQECGPR  62

Query  596  CSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS RCS T +KKPCLFFC KCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  63   CSERCSNTQYKKPCLFFCNKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  117



>ref|XP_008392373.1| PREDICTED: protein GAST1 isoform X1 [Malus domestica]
Length=117

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 82/117 (70%), Gaps = 9/117 (8%)
 Frame = -2

Query  755  MLTILKFSIFIFVIMF---------QNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECS  603
            M   L F +F  VI+F          N     A +  PQ   N+ M G+TEGSL+PQEC 
Sbjct  1    MARALNFVMFFLVILFFALTVENHQANATGTEAPAPQPQSSNNHTMNGITEGSLQPQECG  60

Query  602  PKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            P+C+ RCS T +KKPCLFFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   PRCTTRCSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  117



>ref|XP_002298301.2| hypothetical protein POPTR_0001s26100g, partial [Populus trichocarpa]
 gb|EEE83106.2| hypothetical protein POPTR_0001s26100g, partial [Populus trichocarpa]
Length=136

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = -2

Query  824  ISLLIIQFLCVSFFLSSMAKMATMLTILKFSIFIFVIMFQNQA-SMAAHSSTPQPLGNNR  648
            +S  I   L    FL +     + + I   S+ + V++ QNQA      +S  Q  GN+ 
Sbjct  5    LSHPIPTHLLYCSFLPTKKMGKSSIAIFLCSLLVLVLLGQNQALKTPISASQTQRQGNHA  64

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            MYG T+GSLRPQEC+P+C+ RCS TA+KKPCLFFCQKCCAKCLCVPPGTYGNKQ CPCYN
Sbjct  65   MYGATQGSLRPQECAPRCTTRCSATAYKKPCLFFCQKCCAKCLCVPPGTYGNKQSCPCYN  124

Query  467  NWKTKRGGPKCP  432
            NWKTKRGGPKCP
Sbjct  125  NWKTKRGGPKCP  136



>ref|XP_011075384.1| PREDICTED: protein GAST1-like [Sesamum indicum]
Length=114

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = -2

Query  746  ILKFSIFIFVIMFQNQASMA-AHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTA  570
            IL F + +F++   N A++  + +  PQP G   MYG T GSL+PQEC  +C+ RCSKTA
Sbjct  9    ILCFLLIMFLLAVHNHATIVESPTPQPQPSGGFPMYGATPGSLQPQECGRRCTTRCSKTA  68

Query  569  FKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            FKKPC+FFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  69   FKKPCMFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  114



>ref|XP_008464949.1| PREDICTED: protein GAST1-like [Cucumis melo]
Length=117

 Score =   150 bits (378),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = -2

Query  755  MLTILKFSIFIF--VIMFQNQASMAAHSSTPQPLGN--NRMYGVTEGSLRPQECSPKCSF  588
            ++ IL F + +   V++  NQA   A +  PQ   N  N M+GVTEGSL+PQEC P+C+ 
Sbjct  6    IIEILLFVVMLLNCVLLAHNQAISEAPTPQPQTSANYSNPMHGVTEGSLQPQECGPRCTG  65

Query  587  RCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            RCSKTAFKKPC+FFCQKCCAKCLCVP GTYGNKQ CPCYN WKTKRGGPKCP
Sbjct  66   RCSKTAFKKPCMFFCQKCCAKCLCVPYGTYGNKQTCPCYNQWKTKRGGPKCP  117



>gb|AAG43509.1|AF210049_1 gibberellin-induced protein 1 [Petunia x hybrida]
 emb|CAD10103.1| putative gibberellin induced protein 2 [Petunia x hybrida]
Length=112

 Score =   149 bits (377),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 79/94 (84%), Gaps = 2/94 (2%)
 Frame = -2

Query  707  QNQASMAAH--SSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKC  534
            QNQ SMA     S  Q  GN+++YGV++GSL PQ+C PKC++RCSKT+FKKPC+FFCQKC
Sbjct  19   QNQVSMAKKVLDSKVQRRGNDQIYGVSQGSLHPQDCQPKCTYRCSKTSFKKPCMFFCQKC  78

Query  533  CAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CAKCLCVP GTYGNKQ CPCYNNWKTK GGPKCP
Sbjct  79   CAKCLCVPAGTYGNKQTCPCYNNWKTKEGGPKCP  112



>ref|XP_006470710.1| PREDICTED: protein GAST1-like [Citrus sinensis]
Length=113

 Score =   149 bits (377),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -2

Query  764  MATMLTILK-FSIFIFVIMFQNQASMAAHSSTP-QPLGNNRMYGVTEGSLRPQECSPKCS  591
            MA ML I+  F   + V++ QNQA+    ++   QP GN    G T+GSL PQEC+PKC 
Sbjct  1    MARMLRIVVLFVALMVVLVAQNQAAGTGIAAPQLQPQGNRPARGTTQGSLNPQECAPKCD  60

Query  590  FRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +RCS T++KKPCLFFCQKCCAKCLCVP GT GNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   YRCSATSYKKPCLFFCQKCCAKCLCVPAGTNGNKQTCPCYNNWKTKRGGPKCP  113



>ref|XP_009347627.1| PREDICTED: protein GAST1-like [Pyrus x bretschneideri]
Length=116

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 85/116 (73%), Gaps = 8/116 (7%)
 Frame = -2

Query  755  MLTILKFSIFIFVIMF-----QNQASMA---AHSSTPQPLGNNRMYGVTEGSLRPQECSP  600
            M   L F +F  V++F     +N A+     A +  PQ   N+ M G+TEGSL+PQEC P
Sbjct  1    MARALNFVMFFLVMLFFALTVENHATTTGTEAPAPQPQSSNNHTMNGITEGSLQPQECGP  60

Query  599  KCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +C+ RCS T +KKPCLFFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   RCTTRCSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  116



>gb|AFH57279.1| GASA-like protein [Gossypium hirsutum]
 gb|AGE15503.1| GA-stimulated transcript-like protein 7 [Gossypium hirsutum]
 gb|KHG14864.1| Protein GAST1 [Gossypium arboreum]
Length=111

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA  L I+     + +++     + +      Q    N MYG T+GSLRPQEC P+C+ R
Sbjct  1    MAKSLVIVMLCFLLVIVLLGEIQASSPSQKQRQGNHGNGMYGATQGSLRPQECGPRCTQR  60

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS TA+KKPC+FFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   CSATAYKKPCMFFCQKCCAKCLCVPPGTYGNKQSCPCYNNWKTKRGGPKCP  111



>emb|CAD10104.1| gibberellin induced protein 3 [Petunia x hybrida]
Length=112

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 3/113 (3%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAH--SSTPQPLGNNRMYGVTEGSLRPQECSPKCS  591
            MA  L+I+ F + + ++  QNQ SMA     +  Q  GN+++YGV++GSL PQ+C PKC+
Sbjct  1    MAGKLSIILFVLLVVLLA-QNQVSMAKMVLDAKVQRRGNDQIYGVSQGSLHPQDCQPKCT  59

Query  590  FRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +RCSKT+FKKPC+FFCQKCCAKCLCVP GTYGNKQ CPCYNNWKTK GGPKCP
Sbjct  60   YRCSKTSFKKPCMFFCQKCCAKCLCVPAGTYGNKQTCPCYNNWKTKEGGPKCP  112



>ref|XP_006446220.1| hypothetical protein CICLE_v10017244mg [Citrus clementina]
 gb|ESR59460.1| hypothetical protein CICLE_v10017244mg [Citrus clementina]
Length=113

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = -2

Query  764  MATMLT-ILKFSIFIFVIMFQNQASMAA-HSSTPQPLGNNRMYGVTEGSLRPQECSPKCS  591
            MA ML  ++ F   + V++ QNQA+     +S  Q  GN    G T+GSL  QEC+PKC 
Sbjct  1    MARMLRLVVLFVALMLVLVAQNQAAGTGIAASQLQAQGNRPARGTTQGSLNHQECAPKCD  60

Query  590  FRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +RCS T++KKPCLFFCQKCCAKCLCVP GTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   YRCSATSYKKPCLFFCQKCCAKCLCVPAGTYGNKQTCPCYNNWKTKRGGPKCP  113



>gb|KDO50409.1| hypothetical protein CISIN_1g033715mg [Citrus sinensis]
Length=113

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = -2

Query  764  MATMLT-ILKFSIFIFVIMFQNQAS-MAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCS  591
            MA ML  ++ F   + V++ QNQA+     +S  Q  GN    G T+GSL  QEC+PKC 
Sbjct  1    MARMLRLVVLFVALMLVLVAQNQAAGTGIAASQLQAQGNRPARGTTQGSLNHQECAPKCH  60

Query  590  FRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +RCS T++KKPCLFFCQKCCAKCLCVP GTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   YRCSATSYKKPCLFFCQKCCAKCLCVPAGTYGNKQTCPCYNNWKTKRGGPKCP  113



>ref|XP_004493436.1| PREDICTED: protein GAST1-like [Cicer arietinum]
Length=120

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 87/120 (73%), Gaps = 9/120 (8%)
 Frame = -2

Query  764  MATMLTILKFS-IFIFVIMFQNQASMAA---HSSTPQPLGNNRM-----YGVTEGSLRPQ  612
            MA  L I+    + IF++  QN   +      + +PQP  N+       +G+TEGSL+PQ
Sbjct  1    MARKLCIVILCLVAIFLLPLQNHGEIVVSTVETPSPQPSKNSTTTQFPNHGITEGSLQPQ  60

Query  611  ECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            EC P+CS RCS T +KKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  61   ECGPRCSNRCSNTQYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  120



>ref|XP_003554146.1| PREDICTED: protein GAST1-like isoform 1 [Glycine max]
Length=137

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 6/99 (6%)
 Frame = -2

Query  710  FQNQASMAAHSSTPQPLGN------NRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLF  549
             +N     +H+  PQP  N      N  +G+TEGSL+PQEC P+C+ RCS T +KKPCLF
Sbjct  39   HKNTTHTLSHAPAPQPHKNTKSPVPNLQHGITEGSLKPQECGPRCTARCSNTQYKKPCLF  98

Query  548  FCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            FCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  99   FCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  137



>emb|CAA60677.1| gip1 [Petunia x hybrida]
Length=112

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 2/94 (2%)
 Frame = -2

Query  707  QNQASMAAH--SSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKC  534
            QNQ S A     S  Q  GN+++YGV++GSL PQ+C PKC++RCSKT+FKKPC+FFCQKC
Sbjct  19   QNQVSRAKMVLDSKVQRRGNDQIYGVSQGSLHPQDCQPKCTYRCSKTSFKKPCMFFCQKC  78

Query  533  CAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CAKCLCVP GTYGNKQ CPCYNNWKTK GGPKCP
Sbjct  79   CAKCLCVPAGTYGNKQTCPCYNNWKTKEGGPKCP  112



>ref|XP_003632726.1| PREDICTED: protein GAST1 [Vitis vinifera]
 emb|CAN80098.1| hypothetical protein VITISV_028566 [Vitis vinifera]
Length=114

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNR---MYGVTEGSLRPQECSPKC  594
            MA  L+I+  S+ + +++     +    + TPQP  +     M+GVT+GSL PQEC+P+C
Sbjct  1    MARKLSIVMLSLSMMLLLLVQNNATITEAPTPQPQQSTNGFPMHGVTQGSLHPQECAPRC  60

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCSKTA+KKPC+FFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   TTRCSKTAYKKPCMFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  114



>gb|ACS68670.1| gibberellin induced protein [Sonneratia alba]
 gb|ACS68740.1| gibberellin induced protein [Sonneratia alba]
Length=105

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = -2

Query  737  FSIFIFVIMFQNQAS----MAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTA  570
            F+ F+FV++ +   +    +AA+    Q    N+MYG++EGSLRPQEC P+C+ RCS T+
Sbjct  5    FAAFLFVLLLEETEASSSVVAANELQLQGRDINKMYGISEGSLRPQECGPRCTRRCSATS  64

Query  569  FKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRG  447
            +KKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRG
Sbjct  65   YKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRG  105



>ref|XP_004158330.1| PREDICTED: protein GAST1-like [Cucumis sativus]
Length=117

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 85/116 (73%), Gaps = 4/116 (3%)
 Frame = -2

Query  767  KMATMLTILKFSIFIF--VIMFQNQASMAAHSSTPQPLGN--NRMYGVTEGSLRPQECSP  600
            +   ++ IL F + +   V++  N A   A +  PQ   N  N M+GVTEGSL+PQEC  
Sbjct  2    RRKQVIEILLFVVMLLNCVLLVHNLAISEAPTPQPQTSSNYSNPMHGVTEGSLQPQECGA  61

Query  599  KCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +C+ RCSKTAFKKPC+FFCQKCCAKCLCVP GTYGNKQ CPCYN WKTKRGGPKCP
Sbjct  62   RCTGRCSKTAFKKPCMFFCQKCCAKCLCVPYGTYGNKQTCPCYNQWKTKRGGPKCP  117



>gb|EYU18662.1| hypothetical protein MIMGU_mgv1a016553mg [Erythranthe guttata]
Length=117

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -2

Query  680  SSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGT  501
            +  PQP G   MYG T GSL+PQEC P+CS RCSKTAFKKPC+FFCQKCC KCLCVPPGT
Sbjct  35   APQPQPPGTYPMYGATPGSLQPQECGPRCSVRCSKTAFKKPCMFFCQKCCGKCLCVPPGT  94

Query  500  YGNKQVCPCYNNWKTKRGGPKCP  432
            YGNKQ CPCYNNWKTKRGGPKCP
Sbjct  95   YGNKQFCPCYNNWKTKRGGPKCP  117



>ref|XP_007028593.1| Gibberellin-regulated family protein [Theobroma cacao]
 gb|EOY09095.1| Gibberellin-regulated family protein [Theobroma cacao]
Length=114

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = -2

Query  764  MATMLTI-LKFSIFIFVIMFQNQASMAAHSSTPQPL--GNNRMYGVTEGSLRPQECSPKC  594
            M   LTI + F + + +++ QN AS    +  PQP    N   +G+T+GSL PQEC P+C
Sbjct  1    MTGKLTIVMYFLVIMLLLLAQNNASSIKEAPAPQPQPPSNFTRHGITQGSLHPQECGPRC  60

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +FRCSKT ++KPCLFFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   TFRCSKTQYRKPCLFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  114



>ref|XP_010246225.1| PREDICTED: protein GAST1-like [Nelumbo nucifera]
Length=115

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 84/114 (74%), Gaps = 10/114 (9%)
 Frame = -2

Query  758  TMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNR-----MYGVTEGSLRPQECSPKC  594
            T++  L   + I +I  Q     AA ++T  P    +     MYG T+GSL+PQEC+P+C
Sbjct  7    TLMLCLVTMMLILLIEVQ-----AAKTTTEPPAAEPQSATFHMYGATQGSLQPQECAPRC  61

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCS TA+KKPC+FFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  62   TARCSATAYKKPCMFFCQKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  115



>ref|XP_009414177.1| PREDICTED: gibberellin-regulated protein 5-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=132

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 80/103 (78%), Gaps = 6/103 (6%)
 Frame = -2

Query  722  FVIMFQNQASMAAHSSTPQPLGNNR------MYGVTEGSLRPQECSPKCSFRCSKTAFKK  561
            F+++ Q + S+A  +    PLG         MYG T GSL+PQECS +C+ RCS TA+KK
Sbjct  30   FLLVVQGRISLAPTAQPGNPLGPTPQPIKFPMYGATPGSLQPQECSGRCAGRCSATAYKK  89

Query  560  PCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            PC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  90   PCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  132



>emb|CBI30071.3| unnamed protein product [Vitis vinifera]
Length=106

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 4/96 (4%)
 Frame = -2

Query  710  FQNQASMAAHSSTPQPLGNNR---MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQ  540
             QN A++   + TPQP  +     M+GVT+GSL PQEC+P+C+ RCSKTA+KKPC+FFCQ
Sbjct  12   VQNNATIT-EAPTPQPQQSTNGFPMHGVTQGSLHPQECAPRCTTRCSKTAYKKPCMFFCQ  70

Query  539  KCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            KCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  71   KCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  106



>ref|XP_009414179.1| PREDICTED: gibberellin-regulated protein 5-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=121

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 86/118 (73%), Gaps = 8/118 (7%)
 Frame = -2

Query  767  KMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNR------MYGVTEGSLRPQEC  606
            ++A +L ++   +   VI  Q + S+A  +    PLG         MYG T GSL+PQEC
Sbjct  6    RVAILLCMV--VLHCLVIQAQGRISLAPTAQPGNPLGPTPQPIKFPMYGATPGSLQPQEC  63

Query  605  SPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            S +C+ RCS TA+KKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  64   SGRCAGRCSATAYKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  121



>ref|XP_002530088.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF32287.1| GAST1 protein precursor, putative [Ricinus communis]
Length=116

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (74%), Gaps = 7/117 (6%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMF----QNQASMAAHSSTPQPLGNNRM--YGVTEGSLRPQECS  603
            M  M+    F++F+  +M     ++ AS  + +  PQP  N+ +  YG T+GSL+PQ+C 
Sbjct  1    MMMMMRKASFAMFVLALMLLFILESHAS-TSEAPAPQPQQNSSLPKYGSTQGSLQPQDCG  59

Query  602  PKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            P+C+ RCSKT + KPC+FFCQKCCAKCLCVP GTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  60   PQCTRRCSKTQYHKPCMFFCQKCCAKCLCVPSGTYGNKQTCPCYNNWKTKRGGPKCP  116



>gb|KDP26211.1| hypothetical protein JCGZ_22457 [Jatropha curcas]
Length=118

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 10/121 (8%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAA-------HSSTPQPLGNNRMYGVTEGSLRP  615
            M K +  +++L   + +F+ + QN A++             P    +N  +G TEGSL P
Sbjct  1    MKKASIAMSVL---VLMFLTVVQNNANITEVPSPQPQPQPQPNHNHDNPTHGTTEGSLHP  57

Query  614  QECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKC  435
            QEC+P+CS RCSKT +KKPCLFFCQKCCAKCLCVP GTYGNKQ CPCYNNWKTKRGGPKC
Sbjct  58   QECAPRCSTRCSKTQYKKPCLFFCQKCCAKCLCVPEGTYGNKQSCPCYNNWKTKRGGPKC  117

Query  434  P  432
            P
Sbjct  118  P  118



>ref|XP_010673717.1| PREDICTED: protein GAST1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=111

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 81/111 (73%), Gaps = 2/111 (2%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            M+  +++L +   + +++  NQA   +          + M G ++GSL PQEC P+C+ R
Sbjct  3    MSRNISLLLYVTLMLIVLTANQAESQSSQPQI--QSGHSMQGASQGSLHPQECGPRCTMR  60

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T +KKPCLFFCQKCCAKCLCVPPGTYGNKQ+CPCYNNWKTKRGGPKCP
Sbjct  61   CSATQYKKPCLFFCQKCCAKCLCVPPGTYGNKQLCPCYNNWKTKRGGPKCP  111



>ref|XP_010273304.1| PREDICTED: uncharacterized protein LOC104608881 isoform X2 [Nelumbo 
nucifera]
Length=787

 Score =   153 bits (387),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%), Gaps = 7/121 (6%)
 Frame = -2

Query  779  SSMAKMATMLTILKFSIFIFVIMFQNQASMAAH-----SSTPQPLGNNRMYGVTEGSLRP  615
            S+MA+  + L +   +I + V++ + Q S+ A      ++ PQP   N MYG T+GSL P
Sbjct  669  SAMARKPSTLMLCVLTILL-VLLREIQGSIIATKTEAPAAEPQPATLN-MYGATQGSLHP  726

Query  614  QECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKC  435
            QEC+P+C+ RCS TA+KKPC+FFCQKCCA+CLCVPPGTYGNKQ CPCYNNWKTKRGGPKC
Sbjct  727  QECAPRCTARCSATAYKKPCMFFCQKCCAECLCVPPGTYGNKQFCPCYNNWKTKRGGPKC  786

Query  434  P  432
            P
Sbjct  787  P  787



>ref|XP_009619459.1| PREDICTED: protein GAST1-like [Nicotiana tomentosiformis]
Length=112

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = -2

Query  707  QNQASMA--AHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKC  534
            QNQ S A     S  Q   N +MYGV++GSL PQ+C PKC++RCS+T+FKKPC+FFCQKC
Sbjct  19   QNQVSRAKLVLDSKLQTQRNYQMYGVSQGSLHPQDCLPKCTYRCSQTSFKKPCMFFCQKC  78

Query  533  CAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            C+KCLCVPPGTYGNKQ CPCYNNWKTK GGPKCP
Sbjct  79   CSKCLCVPPGTYGNKQTCPCYNNWKTKEGGPKCP  112



>ref|XP_010273303.1| PREDICTED: uncharacterized protein LOC104608881 isoform X1 [Nelumbo 
nucifera]
Length=810

 Score =   154 bits (388),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%), Gaps = 7/121 (6%)
 Frame = -2

Query  779  SSMAKMATMLTILKFSIFIFVIMFQNQASMAAH-----SSTPQPLGNNRMYGVTEGSLRP  615
            S+MA+  + L +   +I + V++ + Q S+ A      ++ PQP   N MYG T+GSL P
Sbjct  692  SAMARKPSTLMLCVLTILL-VLLREIQGSIIATKTEAPAAEPQPATLN-MYGATQGSLHP  749

Query  614  QECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKC  435
            QEC+P+C+ RCS TA+KKPC+FFCQKCCA+CLCVPPGTYGNKQ CPCYNNWKTKRGGPKC
Sbjct  750  QECAPRCTARCSATAYKKPCMFFCQKCCAECLCVPPGTYGNKQFCPCYNNWKTKRGGPKC  809

Query  434  P  432
            P
Sbjct  810  P  810



>gb|KHG09441.1| Protein GAST1 [Gossypium arboreum]
Length=119

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -2

Query  704  NQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAK  525
            ++ S  A +   QP GN  M+G+T+GSL PQEC P+C  RCS T +KKPCLFFC KCCAK
Sbjct  29   HEMSREAPAPQAQPPGNFTMHGITQGSLLPQECGPRCGERCSNTQYKKPCLFFCNKCCAK  88

Query  524  CLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP
Sbjct  89   CLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  119



>ref|XP_007212837.1| hypothetical protein PRUPE_ppa020764mg [Prunus persica]
 gb|EMJ14036.1| hypothetical protein PRUPE_ppa020764mg [Prunus persica]
Length=95

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  644  YGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            YG T+GSLRPQEC P+C+ RCS TA+KKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN
Sbjct  25   YGTTQGSLRPQECGPRCTTRCSATAYKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  84

Query  464  WKTKRGGPKCP  432
            WKTKRGGPKCP
Sbjct  85   WKTKRGGPKCP  95



>ref|XP_003625068.1| Gibberellin induced protein [Medicago truncatula]
 gb|ABD33300.1| Gibberellin regulated protein [Medicago truncatula]
 gb|AES81286.1| GASA/GAST/Snakin [Medicago truncatula]
Length=120

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 84/116 (72%), Gaps = 8/116 (7%)
 Frame = -2

Query  755  MLTILKFSIFIFVIMFQNQASMAA---HSSTPQPL---GNNRM--YGVTEGSLRPQECSP  600
            M  ++ F + + ++  QN A +      +  PQP    G N+   +G+TEGSL+PQEC P
Sbjct  5    MCIVVLFLVQMLLLPLQNHAEIVVSTVEAPAPQPSKSSGTNQFPNHGITEGSLQPQECGP  64

Query  599  KCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +C+ RCS T +KKPCLFFC KCCAKCLCVPPG YGNKQVCPCYNNWKTKRGGPKCP
Sbjct  65   RCTNRCSNTQYKKPCLFFCNKCCAKCLCVPPGYYGNKQVCPCYNNWKTKRGGPKCP  120



>ref|XP_009123090.1| PREDICTED: gibberellin-regulated protein 13-like [Brassica rapa]
Length=128

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 83/127 (65%), Gaps = 13/127 (10%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASM-------------AAHSSTPQPLGNNRMYGVT  633
            ++KMAT L  +  SI +F ++   Q  M                S    P  N+  YG T
Sbjct  2    LSKMATNLNTIFLSIVMFHLVLSAQTQMHPIHLESPAPQPHPPQSQPQTPHHNSSQYGTT  61

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
            EGSL+PQEC P+C  RCS T +KKPCLFFC KCCAKCLCVPPGTYGNKQVCPCYNNWKT+
Sbjct  62   EGSLQPQECGPRCGDRCSNTKYKKPCLFFCNKCCAKCLCVPPGTYGNKQVCPCYNNWKTQ  121

Query  452  RGGPKCP  432
             GGPKCP
Sbjct  122  LGGPKCP  128



>gb|KGN59726.1| hypothetical protein Csa_3G841990 [Cucumis sativus]
Length=103

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = -2

Query  719  VIMFQNQASMAAHSSTPQPLGN--NRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFF  546
            V++  N A   A +  PQ   N  N M+GVTEGSL+PQEC  +C+ RCSKTAFKKPC+FF
Sbjct  6    VLLVHNLAISEAPTPQPQTSSNYSNPMHGVTEGSLQPQECGARCTGRCSKTAFKKPCMFF  65

Query  545  CQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CQKCCAKCLCVP GTYGNKQ CPCYN WKTKRGGPKCP
Sbjct  66   CQKCCAKCLCVPYGTYGNKQTCPCYNQWKTKRGGPKCP  103



>ref|XP_007162142.1| hypothetical protein PHAVU_001G127700g [Phaseolus vulgaris]
 gb|ESW34136.1| hypothetical protein PHAVU_001G127700g [Phaseolus vulgaris]
Length=144

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 71/83 (86%), Gaps = 3/83 (4%)
 Frame = -2

Query  671  PQPLGNNRMY---GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGT  501
            PQP  N   +   G+TEGSL+PQEC P+C+ RCS T +KKPCLFFCQKCCAKCLCVPPGT
Sbjct  62   PQPDKNTTHFPNRGITEGSLKPQECGPRCTGRCSNTQYKKPCLFFCQKCCAKCLCVPPGT  121

Query  500  YGNKQVCPCYNNWKTKRGGPKCP  432
            YGNKQVCPCYNNWKTKRGGPKCP
Sbjct  122  YGNKQVCPCYNNWKTKRGGPKCP  144



>emb|CDP14204.1| unnamed protein product [Coffea canephora]
Length=116

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -2

Query  644  YGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            +G+T GSL PQECSP+C++RCSKTAFKKPC+FFCQKCCAKCLCVPPGTYGNKQ CPCYNN
Sbjct  46   HGITPGSLHPQECSPRCTYRCSKTAFKKPCMFFCQKCCAKCLCVPPGTYGNKQFCPCYNN  105

Query  464  WKTKRGGPKCP  432
            WKTKRGGPKCP
Sbjct  106  WKTKRGGPKCP  116



>gb|AFK49188.1| unknown [Lotus japonicus]
Length=118

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 84/118 (71%), Gaps = 7/118 (6%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIM-FQNQASMAA---HSSTPQPLGNNRM---YGVTEGSLRPQEC  606
            MA  L ++   +   +++  +N A +      + +PQP  N      +G+TEGSL+PQEC
Sbjct  1    MAKKLCLVILCLVQMLLLPVENHAEIVVTPIEAPSPQPANNTAQFPNHGITEGSLQPQEC  60

Query  605  SPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             P+C+ RCS T +KKPCLFFC KCCAKCLCVPPG YGNKQVCPCYNNWKTKRGGPKCP
Sbjct  61   GPRCANRCSNTQYKKPCLFFCNKCCAKCLCVPPGLYGNKQVCPCYNNWKTKRGGPKCP  118



>ref|XP_010481166.1| PREDICTED: gibberellin-regulated protein 13-like isoform X1 [Camelina 
sativa]
Length=123

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 83/129 (64%), Gaps = 24/129 (19%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPL------------------GNNRMYG  639
            MAT L+ + FSI +  ++      ++AH    QP+                   N+  YG
Sbjct  1    MATKLSTIVFSIVVLHLL------LSAHMHCTQPIRLESPAPQPQPPQSQPSHHNSSQYG  54

Query  638  VTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWK  459
             TEGSL+PQEC P+C  RCS T +KKPCLFFC KCC KCLCVPPGTYGNKQVCPCYNNWK
Sbjct  55   TTEGSLQPQECGPRCGDRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNWK  114

Query  458  TKRGGPKCP  432
            T+ GGPKCP
Sbjct  115  TQTGGPKCP  123



>emb|CDY22221.1| BnaC01g38800D [Brassica napus]
Length=128

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 82/127 (65%), Gaps = 13/127 (10%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASM-------------AAHSSTPQPLGNNRMYGVT  633
            ++KMAT L  +  SI +  ++   Q  M                S    P  N+  YG T
Sbjct  2    LSKMATNLNTIFLSIVMLHLVLSAQTEMHPKHLESPAPQPHPPQSQPQTPHHNSSQYGTT  61

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
            EGSL+PQEC P+C  RCS T +KKPCLFFC KCCAKCLCVPPGTYGNKQVCPCYNNWKT+
Sbjct  62   EGSLQPQECGPRCGDRCSNTKYKKPCLFFCNKCCAKCLCVPPGTYGNKQVCPCYNNWKTQ  121

Query  452  RGGPKCP  432
             GGPKCP
Sbjct  122  LGGPKCP  128



>ref|XP_010673718.1| PREDICTED: protein GAST1-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=110

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            M+  +++L +   + +++  NQA   +       + +    G ++GSL PQEC P+C+ R
Sbjct  3    MSRNISLLLYVTLMLIVLTANQAESQSSQPQ---IQSGHSMGASQGSLHPQECGPRCTMR  59

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T +KKPCLFFCQKCCAKCLCVPPGTYGNKQ+CPCYNNWKTKRGGPKCP
Sbjct  60   CSATQYKKPCLFFCQKCCAKCLCVPPGTYGNKQLCPCYNNWKTKRGGPKCP  110



>ref|XP_011027306.1| PREDICTED: protein GAST1-like [Populus euphratica]
Length=116

 Score =   139 bits (351),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 74/88 (84%), Gaps = 4/88 (5%)
 Frame = -2

Query  683  HSSTPQPLGN---NR-MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLC  516
             + TPQP  N   NR +YG T+GSL PQEC P+C+ RCSKTAFKKPC+FFCQKCCAKCLC
Sbjct  29   EAPTPQPQPNTNSNRPLYGTTQGSLNPQECGPRCTGRCSKTAFKKPCMFFCQKCCAKCLC  88

Query  515  VPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            VP GTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  89   VPAGTYGNKQSCPCYNNWKTKRGGPKCP  116



>ref|XP_010464684.1| PREDICTED: gibberellin-regulated protein 13-like [Camelina sativa]
Length=115

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQAS----MAAHSSTPQPLGNNRMYGVTEGSLRPQECSPK  597
            MAT L+   FSI +  ++           +       P  N+  YG TEGSL+PQEC P+
Sbjct  1    MATKLSTTVFSIVVLQLLLSAHMHPLHLESPAPQPQPPHHNSSQYGTTEGSLQPQECGPR  60

Query  596  CSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            C  RCS T +KKPCLFFC KCC KCLCVPPGTYGNKQVCPCYNNWKT+ GGPKCP
Sbjct  61   CGDRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNWKTQTGGPKCP  115



>ref|NP_001235028.1| uncharacterized protein LOC100500485 precursor [Glycine max]
 gb|ACU15584.1| unknown [Glycine max]
Length=138

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 87/138 (63%), Gaps = 27/138 (20%)
 Frame = -2

Query  764  MATMLTILKFSIF-IFVIMFQNQASMAAH-----------------SSTPQPLGN-----  654
            MA  L+I+   I  + +++ +N A +                    SS P PL +     
Sbjct  1    MARKLSIVVLCIVQMLLLLVENDAEIVVSTVEAPAPQPHKNTTHTLSSAPAPLPHTNTTK  60

Query  653  ----NRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQ  486
                N  +G+TEGSL+PQEC P+C+ RCS T +KKPCLFFCQKCCAKCLCV PGT+GNKQ
Sbjct  61   SHVPNLQHGITEGSLKPQECGPRCTARCSNTQYKKPCLFFCQKCCAKCLCVSPGTFGNKQ  120

Query  485  VCPCYNNWKTKRGGPKCP  432
            VCPCYNNWK KRGGPKCP
Sbjct  121  VCPCYNNWKIKRGGPKCP  138



>ref|XP_002308912.2| hypothetical protein POPTR_0006s04300g [Populus trichocarpa]
 gb|EEE92435.2| hypothetical protein POPTR_0006s04300g [Populus trichocarpa]
Length=116

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 73/88 (83%), Gaps = 4/88 (5%)
 Frame = -2

Query  683  HSSTPQPLGN---NRM-YGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLC  516
             + TPQP  N   NR  YG T+GSL PQEC P+C+ RCSKTAFKKPC+FFCQKCCAKCLC
Sbjct  29   EAPTPQPQPNTNSNRPPYGTTQGSLNPQECGPRCTGRCSKTAFKKPCMFFCQKCCAKCLC  88

Query  515  VPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            VP GTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  89   VPAGTYGNKQSCPCYNNWKTKRGGPKCP  116



>ref|XP_010056457.1| PREDICTED: protein GAST1 [Eucalyptus grandis]
 gb|KCW90091.1| hypothetical protein EUGRSUZ_A02289 [Eucalyptus grandis]
Length=114

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  659  GNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVC  480
            GN   YG  EGSL+PQEC P+C+ RCSKT +KKPC+FFCQKCCAKCLCVPPGTYGNKQ+C
Sbjct  39   GNLPSYGAREGSLKPQECGPRCTGRCSKTQYKKPCMFFCQKCCAKCLCVPPGTYGNKQLC  98

Query  479  PCYNNWKTKRGGPKCP  432
            PCYNNWKTKRGGPKCP
Sbjct  99   PCYNNWKTKRGGPKCP  114



>ref|XP_010045037.1| PREDICTED: protein GAST1-like [Eucalyptus grandis]
 gb|KCW87192.1| hypothetical protein EUGRSUZ_B03715 [Eucalyptus grandis]
Length=116

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 84/116 (72%), Gaps = 5/116 (4%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQ-----PLGNNRMYGVTEGSLRPQECSP  600
            MA   +IL   + + +++ Q      +  S P+       G+++ YG T+GSL+PQ+C P
Sbjct  1    MAKAQSILLLCVALLLVLAQENEVFGSTESVPEFDVQARKGSHQTYGTTQGSLKPQDCGP  60

Query  599  KCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +C+ RCS T++KKPCLFFCQKCCAKCLCVP GTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   RCTSRCSATSYKKPCLFFCQKCCAKCLCVPAGTYGNKQTCPCYNNWKTKRGGPKCP  116



>ref|XP_010481220.1| PREDICTED: gibberellin-regulated protein 13-like isoform X2 [Camelina 
sativa]
Length=120

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 80/120 (67%), Gaps = 9/120 (8%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMF---------QNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQ  612
            MAT L+ + FSI +  ++          ++ A       +     N+  YG TEGSL+PQ
Sbjct  1    MATKLSTIVFSIVVLHLLLSAHMHPIRLESPAPQPQPPQSQPSHHNSSQYGTTEGSLQPQ  60

Query  611  ECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            EC P+C  RCS T +KKPCLFFC KCC KCLCVPPGTYGNKQVCPCYNNWKT+ GGPKCP
Sbjct  61   ECGPRCGDRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNWKTQTGGPKCP  120



>ref|XP_006338319.1| PREDICTED: protein GAST1-like [Solanum tuberosum]
Length=112

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -2

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            +YGV++GSL PQ+C PKC++RCSKT++KKPC+FFCQKCCAKCLCVP GTYGNKQ CPCYN
Sbjct  41   LYGVSQGSLHPQDCQPKCTYRCSKTSYKKPCMFFCQKCCAKCLCVPAGTYGNKQSCPCYN  100

Query  467  NWKTKRGGPKCP  432
            NWKTKRGGPKCP
Sbjct  101  NWKTKRGGPKCP  112



>ref|XP_004232126.1| PREDICTED: protein GAST1 [Solanum lycopersicum]
 sp|P27057.1|GAST1_SOLLC RecName: Full=Protein GAST1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA44807.1| gast1 [Solanum lycopersicum]
Length=112

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -2

Query  707  QNQASMAA--HSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKC  534
            QNQ S A        Q   NN++YGV+EG L PQ+C PKC++RCSKT++KKPC+FFCQKC
Sbjct  19   QNQVSRANIMRDEQQQQQRNNQLYGVSEGRLHPQDCQPKCTYRCSKTSYKKPCMFFCQKC  78

Query  533  CAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CAKCLCVP GTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  79   CAKCLCVPAGTYGNKQSCPCYNNWKTKRGGPKCP  112



>ref|XP_009793969.1| PREDICTED: protein GAST1-like [Nicotiana sylvestris]
Length=114

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            MYG+T GSL PQEC  +C +RCSKTAFKKPC+FFCQKCCAKCLCVPPGTYGNKQ CPCYN
Sbjct  43   MYGITPGSLHPQECGARCMYRCSKTAFKKPCMFFCQKCCAKCLCVPPGTYGNKQFCPCYN  102

Query  467  NWKTKRGGPKCP  432
            NWKTKRGGPKCP
Sbjct  103  NWKTKRGGPKCP  114



>ref|XP_006421227.1| hypothetical protein CICLE_v10006243mg [Citrus clementina]
 gb|ESR34467.1| hypothetical protein CICLE_v10006243mg [Citrus clementina]
Length=96

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 73/95 (77%), Gaps = 6/95 (6%)
 Frame = -2

Query  698  ASMAAHSSTPQPL------GNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQK  537
            A+    + TPQP       GN+  YG T+GSL+PQEC P+C+ RCSKT ++KPCL FCQK
Sbjct  2    ATSIVEAPTPQPAESSGRNGNHSTYGTTQGSLQPQECGPRCTTRCSKTQYRKPCLVFCQK  61

Query  536  CCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CCAKCLCVP G YGNKQ CPCYNNWKTKRGGPKCP
Sbjct  62   CCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP  96



>ref|XP_010938633.1| PREDICTED: protein GAST1-like [Elaeis guineensis]
Length=107

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = -2

Query  680  SSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGT  501
            S TPQP+    +YG T+GSL+PQEC  +C+ RCS TA+KKPC+FFCQKCCAKCLCVPPGT
Sbjct  26   SPTPQPI-KFPLYGTTQGSLQPQECPGRCTSRCSATAYKKPCMFFCQKCCAKCLCVPPGT  84

Query  500  YGNKQVCPCYNNWKTKRGGPKCP  432
            YGNKQ CPCYNNWKTKRGGPKCP
Sbjct  85   YGNKQFCPCYNNWKTKRGGPKCP  107



>ref|XP_010486614.1| PREDICTED: gibberellin-regulated protein 13 [Camelina sativa]
Length=124

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 77/124 (62%), Gaps = 13/124 (10%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQAS-------------MAAHSSTPQPLGNNRMYGVTEGS  624
            MAT L+ + FSI +  ++                         +     N+  YG TEGS
Sbjct  1    MATKLSTIVFSIVVLHLLLSAHVHPIRLESPAPQPQPQPQPPQSQPSHHNSSQYGTTEGS  60

Query  623  LRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGG  444
            L+PQEC P+C  RCS T +KKPCLFFC KCC KCLCVPPGTYGNKQVCPCYNNWKT+ GG
Sbjct  61   LQPQECGPRCGDRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNWKTQTGG  120

Query  443  PKCP  432
            PKCP
Sbjct  121  PKCP  124



>ref|XP_009787829.1| PREDICTED: protein GAST1-like [Nicotiana sylvestris]
Length=107

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            MYG T G+L PQEC P+C++RCSKT +KKPC+FFCQKCCAKCLCVPPGTYGNKQ CPCYN
Sbjct  36   MYGTTPGNLHPQECLPRCTYRCSKTQYKKPCMFFCQKCCAKCLCVPPGTYGNKQFCPCYN  95

Query  467  NWKTKRGGPKCP  432
            NWKTKRGGPKCP
Sbjct  96   NWKTKRGGPKCP  107



>gb|AAC32128.1| GASA5-like protein [Picea mariana]
Length=110

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 4/114 (4%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MA++ +   +L   I IF +   N  +   HS+   P    +     EGSLRP EC  +C
Sbjct  1    MARLQSFAVLL---ITIFALFIWNIEAALPHSNV-DPFMEQKQGQYGEGSLRPSECGQRC  56

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            S+RCS T+ KKPC+FFCQKCCAKCLCVPPGT+GNKQVCPCYNNWKT++GGPKCP
Sbjct  57   SYRCSATSHKKPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTQQGGPKCP  110



>gb|EEC79111.1| hypothetical protein OsI_19744 [Oryza sativa Indica Group]
Length=152

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            MYGVT GSLRPQEC  +C++RCS TA++KPC+FFCQKCCA CLCVPPGTYGNKQ CPCYN
Sbjct  81   MYGVTPGSLRPQECGGRCAYRCSATAYRKPCMFFCQKCCASCLCVPPGTYGNKQSCPCYN  140

Query  467  NWKTKRGGPKCP  432
            +WKTKRGGPKCP
Sbjct  141  DWKTKRGGPKCP  152



>emb|CDY41324.1| BnaA01g31950D [Brassica napus]
Length=111

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -2

Query  656  NNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCP  477
            N+  YG TEGSL+PQEC P+C  RCS T +KKPCLFFC KCCAKCLCVPPGTYGNKQVCP
Sbjct  37   NSSQYGTTEGSLQPQECGPRCGDRCSNTKYKKPCLFFCNKCCAKCLCVPPGTYGNKQVCP  96

Query  476  CYNNWKTKRGGPKCP  432
            CYNNWKT+ GGPKCP
Sbjct  97   CYNNWKTQLGGPKCP  111



>ref|XP_009589707.1| PREDICTED: protein GAST1-like [Nicotiana tomentosiformis]
Length=113

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -2

Query  680  SSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGT  501
            +  PQP     M G T GSL PQEC P+C++RCSKT +KKPC+FFCQKCCAKC CVPPGT
Sbjct  31   APQPQPPNTFPMNGTTPGSLHPQECLPRCTYRCSKTQYKKPCMFFCQKCCAKCFCVPPGT  90

Query  500  YGNKQVCPCYNNWKTKRGGPKCP  432
            YGNKQ CPCYNNWKTKRGGPKCP
Sbjct  91   YGNKQFCPCYNNWKTKRGGPKCP  113



>ref|XP_004513859.1| PREDICTED: gibberellin-regulated protein 14-like [Cicer arietinum]
Length=163

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  644  YGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            +G TEGSL+P+ECSP+C +RCSKT  KKPCLFFC+KCCA+CLCVPPGTYGNK+VCPCY+N
Sbjct  93   HGTTEGSLKPEECSPRCDYRCSKTHHKKPCLFFCKKCCAECLCVPPGTYGNKEVCPCYDN  152

Query  464  WKTKRGGPKCP  432
            WKTKRG PKCP
Sbjct  153  WKTKRGTPKCP  163



>ref|XP_004513860.1| PREDICTED: gibberellin-regulated protein 14-like [Cicer arietinum]
Length=180

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 5/82 (6%)
 Frame = -2

Query  677  STPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTY  498
            +TP P      +G TEGSL+P+ECSP+C +RCSKT  KKPCLFFC+KCCA+CLCVPPGTY
Sbjct  104  ATPDP-----SHGTTEGSLKPEECSPRCDYRCSKTHHKKPCLFFCKKCCAECLCVPPGTY  158

Query  497  GNKQVCPCYNNWKTKRGGPKCP  432
            GNK+VCPCY+NWKTKRG PKCP
Sbjct  159  GNKEVCPCYDNWKTKRGTPKCP  180



>gb|KFK38405.1| hypothetical protein AALP_AA3G108800 [Arabis alpina]
Length=121

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -2

Query  656  NNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCP  477
            N+  YG TEGSL+PQEC P+C  RCS T +KKPCLFFC KCC  CLCVPPGTYGNKQVCP
Sbjct  47   NSSQYGTTEGSLQPQECGPRCGDRCSNTQYKKPCLFFCNKCCTACLCVPPGTYGNKQVCP  106

Query  476  CYNNWKTKRGGPKCP  432
            CYNNWKTK GGPKCP
Sbjct  107  CYNNWKTKLGGPKCP  121



>ref|XP_006655260.1| PREDICTED: gibberellin-regulated protein 14-like [Oryza brachyantha]
Length=151

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -2

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            MYGVT GSLRPQEC  +C++RCS TA++KPC+FFCQKCCA CLCVPPGTYGNKQ CPCY+
Sbjct  80   MYGVTPGSLRPQECGGRCAYRCSATAYRKPCMFFCQKCCASCLCVPPGTYGNKQSCPCYS  139

Query  467  NWKTKRGGPKCP  432
             WKTKRGGPKCP
Sbjct  140  GWKTKRGGPKCP  151



>ref|XP_006358036.1| PREDICTED: protein GAST1-like [Solanum tuberosum]
Length=114

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = -2

Query  701  QASMAAHSSTPQPLGNNR--MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCA  528
             A++   S  PQP   N   M G T GSL PQ+C PKC++RCS T ++KPC+FFCQKCCA
Sbjct  23   HATIIIESPAPQPQPPNTLPMNGTTPGSLHPQDCLPKCTYRCSNTQYRKPCMFFCQKCCA  82

Query  527  KCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            KCLCVP GTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  83   KCLCVPAGTYGNKQFCPCYNNWKTKRGGPKCP  114



>ref|XP_010672958.1| PREDICTED: gibberellin-regulated protein 13-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=114

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 78/114 (68%), Gaps = 6/114 (5%)
 Frame = -2

Query  755  MLTILKFSIFIFVIMFQ------NQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            M   L ++IF FVI         +       S +PQP      YG T GSL+PQEC P+C
Sbjct  1    MAMKLLYAIFFFVIFLHFSPAENHVGKTEVPSPSPQPSSTMPSYGSTPGSLQPQECGPRC  60

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCS T +KKPCLFFC KCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   ATRCSNTQYKKPCLFFCNKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  114



>ref|XP_002441006.1| hypothetical protein SORBIDRAFT_09g018790 [Sorghum bicolor]
 gb|EES19436.1| hypothetical protein SORBIDRAFT_09g018790 [Sorghum bicolor]
Length=137

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 81/130 (62%), Gaps = 21/130 (16%)
 Frame = -2

Query  758  TMLTILKFSIFIFVIMFQNQASMAAH---SSTPQPLGNNR------------------MY  642
            ++L +L  +  +  ++   Q S AA+   S  P P   N                   MY
Sbjct  8    SLLQLLCCAAMVVALLLSQQGSQAAYFVPSPGPAPAPTNSSAAPPPPPPAKPNAFPLPMY  67

Query  641  GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNW  462
            GVT GSL+PQEC  +C+ RCS TA++KPCLFFC+KCCA CLCVP GTYGNK  CPCYNNW
Sbjct  68   GVTPGSLQPQECGGRCAARCSATAYRKPCLFFCRKCCATCLCVPAGTYGNKNTCPCYNNW  127

Query  461  KTKRGGPKCP  432
            KTKRGGPKCP
Sbjct  128  KTKRGGPKCP  137



>ref|NP_001055385.1| Os05g0376800 [Oryza sativa Japonica Group]
 gb|AAT93888.1| putative gibberellin-induced protein [Oryza sativa Japonica Group]
 gb|AAU10727.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17299.1| Os05g0376800 [Oryza sativa Japonica Group]
 dbj|BAG97829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63525.1| hypothetical protein OsJ_18341 [Oryza sativa Japonica Group]
Length=152

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -2

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            MYGVT GSLRPQEC  +C++RCS TA++KPC+FFCQKCCA CLCV PGTYGNKQ CPCYN
Sbjct  81   MYGVTPGSLRPQECGGRCAYRCSATAYRKPCMFFCQKCCASCLCVLPGTYGNKQSCPCYN  140

Query  467  NWKTKRGGPKCP  432
            +WKTKRGGPKCP
Sbjct  141  DWKTKRGGPKCP  152



>ref|XP_004236562.1| PREDICTED: protein GAST1-like [Solanum lycopersicum]
Length=114

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 70/92 (76%), Gaps = 2/92 (2%)
 Frame = -2

Query  701  QASMAAHSSTPQPLGNNR--MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCA  528
             A +   S  PQP   N   M G T GSL PQ+C PKC++RCS T ++KPC+FFCQKCCA
Sbjct  23   HAKIIIESPAPQPQPPNTLPMNGTTPGSLHPQDCLPKCTYRCSNTQYRKPCMFFCQKCCA  82

Query  527  KCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            KCLCVP GTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  83   KCLCVPAGTYGNKQFCPCYNNWKTKRGGPKCP  114



>emb|CDY00909.1| BnaC05g42910D [Brassica napus]
Length=119

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 79/123 (64%), Gaps = 16/123 (13%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAH------------SSTPQPLGNNRMYGVTEGSL  621
            MAT L ++ FSI    +M  +  S+  H                QP  N+   G TEGSL
Sbjct  1    MATKLNLIVFSI----VMLHHLISVQMHPIHAKSPAPQPHPPQSQPHHNSSQNGTTEGSL  56

Query  620  RPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGP  441
            + QEC P+C  RCS T +KKPCLFFC KCC KCLCVPPGTYGNKQVCPCYNNWKTK GGP
Sbjct  57   QLQECGPRCGHRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNWKTKLGGP  116

Query  440  KCP  432
            KCP
Sbjct  117  KCP  119



>ref|XP_008800232.1| PREDICTED: protein GAST1-like [Phoenix dactylifera]
Length=100

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = -2

Query  680  SSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGT  501
            + TPQP+    +YG T+GSL+PQEC   C+ RCS TA+KKPC+FFCQKCC+KCLCVPPGT
Sbjct  19   APTPQPI-KFPLYGTTQGSLQPQECPGHCASRCSATAYKKPCMFFCQKCCSKCLCVPPGT  77

Query  500  YGNKQVCPCYNNWKTKRGGPKCP  432
            YGNK+ CPCYNNWKTKRGGPKCP
Sbjct  78   YGNKEFCPCYNNWKTKRGGPKCP  100



>ref|XP_010672957.1| PREDICTED: gibberellin-regulated protein 13-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=115

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 77/115 (67%), Gaps = 7/115 (6%)
 Frame = -2

Query  755  MLTILKFSIFIFVIMFQ-------NQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPK  597
            M   L ++IF FVI                  S +PQP      YG T GSL+PQEC P+
Sbjct  1    MAMKLLYAIFFFVIFLHFSPAENHKVGKTEVPSPSPQPSSTMPSYGSTPGSLQPQECGPR  60

Query  596  CSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            C+ RCS T +KKPCLFFC KCCAKCLCVPPGTYGNKQ CPCYNNWKTKRGGPKCP
Sbjct  61   CATRCSNTQYKKPCLFFCNKCCAKCLCVPPGTYGNKQFCPCYNNWKTKRGGPKCP  115



>ref|XP_009146866.1| PREDICTED: gibberellin-regulated protein 13-like [Brassica rapa]
Length=119

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 78/123 (63%), Gaps = 16/123 (13%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAH------------SSTPQPLGNNRMYGVTEGSL  621
            MA  L ++ FSI    +M  +  S+  H                QP  N+   G TEGSL
Sbjct  1    MAAKLNLIVFSI----VMLHHLISVQMHPIHAKSPSPQPHPPQSQPHHNSSQNGTTEGSL  56

Query  620  RPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGP  441
            + QEC P+C  RCS T +KKPCLFFC KCC KCLCVPPGTYGNKQVCPCYNNWKTK GGP
Sbjct  57   KLQECGPRCGHRCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNWKTKLGGP  116

Query  440  KCP  432
            KCP
Sbjct  117  KCP  119



>emb|CDY60168.1| BnaAnng16620D [Brassica napus]
Length=120

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 80/121 (66%), Gaps = 11/121 (9%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSS----------TPQPLGNNRMYGVTEGSLRP  615
            MAT L ++ FSI +  ++   Q     HS+            QP  N+   G TEGSL+ 
Sbjct  1    MATKLNLIVFSIVMLHLLMSVQMH-PIHSNKSPAPQPHPPQSQPHHNSSQNGTTEGSLQL  59

Query  614  QECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKC  435
            +EC P+C  RCS T +K+PCLFFC KCC KCLCVPPGTYGNKQVCPCYNNWKTK GGPKC
Sbjct  60   RECGPRCGHRCSNTKYKEPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNWKTKLGGPKC  119

Query  434  P  432
            P
Sbjct  120  P  120



>ref|XP_003519099.2| PREDICTED: protein GAST1-like, partial [Glycine max]
Length=123

 Score =   129 bits (324),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  641  GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNW  462
            G TEGSL+PQ+C P+C  RCSKT  KKPCLFFC KCCAKCLCVPPGTYGNK+VCPCYNNW
Sbjct  54   GTTEGSLQPQDCGPRCEERCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKEVCPCYNNW  113

Query  461  KTKRGGPKCP  432
            KTKRGGPKCP
Sbjct  114  KTKRGGPKCP  123



>gb|ABK22391.1| unknown [Picea sitchensis]
 gb|ABK22466.1| unknown [Picea sitchensis]
 gb|ACN39986.1| unknown [Picea sitchensis]
Length=108

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = -2

Query  755  MLTILKFSIFI--FVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRC  582
            M  +L F++ +  F +   N  +   +S+    +   R  G   G L P EC  +CS+RC
Sbjct  1    MARLLAFTVLVIVFALFIWNIEAALPYSNGDTWMQQKR--GRGSGRLHPSECGGRCSYRC  58

Query  581  SKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            S T+ KKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++GGPKCP
Sbjct  59   SATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  108



>ref|XP_003617836.1| Gibberellin induced protein [Medicago truncatula]
Length=157

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 66/81 (81%), Gaps = 5/81 (6%)
 Frame = -2

Query  674  TPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYG  495
            TP P       G TEGSL+P+EC+P+C  RCSKT  KKPCLF+C+ CCAKCLCVPPGTYG
Sbjct  82   TPDPTD-----GTTEGSLKPEECAPRCEDRCSKTHHKKPCLFYCKYCCAKCLCVPPGTYG  136

Query  494  NKQVCPCYNNWKTKRGGPKCP  432
            NK+VCPCYN+WKTK GGPKCP
Sbjct  137  NKEVCPCYNDWKTKEGGPKCP  157



>gb|EPS65179.1| hypothetical protein M569_09600 [Genlisea aurea]
Length=122

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            M+G+T+GSL PQEC  +C++RCSKT +KKPCLFFC KCCA CLCVPPGTYGNKQ CPCYN
Sbjct  51   MHGITQGSLHPQECDGRCAYRCSKTQYKKPCLFFCNKCCATCLCVPPGTYGNKQYCPCYN  110

Query  467  NWKTKRGGPKCP  432
             WKTK GGPKCP
Sbjct  111  QWKTKEGGPKCP  122



>ref|XP_010108998.1| hypothetical protein L484_027195 [Morus notabilis]
 gb|EXC20638.1| hypothetical protein L484_027195 [Morus notabilis]
Length=97

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
             G LRPQ+C PKC++RCS T+ KKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK
Sbjct  31   RGKLRPQDCKPKCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  90

Query  452  RGGPKCP  432
             GGPKCP
Sbjct  91   EGGPKCP  97



>gb|AET00795.2| GASA/GAST/Snakin [Medicago truncatula]
Length=149

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 66/81 (81%), Gaps = 5/81 (6%)
 Frame = -2

Query  674  TPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYG  495
            TP P       G TEGSL+P+EC+P+C  RCSKT  KKPCLF+C+ CCAKCLCVPPGTYG
Sbjct  74   TPDPTD-----GTTEGSLKPEECAPRCEDRCSKTHHKKPCLFYCKYCCAKCLCVPPGTYG  128

Query  494  NKQVCPCYNNWKTKRGGPKCP  432
            NK+VCPCYN+WKTK GGPKCP
Sbjct  129  NKEVCPCYNDWKTKEGGPKCP  149



>ref|XP_006843409.1| hypothetical protein AMTR_s00053p00132370 [Amborella trichopoda]
 gb|ERN05084.1| hypothetical protein AMTR_s00053p00132370 [Amborella trichopoda]
Length=72

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            MYG T+GSL PQECSP+C+ RCS TA+ K C+F CQKCCA CLCVPPGTYGNKQ CPCYN
Sbjct  1    MYGATQGSLHPQECSPRCTVRCSATAYTKSCMFLCQKCCATCLCVPPGTYGNKQFCPCYN  60

Query  467  NWKTKRGGPKCP  432
            NWKTKRG PKCP
Sbjct  61   NWKTKRGCPKCP  72



>emb|CBL95259.1| gasa5 like protein [Pinus pinaster]
Length=108

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 78/114 (68%), Gaps = 6/114 (5%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MA++ + + +L     +F +   N  +   +S+    +   R  G   G L P EC  +C
Sbjct  1    MARLLSFVVLLT----VFALFIWNIEAALPYSNGGTWMEQKR--GRGSGRLHPSECGGRC  54

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            S+RCS T+ KKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++GGPKCP
Sbjct  55   SYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  108



>ref|XP_003598155.1| Gibberellin induced protein [Medicago truncatula]
Length=162

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  641  GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNW  462
            G TEGSL+P+EC+P+C  RCSKT  +KPCLF+C+ CCAKCLCVPPGTYGNK+VCPCYN+W
Sbjct  93   GTTEGSLKPEECAPRCEDRCSKTHHRKPCLFYCKYCCAKCLCVPPGTYGNKEVCPCYNDW  152

Query  461  KTKRGGPKCP  432
            KTK GGPKCP
Sbjct  153  KTKEGGPKCP  162



>ref|XP_003544991.1| PREDICTED: protein RSI-1-like [Glycine max]
 gb|KHN39454.1| Protein RSI-1 [Glycine soja]
Length=97

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 75/114 (66%), Gaps = 17/114 (15%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MA  +   T++  S+ + V  F N A     S                G+LRP +C P+C
Sbjct  1    MAARSYSPTMVALSLLLLVT-FSNVAEAYTRS----------------GTLRPSDCKPRC  43

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            ++RCS T+ KKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYN+WKTK GGPKCP
Sbjct  44   TYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNSWKTKEGGPKCP  97



>gb|AES68406.2| GASA/GAST/Snakin [Medicago truncatula]
Length=154

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  641  GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNW  462
            G TEGSL+P+EC+P+C  RCSKT  +KPCLF+C+ CCAKCLCVPPGTYGNK+VCPCYN+W
Sbjct  85   GTTEGSLKPEECAPRCEDRCSKTHHRKPCLFYCKYCCAKCLCVPPGTYGNKEVCPCYNDW  144

Query  461  KTKRGGPKCP  432
            KTK GGPKCP
Sbjct  145  KTKEGGPKCP  154



>gb|KHN48768.1| Protein GAST1, partial [Glycine soja]
Length=67

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
            EGSL+PQ+C P+C  RCSKT  KKPCLFFC KCCAKCLCVPPGTYGNK+VCPCYNNWKTK
Sbjct  1    EGSLQPQDCGPRCEERCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKEVCPCYNNWKTK  60

Query  452  RGGPKCP  432
            RGGPKCP
Sbjct  61   RGGPKCP  67



>gb|ADX36135.1| gibberellic acid-stimulated protein 1 [Glycine soja]
 gb|KHN41076.1| Protein RSI-1 [Glycine soja]
Length=97

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
             G+LRP +C PKC++RCS T+ KKPC+FFCQKCCAKCLCVPPGTYGNKQ+CPCYN+WKTK
Sbjct  31   SGTLRPSDCKPKCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQICPCYNSWKTK  90

Query  452  RGGPKCP  432
             GGPKCP
Sbjct  91   EGGPKCP  97



>ref|NP_001150577.1| LOC100284210 precursor [Zea mays]
 gb|ACG39629.1| GAST1 protein precursor [Zea mays]
 gb|ACG40227.1| GAST1 protein precursor [Zea mays]
Length=143

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -2

Query  704  NQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAK  525
            N +S A   + P         GVT GSL+P EC  +C+ RCS TA++KPCLFFC+KCCA 
Sbjct  53   NDSSAAPRPAKPSAFPPPMYGGVTPGSLQPHECGGRCAGRCSATAYQKPCLFFCRKCCAA  112

Query  524  CLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CLCVPPGTYGNK  CPCYNNWKTKRGGPKCP
Sbjct  113  CLCVPPGTYGNKNTCPCYNNWKTKRGGPKCP  143



>ref|XP_010510284.1| PREDICTED: gibberellin-regulated protein 12-like [Camelina sativa]
Length=106

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            M  ++  L  S  +    F N   + + +  P P    +M G  EGSLRP+EC   C +R
Sbjct  1    MLKLIIFLMISSLLLATQFSNAEELDSSAEVPAP---RKMGG--EGSLRPEECPKACDYR  55

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T+ +KPCLFFC KCC KCLCVP GTYG+K+ CPCY+NW+TK GGPKCP
Sbjct  56   CSATSHRKPCLFFCNKCCMKCLCVPSGTYGHKEECPCYDNWRTKEGGPKCP  106



>ref|XP_004962265.1| PREDICTED: protein GAST1-like isoform X2 [Setaria italica]
Length=135

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  644  YGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            YGVT GSL+PQEC  +C+ RCS TA++KPCLFFC+KCCA CLCVP GTYGNK  CPCY+N
Sbjct  65   YGVTPGSLQPQECGGRCAARCSATAYRKPCLFFCRKCCAACLCVPAGTYGNKASCPCYDN  124

Query  464  WKTKRGGPKCP  432
            WKTKRGGPKCP
Sbjct  125  WKTKRGGPKCP  135



>ref|XP_004962264.1| PREDICTED: protein GAST1-like isoform X1 [Setaria italica]
Length=133

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  644  YGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            YGVT GSL+PQEC  +C+ RCS TA++KPCLFFC+KCCA CLCVP GTYGNK  CPCY+N
Sbjct  63   YGVTPGSLQPQECGGRCAARCSATAYRKPCLFFCRKCCAACLCVPAGTYGNKASCPCYDN  122

Query  464  WKTKRGGPKCP  432
            WKTKRGGPKCP
Sbjct  123  WKTKRGGPKCP  133



>ref|NP_001063170.1| Os09g0414900 [Oryza sativa Japonica Group]
 dbj|BAD28903.1| putative gibberellin-induced protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAF25084.1| Os09g0414900 [Oryza sativa Japonica Group]
 gb|EAZ09095.1| hypothetical protein OsI_31361 [Oryza sativa Indica Group]
 dbj|BAG86886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=112

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVT---EGSLRPQECSPKC  594
            +A  L +L F+I +  I      ++A  S++     ++ +Y V+   +GSL+  +CSP+C
Sbjct  3    LAGRLLVL-FAIALLAISIAEHKALAKGSTSEH---DDNVYQVSKGGQGSLKSYQCSPQC  58

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            ++RCS+T +KKPCLFFC KCC  CLCVP G YGNK  CPCYNNWKTKRGGPKCP
Sbjct  59   AYRCSQTQYKKPCLFFCNKCCNACLCVPSGLYGNKGECPCYNNWKTKRGGPKCP  112



>ref|NP_001148171.1| GAST1 protein precursor [Zea mays]
 gb|ACG30044.1| GAST1 protein precursor [Zea mays]
Length=143

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -2

Query  704  NQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAK  525
            N +S A   + P         GVT GSL+P EC  +C+ RCS TA++KPCLFFC+KCCA 
Sbjct  53   NDSSAAPRPAKPSAFQPPMYGGVTPGSLQPHECGGRCAGRCSATAYQKPCLFFCRKCCAA  112

Query  524  CLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CLCVPPGTYGNK  CPCYNNWKTK GGPKCP
Sbjct  113  CLCVPPGTYGNKNTCPCYNNWKTKLGGPKCP  143



>emb|CDY71845.1| BnaAnng38970D [Brassica napus]
Length=101

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 74/111 (67%), Gaps = 10/111 (9%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++T L F   +F  +F   +    +        N   YG   GSL+  +C  +C+ R
Sbjct  1    MANLITYLLFITILFSFIFLTMSKETEY--------NPESYGA--GSLKSYQCGGECTRR  50

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T + KPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++GGPKCP
Sbjct  51   CSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>ref|XP_009128056.1| PREDICTED: gibberellin-regulated protein 6 [Brassica rapa]
Length=101

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 74/111 (67%), Gaps = 10/111 (9%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++T L F   +F  +F   +    +        N   YG   GSL+  +C  +C+ R
Sbjct  1    MAKLITYLLFITILFSFIFLTMSKETEY--------NPESYGA--GSLKSYQCGGECTRR  50

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T + KPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++GGPKCP
Sbjct  51   CSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>ref|NP_001235155.1| uncharacterized protein LOC100306189 precursor [Glycine max]
 gb|ACU14251.1| unknown [Glycine max]
Length=97

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
             G+LRP +C PKC++RCS T+ KKPC+FFCQKCCAKCLCVPPGTYGNKQ+CP YN+WKTK
Sbjct  31   SGTLRPSDCKPKCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQICPFYNSWKTK  90

Query  452  RGGPKCP  432
             GGPKCP
Sbjct  91   EGGPKCP  97



>gb|AFK43939.1| unknown [Lotus japonicus]
Length=96

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  656  NNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCP  477
            +N         LRP +C PKC++RCS T+ KKPC+FFCQKCCAKCLCVPPG YGNK+VCP
Sbjct  22   SNVAEAYGSAKLRPSDCKPKCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGVYGNKEVCP  81

Query  476  CYNNWKTKRGGPKCP  432
            CYN+WKTK GGPKCP
Sbjct  82   CYNSWKTKEGGPKCP  96



>gb|ACG30820.1| GAST1 protein precursor [Zea mays]
Length=143

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 69/88 (78%), Gaps = 5/88 (6%)
 Frame = -2

Query  680  SSTPQPLGNNR----MYG-VTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLC  516
            S+ P+P  ++     MYG VT GSL+P EC  +C+ RCS TA++KPCLFFC+KCCA CLC
Sbjct  56   SAAPRPAKSSAFQPPMYGGVTPGSLQPHECGGRCAGRCSATAYQKPCLFFCRKCCAACLC  115

Query  515  VPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            VPPGTYGNK  CPCYNNWKTK GGPKCP
Sbjct  116  VPPGTYGNKNTCPCYNNWKTKLGGPKCP  143



>ref|XP_010062256.1| PREDICTED: gibberellin-regulated protein 5-like [Eucalyptus grandis]
Length=93

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
             G LRP +C  KC FRCS T+ KKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK
Sbjct  27   RGKLRPSDCPNKCKFRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  86

Query  452  RGGPKCP  432
             GGPKCP
Sbjct  87   EGGPKCP  93



>ref|XP_010510285.1| PREDICTED: gibberellin-regulated protein 12-like [Camelina sativa]
Length=106

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++ +   S  +  I F N   + +    P      +M G  EGSLRP+EC  +C  R
Sbjct  1    MAKLIVLFIVSCLLLAIQFSNAEELESPGEAPTIY---KMGG--EGSLRPEECPAECQRR  55

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T+ KKPCLFFC KCC  CLCVP GTYG+K+ CPCYNNW+TK GGPKCP
Sbjct  56   CSATSHKKPCLFFCNKCCNTCLCVPSGTYGHKEECPCYNNWRTKEGGPKCP  106



>ref|XP_004490815.1| PREDICTED: protein RSI-1-like [Cicer arietinum]
Length=95

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  656  NNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCP  477
            +N         LRP +C P+CS+RCS T+ KKPC+FFCQKCCA CLCVPPGTYGNKQVCP
Sbjct  21   SNVAQAYGSAKLRPSDCKPRCSYRCSATSHKKPCMFFCQKCCATCLCVPPGTYGNKQVCP  80

Query  476  CYNNWKTKRGGPKCP  432
            CYN WKT+ GGPKCP
Sbjct  81   CYNTWKTREGGPKCP  95



>ref|XP_010471557.1| PREDICTED: gibberellin-regulated protein 6-like [Camelina sativa]
Length=101

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 10/111 (9%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++T L +   IF  +F   +  A +   P+  G         GSL+  +C  +C+ R
Sbjct  1    MAKLITSLLYLTIIFSFIFLTTSKDAKYH--PEKYG--------PGSLKSYQCGGECTRR  50

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T + KPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++GGPKCP
Sbjct  51   CSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>ref|XP_009587065.1| PREDICTED: gibberellin-regulated protein 6-like [Nicotiana tomentosiformis]
Length=103

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 70/114 (61%), Gaps = 11/114 (10%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK+  +L +  F++ I             HS    P           GSL P +C P+C
Sbjct  1    MAKIVAVLFLALFAMSILATTVLATNGKHHHSKKHGP-----------GSLNPSQCQPQC  49

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCSKT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  50   TRRCSKTQYHKPCMFFCQKCCNKCLCVPPGFYGNKSVCPCYNNWKTKEGGPKCP  103



>gb|KDP27148.1| hypothetical protein JCGZ_19847 [Jatropha curcas]
Length=107

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK   +L +     FI + M Q    MA++        + + YG   GSL+  +C  +C
Sbjct  1    MAKFVALLLL----AFIAISMLQTLV-MASNGHGGHHYNDQKRYG--PGSLKSSQCPSQC  53

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            S RCSKT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  54   SRRCSKTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  107



>ref|XP_010258349.1| PREDICTED: gibberellin-regulated protein 6 isoform X1 [Nelumbo 
nucifera]
Length=105

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 77/114 (68%), Gaps = 9/114 (8%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK+  ++ +  F+I +       +A+M         L +NR YG   GSL+  +C  +C
Sbjct  1    MAKVVALMLLALFAISMI------EATMVLAKEAEYHLDSNR-YG--PGSLKSYQCPSQC  51

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCSKT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTKRGGPKCP
Sbjct  52   TRRCSKTQYHKPCMFFCQKCCRKCLCVPPGFYGNKGVCPCYNNWKTKRGGPKCP  105



>ref|XP_007151230.1| hypothetical protein PHAVU_004G028800g [Phaseolus vulgaris]
 gb|ESW23224.1| hypothetical protein PHAVU_004G028800g [Phaseolus vulgaris]
Length=110

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 74/114 (65%), Gaps = 4/114 (4%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MA  A +L+   F I +  I       +A+H        + + YG   GS++  +C  +C
Sbjct  1    MAVTAKLLSA--FIIALIAISMLQTMVVASHGHGGHHYNDKKKYG--PGSVKSYQCPSQC  56

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCS+T + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTKRGGPKCP
Sbjct  57   TRRCSRTQYHKPCMFFCQKCCMKCLCVPPGYYGNKAVCPCYNNWKTKRGGPKCP  110



>ref|XP_006440597.1| hypothetical protein CICLE_v10023012mg [Citrus clementina]
 gb|ESR53837.1| hypothetical protein CICLE_v10023012mg [Citrus clementina]
Length=103

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = -2

Query  731  IFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCL  552
            +F+ ++      S+   + T   L  N   G   GSLR  +C  +C+ RCS+T F KPC+
Sbjct  7    VFVLLVAALFSISIVMATETQNHLDTN---GYGPGSLRSYQCPSQCTRRCSQTQFHKPCM  63

Query  551  FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            FFCQKCCAKCLCVPPG YGNK VCPCYNNWKTKRGGPKCP
Sbjct  64   FFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTKRGGPKCP  103



>ref|NP_001235994.1| uncharacterized protein LOC100305480 precursor [Glycine max]
 gb|ACU13162.1| unknown [Glycine max]
Length=110

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 75/114 (66%), Gaps = 4/114 (4%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MA    +L++L  ++ I + M Q    MA+H        + + YG   GSL+  +C  +C
Sbjct  1    MAVANKLLSVLIIAL-IAISMLQT-VVMASHGHGGHHYNDKKKYG--PGSLKSFQCPSQC  56

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            S RC KT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  57   SRRCGKTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  110



>ref|XP_010414214.1| PREDICTED: gibberellin-regulated protein 12-like [Camelina sativa]
Length=106

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            M  ++  L  S  +    F     + + +  P     ++M G  EGSLRP+EC   C +R
Sbjct  1    MLKLIIFLMISGLLLATQFSKTQELDSPAEAPS---ASKMGG--EGSLRPEECPKACEYR  55

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T+ KKPCLFFC KCC KCLCVP GTYG+K+ CPCY+NWKTK GGPKCP
Sbjct  56   CSATSHKKPCLFFCNKCCMKCLCVPSGTYGHKEECPCYDNWKTKEGGPKCP  106



>ref|XP_008649585.1| PREDICTED: gibberellin-regulated protein 6-like [Zea mays]
 gb|AFW77818.1| GAST1 protein [Zea mays]
Length=145

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 67/93 (72%), Gaps = 2/93 (2%)
 Frame = -2

Query  704  NQASMAAHSSTPQPLGNNRMYGVTEG--SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCC  531
            N +S A   + P         GVT G  SL+P EC  +C+ RCS TA++KPCLFFC+KCC
Sbjct  53   NASSAAPRPAKPSAFPPPMYGGVTPGTGSLQPHECGGRCAERCSATAYQKPCLFFCRKCC  112

Query  530  AKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            A CLCVPPGTYGNK  CPCYNNWKTKRGGPKCP
Sbjct  113  AACLCVPPGTYGNKNTCPCYNNWKTKRGGPKCP  145



>ref|XP_008460555.1| PREDICTED: protein RSI-1-like [Cucumis melo]
Length=95

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -2

Query  626  SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRG  447
            +LRP +C PKCS+RCS T+ +KPC+FFCQKCCAKCLCVPPGTYGNKQ CPCYNNWKT++G
Sbjct  31   NLRPSDCKPKCSYRCSATSHRKPCMFFCQKCCAKCLCVPPGTYGNKQECPCYNNWKTQQG  90

Query  446  GPKCP  432
            GPKCP
Sbjct  91   GPKCP  95



>ref|XP_002442726.1| hypothetical protein SORBIDRAFT_08g001840 [Sorghum bicolor]
 gb|EES16564.1| hypothetical protein SORBIDRAFT_08g001840 [Sorghum bicolor]
Length=127

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 78/136 (57%), Gaps = 10/136 (7%)
 Frame = -2

Query  839  TNSLYISLLIIQFLCVSFFLSSMAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPL  660
            T    ++ L++ FL ++  +S+         I    +       + Q             
Sbjct  2    TTKNKVAALLLCFLVLAAIVSAE-------IIDANGVDDDDGGDEEQLDKGGSGGHHNHK  54

Query  659  GNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVC  480
            G+N+     +G+L+P +C  +C  RCSKT  KKPCLFFC KCCAKCLCVPPGTYGNK  C
Sbjct  55   GHNKD---GKGNLKPSQCGGECKRRCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKDTC  111

Query  479  PCYNNWKTKRGGPKCP  432
            PCYNNWKTKRGGPKCP
Sbjct  112  PCYNNWKTKRGGPKCP  127



>ref|XP_003613454.1| Gibberellin induced protein [Medicago truncatula]
 gb|AES96412.1| Thionin-like protein [Medicago truncatula]
Length=92

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  650  RMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCY  471
             +Y   EGSL+P EC+PKC +RCSKTA+KK CL +C  CCAKCLCVP GTYGNK+ CPCY
Sbjct  20   DVYAGGEGSLKPAECAPKCDYRCSKTAYKKACLTYCNLCCAKCLCVPSGTYGNKEECPCY  79

Query  470  NNWKTKRGGPKCP  432
            NNWK K+GGPKCP
Sbjct  80   NNWKNKKGGPKCP  92



>ref|XP_010908421.1| PREDICTED: protein RSI-1-like [Elaeis guineensis]
Length=93

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  641  GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNW  462
            G   G L+P +C P+C +RCS T+ KKPC+FFC KCCA+CLCVPPGTYGNKQVCPCYNNW
Sbjct  24   GSVHGRLKPSDCQPRCQYRCSATSHKKPCMFFCLKCCAQCLCVPPGTYGNKQVCPCYNNW  83

Query  461  KTKRGGPKCP  432
            KTK GGPKCP
Sbjct  84   KTKEGGPKCP  93



>ref|XP_008788455.1| PREDICTED: protein RSI-1-like [Phoenix dactylifera]
Length=93

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  641  GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNW  462
            G   G L+P +C P+C +RCS T+ KKPC+FFC KCCA+CLCVPPGTYGNKQVCPCYNNW
Sbjct  24   GSVHGRLKPSDCQPRCQYRCSGTSHKKPCMFFCLKCCAQCLCVPPGTYGNKQVCPCYNNW  83

Query  461  KTKRGGPKCP  432
            KTK GGPKCP
Sbjct  84   KTKEGGPKCP  93



>ref|XP_010428457.1| PREDICTED: gibberellin-regulated protein 6-like [Camelina sativa]
Length=101

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 10/111 (9%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++T L     IF ++F   +  A +   P+  G         GSL+  +C  +C+ R
Sbjct  1    MAKLITSLLCLTIIFSLIFLTTSKEAEYH--PEKYG--------PGSLKSYQCGGECTRR  50

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T + KPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++GGPKCP
Sbjct  51   CSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>ref|XP_009419112.1| PREDICTED: gibberellin-regulated protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  638  VTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWK  459
            V  GSL+P EC+ KC FRCS T+ KKPCLFFC++CCA CLCVPPGTYGNK+ CPCYNNWK
Sbjct  23   VRSGSLKPSECNNKCDFRCSATSHKKPCLFFCKECCATCLCVPPGTYGNKEACPCYNNWK  82

Query  458  TKRGGPKCP  432
            TK GGPKCP
Sbjct  83   TKEGGPKCP  91



>gb|AGE15498.1| GA-stimulated transcript-like protein 2 [Gossypium hirsutum]
 gb|KHG09539.1| Gibberellin-regulated 4 -like protein [Gossypium arboreum]
Length=106

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  746  ILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAF  567
            +  F + +  I       MA+H        N R YG   GSL+P +C  +C+ RCS+T +
Sbjct  5    VATFFLALIAISMVQTLVMASHGHGGHHYDNKR-YG--PGSLKPYQCPSQCTRRCSQTQY  61

Query  566  KKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             KPC+FFCQKCC  CLCVPPG YGNKQVCPCYNNWKTK GGPKCP
Sbjct  62   HKPCMFFCQKCCRTCLCVPPGYYGNKQVCPCYNNWKTKEGGPKCP  106



>ref|XP_007215189.1| hypothetical protein PRUPE_ppa013959mg [Prunus persica]
 gb|EMJ16388.1| hypothetical protein PRUPE_ppa013959mg [Prunus persica]
Length=89

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 71/110 (65%), Gaps = 23/110 (21%)
 Frame = -2

Query  761  ATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRC  582
              +L+IL   +F+FVI  Q               G N+        LRP EC P+C++RC
Sbjct  3    VDILSILSKFVFVFVIHEQ---------------GYNK--------LRPSECKPRCTYRC  39

Query  581  SKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            S T+ KKPC+FFCQKCCA CLCVPPG YGNKQVCPCYNNWKT+ G PKCP
Sbjct  40   SATSHKKPCMFFCQKCCATCLCVPPGVYGNKQVCPCYNNWKTQEGRPKCP  89



>ref|XP_002881134.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57393.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=106

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            M  ++     S  +F   F N   + + +  P     ++  G  EGSLRP+EC   C  R
Sbjct  1    MMKLIVFFVVSSLLFSTQFSNGEELESSADAP---AIHKTGG--EGSLRPEECPKACEIR  55

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T+ KKPCLF+C KCC+KCLCVP GTYG+K+ CPCY+NW+TK GGPKCP
Sbjct  56   CSATSHKKPCLFYCNKCCSKCLCVPSGTYGHKEECPCYDNWRTKEGGPKCP  106



>gb|AFK42462.1| unknown [Lotus japonicus]
Length=105

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 9/114 (8%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK+  +L +   +I +       + +   H  +    GN   YG   GSL+  EC  +C
Sbjct  1    MAKLVCVLLLALIAISMIATQVMAKENAQYHLDS----GN---YG--PGSLKSNECPSQC  51

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RC++T + KPC+FFCQKCCAKCLCVPPG YGNK VCPCYNNWKTKRGGPKCP
Sbjct  52   TRRCAQTQYHKPCMFFCQKCCAKCLCVPPGYYGNKSVCPCYNNWKTKRGGPKCP  105



>ref|XP_009781826.1| PREDICTED: gibberellin-regulated protein 6-like [Nicotiana sylvestris]
Length=103

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 71/114 (62%), Gaps = 11/114 (10%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK+  +  +  F++ I             HS         + YG   GSL P +C P+C
Sbjct  1    MAKIVAVFLLALFAMSILATTVLATNGKHHHS---------KKYG--PGSLNPSQCLPQC  49

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCSKT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  50   TRRCSKTQYHKPCMFFCQKCCNKCLCVPPGFYGNKSVCPCYNNWKTKEGGPKCP  103



>ref|XP_004236040.1| PREDICTED: gibberellin-regulated protein 6 [Solanum lycopersicum]
Length=104

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = -2

Query  734  SIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPC  555
            S F+  ++  +  +  A ++  Q   +   YG   GSL+P +C P+C+ RCSKT + KPC
Sbjct  6    SFFLLALIAISMVATTALAADAQYHLDRSRYG--PGSLKPTQCLPQCTRRCSKTQYHKPC  63

Query  554  LFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +FFCQKCC  CLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  64   MFFCQKCCKTCLCVPPGFYGNKGVCPCYNNWKTKEGGPKCP  104



>ref|XP_004978479.1| PREDICTED: gibberellin-regulated protein 6-like [Setaria italica]
 ref|XP_004978480.1| PREDICTED: gibberellin-regulated protein 6-like [Setaria italica]
Length=120

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 69/108 (64%), Gaps = 9/108 (8%)
 Frame = -2

Query  728  FIFVIMFQNQASMAAHSSTPQPLGNNRMYGVT---------EGSLRPQECSPKCSFRCSK  576
            F+F+I   + A +   +       N++   V          +G+L+P +C  +C  RCSK
Sbjct  13   FLFLIALASAAEIIGSNGVAGEDLNSKGDDVDNHKGNNKDGKGNLKPSQCGGECRRRCSK  72

Query  575  TAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            T  KKPCLFFC KCCAKCLCVPPGTYGNK  CPCYNNWKTKRGG KCP
Sbjct  73   THHKKPCLFFCNKCCAKCLCVPPGTYGNKDTCPCYNNWKTKRGGTKCP  120



>ref|XP_006364599.1| PREDICTED: gibberellin-regulated protein 6-like [Solanum tuberosum]
Length=104

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = -2

Query  734  SIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPC  555
            S F+  ++  +  +  A ++  Q   +   YG   GSL+P +C P+C+ RCSKT + KPC
Sbjct  6    SFFLLALIAISMVATTALAADAQYHLDRSRYG--PGSLKPTQCLPQCTRRCSKTQYHKPC  63

Query  554  LFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +FFCQKCC  CLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  64   MFFCQKCCKTCLCVPPGFYGNKGVCPCYNNWKTKEGGPKCP  104



>ref|XP_010416324.1| PREDICTED: gibberellin-regulated protein 6 [Camelina sativa]
Length=101

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 74/111 (67%), Gaps = 10/111 (9%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++T L     IF  +F   +  A +   P+  G         GSL+  +C  +C+ R
Sbjct  1    MAKLITSLLCLTIIFSFIFLTTSKEAKYH--PEKYG--------PGSLKSYQCGGECTRR  50

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T + KPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++GGPKCP
Sbjct  51   CSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>gb|AFW77815.1| hypothetical protein ZEAMMB73_495748 [Zea mays]
Length=75

 Score =   116 bits (291),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = -2

Query  647  MYGVTE---GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCP  477
            MYG      GSL+P EC  +C+ RCS TA++KPCLFFC+KCCA CLCVPPGTYGNK  CP
Sbjct  1    MYGGVTPGTGSLQPHECGGRCAERCSATAYQKPCLFFCRKCCAACLCVPPGTYGNKNTCP  60

Query  476  CYNNWKTKRGGPKCP  432
            CYNNWKTKRGGPKCP
Sbjct  61   CYNNWKTKRGGPKCP  75



>ref|XP_004489396.1| PREDICTED: gibberellin-regulated protein 4-like [Cicer arietinum]
Length=107

 Score =   117 bits (294),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 71/111 (64%), Gaps = 4/111 (4%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA +L +  F + +          MA+H        + R YG   GSL+  +C  +CS R
Sbjct  1    MARLLVV--FILVVIATSMLQTLVMASHGHGGHHYNDKRKYG--PGSLKSFQCPSRCSKR  56

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            C +T + KPC+FFCQKCC KCLCVPPG YGNK +CPCYNNWKT++GGPKCP
Sbjct  57   CKRTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAICPCYNNWKTQQGGPKCP  107



>gb|EPS67879.1| hypothetical protein M569_06897, partial [Genlisea aurea]
Length=60

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  611  ECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            EC+P+CS RCS+T+FKKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK GGPKCP
Sbjct  1    ECNPRCSNRCSRTSFKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKEGGPKCP  60



>ref|XP_003618498.1| Gibberellin-regulated protein [Medicago truncatula]
 gb|AES74716.1| gibberellin-regulated family protein [Medicago truncatula]
Length=107

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 71/111 (64%), Gaps = 4/111 (4%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++ +  F + +  I       MA+H        + + YG   GSL+  +C  +CS R
Sbjct  1    MARLVVV--FILVLIAISMLQTVVMASHGHGGHHYNDKKKYG--PGSLKSYQCPSQCSRR  56

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            C  T + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKT++GGPKCP
Sbjct  57   CKNTQYHKPCMFFCQKCCNKCLCVPPGYYGNKAVCPCYNNWKTQQGGPKCP  107



>emb|CDP01621.1| unnamed protein product [Coffea canephora]
Length=98

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 2/71 (3%)
 Frame = -2

Query  638  VTEG--SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            V EG   L P++CSP+C++RCS T+ KKPC+FFC KCCA CLCVPPGTYGNKQ CPCYNN
Sbjct  28   VAEGYNRLHPRDCSPRCTYRCSGTSHKKPCMFFCLKCCATCLCVPPGTYGNKQACPCYNN  87

Query  464  WKTKRGGPKCP  432
            WKTK GGPKCP
Sbjct  88   WKTKEGGPKCP  98



>ref|XP_007138184.1| hypothetical protein PHAVU_009G187400g [Phaseolus vulgaris]
 gb|ESW10178.1| hypothetical protein PHAVU_009G187400g [Phaseolus vulgaris]
Length=112

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = -2

Query  719  VIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQ  540
            +I  Q  A+ AA+       G+ R YG   GSLR  +C  +C+ RCS+T + KPC+FFCQ
Sbjct  19   MITTQVMANDAAYHLDRSNNGSGRNYG--PGSLRSSQCPSECTRRCSQTQYHKPCMFFCQ  76

Query  539  KCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            KCC  CLCVPPG YGNK VCPCYNNWKTKRGGPKCP
Sbjct  77   KCCRSCLCVPPGYYGNKSVCPCYNNWKTKRGGPKCP  112



>ref|XP_007139576.1| hypothetical protein PHAVU_008G041200g [Phaseolus vulgaris]
 gb|ESW11570.1| hypothetical protein PHAVU_008G041200g [Phaseolus vulgaris]
Length=109

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = -2

Query  776  SMAK--MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECS  603
            +MAK   A +L ++  S+   V+M       AA+        N   YG   GS++  +C 
Sbjct  2    AMAKFFAAMILALIAISMLQTVVM-------AANGHGDHLNDNKSKYG--SGSVKSYQCP  52

Query  602  PKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             +CS RCS+T + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  53   SQCSRRCSRTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  109



>ref|XP_011098626.1| PREDICTED: gibberellin-regulated protein 4-like [Sesamum indicum]
Length=106

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 71/108 (66%), Gaps = 5/108 (5%)
 Frame = -2

Query  746  ILKFSIFIFVIMFQN---QASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSK  576
            + KF   +FV +      Q  + A +S    L N   YG   GSL+  +C  +CS RCSK
Sbjct  1    MAKFFALVFVALLAISMLQIPVTAMASEESYLSNKSRYG--PGSLKSFQCPSQCSRRCSK  58

Query  575  TAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            T + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  59   TQYHKPCMFFCQKCCRKCLCVPPGFYGNKAVCPCYNNWKTKEGGPKCP  106



>ref|XP_004241582.1| PREDICTED: gibberellin-regulated protein 6-like [Solanum lycopersicum]
Length=104

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+P +C P+C+ RCSKT + KPC+FFCQKCC KCLCVPPGTYGNK VCPCYNNWKTK 
Sbjct  39   GSLKPSQCLPQCTRRCSKTQYHKPCMFFCQKCCNKCLCVPPGTYGNKAVCPCYNNWKTKE  98

Query  449  GGPKCP  432
            GGPKCP
Sbjct  99   GGPKCP  104



>ref|XP_010469795.1| PREDICTED: gibberellin-regulated protein 12-like [Camelina sativa]
Length=106

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++ +   S  +  I F N   +      P      R      GSLRP+EC  +C  R
Sbjct  1    MAKLIVVFIVSCLLLAIQFSNAEELERPGEAPAIYKMGRG-----GSLRPEECPAECQRR  55

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS+T+ KKPCLF+C KCC  CLCVP GTYG+K+ CPCY+NW+TK GGPKCP
Sbjct  56   CSETSHKKPCLFYCNKCCNTCLCVPSGTYGHKEECPCYDNWRTKEGGPKCP  106



>ref|XP_006390402.1| hypothetical protein EUTSA_v10019355mg [Eutrema salsugineum]
 dbj|BAJ34528.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27688.1| hypothetical protein EUTSA_v10019355mg [Eutrema salsugineum]
Length=101

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 10/111 (9%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++T L F   +F   F   +  A +   P+  G         GSL+  +C  +C+ R
Sbjct  1    MAKLVTYLLFITILFSFTFLTMSKEAEYH--PERYG--------PGSLKSYQCGGECTRR  50

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T + KPC+FFCQKCCAKCLCVPPG YGNKQVCPCYNNWKT++GGPKCP
Sbjct  51   CSNTQYHKPCMFFCQKCCAKCLCVPPGFYGNKQVCPCYNNWKTQQGGPKCP  101



>ref|XP_006354781.1| PREDICTED: gibberellin-regulated protein 6-like [Solanum tuberosum]
Length=103

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 2/73 (3%)
 Frame = -2

Query  650  RMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCY  471
            + YG   GSL+P +C P+C+ RCSKT + KPC+FFCQKCC KCLCVPPGTYGNK VCPCY
Sbjct  33   KKYG--PGSLKPSQCLPQCTRRCSKTQYHKPCMFFCQKCCNKCLCVPPGTYGNKAVCPCY  90

Query  470  NNWKTKRGGPKCP  432
            NNWKTK GGPKCP
Sbjct  91   NNWKTKEGGPKCP  103



>gb|AGE15501.1| GA-stimulated transcript-like protein 5 [Gossypium hirsutum]
 gb|KHG02115.1| Gibberellin-regulated 4 -like protein [Gossypium arboreum]
Length=106

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 70/114 (61%), Gaps = 8/114 (7%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK+     +   +I +  +M         H        + + YG   GSL+  +C  +C
Sbjct  1    MAKLVAAFFLALIAISMLQVMVLASHGHGGHHY------DQKHYG--PGSLKSYQCPSQC  52

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            S RCSKT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  53   SRRCSKTQYHKPCMFFCQKCCNKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  106



>ref|NP_177605.2| gibberellin-regulated protein 6 [Arabidopsis thaliana]
 sp|Q6NMQ7.1|GASA6_ARATH RecName: Full=Gibberellin-regulated protein 6; AltName: Full=GAST1 
protein homolog 6; Flags: Precursor [Arabidopsis thaliana]
 gb|AAS47605.1| At1g74670 [Arabidopsis thaliana]
 gb|AEE35620.1| gibberellin-regulated protein 6 [Arabidopsis thaliana]
Length=101

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 70/114 (61%), Gaps = 13/114 (11%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK+ T   +L        +    +A     S  P             GSL+  +C  +C
Sbjct  1    MAKLITSFLLLTILFTFVCLTMSKEAEYHPESYGP-------------GSLKSYQCGGQC  47

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCS T + KPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++GGPKCP
Sbjct  48   TRRCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  101



>gb|AAQ57667.2| Gasa4-like protein [Pelargonium zonale]
Length=106

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 3/87 (3%)
 Frame = -2

Query  692  MAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCV  513
            MA++    Q L  NR YG   GSL+  +C+P+C+ RCSKT + KPC+FFCQKCC KCLCV
Sbjct  23   MASNGELGQSLSKNR-YG--PGSLKSSQCNPECTRRCSKTQYHKPCMFFCQKCCRKCLCV  79

Query  512  PPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            PPG YGNK VCPCYNNWKT++GGPKCP
Sbjct  80   PPGFYGNKAVCPCYNNWKTQQGGPKCP  106



>ref|NP_001149114.1| GAST1 protein precursor [Zea mays]
 gb|ACG34244.1| GAST1 protein precursor [Zea mays]
Length=129

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
            +G+L+P +C  +C  RCSKT  KKPCLFFC KCCAKCLCVPPGTYGNK+ CPCYNNWKTK
Sbjct  63   KGNLKPSQCGGECRRRCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKETCPCYNNWKTK  122

Query  452  RGGPKCP  432
            +GGPKCP
Sbjct  123  KGGPKCP  129



>ref|NP_001240084.1| uncharacterized protein LOC100787539 precursor [Glycine max]
 gb|ACU19304.1| unknown [Glycine max]
 gb|ADX36136.1| gibberellic acid-stimulated protein 2 [Glycine soja]
Length=107

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 71/110 (65%), Gaps = 9/110 (8%)
 Frame = -2

Query  761  ATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRC  582
            A +L ++  S+   V+M       AA+        N   YG   GS++  +C  +CS RC
Sbjct  7    AMILALIAISMLQTVVM-------AANEQGGHLYDNKSKYG--SGSVKRYQCPSQCSRRC  57

Query  581  SKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            S+T + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  58   SQTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  107



>ref|XP_010469794.1| PREDICTED: gibberellin-regulated protein 12-like [Camelina sativa]
Length=106

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++ +   S  +  I F N   +      P      R      GSLRP+EC  +C  R
Sbjct  1    MAKLIVVFIVSCLLLAIQFSNAEELERPCEAPAIYKMGRG-----GSLRPEECPAECQRR  55

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS+T+ KKPCLF+C KCC  CLCVP GTYG+K+ CPCY+NW+TK GGPKCP
Sbjct  56   CSETSHKKPCLFYCNKCCNTCLCVPSGTYGHKEECPCYDNWRTKEGGPKCP  106



>ref|XP_003613435.1| GAST1 [Medicago truncatula]
Length=92

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  650  RMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCY  471
              Y   EGSLRPQ+C+PKC +RCSKT+ +K CL +C  CCAKCLCVP GTYGNKQ CPCY
Sbjct  20   ETYAGGEGSLRPQDCAPKCDYRCSKTSHRKACLTYCNLCCAKCLCVPSGTYGNKQECPCY  79

Query  470  NNWKTKRGGPKCP  432
            +NW+ K GGPKCP
Sbjct  80   DNWRNKNGGPKCP  92



>ref|XP_007215190.1| hypothetical protein PRUPE_ppa013959mg [Prunus persica]
 gb|EMJ16389.1| hypothetical protein PRUPE_ppa013959mg [Prunus persica]
Length=94

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 59/72 (82%), Gaps = 2/72 (3%)
 Frame = -2

Query  641  GVTEG--SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
             V EG   LRP EC P+C++RCS T+ KKPC+FFCQKCCA CLCVPPG YGNKQVCPCYN
Sbjct  23   DVAEGYNKLRPSECKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPPGVYGNKQVCPCYN  82

Query  467  NWKTKRGGPKCP  432
            NWKT+ G PKCP
Sbjct  83   NWKTQEGRPKCP  94



>ref|XP_004491797.1| PREDICTED: gibberellin-regulated protein 4-like [Cicer arietinum]
Length=109

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = -2

Query  728  FIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLF  549
             I + M Q    MA +        N R YG   GSL   EC  +CS RC KT + KPC+F
Sbjct  14   LIAISMLQTLV-MAGNDQGGHLYDNKRKYG--PGSLNINECPSQCSRRCGKTQYHKPCMF  70

Query  548  FCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            FCQKCC KCLCVPPG YGNK VCPCYNNWKT++GGPKCP
Sbjct  71   FCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTQQGGPKCP  109



>emb|CAD10105.1| Gip1-like protein [Petunia x hybrida]
Length=105

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 72/111 (65%), Gaps = 6/111 (5%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA ++ I  F + +FVI       +A+H     P   +   G   GSL+P +C P+C+ R
Sbjct  1    MAKLVPI--FLLALFVISMFATTVLASHD----PKRGHHHKGYGPGSLKPSQCLPQCTRR  54

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS+T +   C+ FCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  55   CSQTQYHNACMLFCQKCCNKCLCVPPGFYGNKGVCPCYNNWKTKEGGPKCP  105



>ref|NP_001235467.1| uncharacterized protein LOC100500003 precursor [Glycine max]
 gb|ACU14567.1| unknown [Glycine max]
Length=107

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 71/114 (62%), Gaps = 7/114 (6%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK    + +  F+I I   +      MAA+        N   YG   GS++  +C  +C
Sbjct  1    MAKFFAAMILALFAISILQTVV-----MAANEQGGHLYDNKSKYG--SGSVKSYQCPSQC  53

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            S RCS+T + KPC+FFCQKCC  CLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  54   SRRCSQTQYHKPCMFFCQKCCRTCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  107



>ref|XP_010257391.1| PREDICTED: gibberellin-regulated protein 6-like [Nelumbo nucifera]
Length=107

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 73/117 (62%), Gaps = 13/117 (11%)
 Frame = -2

Query  776  SMAKMAT--MLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECS  603
            +MAK     +L +L  S+    ++   +A     S+   P           GSL+  +C 
Sbjct  2    AMAKFVGVMLLVLLAISVLHGTVVSAREAEYHLDSNRSGP-----------GSLKSYQCP  50

Query  602  PKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             +C+ RCSKT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTKRGGPKCP
Sbjct  51   SQCTRRCSKTQYHKPCMFFCQKCCNKCLCVPPGFYGNKGVCPCYNNWKTKRGGPKCP  107



>ref|XP_009614794.1| PREDICTED: gibberellin-regulated protein 6 [Nicotiana tomentosiformis]
 ref|XP_009783483.1| PREDICTED: gibberellin-regulated protein 6-like [Nicotiana sylvestris]
Length=104

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = -2

Query  734  SIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPC  555
            S F+  ++  +  +    ++  Q   +   YG   GSL+P +C P+C+ RCSKT + KPC
Sbjct  6    SFFLLALVAISMVATTVLAADAQYHLDASRYG--PGSLKPSQCLPQCTRRCSKTQYHKPC  63

Query  554  LFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +FFCQKCC  CLCVPPG YGNK VCPCYNNWKT++GGPKCP
Sbjct  64   MFFCQKCCKTCLCVPPGFYGNKGVCPCYNNWKTQQGGPKCP  104



>ref|XP_008229202.1| PREDICTED: protein RSI-1 [Prunus mume]
Length=94

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 59/71 (83%), Gaps = 2/71 (3%)
 Frame = -2

Query  638  VTEG--SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            V EG   LRP EC P+C++RCS T+ KKPC+FFCQKCCA CLCVPPG YGNKQVCPCYNN
Sbjct  24   VAEGYNKLRPSECKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPPGVYGNKQVCPCYNN  83

Query  464  WKTKRGGPKCP  432
            WKT+ G PKCP
Sbjct  84   WKTQEGRPKCP  94



>ref|XP_008800752.1| PREDICTED: protein RSI-1-like [Phoenix dactylifera]
Length=93

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  641  GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNW  462
            G     L+P +C P+C FRCS T+ KKPC+FFC KCCA+CLCVPPGTYGNKQ CPCYNNW
Sbjct  24   GSVHAGLKPSDCQPRCEFRCSATSHKKPCMFFCLKCCAQCLCVPPGTYGNKQACPCYNNW  83

Query  461  KTKRGGPKCP  432
            KTK GG KCP
Sbjct  84   KTKEGGSKCP  93



>ref|XP_006828424.1| hypothetical protein AMTR_s00060p00095260 [Amborella trichopoda]
 gb|ERM95840.1| hypothetical protein AMTR_s00060p00095260 [Amborella trichopoda]
Length=91

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = -2

Query  635  TEGS---LRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
             EGS   LRP ECS KC +RCS T+ KKPCLFFC KCCA CLCVPPGTYGNKQ CPCYNN
Sbjct  21   VEGSTRRLRPSECSDKCQYRCSATSHKKPCLFFCNKCCAVCLCVPPGTYGNKQSCPCYNN  80

Query  464  WKTKRGGPKCP  432
            WKT+ G PKCP
Sbjct  81   WKTQEGRPKCP  91



>ref|XP_006477453.1| PREDICTED: gibberellin-regulated protein 6-like [Citrus sinensis]
 gb|KDO55568.1| hypothetical protein CISIN_1g037011mg [Citrus sinensis]
Length=103

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 11/114 (10%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK   +  +L  ++F   I+   +          Q L +   YG   GSL+  +C  +C
Sbjct  1    MAKAKLVFVLLVAALFSISIVMATET---------QNLLDTNGYG--PGSLKSYQCPSQC  49

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCS+T + KPC+FFCQKCCAKCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  50   TRRCSQTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTKSGGPKCP  103



>ref|XP_009761199.1| PREDICTED: gibberellin-regulated protein 4 [Nicotiana sylvestris]
Length=108

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 74/116 (64%), Gaps = 10/116 (9%)
 Frame = -2

Query  773  MAKMAT--MLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSP  600
            MAK+    +L I+  S+   +++  +Q    AH S      N   YG   GSL+  +C  
Sbjct  1    MAKVRAFFLLAIVAISMLQAIVLAISQQGNEAHHS------NKNRYG--PGSLKSSQCPS  52

Query  599  KCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +C+ RC +T + K C+FFCQKCC KCLCVPPG YGNK +CPCYNNWKTK GGPKCP
Sbjct  53   QCTRRCGRTQYHKACIFFCQKCCRKCLCVPPGYYGNKALCPCYNNWKTKEGGPKCP  108



>emb|CDP19133.1| unnamed protein product [Coffea canephora]
Length=97

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 61/79 (77%), Gaps = 5/79 (6%)
 Frame = -2

Query  668  QPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNK  489
            Q    +R  G +E      EC   C++RCSKTA+KKPC+FFCQKCC KC CVPPGTYGNK
Sbjct  24   QKHDKHRHSGFSEA-----ECPGACTYRCSKTAYKKPCMFFCQKCCFKCRCVPPGTYGNK  78

Query  488  QVCPCYNNWKTKRGGPKCP  432
            QVCPCYNNWKTKRGGPKCP
Sbjct  79   QVCPCYNNWKTKRGGPKCP  97



>gb|AGL92232.1| GASA-like protein GEG2 [Gerbera hybrid cultivar]
Length=100

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 70/104 (67%), Gaps = 10/104 (10%)
 Frame = -2

Query  737  FSIFIFVIMFQN--QASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFK  564
            F++F+  ++  +  QA++ A           R  G   GSL   +C  +C  RCSKT + 
Sbjct  5    FAVFVLALIAISMLQATVLAK--------GGRQNGFGPGSLTSSQCPGQCIRRCSKTQYH  56

Query  563  KPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            KPC+FFCQKCCAKCLCVPPG YGNKQVCPCYNNWKTK GGPKCP
Sbjct  57   KPCMFFCQKCCAKCLCVPPGFYGNKQVCPCYNNWKTKEGGPKCP  100



>ref|XP_003616284.1| GASA5-like protein [Medicago truncatula]
Length=96

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  656  NNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCP  477
            +N         LRPQ+C P+C++RCS T+ KKPC+FFCQKCCA CLCVPPG YGNKQVCP
Sbjct  22   SNVAEAYGRAKLRPQDCKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPPGVYGNKQVCP  81

Query  476  CYNNWKTKRGGPKCP  432
            CYN+WKT+ G PKCP
Sbjct  82   CYNSWKTQEGKPKCP  96



>gb|ACF74297.1| gibberellin-regulated protein [Arachis hypogaea]
Length=107

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = -2

Query  737  FSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKP  558
            F + +  I       MAA+        N   YG   GS++  +C  +CS RC KT + KP
Sbjct  8    FILALIAISMLQTMVMAANGQGGHLYDNKSQYG--PGSVKSYQCPSQCSRRCGKTQYHKP  65

Query  557  CLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            C+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  66   CMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  107



>ref|XP_010538071.1| PREDICTED: gibberellin-regulated protein 6 [Tarenaya hassleriana]
Length=103

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 74/117 (63%), Gaps = 17/117 (15%)
 Frame = -2

Query  773  MAKMAT---MLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECS  603
            MAK+      LT L  S+ I  IM + +A     S  P             GSL+  +C 
Sbjct  1    MAKLIACIIFLTCLCISVVITPIMAK-EAEYHLDSYGP-------------GSLKSSQCP  46

Query  602  PKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             +C  RC KT + KPC+FFCQKCCAKCLCVPPGT+GNKQVCPCYNNWKTKRGGPKCP
Sbjct  47   SQCIRRCGKTQYHKPCMFFCQKCCAKCLCVPPGTFGNKQVCPCYNNWKTKRGGPKCP  103



>ref|XP_006295413.1| hypothetical protein CARUB_v10024510mg [Capsella rubella]
 gb|EOA28311.1| hypothetical protein CARUB_v10024510mg [Capsella rubella]
Length=108

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 68/108 (63%), Gaps = 1/108 (1%)
 Frame = -2

Query  755  MLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSK  576
            M   + F + +  ++   Q S A    +P         G  EGSLR +EC   C++RCS 
Sbjct  2    MKKFILFFVLVSSLLLATQFSNAEEFESPVEAPEIHKMG-GEGSLRIEECPKACAYRCSA  60

Query  575  TAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            T+ KKPCLFFC KCC KCLCVP GTYG+K+ CPCYNNW TK GGPKCP
Sbjct  61   TSHKKPCLFFCNKCCRKCLCVPSGTYGHKEECPCYNNWTTKEGGPKCP  108



>gb|AAC32170.1| GASA5-like protein [Picea mariana]
 gb|AAC32171.1| GASA5-like protein [Picea mariana]
Length=62

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -2

Query  617  PQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPK  438
            P EC  +CS+RCS T+ KKPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++GGPK
Sbjct  1    PSECGQRCSYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPK  60

Query  437  CP  432
            CP
Sbjct  61   CP  62



>ref|XP_009383413.1| PREDICTED: gibberellin-regulated protein 12 [Musa acuminata subsp. 
malaccensis]
Length=73

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
            EGSLRP+EC+ KC +RCS+T+ KKPCLFFC+ CCAKCLCVP GTYG+K+ CPCYNNWKTK
Sbjct  7    EGSLRPEECAGKCEYRCSETSHKKPCLFFCKMCCAKCLCVPSGTYGHKEECPCYNNWKTK  66

Query  452  RGGPKCP  432
             G PKCP
Sbjct  67   EGKPKCP  73



>gb|AFK34043.1| unknown [Medicago truncatula]
 gb|KEH33468.1| gibberellin-regulated family protein [Medicago truncatula]
Length=103

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 76/112 (68%), Gaps = 10/112 (9%)
 Frame = -2

Query  764  MATMLTILKFSIF-IFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSF  588
            MA ++ +L  ++  I +I  Q  A  AA   +    GN   YG   GSL+  +C  +C+ 
Sbjct  1    MAKLVCVLFLALLCIAMITTQVMAKDAAQYGS----GN---YG--PGSLQSYQCPSQCTR  51

Query  587  RCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            RC +T + KPC+FFCQKCCAKCLCVPPG YGNK VCPCYNNWKTKRGGPKCP
Sbjct  52   RCGQTQYHKPCMFFCQKCCAKCLCVPPGYYGNKSVCPCYNNWKTKRGGPKCP  103



>gb|AAV84588.1| Gip1-like protein [Populus tomentosa]
 gb|AAV84589.1| Gip1-like protein [Populus tomentosa]
Length=106

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK+  +  +   +I +   +         H        N   YG   GSL+  +C  +C
Sbjct  1    MAKLVAVFLLALIAISMLQTLVVASHGRGGHHQ------NKNQYG--PGSLKSFQCPSQC  52

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCSKT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  53   TRRCSKTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  106



>gb|AFW55883.1| GAST1 protein [Zea mays]
Length=129

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
            +G+L+P +C  +C  RCSKT  KKPCLFFC KCCAKCLCVPPGTYGNK+ CPCYNNWKTK
Sbjct  63   KGNLKPSQCGGECRRRCSKTHHKKPCLFFCNKCCAKCLCVPPGTYGNKETCPCYNNWKTK  122

Query  452  RGGPKCP  432
            +GGPKCP
Sbjct  123  KGGPKCP  129



>ref|XP_009410001.1| PREDICTED: gibberellin-regulated protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=109

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 71/114 (62%), Gaps = 5/114 (4%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK+  ++ I   +I I     +  A    HS       +N      +G+LR  +C  +C
Sbjct  1    MAKLVVLVAIALLAISIADSGSKVLAKATEHSEEEYMPASN-----GQGTLRTYQCPSQC  55

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCS+T + KPC+FFCQKCC KCLCVP G YGNK  CPCYNNWKTKRGGPKCP
Sbjct  56   TRRCSRTQYHKPCMFFCQKCCMKCLCVPSGFYGNKGECPCYNNWKTKRGGPKCP  109



>ref|XP_007141900.1| hypothetical protein PHAVU_008G235300g [Phaseolus vulgaris]
 gb|ESW13894.1| hypothetical protein PHAVU_008G235300g [Phaseolus vulgaris]
Length=97

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
             G+LR  +C  +C++RCS T+ KKPC+FFCQKCCAKCLCVPPGTYGNKQ+CPCYN WKTK
Sbjct  31   SGTLRASDCKGRCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGTYGNKQLCPCYNTWKTK  90

Query  452  RGGPKCP  432
             G PKCP
Sbjct  91   EGRPKCP  97



>gb|AGL92234.1| GASA-like protein GEG4 [Gerbera hybrid cultivar]
Length=96

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 2/71 (3%)
 Frame = -2

Query  638  VTEGS--LRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            V +GS  LRPQ+C  KC++RCS T+ KKPC+FFCQKCCAKCLCVPPG YGNKQ C CYNN
Sbjct  26   VAQGSKRLRPQDCKGKCTYRCSATSHKKPCMFFCQKCCAKCLCVPPGVYGNKQTCACYNN  85

Query  464  WKTKRGGPKCP  432
            WKT+ G PKCP
Sbjct  86   WKTQEGKPKCP  96



>gb|AGM20679.1| GASA5 [Populus tomentosa]
Length=95

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  638  VTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWK  459
            +    LRP EC P+C++RCS T+ KKPC+FFC KCCA CLCVPPGTYGNK+ CPCYNNWK
Sbjct  27   IHGAKLRPSECKPRCNYRCSATSHKKPCMFFCLKCCATCLCVPPGTYGNKETCPCYNNWK  86

Query  458  TKRGGPKCP  432
            TK G PKCP
Sbjct  87   TKEGRPKCP  95



>ref|XP_006383339.1| gibberellin-regulated protein 5 [Populus trichocarpa]
 gb|ERP61136.1| gibberellin-regulated protein 5 [Populus trichocarpa]
Length=95

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  638  VTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWK  459
            +    LRP EC P+C++RCS T+ KKPC+FFC KCCA CLCVPPGTYGNK+ CPCYNNWK
Sbjct  27   IHGAKLRPSECKPRCNYRCSATSHKKPCMFFCLKCCATCLCVPPGTYGNKETCPCYNNWK  86

Query  458  TKRGGPKCP  432
            TK G PKCP
Sbjct  87   TKEGRPKCP  95



>ref|XP_010248044.1| PREDICTED: gibberellin-regulated protein 6-like [Nelumbo nucifera]
Length=111

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = -2

Query  737  FSIFIFVIMFQ---NQASMAAHSSTPQPLG--NNRMYGVTEGSLRPQECSPKCSFRCSKT  573
            F +FI ++ F    +   +       Q L    N+ +          EC   C++RCS+T
Sbjct  5    FHVFILLLCFAALTSSTQVWVEKQLEQSLVTVGNQQHKHRHSGFSQAECPGACTYRCSQT  64

Query  572  AFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            A+KKPC+FFCQKCC KC CVPPGTYG+K+VCPCYNNWKTKRGGPKCP
Sbjct  65   AYKKPCMFFCQKCCFKCRCVPPGTYGHKEVCPCYNNWKTKRGGPKCP  111



>gb|KDP31251.1| hypothetical protein JCGZ_11627 [Jatropha curcas]
Length=108

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 62/84 (74%), Gaps = 5/84 (6%)
 Frame = -2

Query  668  QPLGNNRMYGVTEG-----SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPG  504
            Q + N+  Y +  G     SL+  +C  +C+ RCSKT + KPC+FFCQKCC KCLCVPPG
Sbjct  25   QVMANDTQYHLDSGRYGPGSLKSYQCPSECTRRCSKTQYHKPCMFFCQKCCTKCLCVPPG  84

Query  503  TYGNKQVCPCYNNWKTKRGGPKCP  432
             YGNK VCPCYNNWKTKRGGPKCP
Sbjct  85   FYGNKSVCPCYNNWKTKRGGPKCP  108



>ref|XP_011021371.1| PREDICTED: protein RSI-1 [Populus euphratica]
Length=95

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  638  VTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWK  459
            +    LRP EC P+C++RCS T+ KKPC+FFC KCCA CLCVPPGTYGNK+ CPCYNNWK
Sbjct  27   IHGAKLRPSECKPRCNYRCSATSHKKPCMFFCLKCCATCLCVPPGTYGNKETCPCYNNWK  86

Query  458  TKRGGPKCP  432
            TK G PKCP
Sbjct  87   TKEGRPKCP  95



>ref|NP_001237498.1| uncharacterized protein LOC100306354 precursor [Glycine max]
 gb|ACU14488.1| unknown [Glycine max]
Length=106

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 10/115 (9%)
 Frame = -2

Query  776  SMAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPK  597
            +MAK+  +L +L F + I +I  Q  A+ +AH        + R YG   GSL+  +C  +
Sbjct  2    AMAKLVCVL-LLAF-LGISMITTQVMATDSAHHL------DGRSYG--PGSLKTSQCPSE  51

Query  596  CSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            C+ RC +T + KPC+FFCQ+CC  CLCVPPG YGNK VCPCYNNWK KRGGPKCP
Sbjct  52   CTRRCCQTQYHKPCMFFCQECCKVCLCVPPGYYGNKSVCPCYNNWKNKRGGPKCP  106



>gb|KFK41905.1| hypothetical protein AALP_AA2G187500 [Arabis alpina]
Length=81

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +C+ RCS T ++KPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++
Sbjct  16   GSLKSYQCGGECTRRCSNTKYRKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQ  75

Query  449  GGPKCP  432
            GGPKCP
Sbjct  76   GGPKCP  81



>ref|XP_004489937.1| PREDICTED: gibberellin-regulated protein 12-like [Cicer arietinum]
Length=92

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            +YG  EGSLRPQ+C   C++RCS T +KK CL +C  CCAKCLCVP GTYG+K+ CPCYN
Sbjct  21   VYGGGEGSLRPQDCPGACAYRCSATQYKKACLTYCNLCCAKCLCVPSGTYGHKEECPCYN  80

Query  467  NWKTKRGGPKCP  432
            NW+TK GGPKCP
Sbjct  81   NWRTKEGGPKCP  92



>ref|XP_010937130.1| PREDICTED: gibberellin-regulated protein 6 [Elaeis guineensis]
Length=113

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +CS RCSKT ++KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTKR
Sbjct  48   GSLKSSQCPSQCSRRCSKTQYRKPCMFFCQKCCMKCLCVPPGFYGNKSVCPCYNNWKTKR  107

Query  449  GGPKCP  432
            GGPKCP
Sbjct  108  GGPKCP  113



>gb|AAT42201.1| gibberellin-stimulated protein [Oryza sativa Japonica Group]
Length=110

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -2

Query  626  SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRG  447
            +LRP ECSPKC+ RCS T +KK CL FC KCCAKCLCVPPGTYGNK  CPCYNNWKTK G
Sbjct  46   NLRPWECSPKCAGRCSNTQYKKACLTFCNKCCAKCLCVPPGTYGNKGACPCYNNWKTKEG  105

Query  446  GPKCP  432
            GPKCP
Sbjct  106  GPKCP  110



>ref|XP_002284937.1| PREDICTED: gibberellin-regulated protein 6 [Vitis vinifera]
 emb|CBI15224.3| unnamed protein product [Vitis vinifera]
Length=104

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 16/117 (14%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIF---VIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECS  603
            MAK+  +L +  FSI +    V+  + Q  + + S  P             GSL+  +C 
Sbjct  1    MAKLVPLLLLALFSISMVATKVMAKEAQYHLDSGSYGP-------------GSLKSNQCP  47

Query  602  PKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             +C+ RCSKT + KPC+FFCQKCCAKCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  48   SQCTRRCSKTQYHKPCMFFCQKCCAKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  104



>ref|XP_009383268.1| PREDICTED: gibberellin-regulated protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=126

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 68/104 (65%), Gaps = 5/104 (5%)
 Frame = -2

Query  728  FIFVIMFQNQASMAAHSST--PQPLG---NNRMYGVTEGSLRPQECSPKCSFRCSKTAFK  564
             +F+I+    A+MAA +     +  G     + +          EC   C +RCSKTA+K
Sbjct  23   LLFLILLVCCAAMAASAKDLPAEEFGVSLAEKGHKHKHSGFSEAECPGACQYRCSKTAYK  82

Query  563  KPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            KPCLFFCQKCC KC CVPPGTY +K+VCPCYNNWKTKRGGPKCP
Sbjct  83   KPCLFFCQKCCFKCRCVPPGTYAHKEVCPCYNNWKTKRGGPKCP  126



>gb|AAG52379.1|AC011765_31 GAST1-like protein; 109761-110213 [Arabidopsis thaliana]
Length=80

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +C+ RCS T + KPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++
Sbjct  15   GSLKSYQCGGQCTRRCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQ  74

Query  449  GGPKCP  432
            GGPKCP
Sbjct  75   GGPKCP  80



>ref|XP_008792485.1| PREDICTED: gibberellin-regulated protein 5-like [Phoenix dactylifera]
Length=111

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 5/75 (7%)
 Frame = -2

Query  656  NNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCP  477
            +++  G +EG     EC   C FRCSKTA+KKPC+FFCQKCC KC CVPPGTY +K+VCP
Sbjct  42   HHKHSGFSEG-----ECPDACQFRCSKTAYKKPCMFFCQKCCFKCRCVPPGTYAHKEVCP  96

Query  476  CYNNWKTKRGGPKCP  432
            CYNNWKTKRGGPKCP
Sbjct  97   CYNNWKTKRGGPKCP  111



>gb|EAZ36571.1| hypothetical protein OsJ_20910 [Oryza sativa Japonica Group]
Length=106

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -2

Query  626  SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRG  447
            +LRP ECSPKC+ RCS T +KK CL FC KCCAKCLCVPPGTYGNK  CPCYNNWKTK G
Sbjct  42   NLRPWECSPKCAGRCSNTQYKKACLTFCNKCCAKCLCVPPGTYGNKGACPCYNNWKTKEG  101

Query  446  GPKCP  432
            GPKCP
Sbjct  102  GPKCP  106



>ref|XP_003621217.1| Gibberellin-regulated protein [Medicago truncatula]
 gb|AES77435.1| gibberellin-regulated family protein [Medicago truncatula]
 gb|AFK44961.1| unknown [Medicago truncatula]
Length=109

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = -2

Query  728  FIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLF  549
             I + M Q    MA +        N   YG   GSL+  +C  +CS RC +T + KPC+F
Sbjct  14   LIAISMLQTLV-MAGNDQGGHLYDNKSQYG--PGSLKSYQCPSQCSRRCGQTQYHKPCMF  70

Query  548  FCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            FCQKCC KCLCVPPG YGNK VCPCYNNWKT++GGPKCP
Sbjct  71   FCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTQQGGPKCP  109



>gb|EAZ00446.1| hypothetical protein OsI_22466 [Oryza sativa Indica Group]
Length=112

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -2

Query  626  SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRG  447
            +LRP ECSPKC+ RCS T +KK CL FC KCCAKCLCVPPGTYGNK  CPCYNNWKTK G
Sbjct  48   NLRPWECSPKCAGRCSNTQYKKACLTFCNKCCAKCLCVPPGTYGNKGACPCYNNWKTKEG  107

Query  446  GPKCP  432
            GPKCP
Sbjct  108  GPKCP  112



>ref|NP_001234666.1| protein RSI-1 precursor [Solanum lycopersicum]
 sp|P47926.1|RSI1_SOLLC RecName: Full=Protein RSI-1; AltName: Full=TR132; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA20129.1| RSI-1 protein [Solanum lycopersicum]
 gb|AAA20130.1| RSI-1 protein [Solanum lycopersicum]
Length=96

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = -2

Query  641  GVTEG--SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
             V EG   LRP +C P+C++RCS T+ KKPC+FFCQKCCA CLCVP G YGNKQ CPCYN
Sbjct  25   NVVEGYNKLRPTDCKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYN  84

Query  467  NWKTKRGGPKCP  432
            NWKT+ G PKCP
Sbjct  85   NWKTQEGKPKCP  96



>ref|XP_009339293.1| PREDICTED: gibberellin-regulated protein 6-like [Pyrus x bretschneideri]
Length=107

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -2

Query  695  SMAAHSSTPQPLGNNRMY--GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKC  522
            SMAA     +    N++   G   GSL+  +C  +C+ RCS+T + KPC+FFCQKCCAKC
Sbjct  18   SMAATQVMAKEEARNQLDSGGYGPGSLKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCAKC  77

Query  521  LCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            LCVPPG YGNK VCPCYNNWKT++GGPKCP
Sbjct  78   LCVPPGFYGNKAVCPCYNNWKTQQGGPKCP  107



>ref|XP_008393156.1| PREDICTED: gibberellin-regulated protein 6 [Malus domestica]
Length=107

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -2

Query  695  SMAAHSSTPQPLGNNRMY--GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKC  522
            SMAA     +    N++   G   GSL+  +C  +C+ RCS+T + KPC+FFCQKCCAKC
Sbjct  18   SMAATQVMAKEQARNQLDSGGYGPGSLKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCAKC  77

Query  521  LCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            LCVPPG YGNK VCPCYNNWKT++GGPKCP
Sbjct  78   LCVPPGFYGNKAVCPCYNNWKTQQGGPKCP  107



>ref|NP_001057346.1| Os06g0266800 [Oryza sativa Japonica Group]
 dbj|BAD53514.1| putative gibberellin induced protein 3 [Oryza sativa Japonica 
Group]
 dbj|BAD54389.1| putative gibberellin induced protein 3 [Oryza sativa Japonica 
Group]
 dbj|BAF19260.1| Os06g0266800 [Oryza sativa Japonica Group]
Length=84

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -2

Query  626  SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRG  447
            +LRP ECSPKC+ RCS T +KK CL FC KCCAKCLCVPPGTYGNK  CPCYNNWKTK G
Sbjct  20   NLRPWECSPKCAGRCSNTQYKKACLTFCNKCCAKCLCVPPGTYGNKGACPCYNNWKTKEG  79

Query  446  GPKCP  432
            GPKCP
Sbjct  80   GPKCP  84



>ref|XP_004517034.1| PREDICTED: gibberellin-regulated protein 12-like [Cicer arietinum]
Length=92

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  644  YGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            Y   EGSLRP+EC+  C+ RCS T +K+ CL +C  CCAKCLCVP GTYG+K+ CPCYNN
Sbjct  22   YAGKEGSLRPKECATACALRCSATQYKEACLTYCNLCCAKCLCVPSGTYGHKEECPCYNN  81

Query  464  WKTKRGGPKCP  432
            WKTK+GGPKCP
Sbjct  82   WKTKKGGPKCP  92



>ref|XP_002887551.1| hypothetical protein ARALYDRAFT_895333 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63810.1| hypothetical protein ARALYDRAFT_895333 [Arabidopsis lyrata subsp. 
lyrata]
Length=101

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +C+ RC  T + KPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++
Sbjct  36   GSLKSYQCGGQCTRRCGNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQ  95

Query  449  GGPKCP  432
            GGPKCP
Sbjct  96   GGPKCP  101



>ref|XP_004517033.1| PREDICTED: gibberellin-regulated protein 12-like [Cicer arietinum]
Length=92

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -2

Query  653  NRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPC  474
            N  Y   EGSLRP+EC+  C  RCS T +KK CL +C  CCAKCLCVP GTYG+K+ C C
Sbjct  19   NDTYAGKEGSLRPEECAAACDQRCSATQYKKACLTYCNLCCAKCLCVPSGTYGHKEECAC  78

Query  473  YNNWKTKRGGPKCP  432
            YNNWKTK GGPKCP
Sbjct  79   YNNWKTKEGGPKCP  92



>ref|XP_006364638.1| PREDICTED: protein RSI-1-like [Solanum tuberosum]
Length=96

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 58/71 (82%), Gaps = 2/71 (3%)
 Frame = -2

Query  638  VTEG--SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            V EG   LRP++C PKC++RCS T+ KKPC+FFCQKCCA CLCVP G YGNKQ CPCYNN
Sbjct  26   VVEGYNKLRPRDCKPKCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYNN  85

Query  464  WKTKRGGPKCP  432
            WKT+ G PKCP
Sbjct  86   WKTQEGKPKCP  96



>ref|XP_006299108.1| hypothetical protein CARUB_v10015247mg [Capsella rubella]
 gb|EOA32006.1| hypothetical protein CARUB_v10015247mg [Capsella rubella]
Length=83

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -2

Query  611  ECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             C P+C  RCS T +KKPCLFFC KCCAKCLCVPPGTYGNKQVCPCYNNWKT+ GGPKCP
Sbjct  24   HCGPRCGDRCSNTQYKKPCLFFCNKCCAKCLCVPPGTYGNKQVCPCYNNWKTQSGGPKCP  83



>ref|XP_011035751.1| PREDICTED: gibberellin-regulated protein 4 [Populus euphratica]
Length=106

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 68/114 (60%), Gaps = 8/114 (7%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK   +  +   +I +   +         H        N   YG   GSL+  +C  +C
Sbjct  1    MAKFVAVFLLALIAISMLQTLVVASHGRGGHHR------NKNKYG--PGSLKSFQCPSQC  52

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCS+T + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  53   TRRCSQTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP  106



>ref|XP_008807353.1| PREDICTED: gibberellin-regulated protein 6-like [Phoenix dactylifera]
Length=107

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 70/104 (67%), Gaps = 9/104 (9%)
 Frame = -2

Query  743  LKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFK  564
            + FS+    I+ + +  +A  S   +       YG   GSL+  +C  +CS RCS+T + 
Sbjct  13   ITFSMVSCGIVHEVEVELAKKSQRGR-------YG--PGSLKDYQCPGECSRRCSRTQYH  63

Query  563  KPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            KPC+FFCQKCC KCLCVPPG YGNKQVC CYNNWKTKRGGPKCP
Sbjct  64   KPCMFFCQKCCRKCLCVPPGFYGNKQVCSCYNNWKTKRGGPKCP  107



>ref|XP_010258350.1| PREDICTED: gibberellin-regulated protein 6 isoform X2 [Nelumbo 
nucifera]
Length=93

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +C+ RCSKT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTKR
Sbjct  28   GSLKSYQCPSQCTRRCSKTQYHKPCMFFCQKCCRKCLCVPPGFYGNKGVCPCYNNWKTKR  87

Query  449  GGPKCP  432
            GGPKCP
Sbjct  88   GGPKCP  93



>ref|XP_010091518.1| hypothetical protein L484_015945 [Morus notabilis]
 gb|EXB44688.1| hypothetical protein L484_015945 [Morus notabilis]
Length=111

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +C+ RCSKT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTKR
Sbjct  46   GSLKSYQCPSECTRRCSKTQYHKPCMFFCQKCCNKCLCVPPGFYGNKAVCPCYNNWKTKR  105

Query  449  GGPKCP  432
            GGPKCP
Sbjct  106  GGPKCP  111



>ref|XP_003523021.1| PREDICTED: gibberellin-regulated protein 4 [Glycine max]
Length=106

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 9/112 (8%)
 Frame = -2

Query  764  MATMLTILKFSIF-IFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSF  588
            MA +  +L  ++  I +I  Q  A+ +A+        + R YG   GSL+  +C  +C+ 
Sbjct  3    MAKVFCVLLLALLGISMITTQVMATDSAYHL------DGRNYG--PGSLKSSQCPSECTR  54

Query  587  RCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            RCS+T + KPC+ FC++CC +CLCVPPG YGNK VCPCYNNWKTKRGGPKCP
Sbjct  55   RCSQTQYHKPCMVFCKQCCKRCLCVPPGYYGNKSVCPCYNNWKTKRGGPKCP  106



>ref|XP_010931460.1| PREDICTED: gibberellin-regulated protein 6-like [Elaeis guineensis]
Length=107

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = -2

Query  743  LKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFK  564
            + FS+ +  I  + +  +A  S   +            GSL+  +C  +CS RCS+T + 
Sbjct  13   ITFSMVLCGIGHEVEVELAKKSQGGRH---------GSGSLKSYQCPGECSRRCSRTQYH  63

Query  563  KPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            KPC+FFCQKCC KCLCVPPG YGNKQVC CYNNWKTKRGGPKCP
Sbjct  64   KPCMFFCQKCCRKCLCVPPGFYGNKQVCSCYNNWKTKRGGPKCP  107



>ref|XP_009410471.1| PREDICTED: gibberellin-regulated protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=136

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = -2

Query  659  GNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVC  480
               R YG   GSL+  +C  +C+ RCS+T + KPC+FFCQKCC KCLCVPPG YGNKQVC
Sbjct  63   AQKRQYG--SGSLKSYQCPGECTRRCSRTQYHKPCMFFCQKCCRKCLCVPPGFYGNKQVC  120

Query  479  PCYNNWKTKRGGPKCP  432
             CYNNWKTKRGGPKCP
Sbjct  121  SCYNNWKTKRGGPKCP  136



>ref|XP_002460210.1| hypothetical protein SORBIDRAFT_02g024660 [Sorghum bicolor]
 gb|EER96731.1| hypothetical protein SORBIDRAFT_02g024660 [Sorghum bicolor]
Length=115

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 65/93 (70%), Gaps = 5/93 (5%)
 Frame = -2

Query  695  SMAAHS--STPQPLGNNRMYGVT---EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCC  531
            SMA H   +      ++ +Y V+   +GSL+  +CSP+CS RC  T +KKPCLFFC KCC
Sbjct  23   SMAEHEVLAKGSDEHDDNVYQVSKGGQGSLKSYQCSPQCSRRCGNTRYKKPCLFFCNKCC  82

Query  530  AKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
              CLCVP G YGNK  CPCYNNWKTKRGGPKCP
Sbjct  83   NTCLCVPSGYYGNKGECPCYNNWKTKRGGPKCP  115



>ref|XP_008784232.1| PREDICTED: gibberellin-regulated protein 6 [Phoenix dactylifera]
Length=113

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +CS RCS T + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTKR
Sbjct  48   GSLKSNQCPSQCSRRCSNTQYHKPCMFFCQKCCMKCLCVPPGFYGNKGVCPCYNNWKTKR  107

Query  449  GGPKCP  432
            GGPKCP
Sbjct  108  GGPKCP  113



>ref|XP_004299361.1| PREDICTED: gibberellin-regulated protein 6-like [Fragaria vesca 
subsp. vesca]
Length=100

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +C+ RCSKT + KPC+FFCQKCCAKCLCVPPG YGNK VCPCYNNWKT++
Sbjct  35   GSLKSSQCPSQCTRRCSKTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQ  94

Query  449  GGPKCP  432
            GGPKCP
Sbjct  95   GGPKCP  100



>ref|XP_004140359.1| PREDICTED: protein RSI-1-like [Cucumis sativus]
Length=122

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  611  ECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +C PKCS+RCS T  +KPC+FFCQKCCAKCLCVP GTYGNKQ CPCYNNWKT++GGPKCP
Sbjct  63   DCKPKCSYRCSATTHRKPCMFFCQKCCAKCLCVPSGTYGNKQECPCYNNWKTQQGGPKCP  122



>dbj|BAF00966.1| GAST1-like protein [Arabidopsis thaliana]
Length=78

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -2

Query  611  ECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            EC  +C+ RCS T + KPC+FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKT++GGPKCP
Sbjct  19   ECGGQCTRRCSNTKYHKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP  78



>gb|ACM47319.1| Gasa4-like protein [Rosa x damascena]
 gb|ACM47320.1| Gasa4-like protein [Rosa x damascena]
Length=108

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +C+ RCS+T + KPC+FFCQKCC+KCLCVPPG YGNK VCPCYNNWKTK 
Sbjct  43   GSLKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCSKCLCVPPGYYGNKAVCPCYNNWKTKE  102

Query  449  GGPKCP  432
            GGPKCP
Sbjct  103  GGPKCP  108



>ref|XP_010274082.1| PREDICTED: gibberellin-regulated protein 12 [Nelumbo nucifera]
Length=124

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 67/104 (64%), Gaps = 6/104 (6%)
 Frame = -2

Query  737  FSIFIFVIMFQNQASMAAHSSTPQPLGNNRMY--GVTEGSLRPQECSPKCSFRCSKTAFK  564
            F +    +MF  + S+A     P   G N  Y     EGS+R ++C  +C+ RCS T+ K
Sbjct  25   FLLIFLALMFVMEVSLAE----PVDNGQNTTYHPEGAEGSVRREDCPKECARRCSATSHK  80

Query  563  KPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            KPCLFFC  CC KCLCVP GTYG+K  CPCYNNWKT+RG PKCP
Sbjct  81   KPCLFFCNMCCDKCLCVPSGTYGHKGECPCYNNWKTQRGTPKCP  124



>ref|XP_006407600.1| hypothetical protein EUTSA_v10021857mg [Eutrema salsugineum]
 gb|ESQ49053.1| hypothetical protein EUTSA_v10021857mg [Eutrema salsugineum]
Length=83

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  611  ECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             C P+C  RCS T +KKPCLFFC KCC KCLCVPPGTYGNKQVCPCYNNWKTK GGPKCP
Sbjct  24   HCRPRCGERCSNTQYKKPCLFFCNKCCTKCLCVPPGTYGNKQVCPCYNNWKTKLGGPKCP  83



>ref|XP_007145559.1| hypothetical protein PHAVU_007G248900g [Phaseolus vulgaris]
 gb|ESW17553.1| hypothetical protein PHAVU_007G248900g [Phaseolus vulgaris]
Length=145

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  653  NRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPC  474
            N+  G +EGSL+PQ+C P+C+ RCS T +KKPCLFFC+KCCAKCLCVPPGTYGNK+VCPC
Sbjct  72   NKNNGTSEGSLKPQDCGPRCAHRCSNTQYKKPCLFFCKKCCAKCLCVPPGTYGNKEVCPC  131

Query  473  YNNWKTKRGGPKCP  432
            YNNWKTKRGGPKCP
Sbjct  132  YNNWKTKRGGPKCP  145



>gb|AGM38075.1| putative gibberellin-regulated GAST1-like protein [Stenocereus 
gummosus]
Length=99

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GS++P +C  +C+ RCSKT + KPC+ FCQKCC KC CVPPG YGNKQVCPCYNNWKTKR
Sbjct  34   GSVKPSQCYGQCTRRCSKTQYHKPCMLFCQKCCRKCECVPPGFYGNKQVCPCYNNWKTKR  93

Query  449  GGPKCP  432
            GGPKCP
Sbjct  94   GGPKCP  99



>ref|XP_007209788.1| hypothetical protein PRUPE_ppa013704mg [Prunus persica]
 gb|EMJ10987.1| hypothetical protein PRUPE_ppa013704mg [Prunus persica]
Length=107

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +C+ RCS+T + KPC+FFCQKCCAKCLCVPPG YGNK VCPCYNNWKT++
Sbjct  42   GSLKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCAKCLCVPPGYYGNKAVCPCYNNWKTQQ  101

Query  449  GGPKCP  432
            GGPKCP
Sbjct  102  GGPKCP  107



>ref|XP_010922895.1| PREDICTED: gibberellin-regulated protein 6-like [Elaeis guineensis]
Length=107

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = -2

Query  647  MYGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYN  468
            MYG   GSL   +C  +CS RCS+T + KPC+FFCQKCC KCLCVPPG YGNKQ+C CYN
Sbjct  38   MYG--PGSLNSYQCPSECSRRCSRTQYHKPCMFFCQKCCRKCLCVPPGFYGNKQLCSCYN  95

Query  467  NWKTKRGGPKCP  432
            NWKTKRGGPKCP
Sbjct  96   NWKTKRGGPKCP  107



>ref|XP_009106131.1| PREDICTED: gibberellin-regulated protein 12-like [Brassica rapa]
 emb|CDY18069.1| BnaA01g23300D [Brassica napus]
Length=104

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 64/111 (58%), Gaps = 7/111 (6%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            M   +T+L    F+F   F N   +   S +    G        EGS++  +C   C  R
Sbjct  1    MTKFITVLIVFSFLFATQFSNANELEYSSESIHTEGG-------EGSVKIGDCPAACDVR  53

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T+ K  CL +C +CC KCLCVP GTYGNKQ CPCYNNWKT+ GGPKCP
Sbjct  54   CSATSHKSACLMYCNQCCKKCLCVPSGTYGNKQECPCYNNWKTQEGGPKCP  104



>ref|XP_010037169.1| PREDICTED: gibberellin-regulated protein 6 [Eucalyptus grandis]
 gb|KCW48837.1| hypothetical protein EUGRSUZ_K02472 [Eucalyptus grandis]
Length=105

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C+ +C  RCS+T ++KPCLFFC KCCAKCLCVPPG YGNKQVCPCYNNWKT++
Sbjct  40   GSLKSYQCAGQCQRRCSQTQYRKPCLFFCNKCCAKCLCVPPGYYGNKQVCPCYNNWKTQQ  99

Query  449  GGPKCP  432
            G PKCP
Sbjct  100  GTPKCP  105



>ref|XP_006421228.1| hypothetical protein CICLE_v10006243mg [Citrus clementina]
 gb|ESR34468.1| hypothetical protein CICLE_v10006243mg [Citrus clementina]
Length=81

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  611  ECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            EC P+C+ RCSKT ++KPCL FCQKCCAKCLCVP G YGNKQ CPCYNNWKTKRGGPKCP
Sbjct  22   ECGPRCTTRCSKTQYRKPCLVFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP  81



>ref|XP_009348406.1| PREDICTED: gibberellin-regulated protein 12-like [Pyrus x bretschneideri]
 ref|XP_009348408.1| PREDICTED: gibberellin-regulated protein 12-like [Pyrus x bretschneideri]
Length=108

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 6/114 (5%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            M +++ + T+L     I  ++F    ++A      Q  G         GSLR ++C   C
Sbjct  1    MGRLSWIPTVL---FVILALIFAIDIALAQKD---QNAGAIDHPNGERGSLRSEDCPEAC  54

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
             +RCS T  KKPC+FF  KCCAKCLCVP GTYG+K+ CPC+NNWKTK GGPKCP
Sbjct  55   KYRCSTTTHKKPCMFFSMKCCAKCLCVPSGTYGHKEECPCHNNWKTKEGGPKCP  108



>ref|XP_004304306.1| PREDICTED: gibberellin-regulated protein 4-like [Fragaria vesca 
subsp. vesca]
Length=108

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +C+ RCSKT + KPC+FFCQKCC+KCLCVPPG YGNK VCPCYNNWKTK 
Sbjct  43   GSLKSYQCPSQCTRRCSKTQYHKPCMFFCQKCCSKCLCVPPGFYGNKAVCPCYNNWKTKE  102

Query  449  GGPKCP  432
            GGPKCP
Sbjct  103  GGPKCP  108



>gb|EYU34071.1| hypothetical protein MIMGU_mgv1a016830mg [Erythranthe guttata]
Length=105

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 70/114 (61%), Gaps = 9/114 (8%)
 Frame = -2

Query  773  MAKMATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKC  594
            MAK+   L I   +I +  I           +S  +       YG   GS++  +C  +C
Sbjct  1    MAKLFAFLLIALIAITMLEIPVMASLDGGIQASKIR-------YG--PGSVKSFQCPSQC  51

Query  593  SFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            + RCS+T + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK GGPKCP
Sbjct  52   TRRCSRTQYHKPCMFFCQKCCRKCLCVPPGYYGNKSVCPCYNNWKTKEGGPKCP  105



>ref|XP_010922909.1| PREDICTED: gibberellin-regulated protein 12-like [Elaeis guineensis]
Length=110

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -2

Query  611  ECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            EC   C FRCSKTA+KKPC+FFCQKCC KC CVPPGTY +K+VCPCYNNWKTKRGGPKCP
Sbjct  51   ECPGACQFRCSKTAYKKPCMFFCQKCCFKCRCVPPGTYAHKEVCPCYNNWKTKRGGPKCP  110



>ref|XP_010678520.1| PREDICTED: gibberellin-regulated protein 6-like [Beta vulgaris 
subsp. vulgaris]
Length=97

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GSL+  +C  +C+ RCS+T + KPC+FFCQKCC KCLCVPPG YGNKQVCPCYNNWKTK 
Sbjct  32   GSLKGSQCLGQCTRRCSRTQYHKPCMFFCQKCCRKCLCVPPGFYGNKQVCPCYNNWKTKE  91

Query  449  GGPKCP  432
            GGPKCP
Sbjct  92   GGPKCP  97



>ref|XP_010038994.1| PREDICTED: gibberellin-regulated protein 12 [Eucalyptus grandis]
 gb|KCW48453.1| hypothetical protein EUGRSUZ_K02150 [Eucalyptus grandis]
Length=96

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  632  EGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTK  453
            EGSLRP++C+  C +RCS T+ +KPCL FC  CCAKCLCVP GTYG+K+ CPCYNNWKTK
Sbjct  30   EGSLRPEQCAAACDYRCSATSHRKPCLSFCNMCCAKCLCVPSGTYGHKEECPCYNNWKTK  89

Query  452  RGGPKCP  432
             G PKCP
Sbjct  90   EGKPKCP  96



>ref|XP_006827240.1| hypothetical protein AMTR_s00010p00261380 [Amborella trichopoda]
 gb|ERM94477.1| hypothetical protein AMTR_s00010p00261380 [Amborella trichopoda]
Length=112

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  641  GVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNW  462
            G   GSLR  +C   C+ RCS+T + KPC+FFCQKCC KCLCVP G YGNKQ CPCYNNW
Sbjct  43   GSRPGSLRRYQCPNACTRRCSQTQYHKPCMFFCQKCCRKCLCVPSGFYGNKQTCPCYNNW  102

Query  461  KTKRGGPKCP  432
            KTKRGGPKCP
Sbjct  103  KTKRGGPKCP  112



>ref|XP_006601874.1| PREDICTED: gibberellin-regulated protein 12-like [Glycine max]
Length=92

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 62/100 (62%), Gaps = 16/100 (16%)
 Frame = -2

Query  731  IFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSKTAFKKPCL  552
            + IFV+ F  Q +                YG  EGSL PQEC   C +RCSK   +K CL
Sbjct  9    LLIFVMAFVTQVA----------------YGGGEGSLTPQECPGACDYRCSKARARKACL  52

Query  551  FFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            +FC  CCAKCLCVP GTYG+K+ CPCYNNWKT +G PKCP
Sbjct  53   YFCNLCCAKCLCVPSGTYGHKEECPCYNNWKTNKGTPKCP  92



>ref|XP_009108078.1| PREDICTED: gibberellin-regulated protein 12-like [Brassica rapa]
Length=106

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            M  ++ +L     +F   F N   + + S  P       M G   GSL P EC   C FR
Sbjct  1    MMKLIVVLTVFSLLFATQFSNADEIESTSEAPAI----HMKG-GPGSLTPDECPKACDFR  55

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            CS T+ +K CLFFC  CC KCLCVP GTYG+K+ CPCYNN KTK GGPKCP
Sbjct  56   CSATSHQKQCLFFCNYCCNKCLCVPSGTYGHKEECPCYNNLKTKDGGPKCP  106



>gb|AGL92233.1| GASA-like protein GEG3 [Gerbera hybrid cultivar]
Length=100

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -2

Query  626  SLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRG  447
            SL   +C  +C  RCSKT + KPC+FFCQKCCAKCLCVPPG YGNKQVCPCYNNWKTK G
Sbjct  36   SLTSSQCPGQCIRRCSKTQYHKPCMFFCQKCCAKCLCVPPGFYGNKQVCPCYNNWKTKEG  95

Query  446  GPKCP  432
            GPKCP
Sbjct  96   GPKCP  100



>ref|XP_007163897.1| hypothetical protein PHAVU_L007200g [Phaseolus vulgaris]
 gb|ESW35891.1| hypothetical protein PHAVU_L007200g [Phaseolus vulgaris]
Length=92

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -2

Query  644  YGVTEGSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNN  465
            YG  EGSL+P+EC   C  RCSKT  KK CLF+C  CC KCLCVP GT GNK+ CPCYNN
Sbjct  22   YGGGEGSLKPEECPGACEVRCSKTRVKKACLFYCNLCCDKCLCVPSGTVGNKEECPCYNN  81

Query  464  WKTKRGGPKCP  432
            WK + GGPKCP
Sbjct  82   WKNENGGPKCP  92



>gb|EPS67539.1| gibberellin-regulated protein, partial [Genlisea aurea]
Length=78

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  629  GSLRPQECSPKCSFRCSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKR  450
            GS+   EC  +CS RCSKT + KPC+FFCQKCC KCLCVPPG YGNK VCPCYNNWKTK 
Sbjct  13   GSVHTLECPSQCSRRCSKTQYHKPCMFFCQKCCRKCLCVPPGFYGNKAVCPCYNNWKTKE  72

Query  449  GGPKCP  432
            GGPKCP
Sbjct  73   GGPKCP  78



>gb|KFK25767.1| hypothetical protein AALP_AA8G157100 [Arabis alpina]
Length=109

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 60/111 (54%), Gaps = 2/111 (2%)
 Frame = -2

Query  764  MATMLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFR  585
            MA     L     I   M Q     A +     P  N + YG   GSL+  +C   C  R
Sbjct  1    MAKSFGALFLLALIVFSMLQTMGEAAKYRGKWNPKWNPKNYG--PGSLKSSQCPKACDTR  58

Query  584  CSKTAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            C  T +   CL FC KCC KCLCVPPG YGNKQVC CYNNWKTK GGPKCP
Sbjct  59   CGDTKYINACLLFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTKEGGPKCP  109



>emb|CDY27104.1| BnaA08g07420D [Brassica napus]
Length=105

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 64/108 (59%), Gaps = 5/108 (5%)
 Frame = -2

Query  755  MLTILKFSIFIFVIMFQNQASMAAHSSTPQPLGNNRMYGVTEGSLRPQECSPKCSFRCSK  576
            ++ +L     +F   F N   + + S  P       M G   GSL P EC   C FRCS 
Sbjct  3    LIVVLTVFSLLFATQFSNADELESTSEAPA----IHMKG-GPGSLTPDECPKACDFRCSA  57

Query  575  TAFKKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP  432
            T+ +KPCLFFC  CC KCLCVP GTYG+K+ CPCYNN KTK G PKCP
Sbjct  58   TSHQKPCLFFCNYCCNKCLCVPSGTYGHKEECPCYNNLKTKEGEPKCP  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2282695893512