BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81929_g1_i1 len=145 path=[170:0-144]

Length=145
                                                                      Score     E

gb|ABB77213.1|  11S globulin-like protein                             60.1    6e-09   Actinidia chinensis
gb|ABB77214.1|  11S globulin-like protein                             58.2    1e-08   Actinidia chinensis
ref|XP_009628307.1|  PREDICTED: glutelin type-B 1-like                58.2    2e-08   
ref|XP_006351673.1|  PREDICTED: legumin B-like                        58.2    3e-08   
ref|XP_009763034.1|  PREDICTED: legumin B-like                        58.2    3e-08   
ref|XP_011083024.1|  PREDICTED: legumin B-like                        57.4    4e-08   
ref|XP_004294115.1|  PREDICTED: legumin B-like                        57.4    6e-08   
ref|XP_004246943.1|  PREDICTED: 12S seed storage protein CRA1-like    57.0    8e-08   
sp|P83004.1|13SB_FAGES  RecName: Full=13S globulin basic chain        54.3    1e-07   Fagopyrum esculentum
emb|CAA57848.1|  legumin precursor                                    56.2    1e-07   Magnolia salicifolia
ref|XP_009354949.1|  PREDICTED: cruciferin CRU1-like                  56.6    1e-07   
gb|ABB60055.1|  11S globulin precursor isoform 4                      55.8    2e-07   Sesamum indicum [beniseed]
ref|XP_011080043.1|  PREDICTED: legumin B-like                        55.8    2e-07   
ref|XP_008364259.1|  PREDICTED: legumin A-like                        55.8    2e-07   
ref|XP_004289944.1|  PREDICTED: legumin A-like                        55.5    2e-07   
gb|ABG73109.1|  Pis v 2.0101 allergen11S globulin precusor            55.5    3e-07   Pistacia vera [pistachio]
ref|XP_004289946.1|  PREDICTED: legumin A-like                        55.5    3e-07   
gb|ABB60054.1|  11S globulin precursor isoform 3                      55.1    3e-07   Sesamum indicum [beniseed]
ref|XP_011091309.1|  PREDICTED: legumin B-like                        55.1    4e-07   
ref|XP_010262323.1|  PREDICTED: glutelin type-B 5-like                54.7    4e-07   
gb|AEO27677.1|  seed storage protein legumin A                        54.7    5e-07   
gb|AEO27676.1|  seed storage protein legumin A                        54.7    5e-07   
sp|P09802.2|LEGA_GOSHI  RecName: Full=Legumin A; AltName: Full=Be...  54.7    5e-07   Gossypium hirsutum [American cotton]
gb|AAA33072.1|  legumin precursor                                     54.7    5e-07   Gossypium hirsutum [American cotton]
ref|XP_002530185.1|  11S globulin subunit beta precursor, putative    54.7    5e-07   Ricinus communis
gb|AEO27675.1|  seed storage protein legumin A                        54.3    6e-07   
gb|AEO27674.1|  seed storage protein legumin A                        54.3    6e-07   
gb|KHG13642.1|  Legumin A                                             54.3    6e-07   
emb|CDO99238.1|  unnamed protein product                              54.3    7e-07   
gb|EYU18319.1|  hypothetical protein MIMGU_mgv1a005193mg              54.3    7e-07   
ref|XP_004289947.1|  PREDICTED: glycinin G4-like                      54.3    7e-07   
gb|AAC61881.1|  11S storage globulin                                  53.9    8e-07   Coffea arabica [arabica coffee]
pdb|3EHK|A  Chain A, Crystal Structure Of Pru Du Amandin, An Alle...  54.3    8e-07   
gb|AAC61983.1|  11S storage globulin                                  53.9    8e-07   Coffea arabica [arabica coffee]
ref|XP_008235678.1|  PREDICTED: legumin type B-like                   53.9    9e-07   
emb|CAA55009.1|  prunin                                               53.9    9e-07   Prunus dulcis [sweet almond]
gb|ADN39440.1|  prunin 1 precursor                                    53.9    9e-07   
ref|XP_007201716.1|  hypothetical protein PRUPE_ppa003759mg           53.9    9e-07   
gb|EYU46455.1|  hypothetical protein MIMGU_mgv1a005708mg              53.9    9e-07   
ref|XP_002533465.1|  legumin B precursor, putative                    53.5    1e-06   Ricinus communis
ref|XP_004289945.1|  PREDICTED: 12S seed storage protein CRU1-like    53.5    1e-06   
gb|ABG73110.1|  Pis v 2.0201 allergen 11S globulin precusor           53.1    1e-06   Pistacia vera [pistachio]
ref|XP_010679299.1|  PREDICTED: 11S globulin seed storage protein...  53.1    1e-06   
gb|ABU42022.1|  11S globulin                                          53.1    1e-06   Pistacia vera [pistachio]
gb|EYU17920.1|  hypothetical protein MIMGU_mgv1a006934mg              53.1    2e-06   
emb|CAA57846.1|  legumin precur                                       53.1    2e-06   Magnolia salicifolia
ref|XP_009603583.1|  PREDICTED: 11S globulin subunit beta-like        53.1    2e-06   
ref|XP_004289943.1|  PREDICTED: legumin A-like                        53.1    2e-06   
emb|CAA57847.1|  globulin precursor                                   52.4    3e-06   Magnolia salicifolia
emb|CAA76573.1|  11S storage protein                                  52.4    3e-06   Coffea arabica [arabica coffee]
ref|XP_007050296.1|  Legumin A, putative                              52.0    4e-06   
gb|EPS62256.1|  hypothetical protein M569_12535                       51.6    5e-06   
ref|XP_009777915.1|  PREDICTED: 11S globulin subunit beta-like        52.0    5e-06   
ref|XP_007200723.1|  hypothetical protein PRUPE_ppa004418mg           51.6    5e-06   
emb|CAA29507.1|  glutelin                                             50.1    7e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006369783.1|  hypothetical protein POPTR_0001s31560g           48.5    8e-06   
ref|XP_006370929.1|  legumin family protein                           51.2    8e-06   
emb|CAA40978.1|  cruciferin cru4 subunit                              48.9    9e-06   Brassica napus [oilseed rape]
emb|CAA55010.1|  pru2                                                 50.8    9e-06   Prunus dulcis [sweet almond]
ref|XP_002533466.1|  glutelin type-A 3 precursor, putative            50.8    9e-06   Ricinus communis
ref|XP_002522726.1|  11S globulin subunit beta precursor, putative    50.8    1e-05   Ricinus communis
gb|AAF73008.1|AF262999_1  seed storage protein                        50.4    1e-05   Ricinus communis
dbj|BAD94859.1|  putative cruciferin 12S seed storage protein         48.5    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006370928.1|  hypothetical protein POPTR_0019s01840g           50.8    1e-05   
ref|XP_009624044.1|  PREDICTED: 11S globulin seed storage protein...  48.5    1e-05   
ref|XP_006369779.1|  hypothetical protein POPTR_0001s31540g           50.4    1e-05   
gb|AAO38859.1|  11S globulin                                          50.4    2e-05   Bertholletia excelsa
ref|XP_008235677.1|  PREDICTED: legumin J-like                        50.4    2e-05   
gb|AAF19607.1|  legumin-like protein                                  50.4    2e-05   Perilla frutescens [beefsteak-mint]
emb|CAA64763.1|  legumin-like protein                                 50.4    2e-05   Dioscorea caucasica
ref|XP_010272888.1|  PREDICTED: legumin B-like                        50.1    2e-05   
emb|CDP79024.1|  edestin 1                                            50.1    2e-05   
gb|ABK80754.1|  11S globulin precursor isoform 3A                     50.1    2e-05   Ficus pumila var. awkeotsang [jelly fig]
gb|ADN39441.1|  prunin 2 precursor                                    50.1    2e-05   
emb|CAR78992.1|  legumin storage protein 3                            50.1    2e-05   Lotus japonicus
emb|CAR78991.1|  legumin storage protein 2                            50.1    2e-05   Lotus japonicus
ref|NP_001275797.1|  citrin precursor                                 50.1    2e-05   
ref|XP_006354542.1|  PREDICTED: legumin B-like                        50.1    2e-05   
gb|KEH23928.1|  glycinin G4                                           50.1    2e-05   
sp|P19084.1|11S3_HELAN  RecName: Full=11S globulin seed storage p...  49.7    2e-05   Helianthus annuus
ref|XP_006420240.1|  hypothetical protein CICLE_v10004854mg           49.7    2e-05   
gb|EPS70989.1|  hypothetical protein M569_03772                       50.1    2e-05   
emb|CDP79023.1|  edestin 1                                            49.7    2e-05   
emb|CAR78995.1|  legumin storage protein 3                            49.7    3e-05   Lotus japonicus
gb|ABG47337.1|  glutelin precursor                                    49.7    3e-05   Zizania latifolia
ref|NP_171885.1|  12S seed storage protein CRD                        49.3    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306303.1|  hypothetical protein CARUB_v10012169mg           49.3    3e-05   
gb|KDO60493.1|  hypothetical protein CISIN_1g046186mg                 49.3    4e-05   
ref|XP_009763876.1|  PREDICTED: legumin B-like                        49.3    4e-05   
ref|XP_009765013.1|  PREDICTED: legumin B-like                        49.3    4e-05   
emb|CDP03744.1|  unnamed protein product                              48.9    4e-05   
ref|XP_009765011.1|  PREDICTED: legumin B-like                        49.3    4e-05   
ref|XP_010475020.1|  PREDICTED: 12S seed storage protein CRD-like     49.3    4e-05   
gb|AAA50316.1|  glutelin                                              49.3    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010482699.1|  PREDICTED: 12S seed storage protein CRD-like     49.3    4e-05   
gb|AGE34644.1|  11S globulin isoform 3                                49.3    4e-05   
gb|ADN39437.1|  11S globulin isoform 1                                49.3    4e-05   
emb|CAA38211.1|  glutelin                                             49.3    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050413.1|  Os03g0427300                                     49.3    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ADN39438.1|  11S globulin isoform 2                                49.3    4e-05   
emb|CAA54153.1|  12s globulin                                         49.3    4e-05   Avena sativa [cultivated oat]
gb|AGT59176.1|  glutelin                                              49.3    4e-05   
gb|ABG47461.1|  glutelin precursor                                    49.3    4e-05   Zizania latifolia
ref|XP_011046347.1|  PREDICTED: legumin B-like                        48.9    4e-05   
ref|XP_009630003.1|  PREDICTED: legumin B-like                        48.9    4e-05   
gb|EEE59300.1|  hypothetical protein OsJ_11349                        49.3    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ54337.1|  Gt3                                                   48.9    5e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAA50314.2|  glutelin                                              48.9    5e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AGT59175.1|  glutelin                                              48.9    5e-05   
prf||1603218A  glutelin                                               48.9    5e-05
ref|XP_006857275.1|  hypothetical protein AMTR_s00067p00022330        48.9    5e-05   
gb|EEC75527.1|  hypothetical protein OsI_12139                        49.3    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_008382906.1|  PREDICTED: 13S globulin basic chain-like         46.6    5e-05   
dbj|BAA00462.1|  prepro-glutelin                                      48.9    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064542.1|  Os10g0400200                                     48.9    5e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ABA46747.1|  glutelin                                              48.9    5e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AGT59174.1|  glutelin                                              48.9    5e-05   
gb|AAF34634.1|AF216800_1  22kDa storage protein                       47.0    5e-05   Fagopyrum gracilipes
gb|AAA33906.1|  glutelin                                              48.9    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009603582.1|  PREDICTED: 11S globulin subunit beta-like        48.9    6e-05   
emb|CAA29150.1|  glutelin                                             48.9    6e-05   Oryza sativa Japonica Group [Japonica rice]
prf||1312296A  glutelin                                               48.9    6e-05
ref|XP_004172305.1|  PREDICTED: 11S globulin subunit beta-like        47.4    6e-05   
ref|XP_002889480.1|  cupin family protein                             48.5    6e-05   
gb|AAD10372.1|  globulin-like protein                                 47.0    6e-05   Oryza sativa [red rice]
gb|ABL74545.1|  glutelin                                              48.5    6e-05   Oryza sativa Japonica Group [Japonica rice]
prf||1210248A  glutelin precursor                                     48.5    6e-05
ref|NP_001044328.1|  Os01g0762500                                     48.5    6e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAA29149.1|  glutelin                                             48.5    6e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAF34635.1|AF216801_1  allergenic protein                          47.0    6e-05   Fagopyrum esculentum
gb|EAY75915.1|  hypothetical protein OsI_03835                        48.5    6e-05   Oryza sativa Indica Group [Indian rice]
emb|CDX89858.1|  BnaA10g02240D                                        48.5    6e-05   
ref|XP_006644747.1|  PREDICTED: glutelin type-A 1-like                48.5    6e-05   
ref|XP_009119353.1|  PREDICTED: cruciferin CRU4                       48.5    6e-05   
emb|CDP79026.1|  edestin 1                                            48.5    7e-05   
ref|XP_004960358.1|  PREDICTED: glutelin type-B 5-like                48.5    7e-05   
ref|XP_011080042.1|  PREDICTED: 11S globulin seed storage protein 2   48.5    7e-05   
ref|XP_006351695.1|  PREDICTED: 11S globulin seed storage protein...  48.5    7e-05   
ref|XP_010111924.1|  Legumin A                                        48.5    7e-05   
ref|XP_010045998.1|  PREDICTED: legumin A-like                        48.5    7e-05   
emb|CDY32518.1|  BnaA09g50780D                                        48.5    7e-05   
ref|XP_011046348.1|  PREDICTED: legumin B-like                        48.5    7e-05   
ref|XP_009761685.1|  PREDICTED: legumin A-like                        48.5    7e-05   
emb|CAA40980.1|  cruciferin cru4 subunit                              48.1    7e-05   Brassica napus [oilseed rape]
gb|AGU36408.1|  11S globulin precursor                                48.1    7e-05   
gb|AGU36396.1|  11S globulin precursor                                47.8    8e-05   
ref|XP_010279433.1|  PREDICTED: legumin A-like                        48.5    8e-05   
gb|AGU36413.1|  11S globulin precursor                                48.1    8e-05   
gb|AAA33963.1|  glycinin A-2-B-1a subunit precursor                   47.0    8e-05   Glycine max [soybeans]
sp|P13744.1|11SB_CUCMA  RecName: Full=11S globulin subunit beta; ...  48.1    8e-05   Cucurbita maxima [Boston marrow]
ref|XP_009624041.1|  PREDICTED: legumin A-like                        48.1    8e-05   
emb|CAA54152.1|  12s globulin                                         48.1    8e-05   Avena sativa [cultivated oat]
gb|KGN45554.1|  hypothetical protein Csa_7G452090                     48.1    8e-05   
ref|XP_004155945.1|  PREDICTED: 11S globulin subunit beta-like        48.1    8e-05   
ref|XP_009118685.1|  PREDICTED: 12S seed storage protein CRD          48.1    8e-05   
ref|XP_008805230.1|  PREDICTED: LOW QUALITY PROTEIN: glutelin typ...  48.1    9e-05   
gb|AEO27681.1|  seed storage protein legumin B                        48.1    9e-05   
gb|AEO27680.1|  seed storage protein legumin B                        48.1    9e-05   
ref|XP_006654150.1|  PREDICTED: glutelin type-A 3-like                48.1    9e-05   
ref|XP_004141669.1|  PREDICTED: LOW QUALITY PROTEIN: 11S globulin...  48.1    9e-05   
gb|AGU36406.1|  11S globulin precursor                                47.8    9e-05   
gb|KHG07690.1|  Legumin B                                             48.1    9e-05   
gb|AGU36407.1|  11S globulin precursor                                47.8    9e-05   
gb|AGU36400.1|  11S globulin precursor                                47.8    9e-05   
gb|AGU36397.1|  11S globulin precursor                                47.8    9e-05   
ref|XP_009624043.1|  PREDICTED: legumin A-like                        48.1    9e-05   
ref|XP_009624040.1|  PREDICTED: 11S globulin seed storage protein...  48.1    9e-05   
emb|CDY18193.1|  BnaC05g02160D                                        48.1    9e-05   
gb|AEO27678.1|  seed storage protein legumin B                        48.1    9e-05   
pdb|2EVX|A  Chain A, Crystal Structure Of Pumpkin Seed Globulin       48.1    9e-05   
sp|P09800.1|LEGB_GOSHI  RecName: Full=Legumin B; AltName: Full=Be...  48.1    9e-05   Gossypium hirsutum [American cotton]
ref|XP_009387667.1|  PREDICTED: glutelin type-A 1-like                48.1    9e-05   
gb|AGU36399.1|  11S globulin precursor                                47.8    9e-05   
gb|AEO27679.1|  seed storage protein legumin B                        48.1    9e-05   
gb|AAK15087.1|AF240004_1  11S globulin                                48.1    9e-05   Sesamum indicum [beniseed]
ref|XP_008372197.1|  PREDICTED: LOW QUALITY PROTEIN: legumin A-like   48.1    1e-04   
gb|AIX48756.1|  legumin-like protein                                  48.1    1e-04   
ref|XP_011091311.1|  PREDICTED: 11S globulin subunit beta-like        48.1    1e-04   
ref|XP_010457408.1|  PREDICTED: 12S seed storage protein CRD          48.1    1e-04   
ref|XP_010481774.1|  PREDICTED: 12S seed storage protein CRA1-like    47.8    1e-04   
gb|KFK42732.1|  hypothetical protein AALP_AA1G032500                  47.8    1e-04   
ref|XP_010265035.1|  PREDICTED: 11S globulin subunit beta-like        48.1    1e-04   
ref|XP_004247523.1|  PREDICTED: 11S globulin seed storage protein...  47.8    1e-04   
gb|AAB24085.1|  legumin propolypeptide beta chain                     46.2    1e-04   
ref|XP_009354982.1|  PREDICTED: legumin type B-like                   48.1    1e-04   
gb|AIA57960.1|  seed storage protein 1                                47.4    1e-04   
ref|XP_009624045.1|  PREDICTED: 11S globulin seed storage protein...  47.8    1e-04   
ref|XP_006420241.1|  hypothetical protein CICLE_v10004871mg           47.8    1e-04   
gb|AGU36395.1|  11S globulin precursor                                47.4    1e-04   
sp|O23878.1|13S1_FAGES  RecName: Full=13S globulin seed storage p...  48.1    1e-04   Fagopyrum esculentum
gb|KDO57580.1|  hypothetical protein CISIN_1g048197mg                 47.8    1e-04   
emb|CAA64762.1|  legumin-like protein                                 47.8    1e-04   Asarum europaeum
ref|XP_010111925.1|  Legumin A                                        47.8    1e-04   
gb|AAA50317.1|  glutelin                                              47.8    1e-04   Oryza sativa [red rice]
gb|AFQ32291.1|  12S seed storage protein                              47.8    1e-04   
ref|XP_006659791.1|  PREDICTED: 13S globulin seed storage protein...  47.8    1e-04   
gb|AAK97787.1|  allergenic protein                                    46.2    1e-04   Fagopyrum tataricum [Kangra buckwheat]
gb|EAZ41388.1|  hypothetical protein OsJ_25906                        47.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05461.1|  hypothetical protein OsI_27675                        47.8    1e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001060907.1|  Os08g0127900                                     47.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648611.1|  PREDICTED: glutelin type-A 1-like                47.8    1e-04   
gb|AAA32778.1|  12S storage protein CRB                               47.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171884.1|  cruciferin 2                                        47.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009761684.1|  PREDICTED: 11S globulin seed storage protein...  47.8    1e-04   
ref|XP_004152049.1|  PREDICTED: 11S globulin subunit beta-like        47.8    1e-04   
ref|XP_002889479.1|  hypothetical protein ARALYDRAFT_470363           47.8    1e-04   
gb|KFK42731.1|  hypothetical protein AALP_AA1G032400                  47.4    1e-04   
ref|XP_006647245.1|  PREDICTED: glutelin type-A 1-like                47.8    1e-04   
prf||1311273A  glutelin                                               47.4    1e-04
pir||JC2098  legumin type B beta chain (clone LeB4, B4) - tick bean   45.8    1e-04
ref|XP_009766463.1|  PREDICTED: 11S globulin seed storage protein...  47.4    1e-04   
ref|XP_010097607.1|  Legumin A                                        47.4    2e-04   
ref|XP_006356113.1|  PREDICTED: legumin B-like                        47.4    2e-04   
ref|XP_006443837.1|  hypothetical protein CICLE_v10023766mg           47.4    2e-04   
gb|ABK80752.1|  11S globulin precursor isoform 1B                     47.4    2e-04   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_008447426.1|  PREDICTED: legumin A-like                        47.4    2e-04   
gb|KDP40339.1|  hypothetical protein JCGZ_02337                       47.4    2e-04   
gb|AGU36402.1|  11S globulin precursor                                47.0    2e-04   
gb|AIA57958.1|  beta-globulin B2                                      47.4    2e-04   
ref|XP_002300775.1|  legumin family protein                           47.4    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006480087.1|  PREDICTED: LOW QUALITY PROTEIN: legumin A-like   47.0    2e-04   
ref|XP_009803568.1|  PREDICTED: legumin A-like                        47.4    2e-04   
emb|CAA52764.1|  11S globulin                                         47.4    2e-04   Avena sativa [cultivated oat]
ref|XP_006370926.1|  legumin family protein                           47.0    2e-04   
dbj|BAO50857.1|  13S globulin                                         47.4    2e-04   
dbj|BAO50867.1|  13S globulin                                         47.0    2e-04   
sp|Q9XFM4.1|13S3_FAGES  RecName: Full=13S globulin seed storage p...  47.4    2e-04   Fagopyrum esculentum
sp|O23880.1|13S2_FAGES  RecName: Full=13S globulin seed storage p...  47.0    2e-04   Fagopyrum esculentum
dbj|BAM63382.1|  major allergenic storage protein                     47.4    2e-04   
dbj|BAO50862.1|  13S globulin                                         47.0    2e-04   
dbj|BAO50859.1|  13S globulin                                         47.4    2e-04   
dbj|BAO50866.1|  13S globulin                                         47.0    2e-04   
dbj|BAO50865.1|  13S globulin                                         47.0    2e-04   
dbj|BAO50858.1|  13S globulin                                         47.0    2e-04   
gb|ABI94736.1|  11S seed storage globulin B                           47.0    2e-04   Chenopodium quinoa
gb|AAS67037.1|  11S seed storage globulin                             47.0    2e-04   Chenopodium quinoa
dbj|BAO50864.1|  13S globulin                                         47.0    2e-04   
ref|XP_008462393.1|  PREDICTED: legumin B-like                        47.0    2e-04   
gb|AFQ32292.1|  12S seed storage protein                              47.0    2e-04   
emb|CDP79027.1|  edestin 2                                            47.0    2e-04   
dbj|BAO50861.1|  13S globulin                                         47.0    2e-04   
emb|CDP79029.1|  edestin 2                                            47.0    2e-04   
emb|CDP79028.1|  edestin 2                                            47.0    2e-04   
dbj|BAO50856.1|  13S globulin                                         47.0    2e-04   
ref|XP_002524198.1|  legumin B precursor, putative                    47.0    2e-04   Ricinus communis
gb|AGU36401.1|  11S globulin precursor                                46.6    2e-04   
gb|EYU46456.1|  hypothetical protein MIMGU_mgv1a005966mg              47.0    2e-04   
dbj|BAO50860.1|  13S globulin                                         47.0    2e-04   
gb|AHA36627.1|  Cor a 9 allergen                                      47.0    2e-04   
emb|CDY10094.1|  BnaC08g43570D                                        47.0    2e-04   
gb|AFJ04523.1|  glutelin type-A 3 precursor                           47.0    2e-04   
gb|AAW29810.1|  seed storage protein                                  47.0    2e-04   Juglans regia
gb|EAY78392.1|  hypothetical protein OsI_33479                        47.0    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006351693.1|  PREDICTED: 11S globulin seed storage protein...  47.0    2e-04   
gb|ABI94735.1|  11S seed storage globulin A                           47.0    3e-04   Chenopodium quinoa
gb|AAS67036.1|  11S seed storage globulin                             47.0    3e-04   Chenopodium quinoa
ref|XP_010679302.1|  PREDICTED: legumin A-like                        47.0    3e-04   
emb|CAA81262.1|  legumin; legumin-related high molecular weight p...  47.0    3e-04   Vicia faba var. minor [tick bean]
emb|CAA44874.1|  legumin-like storage protein                         46.6    3e-04   Picea glauca
gb|ABW86979.1|  11S legumin protein                                   46.6    3e-04   Carya illinoinensis [pecan]
gb|ABW86978.1|  11S legumin protein                                   46.6    3e-04   Carya illinoinensis [pecan]
ref|NP_001172944.1|  Os02g0456150                                     44.3    3e-04   
gb|AAA32719.1|  12S globulin precursor                                46.2    3e-04   Avena sativa [cultivated oat]
sp|P16078.1|LEGB2_VICFA  RecName: Full=Legumin type B; Contains: ...  46.2    3e-04   Vicia faba [broad bean]
gb|AAA61911.1|  beta-coniferin                                        45.1    3e-04   Picea glauca
gb|AAL73404.1|AF449424_1  11S globulin-like protein                   46.6    3e-04   Corylus avellana [European hazelnut]
ref|XP_004247735.1|  PREDICTED: 11S globulin subunit beta             46.6    3e-04   
sp|P16080.1|LEGB7_VICFA  RecName: Full=Legumin type B; Contains: ...  46.2    3e-04   Vicia faba [broad bean]
ref|XP_010441951.1|  PREDICTED: 12S seed storage protein CRA1         46.6    3e-04   
ref|XP_010671027.1|  PREDICTED: legumin B-like                        46.6    3e-04   
ref|XP_010326169.1|  PREDICTED: LOW QUALITY PROTEIN: 11S globulin...  46.6    3e-04   
prf||1306412B  storage protein C94                                    46.6    3e-04
sp|P16079.1|LEGB6_VICFA  RecName: Full=Legumin type B; Contains: ...  46.2    3e-04   Vicia faba [broad bean]
ref|XP_006403137.1|  hypothetical protein EUTSA_v10003429mg           46.6    3e-04   
gb|ABK80751.1|  11S globulin precursor isoform 1A                     46.6    3e-04   Ficus pumila var. awkeotsang [jelly fig]
ref|XP_006403138.1|  hypothetical protein EUTSA_v10003387mg           46.6    3e-04   
emb|CAA26575.1|  unnamed protein product                              46.6    3e-04   Glycine max [soybeans]
ref|NP_001235810.1|  glycinin G2 precursor                            46.6    3e-04   
ref|XP_006370927.1|  hypothetical protein POPTR_0019s01830g           46.6    4e-04   
gb|ABI32184.1|  allergenic protein                                    46.6    4e-04   
emb|CAA64761.1|  legumin-like protein                                 46.2    4e-04   
ref|XP_010482688.1|  PREDICTED: 12S seed storage protein CRB-like     46.2    4e-04   
gb|AIO11048.1|  11S globulin                                          46.2    4e-04   
prf||1515394A  seed storage globulin                                  46.2    4e-04
sp|P12615.1|SSG1_AVESA  RecName: Full=12S seed storage globulin 1...  46.2    4e-04   
gb|KHN02503.1|  Glycinin G3                                           46.2    4e-04   
ref|XP_004234041.1|  PREDICTED: legumin B-like                        46.2    4e-04   
ref|XP_002307645.2|  legumin family protein                           46.2    4e-04   
dbj|BAC55937.1|  glycinin A1bB2-445                                   46.2    4e-04   
sp|P11828.1|GLYG3_SOYBN  RecName: Full=Glycinin G3; Contains: Rec...  46.2    4e-04   
gb|AGU36403.1|  11S globulin precursor                                45.8    4e-04   
ref|XP_011004057.1|  PREDICTED: legumin A-like                        46.2    4e-04   
sp|P14812.1|SSG2_AVESA  RecName: Full=12S seed storage globulin 2...  46.2    4e-04   
ref|XP_010272922.1|  PREDICTED: 13S globulin basic chain-like         45.8    4e-04   
emb|CAA70333.1|  pre-pro-legumin                                      46.2    4e-04   
emb|CDO99985.1|  unnamed protein product                              45.4    4e-04   
gb|KGN61596.1|  hypothetical protein Csa_2G174130                     46.2    5e-04   
gb|AAA68981.1|  legumin-like storage protein                          46.2    5e-04   
sp|P05693.1|LEGK_PEA  RecName: Full=Legumin K; Contains: RecName:...  45.8    5e-04   
gb|EPS68852.1|  hypothetical protein M569_05912                       45.8    5e-04   
ref|XP_006857279.1|  hypothetical protein AMTR_s00067p00026720        45.8    5e-04   
emb|CAA77568.1|  pine globulin-1                                      45.8    5e-04   
emb|CAA77569.1|  pine globulin-2                                      45.8    6e-04   
emb|CAA90643.1|  legumin; 11S globulin                                45.8    6e-04   
ref|XP_009783514.1|  PREDICTED: 11S globulin seed storage protein...  45.8    6e-04   
pir||S30142  pseudotsugin precursor - Douglas fir                     45.8    6e-04
gb|AFQ32289.1|  12S seed storage protein                              45.8    6e-04   
ref|XP_007035123.1|  Legumin B                                        43.1    6e-04   
gb|AAF69015.1|AF261691_1  glutelin                                    45.8    6e-04   
ref|NP_001289907.1|  uncharacterized protein LOC104725055 precursor   45.8    6e-04   
ref|XP_003590690.1|  Legumin                                          45.8    6e-04   
ref|NP_199225.1|  12S seed storage protein CRA1                       45.8    6e-04   
ref|XP_003590686.1|  Legumin B                                        45.8    6e-04   
ref|NP_001289909.1|  uncharacterized protein LOC104754510 precursor   45.4    7e-04   
emb|CDY14908.1|  BnaA02g22500D                                        45.4    7e-04   
emb|CAA70334.1|  pre-pro-legumin                                      45.8    7e-04   
dbj|BAB12448.1|  legumin                                              43.1    7e-04   
ref|XP_003590687.1|  Legumin B                                        45.8    7e-04   
ref|XP_009123931.1|  PREDICTED: cruciferin BnC2                       45.4    7e-04   
dbj|BAB12449.1|  legumin                                              43.1    7e-04   
ref|NP_851128.1|  12S seed storage protein CRA1                       45.4    7e-04   
ref|NP_001236840.1|  glycinin A1bB2-784 precursor                     45.4    7e-04   
gb|ABZ89194.1|  protein                                               45.4    7e-04   
ref|XP_003590689.1|  Legumin                                          45.4    7e-04   
dbj|BAB12446.1|  legumin                                              43.1    7e-04   
ref|XP_010457405.1|  PREDICTED: 12S seed storage protein CRB isof...  45.4    7e-04   
sp|P33522.1|CRU4_BRANA  RecName: Full=Cruciferin CRU4; AltName: F...  45.4    7e-04   
pir||S26688  legumin K - garden pea                                   45.4    7e-04
ref|XP_003590684.1|  Legumin B                                        45.4    8e-04   
gb|EEC73106.1|  hypothetical protein OsI_07091                        45.4    8e-04   
ref|XP_002524604.1|  legumin A precursor, putative                    45.4    8e-04   
ref|NP_001289908.1|  12S seed storage protein CRB precursor           45.4    8e-04   
ref|NP_001046769.1|  Os02g0453600                                     45.4    8e-04   
ref|XP_008447425.1|  PREDICTED: legumin A-like                        45.4    8e-04   
gb|AEB33711.1|  conglutin alpha 3                                     45.4    8e-04   
ref|XP_010231907.1|  PREDICTED: 12S seed storage globulin 1-like      45.4    8e-04   
pir||S11003  glycinin G3 precursor - soybean                          45.4    8e-04
ref|XP_006303676.1|  hypothetical protein CARUB_v10011751mg           45.4    8e-04   
prf||1303273A  glycinin A3B4                                          44.3    8e-04
dbj|BAB12450.1|  legumin                                              42.7    9e-04   
gb|EEE56924.1|  hypothetical protein OsJ_06602                        45.4    9e-04   
ref|NP_851127.1|  12S seed storage protein CRA1                       44.7    9e-04   
gb|EEE56928.1|  hypothetical protein OsJ_06612                        45.1    9e-04   
gb|EEC73108.1|  hypothetical protein OsI_07099                        45.1    0.001   
ref|XP_010928048.1|  PREDICTED: glutelin type-A 3-like                45.1    0.001   
ref|XP_010555095.1|  PREDICTED: cruciferin PGCRURSE5                  45.1    0.001   
prf||1207216B  legumin B                                              43.9    0.001
emb|CAA32455.1|  storage protein                                      44.7    0.001   



>gb|ABB77213.1| 11S globulin-like protein [Actinidia chinensis]
Length=462

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAH  LY T+G A ++IV+QRGEA+ ND +REG
Sbjct  330  GVLYRNALMPPHWKLNAHCVLYATRGEAQMQIVDQRGEAVFNDRIREG  377



>gb|ABB77214.1| 11S globulin-like protein [Actinidia chinensis]
Length=274

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN  + P W +NAH  LY T+G A ++IV+QRG+A+  D +REG
Sbjct  139  GVLYKNALMPPHWKLNAHCVLYATRGEAQMQIVDQRGQAVFKDRIREG  186



>ref|XP_009628307.1| PREDICTED: glutelin type-B 1-like [Nicotiana tomentosiformis]
Length=437

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W  NAHS +Y+T+G + ++IV+ RG A+L+D+VREG
Sbjct  289  GVLYRNSMMAPHWYKNAHSIIYITRGESRIQIVDHRGRAVLDDQVREG  336



>ref|XP_006351673.1| PREDICTED: legumin B-like [Solanum tuberosum]
Length=474

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W  NAHS +YVTKG A ++IV+ RG+A+L+D VR G
Sbjct  337  GVLYRNSIMAPHWWTNAHSVIYVTKGEARIQIVDHRGQAVLDDRVRRG  384



>ref|XP_009763034.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=483

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W  NAHS +Y+T+G + ++IV+ RG A+L+D+VREG
Sbjct  335  GVLYRNSMMAPHWYENAHSIIYITRGESRIQIVDHRGRAVLDDQVREG  382



>ref|XP_011083024.1| PREDICTED: legumin B-like [Sesamum indicum]
Length=460

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P WC+NAHS +YVT+G + ++IVN  G+A+ +  VREG
Sbjct  333  GVLYRNGIMAPHWCVNAHSVIYVTRGESDMQIVNHNGQAVFDGRVREG  380



>ref|XP_004294115.1| PREDICTED: legumin B-like [Fragaria vesca subsp. vesca]
Length=495

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W +NAH  +YV +GSA V++VN  GE IL+D+VR+G
Sbjct  362  GFLYNNAIHSPHWNLNAHEIIYVIRGSARVQVVNDSGETILDDQVRQG  409



>ref|XP_004246943.1| PREDICTED: 12S seed storage protein CRA1-like [Solanum lycopersicum]
Length=474

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W  NAHS +YVT+G A ++IV+ RG+A+L+D VR+G
Sbjct  337  GVLYRNSIMAPLWWTNAHSVIYVTRGEARIQIVDHRGQAVLDDRVRQG  384



>sp|P83004.1|13SB_FAGES RecName: Full=13S globulin basic chain [Fagopyrum esculentum]
Length=194

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W INAHS LYVT+G+A V++V   G  + +DEV++G
Sbjct  52   GFLYSNGIYAPHWNINAHSALYVTRGNAKVQVVGDEGNKVFDDEVKQG  99



>emb|CAA57848.1| legumin precursor [Magnolia salicifolia]
Length=472

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G+L +N    P W INAH+  YVT+G A V++V   G+ +L+D VREG
Sbjct  342  GYLYQNAIFSPHWTINAHNIFYVTRGEARVQVVGHNGQTVLDDTVREG  389



>ref|XP_009354949.1| PREDICTED: cruciferin CRU1-like [Pyrus x bretschneideri]
Length=577

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GF   N    P W INAHS +YV +GSA V+IVN+ G  IL+D+V+EG
Sbjct  443  GFFYSNGIYTPHWNINAHSVVYVIRGSARVQIVNENGNPILDDQVQEG  490



>gb|ABB60055.1| 11S globulin precursor isoform 4 [Sesamum indicum]
Length=469

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P WC+NAHS +YVT+G + ++IV+  G+A+ +  VREG
Sbjct  333  GVLYRNGIMAPHWCVNAHSVIYVTRGESDMQIVSHNGQAVFDGRVREG  380



>ref|XP_011080043.1| PREDICTED: legumin B-like [Sesamum indicum]
Length=464

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAHS +YVT+G A ++IVN +G+A+ +  VREG
Sbjct  328  GVLYRNGIMAPHWSMNAHSIIYVTRGEARMQIVNHKGQAVFDGGVREG  375



>ref|XP_008364259.1| PREDICTED: legumin A-like [Malus domestica]
Length=575

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GF   N    P W INAHS +YV +GSA V+IVN+ G  IL+D+V+EG
Sbjct  441  GFFYSNGIYTPHWNINAHSAVYVIRGSARVQIVNENGNPILDDQVQEG  488



>ref|XP_004289944.1| PREDICTED: legumin A-like [Fragaria vesca subsp. vesca]
Length=499

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GF   N    P W +NAH   YV +GSA V++VN  GE IL+D+VR+G
Sbjct  364  GFFYNNAIYSPHWNLNAHEVYYVIRGSARVQVVNDNGETILDDQVRQG  411



>gb|ABG73109.1| Pis v 2.0101 allergen11S globulin precusor [Pistacia vera]
Length=496

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L+++  L P W +NAHS +Y+T+G+  ++IV++ GE++ ++E+REG
Sbjct  348  GVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDEEIREG  395



>ref|XP_004289946.1| PREDICTED: legumin A-like [Fragaria vesca subsp. vesca]
Length=550

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W +NAH   YV +GSA V+IVN  G+AIL++EVR+G
Sbjct  415  GFLYNNAIYSPHWNLNAHEVYYVIRGSARVQIVNNNGQAILDNEVRQG  462



>gb|ABB60054.1| 11S globulin precursor isoform 3 [Sesamum indicum]
Length=491

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N    P W  N+HS LYVT+GSA +++V  +G ++LN+EV EG
Sbjct  359  GVLYRNGITAPHWSTNSHSALYVTRGSARIQVVGHKGRSVLNEEVNEG  406



>ref|XP_011091309.1| PREDICTED: legumin B-like [Sesamum indicum]
Length=491

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N    P W  N+HS LYVT+GSA +++V  +G ++LN+EV EG
Sbjct  359  GVLYRNGITAPHWSTNSHSALYVTRGSARIQVVGHKGRSVLNEEVNEG  406



>ref|XP_010262323.1| PREDICTED: glutelin type-B 5-like [Nelumbo nucifera]
Length=473

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G LNKN  L P W +NAH+ +YVT+GSA  +IV + G  + +DE+ EG
Sbjct  339  GVLNKNSILTPHWNMNAHAVVYVTRGSARCQIVEENGRLVFDDELSEG  386



>gb|AEO27677.1| seed storage protein legumin A, partial [Gossypium raimondii]
Length=486

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L    GL+PQW +NAH  LY+ +G A V++VN  G+A+ +D V +G
Sbjct  353  GVLYNRAGLIPQWNVNAHKILYMLRGCARVQVVNHNGDAVFDDNVEQG  400



>gb|AEO27676.1| seed storage protein legumin A, partial [Gossypium hirsutum]
Length=487

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L    GL+PQW +NAH  LY+ +G A V++VN  G+A+ +D V +G
Sbjct  354  GVLYNRAGLIPQWNVNAHKILYMLRGCARVQVVNHNGDAVFDDNVEQG  401



>sp|P09802.2|LEGA_GOSHI RecName: Full=Legumin A; AltName: Full=Beta-globulin; AltName: 
Full=LEGA-C94; Contains: RecName: Full=Legumin A acidic chain; 
Contains: RecName: Full=Legumin A basic chain; Flags: Precursor 
[Gossypium hirsutum]
 gb|AAA33053.1| legumin A [Gossypium hirsutum]
 prf||1906369A legumin A:ISOTYPE=D alloallele
Length=509

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L    GL+PQW +NAH  LY+ +G A V++VN  G+A+ +D V +G
Sbjct  376  GVLYNRAGLIPQWNVNAHKILYMLRGCARVQVVNHNGDAVFDDNVEQG  423



>gb|AAA33072.1| legumin precursor, partial [Gossypium hirsutum]
Length=507

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L    GL+PQW +NAH  LY+ +G A V++VN  G+A+ +D V +G
Sbjct  374  GVLYNRAGLIPQWNVNAHKILYMLRGCARVQVVNHNGDAVFDDNVEQG  421



>ref|XP_002530185.1| 11S globulin subunit beta precursor, putative [Ricinus communis]
 gb|EEF32199.1| 11S globulin subunit beta precursor, putative [Ricinus communis]
Length=480

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W +NAH+  Y+T+GS  V+I+N  GE +L+ +VREG
Sbjct  350  GILYSNAMMTPHWNLNAHTICYITRGSGRVQIINDHGETMLDGQVREG  397



>gb|AEO27675.1| seed storage protein legumin A, partial [Gossypium arboreum]
Length=486

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L    GL+PQW +NAH  LY+ +G A V++VN  G+A+ +D V +G
Sbjct  353  GVLYNRAGLIPQWNVNAHKILYMLRGRARVQVVNHNGDAVFDDNVEQG  400



>gb|AEO27674.1| seed storage protein legumin A, partial [Gossypium herbaceum]
Length=486

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L    GL+PQW +NAH  LY+ +G A V++VN  G+A+ +D V +G
Sbjct  353  GVLYNRAGLIPQWNVNAHKILYMLRGRARVQVVNHNGDAVFDDNVEQG  400



>gb|KHG13642.1| Legumin A [Gossypium arboreum]
Length=508

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L    GL+PQW +NAH  LY+ +G A V++VN  G+A+ +D V +G
Sbjct  375  GVLYNRAGLIPQWNVNAHKILYMLRGRARVQVVNHNGDAVFDDNVEQG  422



>emb|CDO99238.1| unnamed protein product [Coffea canephora]
Length=441

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W INAHS LYV +G+A +++V+ +G  + +DEV++G
Sbjct  307  GFLYSNAIFAPHWNINAHSALYVIRGNARIQVVDHKGNKVFDDEVKQG  354



>gb|EYU18319.1| hypothetical protein MIMGU_mgv1a005193mg [Erythranthe guttata]
Length=493

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN  + P W  NAH+ +YVTKGSA +++V  +G+++ +DEV +G
Sbjct  359  GVLYKNAIMAPHWSTNAHTAMYVTKGSARIQVVGNQGKSVFDDEVNKG  406



>ref|XP_004289947.1| PREDICTED: glycinin G4-like [Fragaria vesca subsp. vesca]
Length=505

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GF   N    P W +NAH   YV +GSA V++VN  G+ IL+D+VR+G
Sbjct  371  GFFYNNAIYSPHWNLNAHEVYYVIRGSARVQVVNDNGDCILDDQVRQG  418



>gb|AAC61881.1| 11S storage globulin [Coffea arabica]
Length=487

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W INAHS LYV +G+A +++V+ +G  + +DEV++G
Sbjct  353  GFLYSNAIFAPHWNINAHSALYVIRGNARIQVVDHKGNKVFDDEVKQG  400



>pdb|3EHK|A Chain A, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3EHK|B Chain B, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3EHK|C Chain C, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3EHK|D Chain D, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3EHK|E Chain E, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3EHK|F Chain F, Crystal Structure Of Pru Du Amandin, An Allergenic Protein 
From Prunus Dulcis
 pdb|3FZ3|A Chain A, Crystal Structure Of Almond Pru1 Protein
 pdb|3FZ3|B Chain B, Crystal Structure Of Almond Pru1 Protein
 pdb|3FZ3|C Chain C, Crystal Structure Of Almond Pru1 Protein
 pdb|3FZ3|D Chain D, Crystal Structure Of Almond Pru1 Protein
 pdb|3FZ3|E Chain E, Crystal Structure Of Almond Pru1 Protein
 pdb|3FZ3|F Chain F, Crystal Structure Of Almond Pru1 Protein
Length=531

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GF  +N    P W +NAHS +YV +G+A V++VN+ G+AIL+ EV++G
Sbjct  399  GFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQG  446



>gb|AAC61983.1| 11S storage globulin [Coffea arabica]
Length=490

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W INAHS LYV +G+A +++V+ +G  + +DEV++G
Sbjct  356  GFLYSNAIFAPHWNINAHSALYVIRGNARIQVVDHKGNKVFDDEVKQG  403



>ref|XP_008235678.1| PREDICTED: legumin type B-like [Prunus mume]
Length=520

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GF  +N    P W +NAHS +YV +G+A V++VN+ G+AIL+ EV++G
Sbjct  388  GFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQG  435



>emb|CAA55009.1| prunin [Prunus dulcis]
Length=551

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GF  +N    P W +NAHS +YV +G+A V++VN+ G+AIL+ EV++G
Sbjct  419  GFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQG  466



>gb|ADN39440.1| prunin 1 precursor [Prunus dulcis]
Length=551

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GF  +N    P W +NAHS +YV +G+A V++VN+ G+AIL+ EV++G
Sbjct  419  GFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQG  466



>ref|XP_007201716.1| hypothetical protein PRUPE_ppa003759mg [Prunus persica]
 gb|EMJ02915.1| hypothetical protein PRUPE_ppa003759mg [Prunus persica]
Length=551

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GF  +N    P W +NAHS +YV +G+A V++VN+ G+AIL+ EV++G
Sbjct  419  GFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQG  466



>gb|EYU46455.1| hypothetical protein MIMGU_mgv1a005708mg [Erythranthe guttata]
Length=473

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W  NAHS +YVT+G + ++IVN +G A+ + +VREG
Sbjct  337  GVLYRNAIMSPHWYANAHSIIYVTRGDSRMQIVNHKGRAVFDGQVREG  384



>ref|XP_002533465.1| legumin B precursor, putative [Ricinus communis]
 gb|EEF28917.1| legumin B precursor, putative [Ricinus communis]
Length=403

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  + P W INAHS  Y+T+GS  ++IVN+ G+++ + +VREG
Sbjct  266  LYKNAIMTPHWNINAHSIRYITRGSGRIQIVNENGDSVFDGQVREG  311



>ref|XP_004289945.1| PREDICTED: 12S seed storage protein CRU1-like [Fragaria vesca 
subsp. vesca]
Length=563

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GF   N    P W +NAH   YV +GSA V++VN  G+AIL++EVR+G
Sbjct  421  GFFYNNAIYSPHWNLNAHEVYYVIRGSARVQVVNNNGQAILDNEVRQG  468



>gb|ABG73110.1| Pis v 2.0201 allergen 11S globulin precusor [Pistacia vera]
Length=472

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAHS +Y+T+G+  ++IV++ GE++ ++E+REG
Sbjct  339  GVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIREG  386



>ref|XP_010679299.1| PREDICTED: 11S globulin seed storage protein 2-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010679300.1| PREDICTED: 11S globulin seed storage protein 2-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=473

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  32   PQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            P W IN+HS +YVT+G A +++V  +G+ I++D VREG
Sbjct  349  PHWAINSHSIIYVTRGEAHIQVVGHQGQTIMDDRVREG  386



>gb|ABU42022.1| 11S globulin [Pistacia vera]
Length=472

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAHS +Y+T+G+  ++IV++ GE++ ++E+REG
Sbjct  339  GVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIREG  386



>gb|EYU17920.1| hypothetical protein MIMGU_mgv1a006934mg [Erythranthe guttata]
Length=425

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G  N N  + P W +NAHS +YVT+G   ++IVN RGEA+ + +V EG
Sbjct  289  GRDNGNAIMAPHWYVNAHSIVYVTRGEGRMQIVNHRGEAVFDGQVGEG  336



>emb|CAA57846.1| legumin precur [Magnolia salicifolia]
Length=470

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  L PQW +NAHS +Y T+G+  V+IV ++G  + + E+REG
Sbjct  336  GVLYRNALLAPQWNVNAHSLVYATRGNGRVQIVGEQGRPVFDGELREG  383



>ref|XP_009603583.1| PREDICTED: 11S globulin subunit beta-like [Nicotiana tomentosiformis]
Length=521

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAHS LY+ +GS  +++V   G ++ NDEVREG
Sbjct  373  GVLYQNAVMAPYWNMNAHSILYILRGSGRIQVVGDTGNSVFNDEVREG  420



>ref|XP_004289943.1| PREDICTED: legumin A-like [Fragaria vesca subsp. vesca]
Length=496

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W + AH   YV +GSA V++VN  GE I +DEVR+G
Sbjct  367  GFLYNNAIYSPHWNLLAHEIFYVIRGSARVQVVNDNGETIFDDEVRQG  414



>emb|CAA57847.1| globulin precursor [Magnolia salicifolia]
Length=476

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  L PQW +NAHS +Y T+G+  V+IV ++G  + + E+REG
Sbjct  340  GVLYRNALLAPQWNVNAHSVVYATRGNGRVQIVGEQGRPVFDGELREG  387



>emb|CAA76573.1| 11S storage protein [Coffea arabica]
Length=492

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W INAH+ LYV +G+A +++V+ +G  + +DEV++G
Sbjct  356  GFLYSNAIFAPHWNINAHNALYVIRGNARIQVVDHKGNKVFDDEVKQG  403



>ref|XP_007050296.1| Legumin A, putative [Theobroma cacao]
 gb|EOX94453.1| Legumin A, putative [Theobroma cacao]
Length=508

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  23   GLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GL+PQW +NAH   Y+ +G A V++VNQ G+A+ +D + +G
Sbjct  382  GLIPQWSMNAHRIFYMLRGHARVQVVNQNGDAVFDDYLEKG  422



>gb|EPS62256.1| hypothetical protein M569_12535, partial [Genlisea aurea]
Length=476

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L++N  + P W  NAHS +Y T+G    ++VN RGEA+ + +V EG
Sbjct  340  GVLHENAIMAPHWYTNAHSIVYFTRGEGRAQVVNHRGEAVFDGDVNEG  387



>ref|XP_009777915.1| PREDICTED: 11S globulin subunit beta-like [Nicotiana sylvestris]
Length=518

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAHS LY+ +GS  +++V   G ++ ND+VREG
Sbjct  370  GVLYQNAVMAPYWNMNAHSILYILRGSGRIQVVGDTGNSVFNDQVREG  417



>ref|XP_007200723.1| hypothetical protein PRUPE_ppa004418mg [Prunus persica]
 gb|EMJ01922.1| hypothetical protein PRUPE_ppa004418mg [Prunus persica]
Length=511

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W  NA++ +Y  +G+A V++VN+ G+ ILNDEVREG
Sbjct  373  GVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILNDEVREG  420



>emb|CAA29507.1| glutelin [Oryza sativa Japonica Group]
 prf||1312289A glutelin
Length=226

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  87   LYQNALLSPFWNINAHSIVYITQGRAQVQVVNNNGKTVFNGELRRG  132



>ref|XP_006369783.1| hypothetical protein POPTR_0001s31560g, partial [Populus trichocarpa]
 gb|ERP66352.1| hypothetical protein POPTR_0001s31560g, partial [Populus trichocarpa]
Length=111

 Score = 48.5 bits (114),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  26   LVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            + P W INAHS  Y+T+GS  ++IV   G+A+ + +VREG
Sbjct  1    MSPNWNINAHSICYITRGSGRIQIVGDNGQAVFDGQVREG  40



>ref|XP_006370929.1| legumin family protein [Populus trichocarpa]
 gb|ERP48726.1| legumin family protein [Populus trichocarpa]
Length=493

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W +NAHS +Y+T+G+  ++IV   G+ I + EVREG
Sbjct  359  GVLYPNAMMSPHWNMNAHSIIYITRGNGRIQIVGDNGQTIFDGEVREG  406



>emb|CAA40978.1| cruciferin cru4 subunit [Brassica napus]
Length=184

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G ++ N  ++PQW +NA++ LYVTKG A +++VN  G+ + + E+ +G
Sbjct  47   GSIHNNAMVLPQWNVNANAALYVTKGKAHIQMVNDNGQRVFDQEISQG  94



>emb|CAA55010.1| pru2 [Prunus dulcis]
Length=504

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W  NA++ +Y  +G+A V++VN+ G+ ILNDEVREG
Sbjct  366  GVLYNNAIYTPHWHTNANALVYPIRGNARVQVVNENGDPILNDEVREG  413



>ref|XP_002533466.1| glutelin type-A 3 precursor, putative [Ricinus communis]
 gb|EEF28918.1| glutelin type-A 3 precursor, putative [Ricinus communis]
Length=497

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  + P W INAHS  Y+T+GS  V+IVN+ G+++ + +V+ G
Sbjct  370  LYKNALMTPHWNINAHSIRYITRGSGRVQIVNENGDSVFDGQVQRG  415



>ref|XP_002522726.1| 11S globulin subunit beta precursor, putative [Ricinus communis]
 gb|EEF39577.1| 11S globulin subunit beta precursor, putative [Ricinus communis]
Length=386

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  + P W INAHS  Y+ +GS  V+IVN+ G+++ + +VR G
Sbjct  258  LYKNAIMTPHWNINAHSIRYIARGSGRVQIVNENGDSVFDGQVRRG  303



>gb|AAF73008.1|AF262999_1 seed storage protein [Ricinus communis]
Length=353

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  + P W INAHS  Y+T+GS  V+IVN+ G+++ + +V+ G
Sbjct  226  LYKNALMTPHWNINAHSIRYITRGSGRVQIVNENGDSVFDGQVQRG  271



>dbj|BAD94859.1| putative cruciferin 12S seed storage protein [Arabidopsis thaliana]
Length=178

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + KN  ++PQW +NA++ LYVT G A +++VN  GE + + E+  G
Sbjct  44   GSIRKNAMVLPQWNVNANAALYVTNGKAHIQMVNDNGERVFDQEISSG  91



>ref|XP_006370928.1| hypothetical protein POPTR_0019s01840g [Populus trichocarpa]
 gb|ERP48725.1| hypothetical protein POPTR_0019s01840g [Populus trichocarpa]
Length=494

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W +NAHS +Y+T+G+  ++IV   G+ I + EVREG
Sbjct  360  GVLYPNALMSPHWNMNAHSIIYITRGNGRIQIVGDNGQTIFDGEVREG  407



>ref|XP_009624044.1| PREDICTED: 11S globulin seed storage protein 2-like [Nicotiana 
tomentosiformis]
Length=174

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  L P W +N+H  +YV +G A V++V+  G+ ++ND V +G
Sbjct  44   GTLYPNALLTPHWSVNSHCVVYVQRGEAQVQVVDHSGQQVMNDRVNQG  91



>ref|XP_006369779.1| hypothetical protein POPTR_0001s31540g, partial [Populus trichocarpa]
 gb|ERP66348.1| hypothetical protein POPTR_0001s31540g, partial [Populus trichocarpa]
Length=470

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W INAHS  Y+T+GS  ++IV   G+A+ + +VREG
Sbjct  352  GVLYPNALMSPNWNINAHSICYITRGSGRIQIVGDNGQAVFDGQVREG  399



>gb|AAO38859.1| 11S globulin [Bertholletia excelsa]
Length=465

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NA+S +Y  +G A V+IV+ RGE + +D +REG
Sbjct  331  GVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREG  378



>ref|XP_008235677.1| PREDICTED: legumin J-like [Prunus mume]
Length=516

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NA+  +Y  +G+A V++VN+ G++IL+DEVREG
Sbjct  378  GVLYNNAIYTPHWHLNANVLVYAVRGNARVQVVNENGDSILDDEVREG  425



>gb|AAF19607.1| legumin-like protein [Perilla frutescens]
Length=471

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  L P W +  H+ +YVT+G+A V++V+ +G++++ND V++G
Sbjct  337  GTLFPNAMLSPDWAMQGHTIVYVTRGNAKVQVVDHKGQSLMNDRVQQG  384



>emb|CAA64763.1| legumin-like protein [Dioscorea caucasica]
Length=485

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  26   LVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
             VP W +NAH+ +YVT+G   V++V+ RG  + N  VR+G
Sbjct  354  FVPHWTMNAHTIMYVTRGEGQVQVVDNRGRNLFNGRVRQG  393



>ref|XP_010272888.1| PREDICTED: legumin B-like [Nelumbo nucifera]
Length=500

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G+L KN  + P W +NAHS +YV  G A V+IV   G+A+ + ++REG
Sbjct  371  GYLYKNSMMSPHWNMNAHSVIYVLNGEARVQIVANYGQAVFDGQLREG  418



>emb|CDP79024.1| edestin 1 [Cannabis sativa]
Length=511

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN    P W +NAHS +YV +G A V++VN+ G+   + EVR+G
Sbjct  371  GVLYKNAIYTPHWNVNAHSVMYVLRGRARVQVVNRMGQKCFDGEVRQG  418



>gb|ABK80754.1| 11S globulin precursor isoform 3A [Ficus pumila var. awkeotsang]
Length=493

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W INAHS +YV +G A  ++VN  G+ + + E+R+G
Sbjct  360  GFLYSNAMYSPHWNINAHSVIYVIRGRARCQVVNSFGQTVFDGELRQG  407



>gb|ADN39441.1| prunin 2 precursor, partial [Prunus dulcis]
Length=504

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W  NA++ +Y  +G+A V++VN+ G+ IL+DEVREG
Sbjct  366  GVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREG  413



>emb|CAR78992.1| legumin storage protein 3 [Lotus japonicus]
Length=614

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  32   PQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            P W INA+S +YV +G   V IVN +G+A+ NDE+R+G
Sbjct  487  PHWNINANSIIYVVRGRGRVRIVNCQGQAVFNDELRKG  524



>emb|CAR78991.1| legumin storage protein 2 [Lotus japonicus]
Length=583

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  32   PQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            P W INA+S +YV +G   V IVN +G+A+ NDE+R+G
Sbjct  456  PHWNINANSIIYVVRGRGRVRIVNCQGQAVFNDELRKG  493



>ref|NP_001275797.1| citrin precursor [Citrus sinensis]
 gb|AAB52963.1| citrin [Citrus sinensis]
Length=486

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  L PQW +NAHS +YVT+G+  ++IV + GE + + ++REG
Sbjct  351  GNLYPNALLAPQWNLNAHSIVYVTRGNGRMQIVAENGENVFDGQIREG  398



>ref|XP_006354542.1| PREDICTED: legumin B-like [Solanum tuberosum]
Length=489

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + +N  + P W +NAHS +Y+ +G+  +++V   G ++ +DEVREG
Sbjct  341  GVMYQNAVMAPYWNLNAHSIIYIIRGTGRIQVVGDTGNSVFDDEVREG  388



>gb|KEH23928.1| glycinin G4 [Medicago truncatula]
Length=535

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  5    FLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            +L K+   VP W +NA+S +YVT+G   V++VN  G+++ N EV+ G
Sbjct  400  YLYKDGIFVPHWNMNANSIMYVTRGRGRVQVVNSEGKSVFNGEVKRG  446



>sp|P19084.1|11S3_HELAN RecName: Full=11S globulin seed storage protein G3; AltName: 
Full=Helianthinin-G3; Contains: RecName: Full=11S globulin seed 
storage protein G3 acidic chain; Contains: RecName: Full=11S 
globulin seed storage protein G3 basic chain; Flags: Precursor 
[Helianthus annuus]
 gb|AAA33374.1| 11S storage protein [Helianthus annuus]
Length=493

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W INAH+ LYVT+G+  V+IV+ +G ++ ++E+REG
Sbjct  357  GELRPNAIQSPHWTINAHNLLYVTEGALRVQIVDNQGNSVFDNELREG  404



>ref|XP_006420240.1| hypothetical protein CICLE_v10004854mg [Citrus clementina]
 gb|ESR33480.1| hypothetical protein CICLE_v10004854mg [Citrus clementina]
Length=485

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  L PQW +NAHS +YVT+G+  ++IV + GE + + ++REG
Sbjct  350  GNLYPNALLAPQWNLNAHSIVYVTRGNGRMQIVAENGENVFDGQIREG  397



>gb|EPS70989.1| hypothetical protein M569_03772 [Genlisea aurea]
Length=572

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N    P++  NAHS LYVT+G+A +++V   G A+ + EVREG
Sbjct  431  GILYRNALTAPKYSANAHSALYVTRGNARIQVVGNEGNAVFDGEVREG  478



>emb|CDP79023.1| edestin 1 [Cannabis sativa]
 emb|CDP79025.1| edestin 1 [Cannabis sativa]
Length=511

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN    P W +NAHS +YV +G A V++VN  G+   + EVR+G
Sbjct  371  GVLYKNAIYTPHWNVNAHSVMYVLRGRARVQVVNHMGQKCFDGEVRQG  418



>emb|CAR78995.1| legumin storage protein 3 [Lotus japonicus]
Length=498

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  32   PQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            P W INA+S +YV +G   V IVN +G+A+ NDE+R+G
Sbjct  371  PHWNINANSIIYVVRGRGRVRIVNCQGQAVFNDELRKG  408



>gb|ABG47337.1| glutelin precursor [Zizania latifolia]
Length=500

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W IN+HS +YVT+G A V++VN  G+ + N E+R G
Sbjct  361  LYQNALLSPFWNINSHSVVYVTQGCARVQVVNNNGKTVFNGELRRG  406



>ref|NP_171885.1| 12S seed storage protein CRD [Arabidopsis thaliana]
 sp|Q9ZWA9.1|CRU4_ARATH RecName: Full=12S seed storage protein CRD; AltName: Full=Cruciferin 
D; AltName: Full=Legumin-type globulin storage protein 
CRD; Contains: RecName: Full=12S seed storage protein CRD 
alpha chain; AltName: Full=12S seed storage protein CRD acidic 
chain; Contains: RecName: Full=12S seed storage protein 
CRD beta chain; AltName: Full=12S seed storage protein CRD basic 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD10679.1| Putative seed storage protein [Arabidopsis thaliana]
 gb|AAL38873.1| putative cruciferin 12S seed storage protein [Arabidopsis thaliana]
 gb|AAM51303.1| putative cruciferin 12S seed storage protein [Arabidopsis thaliana]
 gb|AEE27629.1| 12S seed storage protein CRD [Arabidopsis thaliana]
Length=451

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G+L     ++PQW  NAH+ LYVT G A +++V+  G+++ N++V +G
Sbjct  322  GYLYSGGMVLPQWTANAHTVLYVTGGQAKIQVVDDNGQSVFNEQVGQG  369



>ref|XP_006306303.1| hypothetical protein CARUB_v10012169mg [Capsella rubella]
 gb|EOA39201.1| hypothetical protein CARUB_v10012169mg [Capsella rubella]
Length=453

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G+L     ++PQW  NAH+ LYVT G A +++V+  G+++ N++V +G
Sbjct  324  GYLYSGGMVLPQWTANAHTVLYVTGGQAKIQVVDDNGQSVFNEQVGQG  371



>gb|KDO60493.1| hypothetical protein CISIN_1g046186mg [Citrus sinensis]
Length=436

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L++N  +VP W +NAHS +Y   GS  V++V+  G ++ + EVR G
Sbjct  339  GLLHRNAMMVPHWNLNAHSIMYAISGSCHVQVVDSYGRSVYDGEVRRG  386



>ref|XP_009763876.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=496

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVRE  142
            G L +N  + P W +NAHS +Y+ +GS  +++V   G ++ +DEVRE
Sbjct  361  GTLYRNAIVAPHWNMNAHSIIYIIRGSGRIQVVGNAGRSVFDDEVRE  407



>ref|XP_009765013.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=499

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAH+ +Y+ +GS  +++V   G ++ +DEVR+G
Sbjct  365  GTLYRNAIVAPHWNMNAHAIIYIIRGSGRIQVVGNAGRSVFDDEVRQG  412



>emb|CDP03744.1| unnamed protein product [Coffea canephora]
Length=392

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN    P W +NA+  +YVT+G   V+IV+ RG+ +L++++ EG
Sbjct  263  GGLYKNAVFAPHWYVNANGVMYVTRGEGRVQIVDHRGQCVLDEQLSEG  310



>ref|XP_009765011.1| PREDICTED: legumin B-like [Nicotiana sylvestris]
Length=499

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAH+ +Y+ +GS  +++V   G ++ +DEVR+G
Sbjct  365  GTLYRNAIVAPHWNMNAHAIIYIIRGSGRIQVVGNAGRSVFDDEVRQG  412



>ref|XP_010475020.1| PREDICTED: 12S seed storage protein CRD-like [Camelina sativa]
Length=456

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G+L     ++PQW  NAH+ LYVT G A +++V+  G+++ N++V +G
Sbjct  327  GYLYSGGMVLPQWTANAHTVLYVTGGQAKIQVVDDNGQSVFNEQVGQG  374



>gb|AAA50316.1| glutelin [Oryza sativa Japonica Group]
Length=497

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + + E+R G
Sbjct  360  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFDGELRRG  405



>ref|XP_010482699.1| PREDICTED: 12S seed storage protein CRD-like [Camelina sativa]
Length=453

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G+L     ++PQW  NAH+ LYVT G A +++V+  G+++ N++V +G
Sbjct  324  GYLYSGGMVLPQWTANAHTVLYVTGGQAKIQVVDDNGQSVFNEQVGQG  371



>gb|AGE34644.1| 11S globulin isoform 3 [Castanea sativa]
Length=531

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L ++   VP W  NAHS +YV KG A V++V+  G+A+ +DE+++G
Sbjct  393  GRLQRDAIYVPHWNRNAHSVIYVVKGRAQVQVVDDFGQAVFDDELQQG  440



>gb|ADN39437.1| 11S globulin isoform 1 [Castanea sativa]
Length=530

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L ++   VP W  NAHS +YV KG A V++V+  G+A+ +DE+++G
Sbjct  392  GRLQRDAIYVPHWNRNAHSVIYVVKGRAQVQVVDDFGQAVFDDELQQG  439



>emb|CAA38211.1| glutelin [Oryza sativa]
Length=496

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + + E+R G
Sbjct  359  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFDGELRRG  404



>ref|NP_001050413.1| Os03g0427300 [Oryza sativa Japonica Group]
 sp|Q09151.2|GLUA3_ORYSJ RecName: Full=Glutelin type-A 3; Contains: RecName: Full=Glutelin 
type-A 3 acidic chain; Contains: RecName: Full=Glutelin 
type-A 3 basic chain; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAR01757.1| glutelin [Oryza sativa Japonica Group]
 gb|ABF96730.1| Glutelin type-A 3 precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12327.1| Os03g0427300 [Oryza sativa Japonica Group]
 gb|ABL74546.1| glutelin [Oryza sativa Japonica Group]
Length=496

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + + E+R G
Sbjct  359  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFDGELRRG  404



>gb|ADN39438.1| 11S globulin isoform 2 [Castanea sativa]
Length=529

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L ++   VP W  NAHS +YV KG A V++V+  G+A+ +DE+++G
Sbjct  391  GRLQRDAIYVPHWNRNAHSVIYVVKGRAQVQVVDDFGQAVFDDELQQG  438



>emb|CAA54153.1| 12s globulin [Avena sativa]
Length=515

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+ +G A V++VN  G+ + ND +R+G
Sbjct  367  LYQNAILSPFWNINAHSVVYMIQGHAQVQVVNNNGQTVFNDRLRQG  412



>gb|AGT59176.1| glutelin, partial [Oryza sativa Indica Group]
Length=486

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + + E+R G
Sbjct  349  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFDGELRRG  394



>gb|ABG47461.1| glutelin precursor [Zizania latifolia]
Length=509

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +YVT+G A V++VN  G+ + N E+R G
Sbjct  369  LYQNALLSPFWNINAHSVVYVTQGRARVQVVNNNGKTVFNGELRRG  414



>ref|XP_011046347.1| PREDICTED: legumin B-like [Populus euphratica]
Length=495

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W INAHS +Y+T+G+  ++IV   G+A+ + +VR+G
Sbjct  362  GVLYPNALMSPHWNINAHSIMYITRGNGRIQIVGDNGQAVFDGQVRKG  409



>ref|XP_009630003.1| PREDICTED: legumin B-like [Nicotiana tomentosiformis]
Length=500

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAH+ +Y+ +GS  +++V   G ++ +DEVR+G
Sbjct  366  GTLYRNAIVAPHWNMNAHAVIYIIRGSGRIQVVGNAGRSVFDDEVRQG  413



>gb|EEE59300.1| hypothetical protein OsJ_11349 [Oryza sativa Japonica Group]
Length=569

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + + E+R G
Sbjct  359  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFDGELRRG  404



>gb|ACJ54337.1| Gt3 [Oryza sativa Japonica Group]
Length=445

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + + E+R G
Sbjct  359  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFDGELRRG  404



>gb|AAA50314.2| glutelin [Oryza sativa Japonica Group]
Length=445

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + + E+R G
Sbjct  359  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFDGELRRG  404



>gb|AGT59175.1| glutelin, partial [Oryza sativa Indica Group]
Length=456

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  317  LYQNALLSPFWNINAHSIVYITQGRAQVQVVNNNGKTVFNGELRRG  362



>prf||1603218A glutelin
Length=499

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSIVYITQGRAQVQVVNNNGKTVFNGELRRG  405



>ref|XP_006857275.1| hypothetical protein AMTR_s00067p00022330 [Amborella trichopoda]
 gb|ERN18742.1| hypothetical protein AMTR_s00067p00022330 [Amborella trichopoda]
Length=486

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 16/40 (40%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  26   LVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L P W INAH+  Y+T+G   ++I+   G+ +++D VR+G
Sbjct  362  LAPHWSINAHTIAYITRGEGQIQIIGTNGQKVMDDRVRQG  401



>gb|EEC75527.1| hypothetical protein OsI_12139 [Oryza sativa Indica Group]
Length=674

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + + E+R G
Sbjct  359  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFDGELRRG  404



>ref|XP_008382906.1| PREDICTED: 13S globulin basic chain-like [Malus domestica]
Length=141

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  44   INAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            INAHS +YV +GSA V++VN+ G  IL+D+V+EG
Sbjct  19   INAHSVVYVIRGSARVQVVNENGNPILDDQVQEG  52



>dbj|BAA00462.1| prepro-glutelin [Oryza sativa Japonica Group]
Length=499

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSIVYITQGRAQVQVVNNNGKTVFNGELRRG  405



>ref|NP_001064542.1| Os10g0400200 [Oryza sativa Japonica Group]
 sp|P07730.1|GLUA2_ORYSJ RecName: Full=Glutelin type-A 2; AltName: Full=Glutelin type 
II; Contains: RecName: Full=Glutelin type-A 2 acidic chain; 
Contains: RecName: Full=Glutelin type-A 2 basic chain; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|AAK50415.1|AC021891_16 Glutelin II precursor [Oryza sativa Japonica Group]
 emb|CAA29151.1| glutelin [Oryza sativa]
 emb|CAA29152.1| glutelin [Oryza sativa]
 emb|CAA68683.1| glutelin [Oryza sativa]
 gb|AAA50315.1| glutelin 1 [Oryza sativa Japonica Group]
 gb|AAP53644.1| Glutelin type-A 2 precursor, putative, expressed [Oryza sativa 
Japonica Group]
 gb|AAS98732.1| glutelin precursor [Oryza sativa Japonica Group]
 gb|ABA39424.1| glutelin [Oryza sativa Japonica Group]
 dbj|BAF26456.1| Os10g0400200 [Oryza sativa Japonica Group]
 gb|ABL74543.1| glutelin [Oryza sativa Japonica Group]
 gb|EAZ15994.1| hypothetical protein OsJ_31438 [Oryza sativa Japonica Group]
Length=499

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSIVYITQGRAQVQVVNNNGKTVFNGELRRG  405



>gb|ABA46747.1| glutelin [Oryza sativa Japonica Group]
Length=499

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSIVYITQGRAQVQVVNNNGKTVFNGELRRG  405



>gb|AGT59174.1| glutelin, partial [Oryza sativa Indica Group]
Length=454

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  315  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRG  360



>gb|AAF34634.1|AF216800_1 22kDa storage protein [Fagopyrum gracilipes]
Length=191

 Score = 47.0 bits (110),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G A+ +D V+ G
Sbjct  54   LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGNAVFDDVVQRG  99



>gb|AAA33906.1| glutelin [Oryza sativa]
Length=499

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRG  405



>ref|XP_009603582.1| PREDICTED: 11S globulin subunit beta-like [Nicotiana tomentosiformis]
Length=496

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVRE  142
            G L +N  + P W +NAHS +Y+ +GS  +++V   G ++ +DEVRE
Sbjct  361  GTLYRNAIVAPHWNMNAHSIIYIIRGSGRIQVVGNAGRSVFDDEVRE  407



>emb|CAA29150.1| glutelin [Oryza sativa]
Length=496

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRG  405



>prf||1312296A glutelin
Length=498

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  359  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRG  404



>ref|XP_004172305.1| PREDICTED: 11S globulin subunit beta-like, partial [Cucumis sativus]
Length=217

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVRE  142
            G L +N   VP W  NAHS ++VT+G A V++VN RG+ + + E+++
Sbjct  93   GVLYRNAMYVPHWNQNAHSVIFVTRGRARVQVVNCRGQTVFDGELQQ  139



>ref|XP_002889480.1| cupin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65739.1| cupin family protein [Arabidopsis lyrata subsp. lyrata]
Length=452

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G+L     ++PQW  NAH+ LYVT G A +++V+  G+++ N++V +G
Sbjct  323  GYLYSGGMVLPQWTANAHTVLYVTGGQAKIQVVDDNGQSVFNEQVGQG  370



>gb|AAD10372.1| globulin-like protein, partial [Oryza sativa]
Length=182

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + +N  L P W INAH+ +Y T GSA +++V+  G  + + E+R G
Sbjct  53   GVMRRNAILAPHWNINAHAAVYATSGSARLQVVSSEGRRVFDGELRRG  100



>gb|ABL74545.1| glutelin [Oryza sativa Japonica Group]
Length=499

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRG  405



>prf||1210248A glutelin precursor
Length=499

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRG  405



>ref|NP_001044328.1| Os01g0762500 [Oryza sativa Japonica Group]
 sp|P07728.2|GLUA1_ORYSJ RecName: Full=Glutelin type-A 1; AltName: Full=Glutelin type 
I; Contains: RecName: Full=Glutelin type-A 1 acidic chain; Contains: 
RecName: Full=Glutelin type-A 1 basic chain; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAB61225.1| glutelin type I precursor [Oryza sativa Japonica Group]
 dbj|BAB92370.1| glutelin [Oryza sativa Japonica Group]
 dbj|BAF06242.1| Os01g0762500 [Oryza sativa Japonica Group]
 gb|ABL74544.1| glutelin [Oryza sativa Japonica Group]
 gb|EAZ13628.1| hypothetical protein OsJ_03545 [Oryza sativa Japonica Group]
Length=499

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRG  405



>emb|CAA29149.1| glutelin [Oryza sativa]
Length=499

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRG  405



>gb|AAF34635.1|AF216801_1 allergenic protein [Fagopyrum esculentum]
 gb|ACZ67528.1| legumin-like protein [Fagopyrum esculentum]
Length=191

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  54   LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  99



>gb|EAY75915.1| hypothetical protein OsI_03835 [Oryza sativa Indica Group]
Length=499

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  360  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRG  405



>emb|CDX89858.1| BnaA10g02240D [Brassica napus]
Length=470

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G ++ N  ++PQW +NA++ LYVTKG A +++VN  G+ + + E+ +G
Sbjct  333  GSIHNNAMVLPQWNVNANAALYVTKGKAHIQMVNDNGQRVFDQEISQG  380



>ref|XP_006644747.1| PREDICTED: glutelin type-A 1-like [Oryza brachyantha]
Length=497

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  358  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGELRRG  403



>ref|XP_009119353.1| PREDICTED: cruciferin CRU4 [Brassica rapa]
Length=464

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G ++ N  ++PQW +NA++ LYVTKG A +++VN  G+ + + E+ +G
Sbjct  327  GSIHNNAMVLPQWNVNANAALYVTKGKAHIQMVNDNGQRVFDQEISQG  374



>emb|CDP79026.1| edestin 1 [Cannabis sativa]
Length=511

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN    P W ++AHS +YV +G A V++VN  G+   + EVR+G
Sbjct  371  GVLYKNAIYTPHWNVSAHSVMYVLRGRARVQVVNHMGQKCFDGEVRQG  418



>ref|XP_004960358.1| PREDICTED: glutelin type-B 5-like [Setaria italica]
Length=432

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P + INA + +YVT GSA +++V+ RG A+LND +R+G
Sbjct  308  GTLKPNEIVSPYYTINAQTVVYVTGGSARLQVVDNRGVAVLNDALRQG  355



>ref|XP_011080042.1| PREDICTED: 11S globulin seed storage protein 2 [Sesamum indicum]
 sp|Q9XHP0.1|11S2_SESIN RecName: Full=11S globulin seed storage protein 2; AltName: Full=11S 
globulin seed storage protein II; AltName: Full=Alpha-globulin; 
Contains: RecName: Full=11S globulin seed storage 
protein 2 acidic chain; AltName: Full=11S globulin seed storage 
protein II acidic chain; Contains: RecName: Full=11S globulin 
seed storage protein 2 basic chain; AltName: Full=11S 
globulin seed storage protein II basic chain; Flags: Precursor 
[Sesamum indicum]
 gb|AAD42944.1|AF091842_1 11S globulin precursor [Sesamum indicum]
Length=459

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W +  H+ +YVT+G A V++V+  G+A++ND V +G
Sbjct  329  GNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQG  376



>ref|XP_006351695.1| PREDICTED: 11S globulin seed storage protein 2-like [Solanum 
tuberosum]
Length=481

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W +N HS +YV +G A V++V+  G+ ++ND V +G
Sbjct  351  GTLYPNALMSPHWSVNGHSIIYVQRGDAQVQVVDHTGQQVMNDRVNQG  398



>ref|XP_010111924.1| Legumin A [Morus notabilis]
 gb|EXC31958.1| Legumin A [Morus notabilis]
Length=490

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W INAHS +YV +GSA  ++V+  G ++ + E+R+G
Sbjct  357  GFLYSNALYSPHWNINAHSVIYVIRGSARCQVVDDFGRSVFDGELRQG  404



>ref|XP_010045998.1| PREDICTED: legumin A-like [Eucalyptus grandis]
 gb|KCW84737.1| hypothetical protein EUGRSUZ_B01551 [Eucalyptus grandis]
Length=503

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L++N  +VP + +N HS +Y  +GSA +++V+  G+ + ++E+REG
Sbjct  365  GHLHRNAIMVPHYNLNCHSVVYAIRGSARIQVVSDDGQTVFDEELREG  412



>emb|CDY32518.1| BnaA09g50780D [Brassica napus]
Length=496

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L     ++P W  NAH+ LYVT G A++++V+  G+++ N +V++G
Sbjct  318  GVLYSGGMMLPHWTANAHTVLYVTGGQAMIQVVDDNGQSVFNAQVQQG  365



>ref|XP_011046348.1| PREDICTED: legumin B-like [Populus euphratica]
Length=491

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W +NAHS +Y+T+G+  ++IV   G+ I + E+REG
Sbjct  357  GVLYPNALMSPHWNMNAHSIIYITRGNGRIQIVGDNGQTIFDGELREG  404



>ref|XP_009761685.1| PREDICTED: legumin A-like [Nicotiana sylvestris]
Length=473

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILND  130
            G L+ +  + P W  NAH  +Y+T+G A ++IV+ RG+A+L+D
Sbjct  336  GVLHTDSIMAPHWVTNAHKVIYITRGEARIQIVDHRGQAVLDD  378



>emb|CAA40980.1| cruciferin cru4 subunit [Brassica napus]
Length=413

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G ++ N  ++PQW +NA++ LYVTKG A +++VN  G+ + + E+ +G
Sbjct  276  GSIHNNAMVLPQWNVNANAALYVTKGKAHIQMVNDNGQRVFDQEISKG  323



>gb|AGU36408.1| 11S globulin precursor, partial [Helianthus annuus]
Length=346

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+ +YV  G A +++V+  GEA+LN++V  G
Sbjct  228  GHLQPNALFSPHWTVNSHTVVYVLSGDAQIQVVSNNGEAVLNEQVSRG  275



>gb|AGU36396.1| 11S globulin precursor, partial [Helianthus argophyllus]
Length=336

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+ +YV  G A +++V+  GEA+LN++V  G
Sbjct  218  GHLQPNALFSPHWTVNSHTVVYVLSGDAQIQVVSNNGEAVLNEQVSRG  265



>ref|XP_010279433.1| PREDICTED: legumin A-like [Nelumbo nucifera]
Length=645

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN  L P W INAHS +YV +G A V+IV   G+ + + ++ EG
Sbjct  509  GHLYKNALLSPHWNINAHSVMYVIRGEARVQIVGNSGQTVFDGQLCEG  556



>gb|AGU36413.1| 11S globulin precursor, partial [Helianthus annuus]
Length=346

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+ +YV  G A +++V+  GEA+LN++V  G
Sbjct  228  GHLQPNALFSPHWTVNSHTVVYVLSGDAQIQVVSNNGEAVLNEQVSRG  275



>gb|AAA33963.1| glycinin A-2-B-1a subunit precursor, partial [Glycine max]
Length=224

 Score = 47.0 bits (110),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN   VP + +NA+S +Y   G ALV++VN  GE + + E++EG
Sbjct  91   GSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEG  138



>sp|P13744.1|11SB_CUCMA RecName: Full=11S globulin subunit beta; Contains: RecName: Full=11S 
globulin gamma chain; AltName: Full=11S globulin acidic 
chain; Contains: RecName: Full=11S globulin delta chain; 
AltName: Full=11S globulin basic chain; Flags: Precursor [Cucurbita 
maxima]
 pir||FWPU1B 11S globulin beta subunit precursor - cucurbita cv. Kurokawa 
Amakuri [Cucurbita cv. Kurokawa Amakuri]
 gb|AAA33110.1| 11-S globulin beta-subunit precursor [Cucurbita pepo]
Length=480

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P + +N+HS +Y T+G+A V++V+  G+++ + EVREG
Sbjct  348  GVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEVREG  395



>ref|XP_009624041.1| PREDICTED: legumin A-like [Nicotiana tomentosiformis]
Length=473

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILND  130
            G L ++  + P W  NAH  +Y+TKG + ++IV+ RG+A+L+D
Sbjct  336  GVLYRDSIMAPHWVTNAHKVIYITKGESRIQIVDHRGQAVLDD  378



>emb|CAA54152.1| 12s globulin [Avena sativa]
Length=472

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+ +G A V++VN  G+ + ND +R+G
Sbjct  324  LYQNAILSPFWNINAHSVVYMIQGHARVQVVNNNGQTVFNDRLRQG  369



>gb|KGN45554.1| hypothetical protein Csa_7G452090 [Cucumis sativus]
Length=476

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P + +NAH+  Y T+GSA V++V+  G+A+ + EVREG
Sbjct  344  GVLYSNAISAPHYTVNAHTVAYATRGSARVQVVDNYGQAVFDGEVREG  391



>ref|XP_004155945.1| PREDICTED: 11S globulin subunit beta-like [Cucumis sativus]
Length=476

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P + +NAH+  Y T+GSA V++V+  G+A+ + EVREG
Sbjct  344  GVLYSNAISAPHYTVNAHTVAYATRGSARVQVVDNYGQAVFDGEVREG  391



>ref|XP_009118685.1| PREDICTED: 12S seed storage protein CRD [Brassica rapa]
Length=445

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L     ++P W  NAH+ LYVT G A++++V+  G+++ N +V++G
Sbjct  318  GVLYSGGMMLPHWTANAHTVLYVTGGQAMIQVVDDNGQSVFNAQVQQG  365



>ref|XP_008805230.1| PREDICTED: LOW QUALITY PROTEIN: glutelin type-A 3-like [Phoenix 
dactylifera]
Length=470

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P W INAHS +Y T G   V++V+  G+ + + E+R+G
Sbjct  338  LYKNAMLAPHWNINAHSVMYCTGGRGRVQVVDNNGKTVFDGELRQG  383



>gb|AEO27681.1| seed storage protein legumin B, partial [Gossypium raimondii]
Length=494

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NAHS +Y+T+G+  ++IV++ GEAI +++V  G
Sbjct  369  GVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIVSENGEAIFDEQVERG  416



>gb|AEO27680.1| seed storage protein legumin B, partial [Gossypium hirsutum]
Length=494

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NAHS +Y+T+G+  ++IV++ GEAI +++V  G
Sbjct  369  GVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIVSENGEAIFDEQVERG  416



>ref|XP_006654150.1| PREDICTED: glutelin type-A 3-like [Oryza brachyantha]
Length=491

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + + E+R+G
Sbjct  354  LYQNAVLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFDGELRQG  399



>ref|XP_004141669.1| PREDICTED: LOW QUALITY PROTEIN: 11S globulin subunit beta-like 
[Cucumis sativus]
Length=475

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P + +NAH+  Y T+GSA V++V+  G+A+ + EVREG
Sbjct  343  GVLYSNAISAPHYTVNAHTVAYATRGSARVQVVDNYGQAVFDGEVREG  390



>gb|AGU36406.1| 11S globulin precursor, partial [Helianthus annuus]
Length=342

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+ +YV  G A +++V+  GEA+LN++V  G
Sbjct  224  GHLQPNALFSPHWTVNSHTVVYVLNGDAQIQVVSNNGEAVLNEQVSRG  271



>gb|KHG07690.1| Legumin B [Gossypium arboreum]
Length=516

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NAHS +Y+T+G+  ++IV++ GEAI +++V  G
Sbjct  386  GVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIVSENGEAIFDEQVERG  433



>gb|AGU36407.1| 11S globulin precursor, partial [Helianthus annuus]
Length=346

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+ +YV  G A +++V+  GEA+LN++V  G
Sbjct  228  GHLQPNALFSPHWTVNSHTVVYVLNGDAQIQVVSNNGEAVLNEQVSRG  275



>gb|AGU36400.1| 11S globulin precursor, partial [Helianthus annuus]
Length=346

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+ +YV  G A +++V+  GEA+LN++V  G
Sbjct  228  GHLQPNALFSPHWTVNSHTVVYVLNGDAQIQVVSNNGEAVLNEQVSRG  275



>gb|AGU36397.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36398.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36404.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36405.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36409.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36410.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36411.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36412.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36414.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36415.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36416.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36417.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36418.1| 11S globulin precursor, partial [Helianthus annuus]
 gb|AGU36419.1| 11S globulin precursor, partial [Helianthus annuus]
Length=346

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+ +YV  G A +++V+  GEA+LN++V  G
Sbjct  228  GHLQPNALFSPHWTVNSHTVVYVLNGDAQIQVVSNNGEAVLNEQVSRG  275



>ref|XP_009624043.1| PREDICTED: legumin A-like [Nicotiana tomentosiformis]
Length=475

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILND  130
            G L ++  + P W  NAH  +Y+TKG + ++IV+ RG+A+L+D
Sbjct  338  GVLYRDSIMAPHWVTNAHKVIYITKGESRIQIVDHRGQAVLDD  380



>ref|XP_009624040.1| PREDICTED: 11S globulin seed storage protein 2-like [Nicotiana 
tomentosiformis]
Length=490

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  L P W +N+H  +YV +G A V++V+  G+ ++ND V +G
Sbjct  360  GTLYPNALLTPHWSVNSHCVVYVQRGEAQVQVVDHSGQQVMNDRVNQG  407



>emb|CDY18193.1| BnaC05g02160D [Brassica napus]
Length=457

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G ++ N  ++PQW +NA++ LYVTKG A +++VN  G+ + + E+ +G
Sbjct  320  GSIHNNAMVLPQWNVNANAALYVTKGKAHIQMVNDNGQRVFDQEISKG  367



>gb|AEO27678.1| seed storage protein legumin B, partial [Gossypium herbaceum]
Length=494

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NAHS +Y+T+G+  ++IV++ GEAI +++V  G
Sbjct  369  GVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIVSENGEAIFDEQVERG  416



>pdb|2EVX|A Chain A, Crystal Structure Of Pumpkin Seed Globulin
 pdb|2E9Q|A Chain A, Recombinant Pro-11s Globulin Of Pumpkin
Length=459

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P + +N+HS +Y T+G+A V++V+  G+++ + EVREG
Sbjct  327  GVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEVREG  374



>sp|P09800.1|LEGB_GOSHI RecName: Full=Legumin B; AltName: Full=Beta-globulin B; AltName: 
Full=LEGB-C134; Contains: RecName: Full=Legumin B acidic 
chain; Contains: RecName: Full=Legumin B basic chain; Flags: 
Precursor [Gossypium hirsutum]
 gb|AAA33070.1| vicilin precursor [Gossypium hirsutum]
 gb|AAD09844.1| legumin B [Gossypium hirsutum]
 prf||1306412C storage protein C134
Length=516

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NAHS +Y+T+G+  ++IV++ GEAI +++V  G
Sbjct  386  GVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIVSENGEAIFDEQVERG  433



>ref|XP_009387667.1| PREDICTED: glutelin type-A 1-like [Musa acuminata subsp. malaccensis]
Length=490

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
              L  N  + P W +NAHS +Y  +G + V++V  RG+ + N E+R+G
Sbjct  354  ALLRPNAIVSPHWNVNAHSIMYALRGCSRVQVVGHRGQTVFNGELRQG  401



>gb|AGU36399.1| 11S globulin precursor, partial [Helianthus annuus]
Length=346

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+ +YV  G A +++V+  GEA+LN++V  G
Sbjct  228  GHLQPNALFSPHWTVNSHTVVYVLNGDAQIQVVSNNGEAVLNEQVSRG  275



>gb|AEO27679.1| seed storage protein legumin B, partial [Gossypium arboreum]
Length=494

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NAHS +Y+T+G+  ++IV++ GEAI +++V  G
Sbjct  369  GVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIVSENGEAIFDEQVERG  416



>gb|AAK15087.1|AF240004_1 11S globulin [Sesamum indicum]
Length=497

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAHS +Y+T+GS   ++V   G ++ +  VREG
Sbjct  341  GVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREG  388



>ref|XP_008372197.1| PREDICTED: LOW QUALITY PROTEIN: legumin A-like [Malus domestica]
Length=455

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NA+  +YV +G+A V++VN+ G+AIL+D+V EG
Sbjct  318  GVLYNNAIYSPYWNLNANELVYVIRGNARVQVVNENGDAILDDQVNEG  365



>gb|AIX48756.1| legumin-like protein [Fagopyrum esculentum]
Length=565

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  431  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  476



>ref|XP_011091311.1| PREDICTED: 11S globulin subunit beta-like [Sesamum indicum]
Length=497

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAHS +Y+T+GS   ++V   G ++ +  VREG
Sbjct  341  GVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREG  388



>ref|XP_010457408.1| PREDICTED: 12S seed storage protein CRD [Camelina sativa]
Length=453

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G+L     ++PQW  NAH+ LYVT G A +++V+  G+++ N+++ +G
Sbjct  324  GYLYSGGMVLPQWTANAHTVLYVTGGQAKIQVVDDNGQSVFNEQMGQG  371



>ref|XP_010481774.1| PREDICTED: 12S seed storage protein CRA1-like [Camelina sativa]
Length=465

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + +N  ++PQW  NA+S LYVT G A V+IVN  G+ + + +V +G
Sbjct  327  GSIRQNAMVLPQWNANANSVLYVTDGEAQVQIVNDNGDRVFDGQVSQG  374



>gb|KFK42732.1| hypothetical protein AALP_AA1G032500 [Arabis alpina]
Length=442

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L     ++PQW  NA++ LYVT G A+++IV+  G+++ N++V +G
Sbjct  318  GLLYSGGMVLPQWTANANTVLYVTGGQAMIQIVDDNGQSVFNEQVGQG  365



>ref|XP_010265035.1| PREDICTED: 11S globulin subunit beta-like [Nelumbo nucifera]
Length=674

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN  L P W INAHS +YV +G A V+IV   GE + + ++ EG
Sbjct  545  GHLYKNAILSPHWNINAHSVVYVLRGEAQVQIVGNSGETVFDGQLCEG  592



>ref|XP_004247523.1| PREDICTED: 11S globulin seed storage protein 2-like [Solanum 
lycopersicum]
Length=481

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W +N HS +YV +G A V++V+  G+ ++ND V +G
Sbjct  351  GTLYPNALMSPHWSVNGHSVIYVQRGDAQVQVVDHTGQQVMNDRVNQG  398



>gb|AAB24085.1| legumin propolypeptide beta chain [beans, Peptide Partial, 181 
aa]
Length=181

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N    P W INA+S LYV +G   V IVN +G A+ +++VR+G
Sbjct  54   LYRNGIYAPHWNINANSLLYVIRGEGRVRIVNSQGNAVFDNKVRKG  99



>ref|XP_009354982.1| PREDICTED: legumin type B-like [Pyrus x bretschneideri]
Length=516

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NA+  +YV +G+A V++VN+ G+AIL+D+V EG
Sbjct  379  GVLYNNAIYSPYWNLNANELVYVIRGNARVQVVNENGDAILDDQVNEG  426



>gb|AIA57960.1| seed storage protein 1, partial [Jatropha curcas]
Length=314

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N    P W INAHS  Y T+G+  V+IV++ G+A+ + +V++G
Sbjct  184  GVLFRNAIFAPHWNINAHSIYYFTRGNGHVQIVDENGDAVFDGQVQQG  231



>ref|XP_009624045.1| PREDICTED: 11S globulin seed storage protein 2-like [Nicotiana 
tomentosiformis]
Length=488

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  L P W +N+H  +YV +G A V++V+  G+ ++ND V +G
Sbjct  358  GTLYPNALLTPHWSVNSHCVVYVQRGEAQVQVVDHSGQQVMNDRVNQG  405



>ref|XP_006420241.1| hypothetical protein CICLE_v10004871mg [Citrus clementina]
 gb|ESR33481.1| hypothetical protein CICLE_v10004871mg [Citrus clementina]
Length=480

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAHS +Y+T+G+  ++IV + GE + + ++REG
Sbjct  351  GNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREG  398



>gb|AGU36395.1| 11S globulin precursor, partial [Helianthus petiolaris]
Length=330

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+ +YV  G A +++V+  GEA+L+++V  G
Sbjct  212  GHLQPNALFSPHWTVNSHTVVYVLNGDAQIQVVSNNGEAVLBEQVSRG  259



>sp|O23878.1|13S1_FAGES RecName: Full=13S globulin seed storage protein 1; AltName: Full=Legumin-like 
protein 1; Contains: RecName: Full=13S globulin 
seed storage protein 1 acidic chain; Contains: RecName: 
Full=13S globulin seed storage protein 1 basic chain; Flags: 
Precursor [Fagopyrum esculentum]
 dbj|BAA21758.1| legumin-like protein [Fagopyrum esculentum]
Length=565

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  431  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  476



>gb|KDO57580.1| hypothetical protein CISIN_1g048197mg [Citrus sinensis]
Length=480

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P W +NAHS +Y+T+G+  ++IV + GE + + ++REG
Sbjct  351  GNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREG  398



>emb|CAA64762.1| legumin-like protein [Asarum europaeum]
Length=462

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 26/48 (54%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NAH+  YVT+GSA V+ V   G  + N  V EG
Sbjct  330  GNLYPNAMFAPHWSVNAHNIFYVTRGSAQVQAVGSNGNTVFNGRVNEG  377



>ref|XP_010111925.1| Legumin A [Morus notabilis]
 gb|EXC31959.1| Legumin A [Morus notabilis]
Length=487

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            GFL  N    P W INAHS +YV +G A  ++V+  G ++ + E+R+G
Sbjct  353  GFLYSNAMYAPHWNINAHSVIYVIRGRARCQVVDDFGRSVFDGELRQG  400



>gb|AAA50317.1| glutelin [Oryza sativa Japonica Group]
Length=499

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+T+G A V++VN  G+ + N E R G
Sbjct  360  LYQNALLSPFWNINAHSVVYITQGRARVQVVNNNGKTVFNGEPRRG  405



>gb|AFQ32291.1| 12S seed storage protein [Camelina sativa]
Length=468

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + +N  ++PQW  NA+S LYVT G A V+IVN  G+ + + +V +G
Sbjct  330  GSIRQNAMVLPQWNANANSVLYVTDGEAQVQIVNDNGDRVFDGQVSQG  377



>ref|XP_006659791.1| PREDICTED: 13S globulin seed storage protein 3-like [Oryza brachyantha]
Length=515

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + +N  L P W INAH+ +Y T GSA +++V+  G  + + E+R G
Sbjct  377  GVMRRNAILAPHWNINAHAAVYATSGSARLQVVSSEGRRVFDGELRRG  424



>gb|AAK97787.1| allergenic protein [Fagopyrum tataricum]
Length=195

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  + P+W +NAHS LYVT+G   V++V   G+++ +D V+ G
Sbjct  54   LYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDNVQRG  99



>gb|EAZ41388.1| hypothetical protein OsJ_25906 [Oryza sativa Japonica Group]
Length=526

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + +N  L P W INAH+ +Y T GSA +++V+  G  + + E+R G
Sbjct  377  GVMRRNAILAPHWNINAHAAVYATSGSARLQVVSSEGRRVFDGELRRG  424



>gb|EAZ05461.1| hypothetical protein OsI_27675 [Oryza sativa Indica Group]
Length=527

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + +N  L P W INAH+ +Y T GSA +++V+  G  + + E+R G
Sbjct  378  GVMRRNAILAPHWNINAHAAVYATSGSARLQVVSSEGRRVFDGELRRG  425



>ref|NP_001060907.1| Os08g0127900 [Oryza sativa Japonica Group]
 dbj|BAD08864.1| putative early embryogenesis protein [Oryza sativa Japonica Group]
 dbj|BAF22821.1| Os08g0127900 [Oryza sativa Japonica Group]
 dbj|BAG97192.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99733.1| unnamed protein product [Oryza sativa Japonica Group]
Length=531

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + +N  L P W INAH+ +Y T GSA +++V+  G  + + E+R G
Sbjct  382  GVMRRNAILAPHWNINAHAAVYATSGSARLQVVSSEGRRVFDGELRRG  429



>ref|XP_006648611.1| PREDICTED: glutelin type-A 1-like [Oryza brachyantha]
Length=504

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/45 (38%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVRE  142
            L  N  L P W +NAH+ +YVT G   +++V+ RG  + + E+R+
Sbjct  369  LQNNALLTPHWTVNAHTVMYVTAGQGRIQVVDHRGRTVFDGELRQ  413



>gb|AAA32778.1| 12S storage protein CRB [Arabidopsis thaliana]
 emb|CAA32494.1| 12S seed storage protein [Arabidopsis thaliana]
Length=455

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + KN  ++PQW +NA++ LYVT G A +++VN  GE + + E+  G
Sbjct  321  GSIRKNAMVLPQWNVNANAALYVTNGKAHIQMVNDNGERVFDQEISSG  368



>ref|NP_171884.1| cruciferin 2 [Arabidopsis thaliana]
 sp|P15456.2|CRU2_ARATH RecName: Full=12S seed storage protein CRB; AltName: Full=Cruciferin 
2; Short=AtCRU2; AltName: Full=Cruciferin B; AltName: 
Full=Legumin-type globulin storage protein CRU2; Contains: 
RecName: Full=12S seed storage protein CRB alpha chain; AltName: 
Full=12S seed storage protein CRB acidic chain; Contains: 
RecName: Full=12S seed storage protein CRB beta chain; AltName: 
Full=12S seed storage protein CRB basic chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD10680.1| 12S seed storage protein [Arabidopsis thaliana]
 gb|AAM13004.1| 12S seed storage protein [Arabidopsis thaliana]
 gb|AAP81800.1| At1g03880 [Arabidopsis thaliana]
 gb|AEE27628.1| cruciferin 2 [Arabidopsis thaliana]
Length=455

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + KN  ++PQW +NA++ LYVT G A +++VN  GE + + E+  G
Sbjct  321  GSIRKNAMVLPQWNVNANAALYVTNGKAHIQMVNDNGERVFDQEISSG  368



>ref|XP_009761684.1| PREDICTED: 11S globulin seed storage protein 2-like [Nicotiana 
sylvestris]
Length=489

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  L P W +N+H  +YV +G A V++V+  G+ ++ND V +G
Sbjct  359  GTLYPNALLTPHWSVNSHCVVYVQRGEAHVQVVDHSGQQVMNDRVNQG  406



>ref|XP_004152049.1| PREDICTED: 11S globulin subunit beta-like [Cucumis sativus]
 gb|KGN57907.1| hypothetical protein Csa_3G386310 [Cucumis sativus]
Length=494

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVRE  142
            G L +N   VP W  NAHS ++VT+G A V++VN RG+ + + E+++
Sbjct  362  GVLYRNAMYVPHWNQNAHSVIFVTRGRARVQVVNCRGQTVFDGELQQ  408



>ref|XP_002889479.1| hypothetical protein ARALYDRAFT_470363 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65738.1| hypothetical protein ARALYDRAFT_470363 [Arabidopsis lyrata subsp. 
lyrata]
Length=455

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + KN  ++PQW +NA++ LYVT G A +++VN  GE + + E+  G
Sbjct  321  GSIRKNAMVLPQWNVNANAALYVTNGKAHIQMVNDNGERVFDQEISSG  368



>gb|KFK42731.1| hypothetical protein AALP_AA1G032400 [Arabis alpina]
Length=455

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G + KN  ++PQW +NA++ LYVT G A +++VN  G+ +L+ E+  G
Sbjct  321  GSIRKNAMVLPQWNVNANAALYVTNGKAHIQMVNDNGQRVLDQEISAG  368



>ref|XP_006647245.1| PREDICTED: glutelin type-A 1-like [Oryza brachyantha]
Length=503

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVRE  142
            L  N  L P W +NAH+ +YVT G   V++V+ RG ++ + E+R+
Sbjct  365  LQNNALLTPHWTVNAHTVMYVTTGQGHVQVVDNRGRSVFDGELRQ  409



>prf||1311273A glutelin
Length=498

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  26   LVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L P W INAHS +Y+T+G A V++VN  G+ + N E+R G
Sbjct  365  LSPFWNINAHSIVYITQGRAQVQVVNNNGKTVFNGELRRG  404



>pir||JC2098 legumin type B beta chain (clone LeB4, B4) - tick bean
Length=194

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N    P W INA+S LYV +G   V IVN +G A+ +++VR+G
Sbjct  67   LYRNGIYAPHWNINANSLLYVIRGEGRVRIVNSQGNAVFDNKVRKG  112



>ref|XP_009766463.1| PREDICTED: 11S globulin seed storage protein 2-like [Nicotiana 
sylvestris]
Length=489

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  L P W +N H  +YV +G A V++V+  G+ ++ND V +G
Sbjct  359  GTLYPNALLTPHWSVNGHCVVYVQRGEAQVQVVDHSGQQVMNDRVNQG  406



>ref|XP_010097607.1| Legumin A [Morus notabilis]
 gb|EXC43199.1| Legumin A [Morus notabilis]
Length=480

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN    P W +NAHS +YV +G A +++V+  G++  + EVR+G
Sbjct  346  GVLYKNGIYTPHWNLNAHSVIYVLRGRARIQVVDHFGQSFFDGEVRQG  393



>ref|XP_006356113.1| PREDICTED: legumin B-like [Solanum tuberosum]
Length=483

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W +NAHS +Y+ +GS   ++V   G+++ +DEVR+G
Sbjct  350  GTLYNNAIVAPHWNMNAHSIIYIIRGSGRFQVVGNAGKSVFDDEVRQG  397



>ref|XP_006443837.1| hypothetical protein CICLE_v10023766mg [Citrus clementina]
 gb|ESR57077.1| hypothetical protein CICLE_v10023766mg [Citrus clementina]
Length=434

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L++N  +VP W ++AHS +Y   GS  V++V+  G ++ + EVR G
Sbjct  337  GLLHRNAMMVPHWNLSAHSIMYAISGSCHVQVVDSYGRSVYDGEVRRG  384



>gb|ABK80752.1| 11S globulin precursor isoform 1B [Ficus pumila var. awkeotsang]
Length=508

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +NAHS LYV +G A +++V+  G+A  + EVR+G
Sbjct  374  GVLYNNGIYTPHWNMNAHSVLYVLRGQARIQVVDHFGQAFFDGEVRQG  421



>ref|XP_008447426.1| PREDICTED: legumin A-like [Cucumis melo]
Length=496

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVRE  142
            G L +N   VP W  NAHS ++VT+G A V++VN RG+ + + E+++
Sbjct  364  GVLYRNAMYVPHWNQNAHSVIFVTRGRARVQVVNCRGQTVFDGELQQ  410



>gb|KDP40339.1| hypothetical protein JCGZ_02337 [Jatropha curcas]
Length=448

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N    P W INAHS  Y T+G+  V+IV++ G+A+ + +V++G
Sbjct  318  GVLFRNAIFAPHWNINAHSIYYFTRGNGHVQIVDENGDAVFDGQVQQG  365



>gb|AGU36402.1| 11S globulin precursor, partial [Helianthus annuus]
Length=342

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+  YV  G A +++V+  GEA+LN++V  G
Sbjct  224  GHLQPNALFSPHWTVNSHTVAYVLNGDAQIQVVSNNGEAVLNEQVSRG  271



>gb|AIA57958.1| beta-globulin B2 [Jatropha curcas]
Length=478

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N    P W INAHS  Y T+G+  V+IV++ G+A+ + +V++G
Sbjct  348  GVLFRNAIFAPHWNINAHSIYYFTRGNGHVQIVDENGDAVFDGQVQQG  395



>ref|XP_002300775.1| legumin family protein [Populus trichocarpa]
 gb|EEE80048.1| legumin family protein [Populus trichocarpa]
Length=480

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L     +VP W +NAHS +Y  +G A +++V+  G  + + E+REG
Sbjct  345  GVLYNEAMMVPHWNLNAHSIMYAIRGQARIQVVDHSGRTVFDGEMREG  392



>ref|XP_006480087.1| PREDICTED: LOW QUALITY PROTEIN: legumin A-like [Citrus sinensis]
Length=436

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L++N  +VP W ++AHS +Y   GS  V++V+  G ++ + EVR G
Sbjct  339  GLLHRNAMMVPHWNLSAHSIMYAISGSCHVQVVDSYGRSVYDGEVRRG  386



>ref|XP_009803568.1| PREDICTED: legumin A-like [Nicotiana sylvestris]
Length=475

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/43 (40%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILND  130
            G L ++  + P W  NAH  +Y+T+G + ++IV+ RG+A+L+D
Sbjct  338  GVLYRDSIMAPHWVTNAHKVIYITRGESRIQIVDHRGQAVLDD  380



>emb|CAA52764.1| 11S globulin [Avena sativa]
Length=527

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L +N  L P W INAHS +Y+ +G A V++VN  G+ + ND +R G
Sbjct  379  LYQNAILSPFWNINAHSVIYMIQGHARVQVVNNNGQTVFNDILRRG  424



>ref|XP_006370926.1| legumin family protein [Populus trichocarpa]
 gb|ERP48723.1| legumin family protein [Populus trichocarpa]
Length=495

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  + P W INAHS +Y+T G+  ++IV   G+A+ + +VR+G
Sbjct  362  GVLYANALMSPHWNINAHSIMYITGGNGRIQIVGDNGQAVFDGQVRKG  409



>dbj|BAO50857.1| 13S globulin [Fagopyrum esculentum]
Length=536

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  402  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  447



>dbj|BAO50867.1| 13S globulin [Fagopyrum esculentum]
Length=504

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  + P+W +NAHS LYVT+G   V++V   G+++ +D+V+ G
Sbjct  367  LYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRG  412



>sp|Q9XFM4.1|13S3_FAGES RecName: Full=13S globulin seed storage protein 3; AltName: Full=Legumin-like 
protein 3; AltName: Allergen=Fag e 1; Contains: 
RecName: Full=13S globulin seed storage protein 3 acidic 
chain; Contains: RecName: Full=13S globulin seed storage protein 
3 basic chain; Flags: Precursor [Fagopyrum esculentum]
 gb|AAD32713.1|AF152003_1 major allergenic storage protein [Fagopyrum esculentum]
Length=538

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  401  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  446



>sp|O23880.1|13S2_FAGES RecName: Full=13S globulin seed storage protein 2; AltName: Full=Legumin-like 
protein 2; Contains: RecName: Full=13S globulin 
seed storage protein 2 acidic chain; Contains: RecName: 
Full=13S globulin seed storage protein 2 basic chain; Flags: 
Precursor [Fagopyrum esculentum]
 dbj|BAA21760.1| legumin-like protein [Fagopyrum esculentum]
Length=504

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  + P+W +NAHS LYVT+G   V++V   G+++ +D+V+ G
Sbjct  367  LYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRG  412



>dbj|BAM63382.1| major allergenic storage protein, partial [Fagopyrum esculentum 
subsp. esculentum]
Length=537

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  400  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  445



>dbj|BAO50862.1| 13S globulin [Fagopyrum esculentum]
Length=528

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  391  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  436



>dbj|BAO50859.1| 13S globulin [Fagopyrum esculentum]
Length=538

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  401  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  446



>dbj|BAO50866.1| 13S globulin [Fagopyrum esculentum]
Length=504

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  + P+W +NAHS LYVT+G   V++V   G+++ +D+V+ G
Sbjct  367  LYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRG  412



>dbj|BAO50865.1| 13S globulin [Fagopyrum esculentum]
Length=504

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  + P+W +NAHS LYVT+G   V++V   G+++ +D+V+ G
Sbjct  367  LYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRG  412



>dbj|BAO50858.1| 13S globulin [Fagopyrum esculentum]
Length=538

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  401  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  446



>gb|ABI94736.1| 11S seed storage globulin B [Chenopodium quinoa]
Length=479

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P + +NAHS +Y  +G   ++IVN +G ++ +DE+R+G
Sbjct  343  GVLYRNAIMAPHYNLNAHSIIYGVRGRGRIQIVNAQGNSVFDDELRQG  390



>gb|AAS67037.1| 11S seed storage globulin [Chenopodium quinoa]
Length=479

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +N  + P + +NAHS +Y  +G   ++IVN +G ++ +DE+R+G
Sbjct  343  GVLYRNAIMAPHYNLNAHSIIYGVRGRGRIQIVNAQGNSVFDDELRQG  390



>dbj|BAO50864.1| 13S globulin [Fagopyrum esculentum]
Length=504

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  + P+W +NAHS LYVT+G   V++V   G+++ +D+V+ G
Sbjct  367  LYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRG  412



>ref|XP_008462393.1| PREDICTED: legumin B-like [Cucumis melo]
Length=476

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P + +NAH+  Y T+GSA V++V+  G+++ + EVREG
Sbjct  344  GVLYSNAISAPHYTVNAHTVAYATRGSARVQVVDNYGQSVFDGEVREG  391



>gb|AFQ32292.1| 12S seed storage protein [Camelina sativa]
Length=468

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G +++N  ++PQW  NA++ LYVT G A V+IVN  G+ + + +V +G
Sbjct  330  GSISQNAMVLPQWNANANAVLYVTDGEAQVQIVNDNGDRVFDGQVSQG  377



>emb|CDP79027.1| edestin 2 [Cannabis sativa]
Length=491

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN  + P + +++HS +YVT+GSA +++V+  G  + + E+REG
Sbjct  359  GVLYKNGMMAPHFNLDSHSVIYVTRGSARLQVVDDNGRNVFDGELREG  406



>dbj|BAO50861.1| 13S globulin [Fagopyrum esculentum]
Length=523

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  386  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  431



>emb|CDP79029.1| edestin 2 [Cannabis sativa]
Length=491

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN  + P + +++HS +YVT+GSA +++V+  G  + + E+REG
Sbjct  359  GVLYKNGMMAPHFNLDSHSVIYVTRGSARLQVVDDNGRNVFDGELREG  406



>emb|CDP79028.1| edestin 2 [Cannabis sativa]
Length=491

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L KN  + P + +++HS +YVT+GSA +++V+  G  + + E+REG
Sbjct  359  GVLYKNGMMAPHFNLDSHSVIYVTRGSARLQVVDDNGRNVFDGELREG  406



>dbj|BAO50856.1| 13S globulin [Fagopyrum esculentum]
Length=553

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  416  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  461



>ref|XP_002524198.1| legumin B precursor, putative [Ricinus communis]
 gb|AAF73007.1|AF262998_1 legumin-like protein [Ricinus communis]
 gb|EEF38213.1| legumin B precursor, putative [Ricinus communis]
Length=476

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/39 (44%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  29   VPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            +P W INAHS +Y  KG A +++V++ G ++ +  VREG
Sbjct  350  LPHWHINAHSVIYAVKGQARIQVVDENGNSVFDGNVREG  388



>gb|AGU36401.1| 11S globulin precursor, partial [Helianthus annuus]
Length=346

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N    P W +N+H+ +YV  G A +++V+  GEA+LN++V  G
Sbjct  228  GHLQPNALFSPHWTVNSHTVVYVLNGDAQIQVVSNNGEAVLNEQVSGG  275



>gb|EYU46456.1| hypothetical protein MIMGU_mgv1a005966mg [Erythranthe guttata]
Length=463

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L  N  L P W +  H+ +YVTKG A V++V+  G++++ND V +G
Sbjct  333  GNLYPNALLSPDWAMLGHTIVYVTKGDAQVQVVDHSGQSLMNDRVNKG  380



>dbj|BAO50860.1| 13S globulin [Fagopyrum esculentum]
Length=534

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  8    LNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            L KN  L P+W +NAHS LYVT+G   V++V   G ++ +D V+ G
Sbjct  397  LYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRG  442



>gb|AHA36627.1| Cor a 9 allergen [Corylus avellana]
Length=514

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L +    VP W +NAHS +Y  +G A V++V+  G  + +DE+R+G
Sbjct  370  GDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQG  417



>emb|CDY10094.1| BnaC08g43570D [Brassica napus]
Length=446

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/48 (38%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    GFLNKNWGLVPQWCINAHSFLYVTKGSALVEIVNQRGEAILNDEVREG  145
            G L     ++P W  NAH+ LYVT G A +++V+  G+++ N +V++G
Sbjct  319  GVLYSGGMMLPHWTANAHTVLYVTGGQATIQVVDDNGQSVFNAQVQQG  366



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506149393984