BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81883_g1_i1 len=680 path=[658:0-679]

Length=680
                                                                      Score     E

gb|ABE67980.1|  pectin methylesterase                                   218   5e-67   Citrus bergamia [bergamot orange]
gb|KDO36003.1|  hypothetical protein CISIN_1g029714mg                   216   8e-67   
emb|CAB95025.1|  pectin methylesterase                                  227   9e-67   Nicotiana tabacum [American tobacco]
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    227   1e-66   
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                227   1e-66   
pir||T10488  pectinesterase (EC 3.1.1.11) PECS1.2 - sweet orange ...    218   3e-66
gb|AAO85706.1|  pectin methyl-esterase                                  225   4e-66   Nicotiana benthamiana
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    225   4e-66   
ref|NP_001274969.1|  pectin methyl esterase                             224   1e-65   
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    223   2e-65   
gb|AFW03475.1|  pectin methylesterase 1                                 222   8e-65   
gb|KHG08631.1|  Pectinesterase 3                                        222   9e-65   
gb|AFW03480.1|  pectin methylesterase 1                                 222   9e-65   
gb|AFB77929.1|  pectin methylesterase                                   222   9e-65   
gb|KDO36004.1|  hypothetical protein CISIN_1g029714mg                   208   2e-64   
ref|NP_001275859.1|  pectinesterase 1 precursor                         221   2e-64   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    221   2e-64   Citrus sinensis [apfelsine]
emb|CAB57457.2|  pectin methylesterase                                  212   2e-64   Nicotiana tabacum [American tobacco]
emb|CDO97787.1|  unnamed protein product                                212   2e-64   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    220   4e-64   Citrus sinensis [apfelsine]
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  217   5e-63   
emb|CBI27741.3|  unnamed protein product                                211   1e-62   
gb|AFQ23194.1|  pectin methylesterase                                   216   1e-62   
ref|XP_010096538.1|  Pectinesterase 1                                   206   3e-62   
gb|AFI23411.1|  pectin methylesterase                                   215   4e-62   
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     214   9e-62   
ref|XP_008361835.1|  PREDICTED: pectinesterase-like                     204   1e-61   
ref|XP_006369079.1|  pectinesterase family protein                      204   1e-61   
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   213   2e-61   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     213   3e-61   
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     213   3e-61   
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   212   4e-61   
gb|AFK42744.1|  unknown                                                 204   4e-61   
emb|CAC01624.1|  putative pectin methylesterase                         211   8e-61   Populus tremula x Populus tremuloides
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          211   9e-61   
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          211   9e-61   
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         211   1e-60   
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     206   2e-60   
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     211   2e-60   
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     210   3e-60   
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  203   4e-60   
gb|AAQ21126.1|  pectinesterase                                          199   4e-60   Fragaria x ananassa
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    202   5e-60   Daucus carota [carrots]
ref|XP_010543030.1|  PREDICTED: pectinesterase 2-like                   208   5e-60   
gb|AAR03544.1|  pectin methylesterase isoform 1                         199   6e-60   Fragaria x ananassa
ref|XP_002304257.2|  pectinesterase family protein                      208   9e-60   Populus trichocarpa [western balsam poplar]
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     208   1e-59   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     208   1e-59   
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    208   1e-59   
ref|XP_002532944.1|  Pectinesterase-3 precursor, putative               208   1e-59   Ricinus communis
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     207   2e-59   
dbj|BAD94011.1|  pectin methylesterase like protein                     198   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002265171.1|  PREDICTED: pectinesterase                          207   4e-59   Vitis vinifera
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             206   4e-59   
ref|XP_008228105.1|  PREDICTED: pectinesterase                          206   6e-59   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          206   8e-59   
dbj|BAD95369.1|  pectin methylesterase like protein                     201   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                203   1e-58   
gb|AAL24278.1|  AT3g14310/MLN21_9                                       201   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273801.1|  PREDICTED: pectinesterase                          204   3e-58   
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                   204   3e-58   
emb|CBI35795.3|  unnamed protein product                                206   4e-58   
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    204   5e-58   
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             203   9e-58   
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             203   1e-57   
ref|XP_003627458.1|  Pectinesterase                                     203   1e-57   
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    202   1e-57   
gb|AAC72288.1|  putative pectin methylesterase                          202   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188048.1|  pectin methylesterase 3                               202   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    202   3e-57   
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              196   4e-57   
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                    201   5e-57   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     201   8e-57   
emb|CDX97564.1|  BnaA05g25150D                                          200   1e-56   
ref|NP_001265901.1|  pectinesterase 3-like                              200   1e-56   
ref|XP_009117000.1|  PREDICTED: pectinesterase/pectinesterase inh...    199   2e-56   
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    197   2e-56   
ref|XP_004168887.1|  PREDICTED: pectinesterase 3-like                   199   3e-56   
ref|XP_004144447.1|  PREDICTED: pectinesterase 3-like                   199   3e-56   
ref|XP_002885033.1|  ATPME3                                             199   3e-56   
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                199   3e-56   
emb|CDY33229.1|  BnaC01g37020D                                          198   4e-56   
ref|XP_007012502.1|  Pectin methylesterase 3                            198   4e-56   
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     198   5e-56   
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...    198   6e-56   
emb|CDX98441.1|  BnaC05g39340D                                          198   7e-56   
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             198   9e-56   
ref|XP_009116991.1|  PREDICTED: pectinesterase/pectinesterase inh...    197   1e-55   
emb|CDY60700.1|  BnaA01g37100D                                          197   1e-55   
emb|CDY39109.1|  BnaA01g29470D                                          197   1e-55   
ref|NP_001275846.1|  putative thermostable pectinesterase               198   1e-55   
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              197   1e-55   Linum usitatissimum
ref|XP_006297218.1|  hypothetical protein CARUB_v10013226mg             197   2e-55   
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg             197   2e-55   
gb|KDO73733.1|  hypothetical protein CISIN_1g008261mg                   197   2e-55   
emb|CDY02461.1|  BnaA08g00680D                                          191   2e-55   
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         197   2e-55   
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             195   1e-54   
gb|KFK35693.1|  hypothetical protein AALP_AA4G024900                    195   1e-54   
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   195   1e-54   
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     195   1e-54   
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        194   1e-54   
ref|XP_009135376.1|  PREDICTED: pectinesterase/pectinesterase inh...    194   2e-54   
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    194   2e-54   
ref|NP_175786.1|  pectin methylesterase 2                               194   3e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAC50023.1|  ATPME2 precursor                                        193   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011048629.1|  PREDICTED: pectinesterase-like                     193   5e-54   
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             193   6e-54   
emb|CDY33228.1|  BnaC01g37010D                                          192   1e-53   
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   192   1e-53   
gb|AAN84553.1|  methyl pectinesterase                                   183   2e-53   Lolium perenne [perennial ryegrass]
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         192   2e-53   
ref|XP_007135363.1|  hypothetical protein PHAVU_010G123100g             195   3e-53   
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     190   5e-53   
ref|XP_006369081.1|  hypothetical protein POPTR_0001s16280g             191   5e-53   
ref|XP_006372149.1|  hypothetical protein POPTR_0018s12530g             191   5e-53   
ref|XP_006369080.1|  putative pectin methylesterase LuPME5 family...    191   6e-53   
ref|XP_002891774.1|  ATPME2                                             189   2e-52   
ref|NP_001042866.1|  Os01g0312500                                       184   8e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006389476.1|  hypothetical protein POPTR_0022s002002g            179   1e-51   
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     186   1e-51   
emb|CAC18725.1|  putative pectin methylesterase                         186   1e-51   Populus tremula x Populus tremuloides
emb|CDY51798.1|  BnaC06g41940D                                          186   3e-51   
gb|EEE54425.1|  hypothetical protein OsJ_01485                          185   6e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70505.1|  hypothetical protein OsI_01594                          184   6e-51   Oryza sativa Indica Group [Indian rice]
emb|CDY08206.1|  BnaA05g14130D                                          184   7e-51   
ref|XP_010534984.1|  PREDICTED: pectinesterase-like                     184   8e-51   
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                        184   9e-51   
ref|XP_002516188.1|  Pectinesterase-3 precursor, putative               183   2e-50   Ricinus communis
ref|XP_006382081.1|  hypothetical protein POPTR_0006s27270g             183   2e-50   
ref|XP_002309641.2|  putative pectin methylesterase LuPME5 family...    183   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     183   2e-50   
emb|CAC18727.1|  putative pectin methylesterase                         182   2e-50   Populus tremula x Populus tremuloides
ref|XP_011039649.1|  PREDICTED: pectinesterase-like isoform X2          182   3e-50   
emb|CBI24284.3|  unnamed protein product                                176   3e-50   
ref|XP_011039648.1|  PREDICTED: pectinesterase-like isoform X1          182   3e-50   
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   179   3e-50   
ref|XP_006387527.1|  putative pectin methylesterase LuPME5 family...    182   4e-50   
ref|XP_006389479.1|  putative pectin methylesterase LuPME5 family...    182   4e-50   
ref|XP_011039646.1|  PREDICTED: pectinesterase-like                     182   5e-50   
ref|XP_011039647.1|  PREDICTED: pectinesterase-like                     182   5e-50   
ref|XP_010921648.1|  PREDICTED: pectinesterase-like                     174   7e-50   
emb|CDO97717.1|  unnamed protein product                                174   8e-50   
ref|XP_008800483.1|  PREDICTED: pectinesterase 3-like isoform X2        174   9e-50   
ref|XP_011003715.1|  PREDICTED: pectinesterase-like                     181   9e-50   
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               181   9e-50   Ricinus communis
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     181   1e-49   
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     181   1e-49   
ref|XP_002518523.1|  Pectinesterase precursor, putative                 180   2e-49   Ricinus communis
gb|AFB77928.1|  pectin methylesterase                                   181   2e-49   
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              181   2e-49   
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     180   2e-49   
dbj|BAJ96804.1|  predicted protein                                      180   2e-49   
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...    180   2e-49   
ref|XP_006385197.1|  hypothetical protein POPTR_0003s00980g             180   3e-49   
ref|XP_006371892.1|  hypothetical protein POPTR_0018s05350g             172   3e-49   
ref|XP_011047860.1|  PREDICTED: pectinesterase-like                     180   4e-49   
emb|CAN83663.1|  hypothetical protein VITISV_017689                     178   5e-49   Vitis vinifera
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        178   5e-49   Vitis vinifera
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                179   6e-49   
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            179   9e-49   
ref|XP_009388374.1|  PREDICTED: pectinesterase-like                     170   2e-48   
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            178   2e-48   
ref|XP_008386773.1|  PREDICTED: pectinesterase-like                     170   2e-48   
emb|CAC18726.1|  putative pectin methylesterase                         178   2e-48   Populus tremula x Populus tremuloides
gb|ABK94644.1|  unknown                                                 172   2e-48   Populus trichocarpa [western balsam poplar]
ref|XP_011000694.1|  PREDICTED: pectinesterase                          177   2e-48   
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    177   3e-48   
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     177   3e-48   
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    177   3e-48   
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          177   3e-48   
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                     177   3e-48   
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         176   4e-48   
ref|XP_008439965.1|  PREDICTED: pectinesterase                          176   7e-48   
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     176   9e-48   
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            176   9e-48   
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 175   1e-47   
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          176   1e-47   
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     175   1e-47   
emb|CBI38888.3|  unnamed protein product                                169   1e-47   
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             175   1e-47   
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     174   2e-47   
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   174   2e-47   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     175   2e-47   
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        174   2e-47   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     174   2e-47   
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   172   3e-47   
ref|XP_008224789.1|  PREDICTED: pectinesterase                          174   3e-47   
gb|AAQ21125.1|  pectinesterase                                          166   4e-47   Fragaria x ananassa
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   173   4e-47   
ref|XP_002317208.1|  pectin methylesterase family protein               173   6e-47   Populus trichocarpa [western balsam poplar]
gb|EPS74082.1|  hypothetical protein M569_00674                         172   7e-47   
gb|ABK92615.1|  unknown                                                 163   7e-47   Populus trichocarpa [western balsam poplar]
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   172   9e-47   
emb|CBI24582.3|  unnamed protein product                                166   1e-46   
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   172   1e-46   
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     172   1e-46   
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             172   1e-46   
dbj|BAF95866.1|  pectin methylesterase isoform alpha                    166   1e-46   Vitis hybrid cultivar
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   170   2e-46   
gb|ABK24761.1|  unknown                                                 172   2e-46   Picea sitchensis
ref|XP_004293266.1|  PREDICTED: pectinesterase/pectinesterase inh...    172   2e-46   
emb|CBI24285.3|  unnamed protein product                                170   2e-46   
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     172   2e-46   
pdb|1XG2|A  Chain A, Crystal Structure Of The Complex Between Pec...    167   2e-46   
pir||S00629  pectinesterase (EC 3.1.1.11) precursor (clone PE1) -...    169   2e-46
ref|XP_009590338.1|  PREDICTED: pectinesterase 3-like                   165   3e-46   
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     172   3e-46   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    171   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             171   3e-46   
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    171   3e-46   
ref|XP_010534985.1|  PREDICTED: pectinesterase-like                     171   4e-46   
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    171   4e-46   
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   171   4e-46   
gb|AGG23325.1|  pectin methylesterase 1                                 171   4e-46   
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        170   5e-46   
gb|ABZ89800.1|  pectin methylesterase-like protein                      171   5e-46   Taiwania cryptomerioides
gb|ACQ85264.1|  pectin methylesterase                                   171   5e-46   Musa acuminata AAA Group [Cavendish banana]
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   171   5e-46   
ref|NP_001275775.1|  pectinesterase 2 precursor                         170   5e-46   
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     171   5e-46   
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             170   5e-46   
gb|KHN25547.1|  Pectinesterase 2                                        167   5e-46   
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   170   6e-46   
emb|CAN76835.1|  hypothetical protein VITISV_043176                     170   6e-46   Vitis vinifera
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 170   6e-46   
gb|AIZ46897.1|  pectin methylesterase                                   163   6e-46   
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        170   7e-46   Vitis vinifera
gb|AAF16637.1|AC011661_15  T23J18.24                                    163   7e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AEW08385.1|  hypothetical protein 2_7981_01                          160   9e-46   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     169   9e-46   
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   169   1e-45   
ref|XP_002322401.1|  putative pectin methylesterase family protein      169   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               169   1e-45   Ricinus communis
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   169   1e-45   Vitis vinifera
ref|XP_010267745.1|  PREDICTED: pectinesterase                          170   1e-45   
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         169   1e-45   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        169   1e-45   
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    170   1e-45   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   169   1e-45   
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        169   1e-45   
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   169   1e-45   
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        169   1e-45   Vitis vinifera
gb|KHN16553.1|  Pectinesterase 2                                        167   1e-45   
gb|EMT05022.1|  Pectinesterase 3                                        168   1e-45   
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               168   2e-45   Ricinus communis
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    169   2e-45   
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         169   2e-45   Linum usitatissimum
gb|EMT27728.1|  Pectinesterase                                          166   2e-45   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          169   2e-45   
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   169   2e-45   
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     169   2e-45   
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     169   3e-45   
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    168   3e-45   Citrus sinensis [apfelsine]
ref|XP_008371117.1|  PREDICTED: pectinesterase                          169   3e-45   
gb|KHN35618.1|  Pectinesterase 2                                        165   3e-45   
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   168   3e-45   
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   167   3e-45   
ref|XP_009364480.1|  PREDICTED: pectinesterase                          169   4e-45   
ref|XP_007038413.1|  Pectinesterase                                     168   4e-45   
gb|ABQ42392.1|  pectin methylesterase-like protein                      169   4e-45   Taiwania cryptomerioides
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 167   4e-45   
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     167   4e-45   
ref|XP_002318285.1|  putative pectin methylesterase family protein      168   4e-45   Populus trichocarpa [western balsam poplar]
gb|EMS66304.1|  Pectinesterase 2.2                                      161   5e-45   
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   166   5e-45   
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    168   5e-45   
ref|XP_008389982.1|  PREDICTED: pectinesterase                          168   5e-45   
ref|NP_001234151.1|  pectinesterase 1 precursor                         168   5e-45   
ref|XP_004296684.1|  PREDICTED: probable pectinesterase/pectinest...    168   6e-45   
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     168   6e-45   
dbj|BAK05307.1|  predicted protein                                      168   6e-45   
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     168   6e-45   
gb|KFK37315.1|  hypothetical protein AALP_AA4G241100                    167   7e-45   
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   167   7e-45   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 168   7e-45   
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    168   7e-45   
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     168   7e-45   
gb|AAB67740.1|  PME1.9                                                  166   7e-45   Solanum lycopersicum
ref|XP_010271283.1|  PREDICTED: pectinesterase                          167   7e-45   
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    167   7e-45   
emb|CAN78759.1|  hypothetical protein VITISV_000562                     167   7e-45   
gb|EMS45437.1|  Pectinesterase                                          163   8e-45   
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   167   8e-45   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   167   8e-45   
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    167   8e-45   
emb|CDY18942.1|  BnaC04g04080D                                          161   8e-45   
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   167   9e-45   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             167   9e-45   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     166   1e-44   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   167   1e-44   
emb|CDP20872.1|  unnamed protein product                                167   1e-44   
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             167   1e-44   
gb|AHC69829.1|  pectin methylesterase PME2.1                            167   1e-44   
gb|AAF23891.1|  pectin methyl esterase                                  167   1e-44   
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 167   1e-44   
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             167   1e-44   
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   167   1e-44   
ref|NP_001233948.1|  pectinesterase 2.1                                 167   1e-44   
ref|NP_001274785.1|  pectin methyl esterase                             167   1e-44   
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               167   1e-44   
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             167   2e-44   
gb|AGV54687.1|  pectinesterase                                          167   2e-44   
ref|XP_002889876.1|  At1g11580/T23J18_33                                167   2e-44   
ref|XP_007052106.1|  Pectinesterase 2                                   166   2e-44   
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    167   2e-44   
emb|CDP20891.1|  unnamed protein product                                166   2e-44   
gb|AAB38794.1|  pectin methylesterase                                   165   2e-44   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   166   2e-44   
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    166   2e-44   
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     166   2e-44   
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     166   2e-44   
sp|Q96575.1|PME22_SOLLC  RecName: Full=Pectinesterase 2.2; Short=...    166   2e-44   
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            166   3e-44   
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             165   3e-44   
gb|AHB84678.1|  pectin methylesterase                                   166   3e-44   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    166   3e-44   
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     166   3e-44   
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    165   3e-44   
gb|AFW03479.1|  pectin methylesterase 5                                 166   3e-44   
gb|ACN40984.1|  unknown                                                 166   4e-44   
emb|CDY34642.1|  BnaC08g42010D                                          164   4e-44   
gb|KHG19575.1|  Uncharacterized protein F383_07269                      165   4e-44   
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    165   4e-44   
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   165   4e-44   
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     165   4e-44   
ref|NP_172624.1|  methylesterase PCR A                                  166   5e-44   
gb|AAK59760.1|  At1g11580/T23J18_33                                     166   5e-44   
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    165   5e-44   
gb|AAB67739.1|  pectin methylesterase PME2.1                            165   5e-44   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          166   6e-44   
ref|XP_008390793.1|  PREDICTED: probable pectinesterase/pectinest...    159   6e-44   
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   165   6e-44   
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    165   6e-44   
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             165   6e-44   
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     165   7e-44   
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       165   7e-44   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    165   7e-44   
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          164   8e-44   
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   166   9e-44   
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         164   1e-43   
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     164   1e-43   
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             164   1e-43   
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     164   1e-43   
gb|EEC82670.1|  hypothetical protein OsI_27314                          164   1e-43   
ref|NP_001060620.1|  Os07g0675100                                       164   1e-43   
ref|XP_011024825.1|  PREDICTED: probable pectinesterase/pectinest...    164   1e-43   
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     163   1e-43   
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     164   1e-43   
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        164   1e-43   
emb|CAN77092.1|  hypothetical protein VITISV_026596                     164   2e-43   
ref|XP_002882002.1|  predicted protein                                  163   2e-43   
ref|XP_006843574.1|  hypothetical protein AMTR_s00007p00101250          164   2e-43   
emb|CBI23005.3|  unnamed protein product                                161   2e-43   
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    163   2e-43   
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    163   2e-43   
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     164   2e-43   
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               164   2e-43   
gb|KEH15723.1|  pectinesterase                                          157   2e-43   
ref|XP_002317777.2|  hypothetical protein POPTR_0012s02170g             164   2e-43   
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   163   2e-43   
emb|CDX83392.1|  BnaA03g21140D                                          162   2e-43   
gb|ABQ88349.1|  pectin methylesterase                                   154   2e-43   
ref|XP_010654104.1|  PREDICTED: pectinesterase                          163   2e-43   
emb|CDX74715.1|  BnaA05g04610D                                          162   3e-43   
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     163   3e-43   
emb|CDX95641.1|  BnaC03g25220D                                          162   3e-43   
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    163   3e-43   
gb|AAQ21127.1|  pectinesterase                                          156   3e-43   
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     162   3e-43   
gb|AFW03484.1|  pectin methylesterase 5                                 163   3e-43   
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             164   3e-43   
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    163   3e-43   
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   163   3e-43   
emb|CDP05792.1|  unnamed protein product                                162   3e-43   
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           157   4e-43   
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    162   4e-43   
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     162   4e-43   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    163   4e-43   
emb|CDM84519.1|  unnamed protein product                                161   4e-43   
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             163   4e-43   
gb|KGN49865.1|  hypothetical protein Csa_5G139430                       163   5e-43   
ref|XP_004172937.1|  PREDICTED: probable pectinesterase/pectinest...    163   5e-43   
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    162   5e-43   
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    162   5e-43   
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   161   5e-43   
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    162   5e-43   
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     162   6e-43   
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   162   6e-43   
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             162   6e-43   
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 162   6e-43   
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...    162   6e-43   
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    162   7e-43   
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             162   7e-43   
gb|EYU25227.1|  hypothetical protein MIMGU_mgv1a0032971mg               155   8e-43   
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    162   8e-43   
gb|AER38244.1|  PME5                                                    162   8e-43   
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     162   8e-43   
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   161   9e-43   
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     161   1e-42   
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   161   1e-42   
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         160   1e-42   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         161   1e-42   
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     161   1e-42   
ref|XP_002278061.1|  PREDICTED: probable pectinesterase/pectinest...    162   1e-42   
ref|NP_001146685.1|  pectinesterase precursor                           161   2e-42   
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   161   2e-42   
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     161   2e-42   
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   161   2e-42   
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             161   2e-42   
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    161   2e-42   
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   160   2e-42   
ref|XP_002321999.2|  pectin methylesterase family protein               161   2e-42   
ref|XP_011006351.1|  PREDICTED: probable pectinesterase/pectinest...    161   2e-42   
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    160   2e-42   
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        161   2e-42   
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     161   2e-42   
gb|EPS66234.1|  hypothetical protein M569_08543                         161   2e-42   
ref|XP_002447200.1|  hypothetical protein SORBIDRAFT_06g030310          162   2e-42   
ref|XP_008386148.1|  PREDICTED: pectinesterase-like                     161   2e-42   
emb|CDP08022.1|  unnamed protein product                                160   2e-42   
ref|XP_008437596.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    161   2e-42   
gb|KGN44975.1|  Pectinesterase                                          161   2e-42   
sp|P85076.1|PME_ACTDE  RecName: Full=Pectinesterase; Short=PE; Al...    157   2e-42   
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    161   2e-42   
gb|KEH21378.1|  pectinesterase                                          158   2e-42   
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     160   2e-42   
gb|EPS67019.1|  pectinesterase                                          157   3e-42   
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    161   3e-42   
gb|EPS67025.1|  pectinesterase                                          154   3e-42   
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             159   3e-42   
ref|XP_010672022.1|  PREDICTED: pectinesterase-like                     160   3e-42   
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     160   3e-42   
ref|XP_003630894.1|  Pectinesterase                                     156   4e-42   
gb|AFC98398.1|  pectin methylesterase                                   160   4e-42   
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    160   4e-42   
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg             160   4e-42   
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     160   4e-42   
emb|CDO97716.1|  unnamed protein product                                160   4e-42   
gb|ACJ02103.1|  pectin methylesterase                                   160   4e-42   
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   160   4e-42   
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...    160   5e-42   
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     160   5e-42   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    160   5e-42   
ref|XP_008668795.1|  PREDICTED: pectinesterase-like                     160   5e-42   
ref|XP_008391336.1|  PREDICTED: probable pectinesterase/pectinest...    158   6e-42   
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    160   6e-42   
emb|CDY27388.1|  BnaC04g50170D                                          159   6e-42   
ref|XP_004240956.1|  PREDICTED: probable pectinesterase/pectinest...    160   7e-42   
ref|XP_009339900.1|  PREDICTED: probable pectinesterase/pectinest...    159   7e-42   
ref|XP_002266980.1|  PREDICTED: pectinesterase                          159   8e-42   
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   159   8e-42   
dbj|BAM05619.1|  pectin methylesterase 3                                151   8e-42   
dbj|BAM05618.1|  pectin methylesterase 3                                151   8e-42   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     159   9e-42   
ref|XP_004155863.1|  PREDICTED: pectinesterase 2-like                   152   9e-42   
ref|XP_010098738.1|  Pectinesterase 3                                   159   1e-41   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    159   1e-41   
emb|CDO99718.1|  unnamed protein product                                159   1e-41   
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    158   1e-41   
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     159   1e-41   
ref|XP_006828613.1|  hypothetical protein AMTR_s00129p00074780          159   1e-41   
ref|XP_007039038.1|  Plant invertase/pectin methylesterase inhibi...    159   1e-41   
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    158   1e-41   
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     159   1e-41   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      158   1e-41   
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     159   1e-41   
ref|XP_008391160.1|  PREDICTED: pectinesterase-like                     159   1e-41   
emb|CDP00815.1|  unnamed protein product                                158   1e-41   
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             159   1e-41   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               158   1e-41   
emb|CAA96436.1|  pectin methylesterase                                  153   1e-41   
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 158   2e-41   
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    159   2e-41   
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     158   2e-41   
ref|XP_004307984.1|  PREDICTED: probable pectinesterase/pectinest...    159   2e-41   
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     158   2e-41   
emb|CDP15270.1|  unnamed protein product                                158   2e-41   
gb|AAL66865.1|  pectin methylesterase                                   149   2e-41   
emb|CAA96435.1|  pectin methylesterase                                  154   2e-41   
emb|CAA96434.1|  pectin methylesterase                                  154   2e-41   
ref|XP_011095338.1|  PREDICTED: pectinesterase 2.1-like                 158   3e-41   
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   157   3e-41   
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     157   3e-41   
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...    158   3e-41   
emb|CAE76634.1|  pectin methylesterase                                  152   3e-41   
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    158   3e-41   
ref|XP_010277646.1|  PREDICTED: pectinesterase 2-like                   157   3e-41   
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     158   3e-41   
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    157   3e-41   
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    158   3e-41   
ref|XP_009357300.1|  PREDICTED: probable pectinesterase/pectinest...    158   4e-41   
dbj|BAF42038.1|  pectin methylesterase 1                                158   4e-41   
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     157   4e-41   
gb|EMS67994.1|  putative pectinesterase/pectinesterase inhibitor 16     152   4e-41   
ref|XP_003564371.1|  PREDICTED: pectinesterase                          157   4e-41   
dbj|BAM05620.1|  pectin methylesterase 3                                149   4e-41   
gb|ABD47734.1|  pectin methylesterase                                   150   4e-41   
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     157   4e-41   
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    157   5e-41   



>gb|ABE67980.1| pectin methylesterase, partial [Citrus bergamia]
Length=229

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDLKPVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  93   NMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITD  152

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H AGWHEW G+FA+NTLFYGEH N+GAGA TS RVKWKGF+VI SATEAQ++T G FI
Sbjct  153  LIHPAGWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFI  212

Query  362  SGSNW  376
            +GS+W
Sbjct  213  AGSSW  217



>gb|KDO36003.1| hypothetical protein CISIN_1g029714mg [Citrus sinensis]
Length=189

 Score =   216 bits (549),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QK RI A SDLKPVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  53   NMVTAQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITD  112

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+H AGWHEW G+FA+NTLFYGEH N GAGA TS RVKWKGF+VI SATEAQ++T G FI
Sbjct  113  VIHPAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFI  172

Query  362  SGSNW  376
            +GS+W
Sbjct  173  AGSSW  177



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score =   227 bits (578),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+QKCRI A SDL+PVQK+FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  443  NMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITD  502

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGWHEW+G+FA+NTLFYGE+ NTGAGA TS RVKWKGFKVI SATEAQ+YT GRFI
Sbjct  503  VINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWKGFKVITSATEAQAYTPGRFI  562

Query  362  SGSNW  376
            +G +W
Sbjct  563  AGGSW  567



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+QKCRI A SDL+PVQK+FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  453  NMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITD  512

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGWHEW+G+FA+NTLFYGE+ NTGAGA TS RVKWKGFKVI SATEAQ+YT GRFI
Sbjct  513  VINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWKGFKVITSATEAQAYTPGRFI  572

Query  362  SGSNW  376
            +G +W
Sbjct  573  AGGSW  577



>gb|EYU21270.1| hypothetical protein MIMGU_mgv1a003278mg [Erythranthe guttata]
Length=594

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM TAQGRTDPNQNTGIV+QKCR+ A SDL+PVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  458  NMFTAQGRTDPNQNTGIVIQKCRLGATSDLRPVQSSFPTYLGRPWKEYSRTVIMQSSITD  517

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VVH AGWHEW G+FA++TLFYGEH NTGAGA TS RV WKGFKVI SATEAQSYTAG FI
Sbjct  518  VVHSAGWHEWDGNFALSTLFYGEHQNTGAGAGTSGRVNWKGFKVITSATEAQSYTAGSFI  577

Query  362  SGSNW  376
            +G +W
Sbjct  578  AGGSW  582



>pir||T10488 pectinesterase (EC 3.1.1.11) PECS1.2 - sweet orange  (fragment)
 gb|AAB57668.1| pectinesterase [Citrus sinensis]
Length=290

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QK RI A SDLKPVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  154  NMVTAQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITD  213

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+H AGWHEW G+FA+NTLFYGEH N GAGA TS RVKWKGF+VI SATEAQ++T G FI
Sbjct  214  VIHPAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFI  273

Query  362  SGSNW  376
            +GS+W
Sbjct  274  AGSSW  278



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+QKCRI A SDL+PVQK+FP YLGRPWKEYSRTV+MQSSI+D
Sbjct  443  NMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPMYLGRPWKEYSRTVIMQSSITD  502

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGWHEW+G+FA+NTLFYGE+ NTGAGA TS RVKWKGFKVI SATEAQ+YT GRFI
Sbjct  503  VINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWKGFKVITSATEAQAYTPGRFI  562

Query  362  SGSNW  376
            +G +W
Sbjct  563  AGGSW  567



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+Q CRI A SDL+PVQK+FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  453  NMVTAQGRTDPNQNTGIVIQNCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITD  512

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGWHEW+G+FA+NTLFYGE+ NTGAGA TS RVKW+GFKVI SATEAQ+YT GRFI
Sbjct  513  VINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWRGFKVITSATEAQAYTPGRFI  572

Query  362  SGSNW  376
            +G +W
Sbjct  573  AGGSW  577



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+PVQK+FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  440  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITD  499

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEW+G+FA+NTLFYGE++NTGAGAATS RVKWKG KVI S+TEAQ+YT G FI
Sbjct  500  VIQPAGWHEWNGNFALNTLFYGEYANTGAGAATSGRVKWKGHKVITSSTEAQAYTPGSFI  559

Query  362  SGSNW  376
            +G +W
Sbjct  560  AGGSW  564



>ref|NP_001233857.1| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
 sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+PVQK+FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  447  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITD  506

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEW+G+FA++TLFYGE++NTGAGA TS RVKWKG KVI S+TEAQ+YT GRFI
Sbjct  507  VIQPAGWHEWNGNFALDTLFYGEYANTGAGAPTSGRVKWKGHKVITSSTEAQAYTPGRFI  566

Query  362  SGSNW  376
            +G +W
Sbjct  567  AGGSW  571



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+PV+KNFPTYLGRPWKEYSRTVVMQS+ISD
Sbjct  446  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISD  505

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSGSFA+ TLFY E+ NTGAGA+TS RVKW G+KVI SA+EAQ++T GRFI
Sbjct  506  VIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI  565

Query  362  SGSNW  376
            +G +W
Sbjct  566  AGGSW  570



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+PV+KNFPTYLGRPWKEYSRTVVMQS+ISD
Sbjct  446  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISD  505

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSGSFA+ TLFY E+ NTGAGA+TS RVKW G+KVI SA+EAQ++T GRFI
Sbjct  506  VIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI  565

Query  362  SGSNW  376
            +G +W
Sbjct  566  AGGSW  570



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+PV+KNFPTYLGRPWKEYSRTVVMQS+ISD
Sbjct  446  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISD  505

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSGSFA+ TLFY E+ NTGAGA+TS RVKW G+KVI SA+EAQ++T GRFI
Sbjct  506  VIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI  565

Query  362  SGSNW  376
            +G +W
Sbjct  566  AGGSW  570



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+PV+KNFPTYLGRPWKEYSRTVVMQS+ISD
Sbjct  446  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTYLGRPWKEYSRTVVMQSTISD  505

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSGSFA+ TLFY E+ NTGAGA+TS RVKW G+KVI SA+EAQ++T GRFI
Sbjct  506  VIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYKVITSASEAQAFTPGRFI  565

Query  362  SGSNW  376
            +G +W
Sbjct  566  AGGSW  570



>gb|KDO36004.1| hypothetical protein CISIN_1g029714mg [Citrus sinensis]
Length=136

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  5    MLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDV  184
            M   QGR DPNQNTGIV+QK RI A SDLKPVQ +FPTYLGRPWKEYSRTV+MQSSI+DV
Sbjct  1    MHETQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITDV  60

Query  185  VHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFIS  364
            +H AGWHEW G+FA+NTLFYGEH N GAGA TS RVKWKGF+VI SATEAQ++T G FI+
Sbjct  61   IHPAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFIA  120

Query  365  GSNW  376
            GS+W
Sbjct  121  GSSW  124



>ref|NP_001275859.1| pectinesterase 1 precursor [Citrus sinensis]
 ref|XP_006426800.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
 gb|AAB57670.1| pectinesterase [Citrus sinensis]
 gb|ESR40040.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
Length=584

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDLKPVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  448  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITD  507

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H AGWHEW G+FA+NTLFYGEH N+GAGA TS RVKWKGF+VI SATEAQ++T G FI
Sbjct  508  LIHPAGWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFI  567

Query  362  SGSNW  376
            +GS+W
Sbjct  568  AGSSW  572



>sp|O04886.1|PME1_CITSI RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57667.1| pectinesterase [Citrus sinensis]
Length=584

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDLKPVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  448  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITD  507

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H AGWHEW G+FA+NTLFYGEH N+GAGA TS RVKWKGF+VI SATEAQ++T G FI
Sbjct  508  LIHPAGWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFI  567

Query  362  SGSNW  376
            +GS+W
Sbjct  568  AGSSW  572



>emb|CAB57457.2| pectin methylesterase [Nicotiana tabacum]
Length=266

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG+V+Q CRI A SDL+PVQK+FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  149  NMVTAQGRTDPNQNTGVVIQNCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITD  208

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGR  355
            V++ AGWHEW+G+FA+NTLFYGE+ NTGAGA TS RVKW+GFKVI SATEAQ+YT GR
Sbjct  209  VINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWRGFKVITSATEAQAYTPGR  266



>emb|CDO97787.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL+PVQ+NFPT+LGRPWKEYSRTVVMQS+++D
Sbjct  124  NMVTAQGRIDPNQNTGIVIQKCRIGATSDLRPVQQNFPTFLGRPWKEYSRTVVMQSTVTD  183

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEW+G+FA++TLFY E+ NTGAGA TS RVKWKG+KVI SA EAQ++T GRFI
Sbjct  184  VIDPAGWHEWNGNFALSTLFYAEYQNTGAGAGTSGRVKWKGYKVITSAAEAQAFTPGRFI  243

Query  362  SGSNW  376
             G++W
Sbjct  244  DGNSW  248



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QK RI A SDLKPVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  448  NMVTAQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITD  507

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+H AGWHEW G+FA+NTLFYGEH N GAGA TS RVKWKGF+VI SATEAQ++T G FI
Sbjct  508  VIHPAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFI  567

Query  362  SGSNW  376
            +GS+W
Sbjct  568  AGSSW  572



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ NFPTYLGRPWKEYSRTVVMQS ISD
Sbjct  446  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVRSNFPTYLGRPWKEYSRTVVMQSVISD  505

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+H AGWHEWS SFA+ TLFYGE+ NTGAGA TS RVKW+G+KVI SA+EAQ+Y+ GRFI
Sbjct  506  VIHPAGWHEWSESFALRTLFYGEYQNTGAGAGTSGRVKWEGYKVITSASEAQAYSPGRFI  565

Query  362  SGSNW  376
            +G +W
Sbjct  566  AGGSW  570



>emb|CBI27741.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDLKPVQ +FPTYLGRPWKEYSRTVVMQ+SISD
Sbjct  230  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYLGRPWKEYSRTVVMQTSISD  289

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW+ W+G+FA++TLFY E+ NTGAGA TS+RV WKGFKVI SA+EAQ++TAG FI
Sbjct  290  VINPAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWKGFKVITSASEAQAFTAGSFI  349

Query  362  SGSNW  376
             GS+W
Sbjct  350  GGSSW  354



>gb|AFQ23194.1| pectin methylesterase [Theobroma cacao]
Length=582

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V  NFPTYLGRPWKEYSRTVVMQS ISD
Sbjct  446  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVTSNFPTYLGRPWKEYSRTVVMQSVISD  505

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+H AGWHEWS SFA+ TLFYGE+ NTGAGA TS RVKW+G+KVI SA+EAQ+Y+ GRFI
Sbjct  506  VIHPAGWHEWSESFALRTLFYGEYQNTGAGAGTSGRVKWEGYKVITSASEAQAYSPGRFI  565

Query  362  SGSNW  376
            +G +W
Sbjct  566  AGGSW  570



>ref|XP_010096538.1| Pectinesterase 1 [Morus notabilis]
 gb|EXB64658.1| Pectinesterase 1 [Morus notabilis]
Length=233

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDLKPVQ +FPTYLGRPWKEYSRTVVMQS IS+
Sbjct  97   NMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQSSFPTYLGRPWKEYSRTVVMQSDISN  156

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSGSFA+NTL Y E+ NTGAGA TS+RV WKG+KVI  A+EAQ YTAG FI
Sbjct  157  VIVPAGWHEWSGSFALNTLVYREYQNTGAGADTSKRVTWKGYKVITGASEAQQYTAGNFI  216

Query  362  SGSNW  376
            +G +W
Sbjct  217  AGGSW  221



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL+PVQ+NFPT+LGRPWKEYSRTVVMQS+++D
Sbjct  451  NMVTAQGRIDPNQNTGIVIQKCRIGATSDLRPVQQNFPTFLGRPWKEYSRTVVMQSTVTD  510

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEW+G+FA++TLFY E+ NTGAGA TS RVKWKG+KVI SA EAQ++T GRFI
Sbjct  511  VIDPAGWHEWNGNFALSTLFYAEYQNTGAGAGTSGRVKWKGYKVITSAAEAQAFTPGRFI  570

Query  362  SGSNW  376
             G++W
Sbjct  571  DGNSW  575



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score =   214 bits (545),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+ K RI A SDLK VQKNFPTYLGRPWKEYSRTV+MQ SI+D
Sbjct  457  NMVTAQGRTDPNQNTGIVIHKSRIGATSDLKSVQKNFPTYLGRPWKEYSRTVIMQCSIAD  516

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEW+G+FA++TLFYGE+ NTGAGA TS+RVKWKGFKVI SATEAQ YT  +FI
Sbjct  517  VISPTGWHEWNGNFALDTLFYGEYENTGAGAGTSERVKWKGFKVITSATEAQDYTPNKFI  576

Query  362  SGSNW  376
            +G++W
Sbjct  577  AGNSW  581



>ref|XP_008361835.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=233

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGRTDPNQNTGIV+QK RI A SDL+  + +F T+LGRPWKEYSRTV+MQSSI+D
Sbjct  97   NMLTAQGRTDPNQNTGIVIQKSRIGATSDLQASKGSFKTFLGRPWKEYSRTVIMQSSITD  156

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++   GWHEWSG+FA+NTLFYGE++NTGAGA TS+RV WKGFKVI S TEAQ+YT GRFI
Sbjct  157  IIDPVGWHEWSGTFALNTLFYGEYANTGAGAGTSKRVTWKGFKVITSTTEAQAYTPGRFI  216

Query  362  SGSNW  376
            +G +W
Sbjct  217  AGGSW  221



>ref|XP_006369079.1| pectinesterase family protein, partial [Populus trichocarpa]
 gb|ERP65648.1| pectinesterase family protein, partial [Populus trichocarpa]
Length=229

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL PVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  93   NMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTYLGRPWKEYSRTVIMQSSITD  152

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSG+FA++TLFY E+ N+G+GA TS RV W+G+KVI SATEAQ++  G FI
Sbjct  153  VIQPAGWHEWSGTFALSTLFYAEYQNSGSGAGTSSRVTWEGYKVITSATEAQAFAPGNFI  212

Query  362  SGSNW  376
            +GS+W
Sbjct  213  AGSSW  217



>ref|XP_004141734.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN45437.1| hypothetical protein Csa_7G447990 [Cucumis sativus]
Length=595

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+QK RI A SDL+PVQK+FPT+LGRPWKEYSRTV+MQ +ISD
Sbjct  459  NMVTAQGRSDPNQNTGIVIQKSRIGATSDLRPVQKSFPTFLGRPWKEYSRTVIMQCTISD  518

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSGSFA+NTLFYGE+ NTGAGA+T  RV WKGF+VI SATEA+S+TAG+FI
Sbjct  519  VIDPKGWHEWSGSFALNTLFYGEYQNTGAGASTGGRVTWKGFRVIRSATEAESFTAGKFI  578

Query  362  SGSNW  376
             G +W
Sbjct  579  GGGSW  583



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDLKPVQ +FPTYLGRPWKEYSRTVVMQ+SISD
Sbjct  442  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYLGRPWKEYSRTVVMQTSISD  501

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW+ W+G+FA++TLFY E+ NTGAGA TS+RV WKGFKVI SA+EAQ++TAG FI
Sbjct  502  VINPAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWKGFKVITSASEAQAFTAGSFI  561

Query  362  SGSNW  376
             GS+W
Sbjct  562  GGSSW  566



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QK RI A SDLK VQKNFPTYLGRPWKEYSRTV+MQ SI+D
Sbjct  456  NMVTAQGRKDPNQNTGIVIQKSRIGATSDLKSVQKNFPTYLGRPWKEYSRTVIMQCSIAD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEW+G FA++TLFYGE+ NTGAGA TS RVKWKGFKVI SATEAQ YT  +FI
Sbjct  516  VISPTGWHEWNGDFALDTLFYGEYENTGAGAGTSGRVKWKGFKVITSATEAQDYTPNKFI  575

Query  362  SGSNW  376
            +G++W
Sbjct  576  AGNSW  580



>ref|XP_004172115.1| PREDICTED: pectinesterase 3-like, partial [Cucumis sativus]
Length=592

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+QK RI A SDL+PVQK+FPT+LGRPWKEYSRTV+MQ +ISD
Sbjct  456  NMVTAQGRSDPNQNTGIVIQKSRIGATSDLRPVQKSFPTFLGRPWKEYSRTVIMQCTISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSGSFA+NTLFYGE+ NTGAGA+T  RV WKGF+VI SATEA+S+TAG+FI
Sbjct  516  VIDPKGWHEWSGSFALNTLFYGEYQNTGAGASTGGRVTWKGFRVIRSATEAESFTAGKFI  575

Query  362  SGSNW  376
             G +W
Sbjct  576  GGGSW  580



>gb|AFK42744.1| unknown [Lotus japonicus]
Length=260

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A  DL+ V+ +FPT+LGRPWK+YSRTV+MQSSI+D
Sbjct  124  NMVTAQGRLDPNQNTGIVIQKCRIGATKDLEAVKSSFPTFLGRPWKDYSRTVIMQSSITD  183

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEW+G+FA+NTLFYGE+ NTG GAATS+RV WKGFKVI SA+EAQ++T   FI
Sbjct  184  VIDPAGWHEWNGNFALNTLFYGEYLNTGPGAATSRRVNWKGFKVITSASEAQAFTPANFI  243

Query  362  SGSNW  376
            +GS W
Sbjct  244  AGSTW  248



>emb|CAC01624.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=579

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL PVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  443  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTYLGRPWKEYSRTVIMQSSITD  502

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSGSFA++TLFY E+ N+GAGA TS RVKW+G+KVI SATEAQ++  G FI
Sbjct  503  VIQPAGWHEWSGSFALSTLFYAEYQNSGAGAGTSSRVKWEGYKVITSATEAQAFAPGNFI  562

Query  362  SGSNW  376
            +GS+W
Sbjct  563  AGSSW  567



>ref|XP_011078160.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=567

 Score =   211 bits (536),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL+PVQ +FPTYLGRPWKEYSRT+VMQ+ IS+
Sbjct  431  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLRPVQSSFPTYLGRPWKEYSRTIVMQTDISN  490

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW+EW+G+FA+NTLFY E+ NTGAGA TS RV W+GF+V+ SA EAQ +TAGRFI
Sbjct  491  VINPAGWYEWNGNFALNTLFYAEYQNTGAGAGTSNRVTWRGFRVLTSAAEAQPFTAGRFI  550

Query  362  SGSNW  376
            +G NW
Sbjct  551  AGGNW  555



>ref|XP_011078159.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
Length=567

 Score =   211 bits (536),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL+PVQ +FPTYLGRPWKEYSRT+VMQ+ IS+
Sbjct  431  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLRPVQSSFPTYLGRPWKEYSRTIVMQTDISN  490

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW+EW+G+FA+NTLFY E+ NTGAGA TS RV W+GF+V+ SA EAQ +TAGRFI
Sbjct  491  VINPAGWYEWNGNFALNTLFYAEYQNTGAGAGTSNRVTWRGFRVLTSAAEAQPFTAGRFI  550

Query  362  SGSNW  376
            +G NW
Sbjct  551  AGGNW  555



>gb|KDP40627.1| hypothetical protein JCGZ_24626 [Jatropha curcas]
Length=581

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDLKPVQ +FPTYLGRPWKEYSRTV+MQS+ISD
Sbjct  445  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQSSFPTYLGRPWKEYSRTVIMQSTISD  504

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+H AGWH W+G FA+NTL Y E+ N+GAGA TS RV WKG+KVI SA+EAQ++T G FI
Sbjct  505  VIHPAGWHLWTGDFALNTLTYREYQNSGAGAGTSNRVTWKGYKVITSASEAQAFTPGNFI  564

Query  362  SGSNW  376
            +GSNW
Sbjct  565  AGSNW  569



>ref|XP_011069392.1| PREDICTED: pectinesterase-like, partial [Sesamum indicum]
Length=398

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDLKPVQ +FPTYLGRPWK+YSRT+VMQ+ IS+
Sbjct  262  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTYLGRPWKKYSRTIVMQTDISN  321

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW+EW G+FA+NTLFY E+ N GAGA TS RV W+GF+V+ SA EAQ +TAGRFI
Sbjct  322  VINPAGWYEWDGNFALNTLFYAEYQNRGAGARTSNRVTWRGFRVLTSAAEAQPFTAGRFI  381

Query  362  SGSNW  376
            +G NW
Sbjct  382  AGGNW  386



>ref|XP_010029512.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=587

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRIA  +DL+ V+ +FPTYLGRPWKEYSRTV+MQSSISD
Sbjct  451  NMVTAQGRIDPNQNTGIVIQKCRIAETNDLRSVKSSFPTYLGRPWKEYSRTVIMQSSISD  510

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSG+FA+NTL+YGE+ N GAGA T++RV WKGFKVI SATEAQ +TAG FI
Sbjct  511  VIDPVGWHEWSGTFALNTLYYGEYQNIGAGAGTTKRVNWKGFKVITSATEAQGFTAGNFI  570

Query  362  SGSNW  376
             G++W
Sbjct  571  GGASW  575



>ref|XP_008462453.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=598

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+QK RI A SDL+PVQK+FPT+LGRPWKEYSRTV+MQ SISD
Sbjct  462  NMVTAQGRSDPNQNTGIVIQKSRIGATSDLRPVQKSFPTFLGRPWKEYSRTVIMQCSISD  521

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSGSFA+NTLFYGE+ NTG GA+T  RV WKGF+VI SATEA+ +TAG+FI
Sbjct  522  VIDPKGWHEWSGSFALNTLFYGEYQNTGPGASTGGRVTWKGFRVIRSATEAEGFTAGKFI  581

Query  362  SGSNW  376
             G +W
Sbjct  582  GGGSW  586



>pdb|1GQ8|A Chain A, Pectin Methylesterase From Carrot
Length=319

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL+PVQ +FPTYLGRPWKEYSRTVVMQSSI++
Sbjct  183  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSRTVVMQSSITN  242

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW  W G+FA++TL+YGE+ NTGAGAATS RV WKGFKVI S+TEAQ +T G FI
Sbjct  243  VINPAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTEAQGFTPGSFI  302

Query  362  SGSNW  376
            +G +W
Sbjct  303  AGGSW  307



>gb|AAQ21126.1| pectinesterase [Fragaria x ananassa]
Length=209

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGRTDPNQNTGIV+QK RI A SDL+ V+ +F TYLGRPWKEYSRTV+MQSSI+D
Sbjct  73   NMLTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTYLGRPWKEYSRTVIMQSSITD  132

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW+EWSG+FA++TLFY E++NTGAGA+TS RV WKG+KVI SATEAQ++T G FI
Sbjct  133  IIDPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWKGYKVITSATEAQAFTPGNFI  192

Query  362  SGSNW  376
            +G +W
Sbjct  193  AGGSW  197



>sp|P83218.1|PME_DAUCA RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Daucus carota]
Length=319

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL+PVQ +FPTYLGRPWKEYSRTVVMQSSI++
Sbjct  183  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSRTVVMQSSITN  242

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW  W G+FA++TL+YGE+ NTGAGAATS RV WKGFKVI S+TEAQ +T G FI
Sbjct  243  VINPAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTEAQGFTPGSFI  302

Query  362  SGSNW  376
            +G +W
Sbjct  303  AGGSW  307



>ref|XP_010543030.1| PREDICTED: pectinesterase 2-like [Tarenaya hassleriana]
Length=529

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYSRTVVMQS ISD
Sbjct  393  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQAVKGSFPTYLGRPWKEYSRTVVMQSEISD  452

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEW+G+FA++TL YGE++NTGAGA T+ RV WKGFKVI SATEAQ +TAG+FI
Sbjct  453  VIRPEGWHEWNGNFALDTLTYGEYANTGAGAGTANRVTWKGFKVITSATEAQEFTAGQFI  512

Query  362  SGSNW  376
             G +W
Sbjct  513  GGGSW  517



>gb|AAR03544.1| pectin methylesterase isoform 1 [Fragaria x ananassa]
Length=224

 Score =   199 bits (507),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGRTDPNQNTGIV+QK RI A SDL+ V+ +F TYLGRPWKEYSRTV+MQSSI+D
Sbjct  88   NMLTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTYLGRPWKEYSRTVIMQSSITD  147

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW+EWSG+FA++TLFY E++NTGAGA+TS RV WKG+KVI SATEAQ++T G FI
Sbjct  148  IIDPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWKGYKVITSATEAQAFTPGNFI  207

Query  362  SGSNW  376
            +G +W
Sbjct  208  AGGSW  212



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score =   208 bits (530),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL+PV+ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  448  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVKSSFPTYLGRPWKEYSRTVIMQSSITD  507

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGW EWSGSFA+NTL+Y E+ N+GAGA TS+RV WKG++VI SATEAQ +T G FI
Sbjct  508  VIQPAGWFEWSGSFALNTLYYAEYQNSGAGAGTSRRVTWKGYRVITSATEAQRFTPGNFI  567

Query  362  SGSNW  376
            +GS+W
Sbjct  568  AGSSW  572



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL+PV+ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  444  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVKSSFPTYLGRPWKEYSRTVIMQSSITD  503

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGW EWSGSFA+NTL+Y E+ N+GAGA TS+RV WKG++VI SATEAQ +T G FI
Sbjct  504  VIQPAGWFEWSGSFALNTLYYAEYQNSGAGAGTSRRVTWKGYRVITSATEAQRFTPGNFI  563

Query  362  SGSNW  376
            +GS+W
Sbjct  564  AGSSW  568



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGI++QKCRI A SDLKPV+++FPTYLGRPWKEYSRTV+MQS I+D
Sbjct  440  NMVTAQGRDDPNQNTGIIIQKCRIGATSDLKPVKRSFPTYLGRPWKEYSRTVIMQSFITD  499

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+H  GWH W+G+FA+NTL+YGE+ NTGAGAAT++RVKWKG+KVI SAT AQ +T   FI
Sbjct  500  VIHPEGWHAWNGNFALNTLYYGEYRNTGAGAATAKRVKWKGYKVITSATVAQQFTVKNFI  559

Query  362  SGSNW  376
             G +W
Sbjct  560  LGDHW  564



>ref|XP_010534986.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
 ref|XP_010534987.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
Length=587

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYSRTVVMQS ISD
Sbjct  451  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSRTVVMQSDISD  510

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEW+G+FA+NTL Y E++N GAGA T+ RVKW+GFKVI SATEAQ++TAGRFI
Sbjct  511  VIRPEGWHEWTGNFALNTLTYREYANRGAGAGTANRVKWRGFKVITSATEAQAFTAGRFI  570

Query  362  SGSNW  376
             G  W
Sbjct  571  GGGGW  575



>ref|XP_002532944.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF29428.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=577

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 1/120 (1%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+QKCRI A SDL+PVQ +FPTYLGRPWKEYSRTVVMQ++ISD
Sbjct  446  NMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQSSFPTYLGRPWKEYSRTVVMQTAISD  505

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQ-SYTAGRF  358
            V+H AGWHEWSGSFA++TLFYGE+ N+GAGA TS+RV WKGFKVI SATEAQ    AG F
Sbjct  506  VIHPAGWHEWSGSFALSTLFYGEYQNSGAGAGTSKRVSWKGFKVITSATEAQGXVAAGEF  565



>ref|XP_011048630.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=579

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL PVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  443  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTYLGRPWKEYSRTVIMQSSITD  502

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSGSFA++TLFY E+ N+GAGA TS RV W+G++VI SATE Q +T G FI
Sbjct  503  VIQPAGWHEWSGSFALSTLFYAEYQNSGAGAGTSSRVTWEGYRVITSATEVQEFTPGNFI  562

Query  362  SGSNW  376
            +GS+W
Sbjct  563  AGSSW  567



>dbj|BAD94011.1| pectin methylesterase like protein [Arabidopsis thaliana]
Length=244

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS+ISD
Sbjct  108  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQTVIMQSAISD  167

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E+SNTGAGA T+ RVKW+GFKVI +A EAQ YTAG+FI
Sbjct  168  VIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWRGFKVITAAAEAQKYTAGQFI  227

Query  362  SGSNW  376
             G  W
Sbjct  228  GGGGW  232



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGRTDPNQNTGIV+QKCRI A SDL+ V  +F TYLGRPWKEYSRTVVMQ+SI++
Sbjct  475  NMLTAQGRTDPNQNTGIVIQKCRIGATSDLQAVISSFKTYLGRPWKEYSRTVVMQTSITN  534

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSGSFA++TL+YGE+ NTGAGA TS+RV WKGFKVI SA+EAQ +T G FI
Sbjct  535  VIDPAGWHEWSGSFALSTLYYGEYQNTGAGAGTSKRVTWKGFKVITSASEAQGFTPGTFI  594

Query  362  SGSNW  376
            +GS+W
Sbjct  595  AGSSW  599



>ref|XP_006388348.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
 gb|ERP47262.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
Length=579

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL PVQ +FPTYLGRPWKEYSRTV+MQSSI+D
Sbjct  443  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTYLGRPWKEYSRTVIMQSSITD  502

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSG+FA++TLFY E+ N+G+GA TS RV W+G+KVI SATEAQ++  G FI
Sbjct  503  VIQPAGWHEWSGTFALSTLFYAEYQNSGSGAGTSSRVTWEGYKVITSATEAQAFAPGNFI  562

Query  362  SGSNW  376
            +GS+W
Sbjct  563  AGSSW  567



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL+ V+ +F T+LGRPWKEYSRTV+MQSSISD
Sbjct  451  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTFLGRPWKEYSRTVIMQSSISD  510

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGWHEWSG+FA++TLFYGE++NTGAGA TS RV WKGFKVI SATEAQ++T G FI
Sbjct  511  IIDPAGWHEWSGTFALDTLFYGEYANTGAGAGTSNRVTWKGFKVITSATEAQTFTPGSFI  570

Query  362  SGSNW  376
            +G +W
Sbjct  571  AGGSW  575



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   206 bits (523),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGI + KCRI+A SDL PV+ +FPTYLGRPWKEYSRTV+MQS+ISD
Sbjct  428  NMVTAQGREDPNQNTGISIHKCRISADSDLAPVKSSFPTYLGRPWKEYSRTVIMQSTISD  487

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGWHEW+G+FA+NTL+YGE+ NTGAGA TS RVKWKG+KVI SA+EA+ +T G FI
Sbjct  488  VINPAGWHEWNGNFALNTLYYGEYQNTGAGAGTSGRVKWKGYKVITSASEAKQFTVGDFI  547

Query  362  SGSNW  376
            +G +W
Sbjct  548  NGGSW  552



>dbj|BAD95369.1| pectin methylesterase like protein [Arabidopsis thaliana]
Length=381

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS+ISD
Sbjct  245  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQTVIMQSAISD  304

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E+SNTGAGA T+ RVKW+GFKVI +A EAQ YTAG+FI
Sbjct  305  VIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWRGFKVITAAAEAQKYTAGQFI  364

Query  362  SGSNW  376
             G  W
Sbjct  365  GGGGW  369



>gb|EYU29495.1| hypothetical protein MIMGU_mgv1a005211mg [Erythranthe guttata]
Length=493

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A +DL PVQ +FPTYLGRPWKEYSRTVVMQ+ IS+
Sbjct  357  NMVTAQGRDDPNQNTGIVIQKCRIGATADLVPVQSSFPTYLGRPWKEYSRTVVMQTQISN  416

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW EW G+FA+NTLFY E+ NTGAGA T+ RV WKGF+V+ S  EAQ +TAGRFI
Sbjct  417  VINPAGWFEWDGNFALNTLFYAEYKNTGAGAGTANRVTWKGFRVLKSDAEAQPFTAGRFI  476

Query  362  SGSNW  376
            SG +W
Sbjct  477  SGGSW  481



>gb|AAL24278.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
Length=388

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS+ISD
Sbjct  252  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQTVIMQSAISD  311

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E+SNTGAGA T+ RVKW+GFKVI +A EAQ YTAG+FI
Sbjct  312  VIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWRGFKVITAAAEAQKYTAGQFI  371

Query  362  SGSNW  376
             G  W
Sbjct  372  GGGGW  376



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGR DPNQNTGIV+Q CRIAA SDL+ V+ +FPTYLGRPWKEYSRTV+MQS+ISD
Sbjct  444  NMLTAQGRDDPNQNTGIVIQNCRIAATSDLQAVKSSFPTYLGRPWKEYSRTVIMQSTISD  503

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+H AGWHEWSG+FA+ TL+Y E+ NTG GAAT+ RV WKG+KVI SATEA  +T   FI
Sbjct  504  VIHPAGWHEWSGNFALTTLYYAEYQNTGPGAATANRVSWKGYKVITSATEALRFTVSNFI  563

Query  362  SGSNW  376
            +G +W
Sbjct  564  AGGSW  568



>ref|XP_008340373.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=573

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGRTDPNQNTGIV+QK RI A SDL+  + +F T+LGRPWKEYSRTV+MQSSI+D
Sbjct  437  NMLTAQGRTDPNQNTGIVIQKSRIGATSDLQASKGSFKTFLGRPWKEYSRTVIMQSSITD  496

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++   GWHEWSG+FA+NTLFYGE++NTGAGA TS+RV WKGFKVI S TEAQ+YT G FI
Sbjct  497  IIDPVGWHEWSGTFALNTLFYGEYANTGAGAGTSKRVTWKGFKVITSTTEAQAYTPGXFI  556

Query  362  SGSNW  376
            +G +W
Sbjct  557  AGGSW  561



>emb|CBI35795.3| unnamed protein product [Vitis vinifera]
Length=670

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGRTDPNQNTGIV+QKCRI A SDL+ V  +F TYLGRPWKEYSRTVVMQ+SI++
Sbjct  124  NMLTAQGRTDPNQNTGIVIQKCRIGATSDLQAVISSFKTYLGRPWKEYSRTVVMQTSITN  183

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEWSGSFA++TL+YGE+ NTGAGA TS+RV WKGFKVI SA+EAQ +T G FI
Sbjct  184  VIDPAGWHEWSGSFALSTLYYGEYQNTGAGAGTSKRVTWKGFKVITSASEAQGFTPGTFI  243

Query  362  SGSNW  376
            +GS+W
Sbjct  244  AGSSW  248


 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 81/126 (64%), Gaps = 6/126 (5%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQG+ DPNQNTGI +QKC I+A + L       PTYLGRPWK YS T+VMQS+I  
Sbjct  538  NTITAQGKKDPNQNTGISIQKCSISALNTLTA-----PTYLGRPWKAYSTTIVMQSNIGS  592

Query  182  VVHIAGWHEW-SGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRF  358
             ++  GW EW +G    +T+FY E  NTG GA   QRVKW GF    +  EA  +T G F
Sbjct  593  FLNPKGWTEWVTGVDPPSTIFYAEFQNTGPGATLDQRVKWAGFMTNITEDEAAKFTVGTF  652

Query  359  ISGSNW  376
            I G++W
Sbjct  653  IQGASW  658



>ref|XP_010501842.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=592

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL PV+ +FPTYLGRPWKEYS+TVVMQS+ISD
Sbjct  456  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLLPVKGSFPTYLGRPWKEYSQTVVMQSAISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++NTGAGA T+ RVKW+GFKVI +A EAQ YTAG+FI
Sbjct  516  VIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWRGFKVITAAAEAQKYTAGQFI  575

Query  362  SGSNW  376
             G  W
Sbjct  576  GGGGW  580



>ref|XP_007139063.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
 gb|ESW11057.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
Length=580

 Score =   203 bits (516),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QK RI A  DL+ V+K+FPT+LGRPWK+YSRTV+MQSSISD
Sbjct  444  NMVTAQGRVDPNQNTGIVIQKSRIGATKDLESVKKSFPTFLGRPWKQYSRTVIMQSSISD  503

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWH W G+FA+NTLFYGE+ NTG GAATS+RV WKGFKVI SA EAQS+T   FI
Sbjct  504  VIDPAGWHVWDGNFALNTLFYGEYQNTGPGAATSRRVTWKGFKVITSAAEAQSFTPANFI  563

Query  362  SGSNW  376
            +GS+W
Sbjct  564  AGSSW  568



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL+ V+ +F T+LGRPWKEYSRTV+MQS+ISD
Sbjct  451  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTFLGRPWKEYSRTVIMQSAISD  510

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGWHEWSG+FA++TLFYGE++NTGAGA  S RV WKGFKVI SATEAQ++T G FI
Sbjct  511  IIDPAGWHEWSGTFALDTLFYGEYANTGAGAGISNRVTWKGFKVITSATEAQTFTPGSFI  570

Query  362  SGSNW  376
            +G +W
Sbjct  571  AGGSW  575



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A  DL+ V+ NFPTYLGRPWKEYSRTV MQSSISD
Sbjct  453  NMVTAQGRVDPNQNTGIVIQKCRIGATKDLEGVKGNFPTYLGRPWKEYSRTVFMQSSISD  512

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEW+G+FA+NTL Y E+ NTG GA TS+RV WKGFKVI SA EAQS+T G FI
Sbjct  513  VIDPVGWHEWNGNFALNTLVYREYQNTGPGAGTSKRVTWKGFKVITSAAEAQSFTPGNFI  572

Query  362  SGSNW  376
             GS+W
Sbjct  573  GGSSW  577



>ref|XP_004303758.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1-like [Fragaria 
vesca subsp. vesca]
Length=578

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGRTDPNQNTGIV+QK RI A SDL+ V+ +F TYLGRPWKEYSRTV+MQSSI+D
Sbjct  442  NMLTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTYLGRPWKEYSRTVIMQSSITD  501

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW+EWSG+FA++TLFY E++NTGAGA+TS RV WKG+KVI SATEAQ++T G FI
Sbjct  502  IIDPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWKGYKVITSATEAQAFTPGNFI  561

Query  362  SGSNW  376
            +G +W
Sbjct  562  AGGSW  566



>gb|AAC72288.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=592

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS+ISD
Sbjct  456  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQTVIMQSAISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E+SNTGAGA T+ RVKW+GFKVI +A EAQ YTAG+FI
Sbjct  516  VIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWRGFKVITAAAEAQKYTAGQFI  575

Query  362  SGSNW  376
             G  W
Sbjct  576  GGGGW  580



>ref|NP_188048.1| pectin methylesterase 3 [Arabidopsis thaliana]
 sp|O49006.2|PME3_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 3; Includes: 
RecName: Full=Pectinesterase inhibitor 3; AltName: Full=Pectin 
methylesterase inhibitor 3; Includes: RecName: Full=Pectinesterase 
3; Short=PE 3; AltName: Full=Pectin methylesterase 
27; Short=AtPME27; AltName: Full=Pectin methylesterase 
3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01037.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK59769.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAK97722.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAN28889.1| At3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AEE75500.1| pectin methylesterase 3 [Arabidopsis thaliana]
Length=592

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS+ISD
Sbjct  456  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQTVIMQSAISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E+SNTGAGA T+ RVKW+GFKVI +A EAQ YTAG+FI
Sbjct  516  VIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWRGFKVITAAAEAQKYTAGQFI  575

Query  362  SGSNW  376
             G  W
Sbjct  576  GGGGW  580



>ref|XP_010465323.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Camelina 
sativa]
Length=592

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL PV+ +FPT+LGRPWKEYS+TV+MQS+ISD
Sbjct  456  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLLPVKGSFPTFLGRPWKEYSQTVIMQSAISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++NTGAGA T+ RVKW+GFKVI +A EAQ YTAG+FI
Sbjct  516  VIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWRGFKVITAAAEAQKYTAGQFI  575

Query  362  SGSNW  376
             G  W
Sbjct  576  GGGGW  580



>gb|KHN15840.1| Pectinesterase/pectinesterase inhibitor U1 [Glycine soja]
Length=362

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A  DL+ V+KNF TYLGRPWKEYSRTV+MQSSISD
Sbjct  226  NMVTAQGRVDPNQNTGIVIQKCRIGATKDLESVKKNFKTYLGRPWKEYSRTVIMQSSISD  285

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSG+FA++TL Y E+ NTG GA TS RV WKG+KVI  A EA+ YT G FI
Sbjct  286  VIDPIGWHEWSGNFALSTLVYREYQNTGPGAGTSNRVTWKGYKVITDAAEARDYTPGSFI  345

Query  362  SGSNW  376
             GS+W
Sbjct  346  GGSSW  350



>gb|KFK38797.1| hypothetical protein AALP_AA3G161500 [Arabis alpina]
Length=593

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TVVMQS ISD
Sbjct  457  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTYLGRPWKEYSQTVVMQSDISD  516

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++N GAGA T+ RVKW+GFKVI +ATEAQ YTAG+FI
Sbjct  517  VIRPEGWAEWTGTFALNTLTYREYANRGAGAGTANRVKWRGFKVITAATEAQRYTAGQFI  576

Query  362  SGSNW  376
             G  W
Sbjct  577  GGGGW  581



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QK RI A SDL+  + +F T+LGRPWKEYSRTV+MQSSI+D
Sbjct  449  NMVTAQGRTDPNQNTGIVIQKSRIGATSDLQASKSSFKTFLGRPWKEYSRTVIMQSSITD  508

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGWHEWSG+FA++TLFYGE++NTGAGA T+ RV WKGFKVI S TEA++YT G FI
Sbjct  509  IIDPAGWHEWSGTFALDTLFYGEYANTGAGAGTANRVTWKGFKVITSPTEAEAYTPGNFI  568

Query  362  SGSNW  376
            +G +W
Sbjct  569  AGGSW  573



>emb|CDX97564.1| BnaA05g25150D [Brassica napus]
Length=592

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS+ISD
Sbjct  456  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTYLGRPWKEYSQTVIMQSAISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++NTGAGA T+ RV WKGFKVI +A EAQ YTAG+FI
Sbjct  516  VIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVTWKGFKVITAAAEAQPYTAGQFI  575

Query  362  SGSNW  376
             G  W
Sbjct  576  GGGGW  580



>ref|NP_001265901.1| pectinesterase 3-like [Cicer arietinum]
 emb|CAE76633.2| pectin methylesterase [Cicer arietinum]
Length=584

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A  DL+ ++  FPTYLGRPWKEYSRTV+MQSSISD
Sbjct  448  NMVTAQGRVDPNQNTGIVIQKCRIGATKDLEGLKGTFPTYLGRPWKEYSRTVIMQSSISD  507

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEW+G+FA+NTL Y E+ NTG GA TS+RV WKGFKVI SA+EAQ++T G FI
Sbjct  508  VIDPIGWHEWNGNFALNTLVYREYQNTGPGAGTSKRVNWKGFKVITSASEAQTFTPGNFI  567

Query  362  SGSNW  376
             GS W
Sbjct  568  GGSTW  572



>ref|XP_009117000.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS ISD
Sbjct  456  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQRVRSHFPTYLGRPWKEYSQTVIMQSDISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++N GAGA T++RVKW+GFKVI +A+EAQ YTAG+FI
Sbjct  516  VIRPEGWFEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASEAQRYTAGQFI  575

Query  362  SGSNW  376
             G  W
Sbjct  576  GGGGW  580



>ref|XP_006599763.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=492

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A  DL+ V+KNF TYLGRPWKEYSRTV+MQSSISD
Sbjct  356  NMVTAQGRVDPNQNTGIVIQKCRIGATKDLESVKKNFKTYLGRPWKEYSRTVIMQSSISD  415

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSG+FA++TL Y E+ NTG GA TS RV WKG+KVI  A EA+ YT G FI
Sbjct  416  VIDPIGWHEWSGNFALSTLVYREYQNTGPGAGTSNRVTWKGYKVITDAAEARDYTPGSFI  475

Query  362  SGSNW  376
             GS+W
Sbjct  476  GGSSW  480



>ref|XP_004168887.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN58477.1| hypothetical protein Csa_3G646640 [Cucumis sativus]
Length=561

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI   SDL+PV  NFPT+LGRPW+ YSRTVVMQ+SIS+
Sbjct  425  NMVTAQGRTDPNQNTGIVIQKCRIGTTSDLRPVISNFPTFLGRPWQRYSRTVVMQTSISN  484

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWH W G+FA++TLFY E+ N+GAGA TS+RVKWKGF+V+  A EA+++TAG FI
Sbjct  485  VIDPAGWHVWDGNFALDTLFYAEYQNSGAGADTSRRVKWKGFRVLTRAAEAEAFTAGNFI  544

Query  362  SGSNW  376
             G  W
Sbjct  545  GGGTW  549



>ref|XP_004144447.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
Length=556

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI   SDL+PV  NFPT+LGRPW+ YSRTVVMQ+SIS+
Sbjct  420  NMVTAQGRTDPNQNTGIVIQKCRIGTTSDLRPVISNFPTFLGRPWQRYSRTVVMQTSISN  479

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWH W G+FA++TLFY E+ N+GAGA TS+RVKWKGF+V+  A EA+++TAG FI
Sbjct  480  VIDPAGWHVWDGNFALDTLFYAEYQNSGAGADTSRRVKWKGFRVLTRAAEAEAFTAGNFI  539

Query  362  SGSNW  376
             G  W
Sbjct  540  GGGTW  544



>ref|XP_002885033.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61292.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS+ISD
Sbjct  454  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTYLGRPWKEYSQTVIMQSAISD  513

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++NTGAGA T+ RVKW GFKVI +A EAQ YTAG+FI
Sbjct  514  VIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWGGFKVITAAAEAQKYTAGQFI  573

Query  362  SGSNW  376
             G  W
Sbjct  574  GGGGW  578



>gb|EYU29496.1| hypothetical protein MIMGU_mgv1a003055mg [Erythranthe guttata]
Length=611

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL+PVQ +FPTYLGRPWKEYSRTVVMQS IS+
Sbjct  475  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLRPVQSSFPTYLGRPWKEYSRTVVMQSEISN  534

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW  W G+FA+NTLFY E+ NTGAGA T  RV W+GF+V+ SA++A  +TAG FI
Sbjct  535  VINPAGWFMWDGNFALNTLFYAEYQNTGAGAGTGSRVTWRGFRVLTSASQATPFTAGNFI  594

Query  362  SGSNW  376
             G NW
Sbjct  595  GGGNW  599



>emb|CDY33229.1| BnaC01g37020D [Brassica napus]
Length=570

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+  FPTYLGRPWKEYS+TV+MQS ISD
Sbjct  434  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQRVRSYFPTYLGRPWKEYSQTVIMQSDISD  493

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++N GAGA T++RVKW+GFKVI +A+EAQ YTAG+FI
Sbjct  494  VIRPEGWFEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASEAQRYTAGQFI  553

Query  362  SGSNW  376
             G  W
Sbjct  554  GGRGW  558



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL  V+ +F +YLGRPWK+YSRTV+MQS+ISD
Sbjct  437  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFASYLGRPWKQYSRTVIMQSNISD  496

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H AGW EW+G FA++TL Y EH NTGAGA TS RV WKG+KVIAS TEAQ YTAG FI
Sbjct  497  IIHPAGWFEWNGPFALDTLTYREHQNTGAGAGTSNRVTWKGYKVIASVTEAQGYTAGNFI  556

Query  362  SGSNW  376
            +G +W
Sbjct  557  AGGSW  561



>ref|XP_008460358.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=559

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI   SDL+PV  NFPT+LGRPW+ YSRTVVMQ+SIS+
Sbjct  423  NMVTAQGRTDPNQNTGIVIQKCRIGTTSDLRPVISNFPTFLGRPWQRYSRTVVMQTSISN  482

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWH W G+FA++TLFY E+ N+GAGA TS+RV+WKGF+V+  A EA+++TAG FI
Sbjct  483  VIDPAGWHVWDGNFALDTLFYAEYQNSGAGADTSRRVRWKGFRVLTRAAEAEAFTAGNFI  542

Query  362  SGSNW  376
             G  W
Sbjct  543  GGGTW  547



>ref|XP_009146386.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Brassica 
rapa]
Length=592

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS+ISD
Sbjct  456  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTYLGRPWKEYSQTVIMQSAISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++NTG GA T+ RV WKGFKVI +A EAQ YTAG+FI
Sbjct  516  VIRPEGWSEWTGTFALNTLTYREYANTGTGAGTANRVTWKGFKVITAAAEAQPYTAGQFI  575

Query  362  SGSNW  376
             G  W
Sbjct  576  GGGGW  580



>emb|CDX98441.1| BnaC05g39340D [Brassica napus]
Length=572

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS+ISD
Sbjct  436  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTYLGRPWKEYSQTVIMQSAISD  495

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA++TL Y E++NTGAGA T+ RV WKGFKVI +A EAQ YTAG+FI
Sbjct  496  VIRPEGWSEWTGTFALSTLTYREYANTGAGAGTANRVTWKGFKVITAAAEAQPYTAGQFI  555

Query  362  SGSNW  376
             G  W
Sbjct  556  GGGGW  560



>ref|XP_006452919.1| hypothetical protein CICLE_v10007806mg [Citrus clementina]
 gb|ESR66159.1| hypothetical protein CICLE_v10007806mg [Citrus clementina]
Length=594

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL  V+ +F TYLGRPWK YSRTVVMQS ISD
Sbjct  458  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISD  517

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW+EWSG+FA++TLFY E+ NTGAGA TS RVKW  FKVI SA EAQ+YTA  FI
Sbjct  518  VINPAGWYEWSGNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFI  577

Query  362  SGSNW  376
            +GS W
Sbjct  578  AGSTW  582



>ref|XP_009116991.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+Q+CRI A SDL+PV+ +FPTYLGRPWKEYS+TV+MQS ISD
Sbjct  456  NMVTAQGRTDPNQNTGIVIQRCRIGATSDLQPVKGSFPTYLGRPWKEYSQTVIMQSDISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++N GAGA T++RVKW+GFKVI +A+EAQ YTAG+FI
Sbjct  516  VIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASEAQRYTAGQFI  575



>emb|CDY60700.1| BnaA01g37100D [Brassica napus]
Length=556

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N++TAQGRTDPNQNTGI++QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS ISD
Sbjct  420  NIVTAQGRTDPNQNTGIIIQKCRIGATSDLQRVRSHFPTYLGRPWKEYSQTVIMQSDISD  479

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++N GAGA T++RVKW+GFKVI +A+EAQ YTAG+FI
Sbjct  480  VIRPEGWFEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASEAQRYTAGQFI  539

Query  362  SGSNW  376
             G  W
Sbjct  540  GGGGW  544



>emb|CDY39109.1| BnaA01g29470D [Brassica napus]
Length=558

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+Q+CRI A SDL+PV+ +FPTYLGRPWKEYS+TV+MQS ISD
Sbjct  422  NMVTAQGRTDPNQNTGIVIQRCRIGATSDLQPVKGSFPTYLGRPWKEYSQTVIMQSDISD  481

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++N GAGA T++RVKW+GFKVI +A+EAQ YTAG+FI
Sbjct  482  VIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASEAQRYTAGQFI  541



>ref|NP_001275846.1| putative thermostable pectinesterase [Citrus sinensis]
 gb|AAK84485.1| putative thermostable pectinesterase [Citrus sinensis]
 gb|AAK84486.1| putative thermostable pectinesterase [Citrus sinensis]
Length=631

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL  V+ +F TYLGRPWK YSRTVVMQS ISD
Sbjct  495  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISD  554

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW+EWSG+FA++TLFY E+ NTGAGA TS RVKW  FKVI SA EAQ+YTA  FI
Sbjct  555  VINPAGWYEWSGNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFI  614

Query  362  SGSNW  376
            +GS W
Sbjct  615  AGSTW  619



>gb|AAG17110.1|AF188895_1 putative pectin methylesterase 3 [Linum usitatissimum]
Length=555

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTA GRTDPNQNTGIV+QK RIAA SDL+ V+ +F TYLGRPWK Y+RTV+MQS+ISD
Sbjct  419  NMLTAHGRTDPNQNTGIVIQKSRIAATSDLQSVKGSFGTYLGRPWKAYARTVIMQSTISD  478

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VVH AGWHEW G+FA+NTLFYGEH N+GAG+  + RVKWKG KVI+S  EA  +T GRFI
Sbjct  479  VVHPAGWHEWDGNFALNTLFYGEHKNSGAGSGVNGRVKWKGHKVISSDAEAAGFTPGRFI  538

Query  362  SGSNW  376
            +G +W
Sbjct  539  AGGSW  543



>ref|XP_006297218.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
 gb|EOA30116.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
Length=623

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL+ V+ +FPTYLGRPWKEYS+TV+MQS+ISD
Sbjct  487  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLQAVKGSFPTYLGRPWKEYSQTVIMQSAISD  546

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++NTGAGA T+ RVKW+GFKVI +A EAQ YTA +FI
Sbjct  547  VIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWRGFKVITAAAEAQKYTASQFI  606

Query  362  SGSNW  376
             G  W
Sbjct  607  GGGGW  611



>ref|XP_006407094.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
 gb|ESQ48547.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
Length=592

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SDL  V+ +FPT+LGRPWKEYS+TV+MQS ISD
Sbjct  456  NMVTAQGRTDPNQNTGIVIQKCRIGATSDLLSVKSSFPTFLGRPWKEYSQTVIMQSDISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++N GAGA T+ RVKWKGFKVI +A EAQ YTAG+FI
Sbjct  516  VIRPEGWSEWTGTFALNTLTYREYANRGAGAGTANRVKWKGFKVITAAAEAQRYTAGQFI  575

Query  362  SGSNW  376
             G  W
Sbjct  576  GGGGW  580



>gb|KDO73733.1| hypothetical protein CISIN_1g008261mg [Citrus sinensis]
Length=572

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL  V+ +F TYLGRPWK YSRTVVMQS ISD
Sbjct  436  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISD  495

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW+EWSG+FA++TLFY E+ NTGAGA TS RVKW  FKVI +A EAQ+YTA  FI
Sbjct  496  VINPAGWYEWSGNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITNAAEAQTYTAANFI  555

Query  362  SGSNW  376
            +GS W
Sbjct  556  AGSTW  560



>emb|CDY02461.1| BnaA08g00680D [Brassica napus]
Length=336

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+Q+CRI   SDL+ V+ +FPTYLGRPWKEYS+TV+MQS ISD
Sbjct  200  NMVTAQGRTDPNQNTGIVIQRCRIGVTSDLQSVKGSFPTYLGRPWKEYSQTVIMQSDISD  259

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++N GAGA T++RVKW+GFKVI +A+EAQ YTAG+FI
Sbjct  260  VIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITAASEAQRYTAGQFI  319



>gb|KDP33985.1| hypothetical protein JCGZ_07556 [Jatropha curcas]
Length=583

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A  DL+ V+ +FPTYLGRPWK YSRTV+MQ+ I+D
Sbjct  447  NMVTAQGRTDPNQNTGIVIQKCRIGATQDLQAVKSSFPTYLGRPWKLYSRTVIMQTDIND  506

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW EW G+FA++TL Y E+ NTGAG+ T+ RV WKGFKV+ SATEAQ YTAG FI
Sbjct  507  VINPAGWFEWDGNFALDTLTYREYQNTGAGSDTANRVNWKGFKVMTSATEAQPYTAGNFI  566

Query  362  SGSNW  376
            +G NW
Sbjct  567  AGGNW  571



>ref|XP_006392745.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
 gb|ESQ30031.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
Length=584

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q CRI A SDL  V+ +FPTYLGRPWK+YSRTV+MQS ISD
Sbjct  448  NMVTAQGRSDPNQNTGIVIQNCRIGATSDLLAVKGSFPTYLGRPWKQYSRTVIMQSDISD  507

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGW EWSGSFA++TL Y E+ N G GA T+ RVKWKGFKVI S TEA+ YTAG+FI
Sbjct  508  VIRPAGWLEWSGSFALDTLTYREYLNRGGGAGTANRVKWKGFKVITSVTEAEQYTAGQFI  567

Query  362  SGSNW  376
             G +W
Sbjct  568  GGGSW  572



>gb|KFK35693.1| hypothetical protein AALP_AA4G024900 [Arabis alpina]
Length=588

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q CRI A SDL  V+ +FPTYLGRPWKEYSRTV+MQS ISD
Sbjct  452  NMVTAQGRSDPNQNTGIVIQNCRIGATSDLLAVKGSFPTYLGRPWKEYSRTVIMQSEISD  511

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSGSFA++TL Y E+ N+GAGA T+ RVKWKGF+VI S T+AQ YTAG+FI
Sbjct  512  VIRPEGWHEWSGSFALDTLTYREYLNSGAGAGTANRVKWKGFEVITSVTDAQQYTAGQFI  571



>ref|XP_010479961.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q CRI  + DL  V++ FPTYLGRPWKEYSRTV+MQS+ISD
Sbjct  458  NMVTAQGRSDPNQNTGIVIQNCRIGGSPDLLAVKETFPTYLGRPWKEYSRTVIMQSAISD  517

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGW EWSGSFA++TL Y E+ N GAGA T+ RV WKGFKVI S TEAQ YTAG+FI
Sbjct  518  VIRPAGWLEWSGSFALDTLTYREYLNRGAGAGTANRVTWKGFKVITSVTEAQQYTAGQFI  577

Query  362  SGSNW  376
             G  W
Sbjct  578  GGGGW  582



>ref|XP_010029511.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=577

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRIA  +DL+ V+ +FPTYLGRPWKEYSRTV+MQSSISD
Sbjct  442  NMVTAQGRIDPNQNTGIVIQKCRIAETNDLQSVKSSFPTYLGRPWKEYSRTVIMQSSISD  501

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWH+W+G+FA++TL+YGE+ NTG GA  S+RV W G+KVI +ATEAQ +TA  FI
Sbjct  502  VIDEVGWHDWNGTFALDTLYYGEYQNTGTGAGISKRVNWTGYKVI-TATEAQGFTAANFI  560

Query  362  SGSNW  376
            SG +W
Sbjct  561  SGGSW  565



>ref|XP_010462289.1| PREDICTED: pectinesterase 2 [Camelina sativa]
Length=584

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q CRI    DL  V++ FPTYLGRPWKEYSRTV+MQS+ISD
Sbjct  448  NMVTAQGRSDPNQNTGIVIQNCRIGGTPDLLAVKETFPTYLGRPWKEYSRTVIMQSAISD  507

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGW EWSGSFA++TL Y E+ N GAGA T+ RV WKGFKVI S TEAQ YTAG+FI
Sbjct  508  VIRPAGWLEWSGSFALDTLTYREYLNRGAGAGTANRVTWKGFKVITSVTEAQQYTAGQFI  567

Query  362  SGSNW  376
             G  W
Sbjct  568  GGGGW  572



>ref|XP_009135376.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=591

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+Q CRI A SDL  V+ +FPTYLGRPWKEYS TV+MQS ISD
Sbjct  455  NMVTAQGRTDPNQNTGIVIQNCRIGATSDLLSVKSSFPTYLGRPWKEYSHTVIMQSDISD  514

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EWSG+FA+NTL Y E++NTGAGA T  RVKWK FKVI  A EA+ YTAG+FI
Sbjct  515  VIRPEGWFEWSGTFALNTLTYREYANTGAGAGTGDRVKWKDFKVITDAAEAEPYTAGQFI  574

Query  362  SGSNW  376
             G  W
Sbjct  575  GGGGW  579



>ref|XP_003528739.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=598

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A +DL+ V+KNF TYLGRPWKEYSRTV+MQSSISD
Sbjct  462  NMVTAQGRVDPNQNTGIVIQKCRIGATNDLESVKKNFKTYLGRPWKEYSRTVIMQSSISD  521

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSG+F ++TL Y E+ NTG GA TS RV WKG+KVI    EA+ YT G FI
Sbjct  522  VIDPIGWHEWSGNFGLSTLVYREYQNTGPGAGTSNRVTWKGYKVITDTAEAREYTPGSFI  581

Query  362  SGSNW  376
             GS+W
Sbjct  582  GGSSW  586



>ref|NP_175786.1| pectin methylesterase 2 [Arabidopsis thaliana]
 sp|Q42534.2|PME2_ARATH RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase 2; Short=AtPME2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02856.1|AC009324_5 pectinesterase 2 [Arabidopsis thaliana]
 gb|AAK32805.1|AF361637_1 At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AAM91439.1| At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AEE33007.1| pectin methylesterase 2 [Arabidopsis thaliana]
Length=587

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q CRI   SDL  V+  FPTYLGRPWKEYSRTV+MQS ISD
Sbjct  451  NMVTAQGRSDPNQNTGIVIQNCRIGGTSDLLAVKGTFPTYLGRPWKEYSRTVIMQSDISD  510

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSGSFA++TL Y E+ N G GA T+ RVKWKG+KVI S TEAQ +TAG+FI
Sbjct  511  VIRPEGWHEWSGSFALDTLTYREYLNRGGGAGTANRVKWKGYKVITSDTEAQPFTAGQFI  570

Query  362  SGSNW  376
             G  W
Sbjct  571  GGGGW  575



>gb|AAC50023.1| ATPME2 precursor, partial [Arabidopsis thaliana]
Length=582

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q CRI   SDL  V+  FPTYLGRPWKEYSRTV+MQS ISD
Sbjct  446  NMVTAQGRSDPNQNTGIVIQNCRIGGTSDLLAVKGTFPTYLGRPWKEYSRTVIMQSDISD  505

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSGSFA++TL Y E+ N G GA T+ RVKWKG+KVI S TEAQ +TAG+FI
Sbjct  506  VIRPEGWHEWSGSFALDTLTYREYLNRGGGAGTANRVKWKGYKVITSDTEAQPFTAGQFI  565

Query  362  SGSNW  376
             G  W
Sbjct  566  GGGGW  570



>ref|XP_011048629.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=587

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DPNQNTGIV+QK RI A SDL PV+ NF  YLGRPWKEYSRTVVMQSSISDV+
Sbjct  453  ITAQGRSDPNQNTGIVIQKSRIHATSDLLPVRSNFSAYLGRPWKEYSRTVVMQSSISDVI  512

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            + AGW EW G +A+NTL+YGE++N+GAGAATS+RV WKG+KVI +ATEA+S+T   FI+G
Sbjct  513  NRAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWKGYKVITAATEAKSFTPRNFIAG  572

Query  368  SNW  376
              W
Sbjct  573  GTW  575



>ref|XP_006307088.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
 gb|EOA39986.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
Length=584

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q  RI    DL  V+  FPTYLGRPWK+YSRTV+MQS+ISD
Sbjct  448  NMVTAQGRSDPNQNTGIVIQNSRIGGTPDLSAVKGTFPTYLGRPWKQYSRTVIMQSAISD  507

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSGSFA++TL Y E+ N GAGA T+ RVKWKGFKVI S TEAQ YTAG+FI
Sbjct  508  VIRPEGWHEWSGSFALDTLTYREYLNRGAGAGTANRVKWKGFKVITSVTEAQQYTAGQFI  567

Query  362  SGSNW  376
             G+ W
Sbjct  568  GGAGW  572



>emb|CDY33228.1| BnaC01g37010D [Brassica napus]
Length=592

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+Q+CRI   SDL+ V+ +FPTYLGRPWKEYS+TV+MQS ISD
Sbjct  456  NMVTAQGRTDPNQNTGIVIQRCRIGVTSDLQSVKGSFPTYLGRPWKEYSQTVIMQSDISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EW+G+FA+NTL Y E++N GAGA T++RVKW+GFKVI +A+EAQ YTAG+FI
Sbjct  516  VIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWRGFKVITTASEAQRYTAGQFI  575



>ref|XP_010501045.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+  CRI    DL  V++ FPTYLGRPWKEYSRTV+MQS+ISD
Sbjct  458  NMVTAQGRSDPNQNTGIVIHNCRIGGTPDLLAVKETFPTYLGRPWKEYSRTVIMQSAISD  517

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGW EWSGSFA++TL Y E+ N GAGA T+ RV WKGFKVI S TEAQ YTAG+FI
Sbjct  518  VIRPAGWLEWSGSFALDTLTYREYLNRGAGAGTANRVTWKGFKVITSITEAQQYTAGQFI  577

Query  362  SGSNW  376
             G  W
Sbjct  578  GGGGW  582



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGRTDPNQNTGI +QKC++AAASDL  VQ +F TYLGRPWK+YSRTV +QS +  
Sbjct  90   NIYTAQGRTDPNQNTGISIQKCKVAAASDLAAVQTSFRTYLGRPWKQYSRTVYLQSELDS  149

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VV   GW EW G+FA++TL+YGE+ NTGAGA+TS RVKWKG++VI+S++EA ++T G FI
Sbjct  150  VVDPKGWLEWDGTFALDTLYYGEYQNTGAGASTSNRVKWKGYRVISSSSEASTFTVGSFI  209

Query  362  SGSNW  376
             G  W
Sbjct  210  DGDVW  214



>gb|KDP33984.1| hypothetical protein JCGZ_07555 [Jatropha curcas]
Length=583

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGRTDPN+NTGIV+Q CRI A  DL+ V+ +FPTYLGRPWK YSRT+VMQ+ ISD
Sbjct  447  NMLTAQGRTDPNENTGIVIQNCRIGATKDLEEVKSSFPTYLGRPWKLYSRTIVMQTYISD  506

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H AGW+EW G+FA++TL Y E+ NTG GA T+ RV WKGFKV+ SA+EA+ YTA  FI
Sbjct  507  IIHPAGWYEWDGNFALDTLTYREYQNTGEGANTANRVNWKGFKVMTSASEARPYTAENFI  566

Query  362  SGSNW  376
            +GS+W
Sbjct  567  AGSSW  571



>ref|XP_007135363.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
 gb|ESW07357.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
Length=1192

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL+ V+K+F TYLGRPWKEYSRTV+MQSSISD
Sbjct  475  NMVTAQGRVDPNQNTGIVIQKCRIGATSDLESVKKSFKTYLGRPWKEYSRTVIMQSSISD  534

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSG+FA++TL Y E+ NTG GA TS RV WKGF+VI  A EA+++T G FI
Sbjct  535  VIDPVGWHEWSGNFALSTLVYREYQNTGPGAGTSSRVSWKGFQVITDAGEARAFTPGSFI  594

Query  362  SGSNW  376
             GS+W
Sbjct  595  GGSSW  599


 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 78/128 (61%), Gaps = 9/128 (7%)
 Frame = +2

Query  2     NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNF--PTYLGRPWKEYSRTVVMQSSI  175
             N +TAQG+ DPNQNTGI++QK      S + P   N   PTYLGRPWK++S TV+MQS I
Sbjct  1059  NTITAQGKKDPNQNTGIIIQK------STITPFGNNLTAPTYLGRPWKDFSTTVIMQSDI  1112

Query  176   SDVVHIAGWHEWSGSF-AVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAG  352
               +++  GW  W  +     T+FY E+ N+G GA  SQRVKW G+K   +   A+ +T  
Sbjct  1113  GALLNPVGWMSWVPNVEPPTTIFYAEYQNSGPGADVSQRVKWAGYKPTITDRNAEEFTVQ  1172

Query  353   RFISGSNW  376
              FI G  W
Sbjct  1173  SFIQGPEW  1180



>ref|XP_011072691.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=551

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 103/125 (82%), Gaps = 13/125 (10%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+QKCRI A SD              PWKEYSRTVVMQSSI+D
Sbjct  428  NMVTAQGRTDPNQNTGIVIQKCRIGATSDW-------------PWKEYSRTVVMQSSITD  474

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEW+G+FA+NTLFYGE+ NTGAGA+TS RV+W+GFKVI SATEAQSYTAGRFI
Sbjct  475  VIDPAGWHEWNGNFALNTLFYGEYQNTGAGASTSGRVRWRGFKVITSATEAQSYTAGRFI  534

Query  362  SGSNW  376
            +G +W
Sbjct  535  AGGSW  539



>ref|XP_006369081.1| hypothetical protein POPTR_0001s16280g [Populus trichocarpa]
 gb|ERP65650.1| hypothetical protein POPTR_0001s16280g [Populus trichocarpa]
Length=623

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+D NQNTGIV+QK RI A SDL PV+ NF  YLGRPWKEYSRTVVMQSSISDV+
Sbjct  489  ITAQGRSDLNQNTGIVIQKSRIHATSDLLPVRSNFSAYLGRPWKEYSRTVVMQSSISDVI  548

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            + AGW EW G +A+NTL+YGE++N+GAGAATS+RV WKG+KVI +ATEA+S+T   FI+G
Sbjct  549  NPAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWKGYKVITAATEAKSFTPRNFIAG  608

Query  368  SNW  376
            S W
Sbjct  609  STW  611



>ref|XP_006372149.1| hypothetical protein POPTR_0018s12530g [Populus trichocarpa]
 gb|ERP49946.1| hypothetical protein POPTR_0018s12530g [Populus trichocarpa]
Length=623

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+D NQNTGIV+QK RI A SDL PV+ NF  YLGRPWKEYSRTVVMQSSISDV+
Sbjct  489  ITAQGRSDLNQNTGIVIQKSRIHATSDLLPVRSNFSAYLGRPWKEYSRTVVMQSSISDVI  548

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            + AGW EW G +A+NTL+YGE++N+GAGAATS+RV WKG+KVI +ATEA+S+T   FI+G
Sbjct  549  NPAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWKGYKVITAATEAKSFTPRNFIAG  608

Query  368  SNW  376
            S W
Sbjct  609  STW  611



>ref|XP_006369080.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP65649.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=623

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+D NQNTGIV+QK RI A SDL PV+ NF  YLGRPWKEYSRTVVMQSSISDV+
Sbjct  489  ITAQGRSDLNQNTGIVIQKSRIHATSDLLPVRSNFSAYLGRPWKEYSRTVVMQSSISDVI  548

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            + AGW EW G +A+NTL+YGE++N+GAGAATS+RV WKG+KVI +ATEA+S+T   FI+G
Sbjct  549  NPAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWKGYKVITAATEAKSFTPRNFIAG  608

Query  368  SNW  376
            S W
Sbjct  609  STW  611



>ref|XP_002891774.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68033.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q CRI   SDL  V+  FPTYLGRPWKEYSRTV+MQS ISD
Sbjct  450  NMVTAQGRSDPNQNTGIVIQNCRIGGTSDLLAVKGTFPTYLGRPWKEYSRTVIMQSDISD  509

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EWSGSFA++TL Y E+ N G GA T+ RV WKGFKVI S TEAQ +TAG+FI
Sbjct  510  VIRPEGWLEWSGSFALDTLTYREYLNRGGGAGTTNRVTWKGFKVITSDTEAQQFTAGQFI  569

Query  362  SGSNW  376
             G  W
Sbjct  570  GGGGW  574



>ref|NP_001042866.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAD45460.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04780.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAG97493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +QKC++AAASDL  VQ +F TYLGRPWK+YSRTV MQS +  
Sbjct  290  NVYTAQGREDPNQNTGISIQKCKVAAASDLLAVQSSFKTYLGRPWKQYSRTVFMQSELDS  349

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VV+ AGW EWSG+FA++TL+YGE+ NTG GA+TS RVKWKG++VI SA+EA ++T G FI
Sbjct  350  VVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWKGYRVITSASEASTFTVGNFI  409

Query  362  SGSNW  376
             G  W
Sbjct  410  DGDVW  414



>ref|XP_006389476.1| hypothetical protein POPTR_0022s002002g, partial [Populus trichocarpa]
 gb|ERP48390.1| hypothetical protein POPTR_0022s002002g, partial [Populus trichocarpa]
Length=255

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DPNQNTGIV+QK RI A  DL+  + NF  YLGRPWKEYSRTV+MQSSISDV+
Sbjct  121  ITAQGRSDPNQNTGIVIQKSRIGATPDLQHARSNFSAYLGRPWKEYSRTVIMQSSISDVI  180

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
              AGW EW G FA+NTL + E+ N+GAGA T+ RV WKG+KVI  ATEAQ++TA  FI+G
Sbjct  181  SPAGWREWKGRFALNTLHFAEYENSGAGAGTAGRVPWKGYKVITDATEAQAFTARNFITG  240

Query  368  SNW  376
            S+W
Sbjct  241  SSW  243



>ref|XP_009409132.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=568

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TA GR DPN+ TGIV+ + RI AA DL PVQ +F TYLGRPWKEY+RTV+M+S ISD
Sbjct  430  NMVTASGRDDPNEPTGIVIHRSRITAAPDLAPVQGSFRTYLGRPWKEYARTVIMESEISD  489

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWHEWSG+FA++TL+YGE+ NTGAGA T  RV+WKG+KVI SA EA  +T G FI
Sbjct  490  VIEPEGWHEWSGTFALDTLYYGEYRNTGAGAGTGSRVQWKGYKVITSAAEAAEFTPGSFI  549

Query  362  SGSNW  376
            +GS+W
Sbjct  550  AGSSW  554



>emb|CAC18725.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=588

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DPNQ TGIV+QK RI A SDL PV+ NF  YLGRPWKE+SRTVVMQSSISDV+
Sbjct  454  ITAQGRSDPNQKTGIVIQKSRIHATSDLLPVRSNFSAYLGRPWKEHSRTVVMQSSISDVI  513

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            + AGW EW G +A+NTL+YGE++N+GAGAATS+RV WKG+KVI +  EA+S+T   FI+G
Sbjct  514  NRAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVTWKGYKVITATAEAKSFTPRNFIAG  573

Query  368  SNW  376
            S W
Sbjct  574  STW  576



>emb|CDY51798.1| BnaC06g41940D [Brassica napus]
Length=585

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q C+I A SDL  V+ +F TYLGRPWK+YSRTV+MQS ISD
Sbjct  449  NMVTAQGRSDPNQNTGIVIQNCKIGATSDLMAVKGSFSTYLGRPWKQYSRTVIMQSDISD  508

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EWSG FA++TL Y E+ N GAGA T+ RVKWKG++VI + TEAQ YTAG+FI
Sbjct  509  VIRPEGWLEWSGDFALDTLTYREYLNRGAGAGTANRVKWKGYQVITNVTEAQQYTAGQFI  568

Query  362  SGSNW  376
             G  W
Sbjct  569  GGEGW  573



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +QKC++AAASDL  VQ +F TYLGRPWK+YSRTV MQS +  
Sbjct  448  NVYTAQGREDPNQNTGISIQKCKVAAASDLLAVQSSFKTYLGRPWKQYSRTVFMQSELDS  507

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VV+ AGW EWSG+FA++TL+YGE+ NTG GA+TS RVKWKG++VI SA+EA ++T G FI
Sbjct  508  VVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWKGYRVITSASEASTFTVGNFI  567

Query  362  SGSNW  376
             G  W
Sbjct  568  DGDVW  572



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +QKC++AAASDL  VQ +F TYLGRPWK+YSRTV MQS +  
Sbjct  429  NVYTAQGREDPNQNTGISIQKCKVAAASDLLAVQSSFKTYLGRPWKQYSRTVFMQSELDS  488

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VV+ AGW EWSG+FA++TL+YGE+ NTG GA+TS RVKWKG++VI SA+EA ++T G FI
Sbjct  489  VVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWKGYRVITSASEASTFTVGNFI  548

Query  362  SGSNW  376
             G  W
Sbjct  549  DGDVW  553



>emb|CDY08206.1| BnaA05g14130D [Brassica napus]
Length=585

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q C+I A SDL  V+ +F TYLGRPWK+YSRTV+MQS ISD
Sbjct  449  NMVTAQGRSDPNQNTGIVIQNCKIGATSDLMAVKGSFSTYLGRPWKQYSRTVIMQSDISD  508

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EWSG FA++TL Y E+ N GAG+ T+ RVKWKG++VI + TEAQ YTAG+FI
Sbjct  509  VIRPEGWLEWSGDFALDTLTYREYLNRGAGSGTANRVKWKGYQVITNVTEAQQYTAGQFI  568

Query  362  SGSNW  376
             G  W
Sbjct  569  GGEGW  573



>ref|XP_010534984.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=567

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTGIV+Q CRI A  DL+  + +FPTYLGRPWK +SRTVVMQS ISD
Sbjct  431  NMVTAQGRTDPNQNTGIVIQNCRIGATLDLREAEDDFPTYLGRPWKRFSRTVVMQSDISD  490

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GWH W+G+FA++TL Y E++N G GA T  RV WKGF+VI    EA+ YTA RFI
Sbjct  491  VIRPEGWHLWNGNFALDTLIYREYANRGPGANTEFRVNWKGFEVITDPEEAEEYTADRFI  550

Query  362  SGSNW  376
             G++W
Sbjct  551  DGADW  555



>ref|XP_009123661.1| PREDICTED: pectinesterase 2 [Brassica rapa]
Length=604

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPNQNTGIV+Q C+I A SDL  V+ +F TYLGRPWK+YSRTV+MQS ISD
Sbjct  468  NMVTAQGRSDPNQNTGIVIQNCKIGATSDLMAVKGSFSTYLGRPWKQYSRTVIMQSDISD  527

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW EWSG FA++TL Y E+ N GAG+ T+ RVKWKG++VI + TEAQ YTAG+FI
Sbjct  528  VIRPEGWLEWSGDFALDTLTYREYLNRGAGSGTANRVKWKGYQVITNVTEAQQYTAGQFI  587

Query  362  SGSNW  376
             G  W
Sbjct  588  GGEGW  592



>ref|XP_002516188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46190.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=541

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A  DL+ V+ +F +YLGRPWK YSRTVVMQ+ ISD
Sbjct  405  NMVTAQGRDDPNQNTGIVIQKCRIGATQDLEAVKDSFQSYLGRPWKLYSRTVVMQTQISD  464

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EW G+FA++TL Y E+ NTG GA T+ RV WKG+KV+ SA+EA  YTA  FI
Sbjct  465  IINPAGWFEWDGNFALDTLTYREYQNTGPGANTANRVTWKGYKVMTSASEALPYTAENFI  524

Query  362  SGSNW  376
            SG+NW
Sbjct  525  SGANW  529



>ref|XP_006382081.1| hypothetical protein POPTR_0006s27270g [Populus trichocarpa]
 gb|ERP59878.1| hypothetical protein POPTR_0006s27270g [Populus trichocarpa]
Length=542

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DP QNTGIV+QKCRI   SDL PV+ NF  YLGRPWKEY+RTV+MQSSISDV+
Sbjct  408  ITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYARTVIMQSSISDVI  467

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            H AGW+   G FA++TL + E+ N+GAGA TS+RV W+G+K+I SATEAQS+T   FI+G
Sbjct  468  HPAGWNGLKGRFALSTLSFAEYENSGAGAGTSERVTWEGYKMITSATEAQSFTPRNFIAG  527

Query  368  SNW  376
            S+W
Sbjct  528  SSW  530



>ref|XP_002309641.2| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|EEE93164.2| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=567

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DP QNTGIV+QKCRI   SDL PV+ NF  YLGRPWKEY+RTV+MQSSISDV+
Sbjct  433  ITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYARTVIMQSSISDVI  492

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            H AGW+   G FA++TL + E+ N+GAGA TS+RV W+G+K+I SATEAQS+T   FI+G
Sbjct  493  HPAGWNGLKGRFALSTLSFAEYKNSGAGAGTSERVTWEGYKMITSATEAQSFTPRNFIAG  552

Query  368  SNW  376
            S+W
Sbjct  553  SSW  555



>ref|XP_010047425.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=585

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL  V+ +F TYLGRPWK YSRTV+MQ++ISD
Sbjct  450  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFQTYLGRPWKMYSRTVIMQTAISD  509

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++ AGW+EW+G+FA++TL+Y EH+NTG GA+T+ RV WKG++VI SA EAQ +TA +FI
Sbjct  510  VINPAGWYEWNGNFALDTLYYAEHANTGPGASTANRVTWKGYRVI-SAPEAQPFTANQFI  568

Query  362  SGSNW  376
               +W
Sbjct  569  VAGSW  573



>emb|CAC18727.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=536

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DPNQNTGIV+QK RI A  DL+  + NF  YLGRPWKEYSRTV+MQSSISDV+
Sbjct  402  ITAQGRSDPNQNTGIVIQKSRIGATPDLQHARSNFSVYLGRPWKEYSRTVIMQSSISDVI  461

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
              AGW EW G FA+NTL + E+ N+GAGA TS RV WKG+KVI  ATEAQ++TA  FI+G
Sbjct  462  SPAGWREWKGRFALNTLHFAEYENSGAGAGTSGRVPWKGYKVITDATEAQAFTARNFITG  521

Query  368  SNW  376
            S+W
Sbjct  522  SSW  524



>ref|XP_011039649.1| PREDICTED: pectinesterase-like isoform X2 [Populus euphratica]
Length=548

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DP QNTGIV+QKCRI   SDL PV+ NF  YLGRPWKEY+RTV+MQSSISDV+
Sbjct  414  ITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYARTVIMQSSISDVI  473

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            H AGW+   G FA++TL + E+ N+GAGA TS+RV W+G+K+I SATEAQS+T   FI+G
Sbjct  474  HPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWEGYKMITSATEAQSFTPRNFIAG  533

Query  368  SNW  376
            S+W
Sbjct  534  SSW  536



>emb|CBI24284.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C++ AASDLKPVQ +  TYLGRPWKEYSRTV +++ +  
Sbjct  123  NTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQGSVKTYLGRPWKEYSRTVFLKTYLDS  182

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG+FA+NTL+YGE+ NTG G++TS RVKW G+ VI S+TEA  +T G FI
Sbjct  183  LINSAGWLEWSGNFALNTLYYGEYMNTGDGSSTSGRVKWAGYHVITSSTEAAKFTVGNFI  242

Query  362  SGSNW  376
            SG++W
Sbjct  243  SGNSW  247



>ref|XP_011039648.1| PREDICTED: pectinesterase-like isoform X1 [Populus euphratica]
Length=548

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DP QNTGIV+QKCRI   SDL PV+ NF  YLGRPWKEY+RTV+MQSSISDV+
Sbjct  414  ITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYARTVIMQSSISDVI  473

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            H AGW+   G FA++TL + E+ N+GAGA TS+RV W+G+K+I SATEAQS+T   FI+G
Sbjct  474  HPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWEGYKMITSATEAQSFTPRNFIAG  533

Query  368  SNW  376
            S+W
Sbjct  534  SSW  536



>ref|XP_006645812.1| PREDICTED: pectinesterase 2-like [Oryza brachyantha]
Length=406

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N  TAQGR DPNQNTGI +QKC++AAASDL  VQ +F TYLGRPWK+YSRTV MQS +  
Sbjct  270  NAYTAQGREDPNQNTGISIQKCKVAAASDLAAVQSSFKTYLGRPWKQYSRTVFMQSQLDS  329

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VV+ AGW EW+G+FA++TL+YGE+ NTG GA+T+ RVKWKG++VI S++EA ++T G FI
Sbjct  330  VVNPAGWLEWNGNFALDTLYYGEYQNTGDGASTANRVKWKGYRVITSSSEASTFTVGSFI  389

Query  362  SGSNW  376
             G  W
Sbjct  390  DGDVW  394



>ref|XP_006387527.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP46441.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=542

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DP QNTGIV+QKCRI   SDL PV+ NF  YLGRPWKEY+RTV+MQSSISDV+
Sbjct  408  ITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYARTVIMQSSISDVI  467

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            H AGW+   G FA++TL + E+ N+GAGA TS+RV W+G+K+I SATEAQS+T   FI G
Sbjct  468  HPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWEGYKMITSATEAQSFTPRNFIGG  527

Query  368  SNW  376
            S+W
Sbjct  528  SSW  530



>ref|XP_006389479.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP48393.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DPNQNTGIV+QK RI A  DL+  + NF  YLGRPWKEYSRTV+MQSSISDV+
Sbjct  438  ITAQGRSDPNQNTGIVIQKSRIGATPDLQHARSNFSAYLGRPWKEYSRTVIMQSSISDVI  497

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
              AGW EW G FA+NTL + E+ N+GAGA TS RV WKG+KVI  ATEAQ++TA  FI+G
Sbjct  498  SPAGWREWKGRFALNTLHFAEYENSGAGAGTSGRVPWKGYKVITDATEAQAFTARNFITG  557

Query  368  SNW  376
            S+W
Sbjct  558  SSW  560



>ref|XP_011039646.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=548

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DP QNTGIV+QKCRI   SDL PV+ NF  YLGRPWKEY+RTV+MQSSISDV+
Sbjct  414  ITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRGNFSAYLGRPWKEYARTVIMQSSISDVI  473

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            H AGW+   G FA++TL + E+ N+GAGA TS+RV W+G+K+I SATEAQS+T   FI+G
Sbjct  474  HPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWEGYKMITSATEAQSFTPRNFIAG  533

Query  368  SNW  376
            S+W
Sbjct  534  SSW  536



>ref|XP_011039647.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=565

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DP QNTGIV+QKCRI   SDL PV+ NF  YLGRPWKEY+RTV+MQSSISDV+
Sbjct  431  ITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAYLGRPWKEYARTVIMQSSISDVI  490

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            H AGW+   G FA++TL + E+ N+GAGA TS+RV W+G+K+I SATEAQS+T   FI G
Sbjct  491  HPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWEGYKMITSATEAQSFTPRNFIGG  550

Query  368  SNW  376
            S+W
Sbjct  551  SSW  553



>ref|XP_010921648.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=240

 Score =   174 bits (441),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +QKC++AAASDL PVQ NF TYLGRPWK+YSRTV MQS +  
Sbjct  103  NIFTAQGREDPNQNTGISIQKCKVAAASDLIPVQSNFSTYLGRPWKQYSRTVFMQSYLGS  162

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EW G FA++TL+YGE+ N G G+ TS+RV W G++VI SA EA ++T   FI
Sbjct  163  LINPAGWLEWDGDFALSTLYYGEYMNLGPGSNTSRRVTWPGYRVITSAAEASNFTVQSFI  222

Query  362  SGSNW  376
             G  W
Sbjct  223  QGDQW  227



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +   R+ AASDLKPVQ +  TYLGRPWKEYSRTV M++ +  
Sbjct  123  NTITAQGRTDPNQNTGISILNSRVTAASDLKPVQSSVKTYLGRPWKEYSRTVFMKTFLDG  182

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW  WSG+FA+NTL+YGE++NTG G++T++RV WKG+ VI SATEA  +T G FI
Sbjct  183  LINPAGWMPWSGNFALNTLYYGEYANTGPGSSTAKRVNWKGYHVITSATEASKFTVGNFI  242

Query  362  SGSNW  376
            +GS+W
Sbjct  243  AGSSW  247



>ref|XP_008800483.1| PREDICTED: pectinesterase 3-like isoform X2 [Phoenix dactylifera]
Length=262

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TA GR DPN+ TGI + + RI AA DL+PV+ +F +YLGRPWKEYSR V+M+S ISD
Sbjct  124  NMVTADGRDDPNEPTGIAIHRSRITAAPDLEPVKSSFRSYLGRPWKEYSRAVIMESEISD  183

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEW+G F ++TL+YGE+ NTGAGA T+ RVKWKG++V+    EA+ +  G  +
Sbjct  184  VIDPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTADRVKWKGYRVLTDVQEAKQFAPGNLL  243

Query  362  SGSNW  376
             GSNW
Sbjct  244  GGSNW  248



>ref|XP_011003715.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=575

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DPNQNTGIV+QK RI A  DL+  + NF  YLGRPWKEYSRTV+MQSSISDV+
Sbjct  441  ITAQGRSDPNQNTGIVIQKSRIGATRDLQHARSNFSAYLGRPWKEYSRTVIMQSSISDVI  500

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
              AGW EW G FA++TL + E+ N+GAGA TS RV WKG+KVI  ATEAQ++TA  FI+G
Sbjct  501  SPAGWREWKGRFALDTLHFAEYENSGAGAGTSGRVPWKGYKVITDATEAQAFTARNFITG  560

Query  368  SNW  376
            S+W
Sbjct  561  SSW  563



>ref|XP_002516186.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=589

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A  DL+  + +F +YLGRPWK YSRTV+MQS ISD
Sbjct  453  NMVTAQGREDPNQNTGIVIQKCRIGATQDLEAAKNSFQSYLGRPWKLYSRTVIMQSQISD  512

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H AGW  W G+FA++TL Y E+ NTG GA T+ RV W G+KV+ SA+EA  YTAG FI
Sbjct  513  IIHPAGWFMWDGTFALDTLTYREYQNTGPGANTANRVTWMGYKVMTSASEALPYTAGNFI  572

Query  362  SGSNW  376
            SG NW
Sbjct  573  SGGNW  577



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N  TAQGRTDPNQNTGI +Q+C+++AASDL  VQ +F TYLGRPW++YSRTV M+S +  
Sbjct  425  NTYTAQGRTDPNQNTGISVQRCKVSAASDLAAVQSSFRTYLGRPWQQYSRTVFMESQMDS  484

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VV+ AGW EW+G+FA++TL+YGE+ NTGAGAATS RVKWKG++VI SA+EA ++T G FI
Sbjct  485  VVNPAGWLEWNGNFALDTLYYGEYQNTGAGAATSNRVKWKGYRVITSASEASAFTVGSFI  544

Query  362  SGSNW  376
             G  W
Sbjct  545  DGDVW  549



>ref|XP_010047423.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=578

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A SDL  V+ +F TYLGRPWK YSRTV+MQ+ ISD
Sbjct  443  NMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFQTYLGRPWKMYSRTVIMQTEISD  502

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V++  GW+EW G+FA++TL+Y EH+NTG GA+T+ RV WKG++VI SA EAQ +TA +FI
Sbjct  503  VINPTGWYEWDGNFALDTLYYAEHANTGPGASTANRVTWKGYRVI-SAPEAQPFTANQFI  561

Query  362  SGSNW  376
               +W
Sbjct  562  VAGSW  566



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +QKC + A+SDL+PV+ +FP+YLGRPWKEYSRTVVMQS+I D
Sbjct  411  NMVTAQGRTDPNQNTGTSIQKCDVIASSDLQPVKGSFPSYLGRPWKEYSRTVVMQSNIGD  470

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +  AGW  W G FA+ TL+YGE+ N GAGA TS+RVKW G+ VI SATEA+ +T    I
Sbjct  471  HIDPAGWSIWDGEFALKTLYYGEYMNKGAGAGTSKRVKWPGYHVITSATEAKKFTVAELI  530

Query  362  SGSNW  376
             G  W
Sbjct  531  QGGAW  535



>gb|AFB77928.1| pectin methylesterase [Gossypium hirsutum]
Length=567

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPN+NTGIV+QKCRI A SDL+ V+ +F TYLGRPWK +SRTV+MQS ISD
Sbjct  431  NMVTAQGRSDPNENTGIVIQKCRIGATSDLEAVKSDFETYLGRPWKTHSRTVIMQSVISD  490

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H AGW  W   FA++TL Y E+ NTG GA TS RV WKG+ VI + +EAQ+YTA  FI
Sbjct  491  IIHPAGWFPWDKDFALDTLTYREYQNTGPGANTSSRVTWKGYSVITNISEAQTYTARNFI  550

Query  362  SGSNW  376
             G+NW
Sbjct  551  GGANW  555



>gb|KHF97383.1| Pectinesterase/pectinesterase inhibitor U1 [Gossypium arboreum]
Length=567

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPN+NTGIV+QKCRI A SDL+ V+ +F TYLGRPWK +SRTV+MQS ISD
Sbjct  431  NMVTAQGRSDPNENTGIVIQKCRIGATSDLEAVKSDFETYLGRPWKTHSRTVIMQSVISD  490

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H AGW  W   FA++TL Y E+ NTG GA TS RV WKG+ VI + +EAQ+YTA  FI
Sbjct  491  IIHPAGWFPWDKDFALDTLTYREYQNTGPGANTSSRVTWKGYSVITNISEAQTYTARNFI  550

Query  362  SGSNW  376
             G+NW
Sbjct  551  GGANW  555



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+Q+CRI A SDL   + +F +YLGRPWK YSRTV+MQ+ ISD
Sbjct  429  NMVTAQGRDDPNQNTGIVIQRCRIGATSDLLEAKDSFESYLGRPWKMYSRTVIMQTVISD  488

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H AGW+ W G FA++TL+Y EH+NTG GA T+ RV WKG++VI SA+EAQ++T   FI
Sbjct  489  IIHPAGWYPWDGDFALDTLYYAEHANTGDGADTANRVTWKGYRVI-SASEAQAFTVDPFI  547

Query  362  SGSNW  376
            +G +W
Sbjct  548  TGGSW  552



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGRTDPNQNTGI +QKC++AAASDL  VQ +F TYLGRPWK+YSRTV MQS +  
Sbjct  430  NIYTAQGRTDPNQNTGISIQKCKVAAASDLAAVQSSFKTYLGRPWKQYSRTVFMQSELDS  489

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VV+ AGW  W G+FA++TL+YGE+ NTG GA TS RV WKG++VI SA+EA ++T G FI
Sbjct  490  VVNPAGWLAWDGTFALDTLYYGEYQNTGPGAGTSGRVTWKGYRVITSASEASTFTVGSFI  549

Query  362  SGSNW  376
             G  W
Sbjct  550  DGDVW  554



>ref|XP_006385198.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP62995.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DPNQNTGIV+QK RI A +DL+  + NF  YLGRPWKEYSRTV+MQSSISDV+
Sbjct  438  ITAQGRSDPNQNTGIVIQKSRIGATADLQHARSNFSAYLGRPWKEYSRTVIMQSSISDVI  497

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
              AGW EW G FA+NTL + E+ N+G GA T+ RV WKG+KVI  ATEAQ++TA  FI+G
Sbjct  498  SPAGWREWKGRFALNTLHFAEYENSGVGAGTAGRVPWKGYKVITDATEAQAFTARNFITG  557

Query  368  SNW  376
            S+W
Sbjct  558  SSW  560



>ref|XP_006385197.1| hypothetical protein POPTR_0003s00980g [Populus trichocarpa]
 gb|ERP62994.1| hypothetical protein POPTR_0003s00980g [Populus trichocarpa]
Length=572

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DPNQNTGIV+QK RI A +DL+  + NF  YLGRPWKEYSRTV+MQSSISDV+
Sbjct  438  ITAQGRSDPNQNTGIVIQKSRIGATADLQHARSNFSAYLGRPWKEYSRTVIMQSSISDVI  497

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
              AGW EW G FA+NTL + E+ N+GAGA T+ RV WKG+KVI   TEAQ++TA  FI+G
Sbjct  498  SPAGWREWKGRFALNTLHFAEYENSGAGAGTAGRVPWKGYKVITDTTEAQAFTARNFITG  557

Query  368  SNW  376
            S+W
Sbjct  558  SSW  560



>ref|XP_006371892.1| hypothetical protein POPTR_0018s05350g, partial [Populus trichocarpa]
 gb|ERP49689.1| hypothetical protein POPTR_0018s05350g, partial [Populus trichocarpa]
Length=229

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR+DPN+NTGIV+QKCRI A  DL   + +F +YLGRPWK YSRT+VMQ+ ISD
Sbjct  93   NMVTAQGRSDPNENTGIVIQKCRIGATQDLLAAKSSFRSYLGRPWKLYSRTIVMQTEISD  152

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW G FA++TL Y E+ NTG GA T+ RV WKGFKV+ SA E Q + A  FI
Sbjct  153  IIDPAGWFEWDGDFALDTLVYREYQNTGPGANTANRVNWKGFKVVTSAIEVQPFIARNFI  212

Query  362  SGSNW  376
             G++W
Sbjct  213  RGASW  217



>ref|XP_011047860.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=574

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DPNQNTGIV+QK RI A  DL+  + NF  YLGRPWKEYSRTV+MQSSISDV+
Sbjct  440  ITAQGRSDPNQNTGIVIQKSRIGATRDLQHARSNFSAYLGRPWKEYSRTVIMQSSISDVI  499

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
              AGW EW G FA++TL + E+ N+GAGA T+ RV WKG+KVI  ATEAQ++TA  FI+G
Sbjct  500  SPAGWREWKGRFALDTLHFAEYENSGAGAGTAGRVPWKGYKVITDATEAQAFTARNFITG  559

Query  368  SNW  376
            S+W
Sbjct  560  SSW  562



>emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera]
Length=512

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C++ AASDLKPVQ +  TYLGRPWKEYSRTV +++ +  
Sbjct  376  NTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQSSVKTYLGRPWKEYSRTVFLKTYLDS  435

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG FA+NTL+YGE+ NTG G++TS RVKW G+ VI S+TEA  +TAG FI
Sbjct  436  LINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTSGRVKWAGYHVITSSTEAAKFTAGNFI  495

Query  362  SGSNW  376
            SG++W
Sbjct  496  SGNSW  500



>ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=512

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C++ AASDLKPVQ +  TYLGRPWKEYSRTV +++ +  
Sbjct  376  NTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQSSVKTYLGRPWKEYSRTVFLKTYLDS  435

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG FA+NTL+YGE+ NTG G++TS RVKW G+ VI S+TEA  +TAG FI
Sbjct  436  LINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTSGRVKWAGYHVITSSTEAAKFTAGNFI  495

Query  362  SGSNW  376
            SG++W
Sbjct  496  SGNSW  500



>gb|EYU19222.1| hypothetical protein MIMGU_mgv1a003983mg [Erythranthe guttata]
Length=551

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +Q C I A++DL PV+ +FPTYLGRPWKEYSRTVVMQS+I D
Sbjct  415  NMVTAQGRTDPNQNTGTSIQDCEIIASADLAPVKGSFPTYLGRPWKEYSRTVVMQSTIGD  474

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EWSG FA+ TL+YGE+ N G GA TS+RV W G+ VI  A EA  +T    I
Sbjct  475  LIDPAGWAEWSGDFALKTLYYGEYMNKGGGAGTSKRVNWTGYHVITDAAEATKFTVKELI  534

Query  362  SGSNW  376
             G +W
Sbjct  535  QGGDW  539



>ref|XP_010088582.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB36723.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=658

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +  C I A+ DL+PV+ +FP+YLGRPWKEYSRTVVMQS I D
Sbjct  520  NMVTAQGRTDPNQNTGTSIHNCEIFASPDLEPVKDSFPSYLGRPWKEYSRTVVMQSYIGD  579

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW G FA+NTL+YGE++N G GA TS+RVKW G+ VI S  EAQ +T    I
Sbjct  580  LIDPAGWFEWDGDFALNTLYYGEYANRGPGAGTSKRVKWAGYHVITSPDEAQKFTVAELI  639

Query  362  SGSNW  376
             G  W
Sbjct  640  QGGPW  644



>ref|XP_009388374.1| PREDICTED: pectinesterase-like, partial [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI + KC++AAA+DL PVQ NF TYLGRPWKE+SRTV MQS + +
Sbjct  102  NVFTAQGREDPNQNTGISIHKCKVAAAADLIPVQSNFSTYLGRPWKEFSRTVFMQSYLDN  161

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW+G FA+NTL+YGE+ N G G+ T+ RVKW G++VI S  EA ++T   FI
Sbjct  162  LIDPAGWLEWNGDFALNTLYYGEYMNRGPGSNTTGRVKWPGYRVINSTAEASNFTVTSFI  221

Query  362  SGSNW  376
             G  W
Sbjct  222  QGDQW  226



>ref|XP_010101474.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88457.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=556

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +  C I A+ DL+PV+ +FP+YLGRPWKEYSRTVVMQS I D
Sbjct  418  NMVTAQGRTDPNQNTGTSIHNCEIFASPDLEPVKDSFPSYLGRPWKEYSRTVVMQSYIGD  477

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW G FA+NTL+YGE++N G GA TS+RVKW G+ VI S  EAQ +T    I
Sbjct  478  LIDPAGWFEWDGDFALNTLYYGEYANRGPGAGTSKRVKWVGYHVITSPDEAQKFTVVELI  537

Query  362  SGSNW  376
             G  W
Sbjct  538  QGGPW  542



>ref|XP_008386773.1| PREDICTED: pectinesterase-like, partial [Malus domestica]
Length=238

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +  C++ A SDL PV+ NF TYLGRPWKEYSRTV ++S I D
Sbjct  100  NIFTAQGREDPNQNTGISILNCKVTAGSDLIPVKSNFTTYLGRPWKEYSRTVYLKSYIDD  159

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EW+GSFA++TL+YGE+ N G G+ TS RV W G++VI S+ EA  +T G FI
Sbjct  160  LVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNTSARVTWPGYRVINSSVEASQFTVGEFI  219

Query  362  SGSNW  376
             GS+W
Sbjct  220  QGSDW  224



>emb|CAC18726.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=574

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGR+DPNQNTGIV+QK RI    DL+  + NF  +LGRPWKEYSRTV+MQSSISDV+
Sbjct  440  ITAQGRSDPNQNTGIVIQKSRIGGTPDLQHARSNFSAFLGRPWKEYSRTVIMQSSISDVI  499

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
              AGW EW G FA++TL + E+ N+GAGA TS RV WKG+KVI  ATEAQ++TA  FI+G
Sbjct  500  SPAGWREWKGRFALDTLHFAEYENSGAGAGTSGRVPWKGYKVITDATEAQAFTARNFITG  559

Query  368  SNW  376
            S+W
Sbjct  560  SSW  562



>gb|ABK94644.1| unknown [Populus trichocarpa]
Length=327

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +QKC I A+SDL PV+ +F ++LGRPWKEYSRTVVMQS+I D
Sbjct  191  NMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSFLGRPWKEYSRTVVMQSNIGD  250

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW  W G FA+ TL+YGE+ N GAGA TS+RV W G+ VI SA EA+ +T    I
Sbjct  251  LIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWAGYHVITSANEAKKFTVAELI  310

Query  362  SGSNW  376
             G  W
Sbjct  311  QGGVW  315



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +QKC I A+SDL PV+ +F +YLGRPWKEYSRTVVMQS+I D
Sbjct  421  NMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSYLGRPWKEYSRTVVMQSNIGD  480

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW  W G FA+ TL+YGE+ N GAGA TS+RVKW G+ VI SA EA+ +T    I
Sbjct  481  LIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVKWPGYHVITSANEAKKFTVAELI  540

Query  362  SGSNW  376
             G  W
Sbjct  541  QGGVW  545



>ref|XP_004155595.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cucumis 
sativus]
Length=555

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTG  +Q+C I A+SDL+PV+K+  TYLGRPWKEYSRTV+MQS I D
Sbjct  419  NMVTAQGRIDPNQNTGTSIQQCDIVASSDLEPVKKSIKTYLGRPWKEYSRTVIMQSRIGD  478

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW+G FA+ TL+YGE+SNTG G+  S+RVKW G+ +I S +EAQ +T    I
Sbjct  479  LIQPAGWAEWNGDFALKTLYYGEYSNTGPGSDVSKRVKWDGYHIITSPSEAQKFTVDSLI  538

Query  362  SGSNW  376
             G  W
Sbjct  539  QGGEW  543



>ref|XP_011012638.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=573

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPN+NTGIV+QKCRI A  DL   + NF +YLGRPWK YSRT++MQ+ ISD
Sbjct  437  NMVTAQGRNDPNENTGIVIQKCRIGATQDLLAEKSNFRSYLGRPWKLYSRTIIMQTEISD  496

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW G FA++TL Y E+ NTG GA T+ RV WKGFKV+ SATE Q +TA  F+
Sbjct  497  IIDPAGWFEWDGDFALDTLVYREYQNTGPGANTTIRVNWKGFKVVTSATEVQPFTARNFV  556

Query  362  SGSNW  376
             G++W
Sbjct  557  GGASW  561



>ref|XP_004134752.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cucumis 
sativus]
 gb|KGN49128.1| Pectinesterase [Cucumis sativus]
Length=555

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTG  +Q+C I A+SDL+PV+K+  TYLGRPWKEYSRTV+MQS I D
Sbjct  419  NMVTAQGRIDPNQNTGTSIQQCDIVASSDLEPVKKSIKTYLGRPWKEYSRTVIMQSRIGD  478

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW+G FA+ TL+YGE+SNTG G+  S+RVKW G+ +I S +EAQ +T    I
Sbjct  479  LIQPAGWAEWNGDFALKTLYYGEYSNTGPGSDVSKRVKWDGYHIITSPSEAQKFTVDSLI  538

Query  362  SGSNW  376
             G  W
Sbjct  539  QGGEW  543



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +Q C++AAA+DL PVQ +F  YLGRPWK+YSRT+ MQS I D
Sbjct  403  NLFTAQGRVDPNQNTGISIQNCKVAAAADLIPVQSSFKNYLGRPWKQYSRTIFMQSDIGD  462

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EWSG FA++TL+YGE+ N G GA TS RVKW G++VI S++EA  +T   FI
Sbjct  463  LIDPAGWFEWSGDFALSTLYYGEYMNRGPGADTSNRVKWPGYRVINSSSEASQFTVASFI  522

Query  362  SGSNW  376
             G+ W
Sbjct  523  QGNEW  527



>ref|XP_010937249.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=582

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TA GR DP++ TGI + + RI AA+DL+PV+ +F +YLGRPWKEYSRT++M+S I D
Sbjct  444  NMVTADGREDPDEPTGIAIHRSRITAAADLEPVKSSFRSYLGRPWKEYSRTLIMESEIGD  503

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEW+G F ++TL+YGE+ NTGAGA T+ RVKWKG +VI  A EA+ +T G F+
Sbjct  504  VIDPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTAGRVKWKGHEVITDAGEAEKFTPGNFL  563

Query  362  SGSNW  376
             GSNW
Sbjct  564  GGSNW  568



>gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTG  +QKC I A+SDL+PV+ +  +YLGRPWKEYSRTVVMQS+I+D
Sbjct  408  NMVTAQGRIDPNQNTGTSIQKCEIIASSDLEPVKSSVKSYLGRPWKEYSRTVVMQSNIAD  467

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +  AGW  W G FA+ TL+YGE+ N GAGA TS+RVKW G++VI SATEAQ +T    I
Sbjct  468  HIDPAGWSIWEGDFALKTLYYGEYMNRGAGAGTSKRVKWAGYRVITSATEAQKFTVAELI  527

Query  362  SGSNW  376
             G  W
Sbjct  528  QGGVW  532



>ref|XP_008439965.1| PREDICTED: pectinesterase [Cucumis melo]
Length=555

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTG  +Q+C I A+ DL+PV+K+  TYLGRPWKEYSRTVVMQS I D
Sbjct  419  NMVTAQGRIDPNQNTGTSIQQCDIVASFDLEPVKKSIKTYLGRPWKEYSRTVVMQSRIGD  478

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EWSG FA+ TL+YGE+SNTG G+  S+RVKW G+ VI S +EAQ +T    I
Sbjct  479  LIQPAGWAEWSGDFALKTLYYGEYSNTGPGSDVSKRVKWAGYHVITSPSEAQKFTVNSLI  538

Query  362  SGSNW  376
             G  W
Sbjct  539  QGGEW  543



>ref|XP_010939846.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=591

 Score =   176 bits (446),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TA GR DPN+ TGI + + RIAAA DL+PV+ +F +YLGRPWKE+SRTV+M+S I D
Sbjct  453  NMVTADGRDDPNEPTGITIHRSRIAAAPDLEPVKSSFRSYLGRPWKEHSRTVIMESDIGD  512

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEW+G FA++TL+YGE+ NTGAGA T+ RVKW G++V+    EA+ +T G  +
Sbjct  513  VIDPAGWHEWNGPFALDTLYYGEYKNTGAGAGTAGRVKWNGYRVLTDVREAEQFTPGNLL  572

Query  362  SGSNW  376
             GSNW
Sbjct  573  GGSNW  577



>ref|XP_010101471.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88454.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=552

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +QKC I+A+SDL+PV+ ++ +YLGRPWKEYSRTVVMQS+I D
Sbjct  416  NMVTAQGRTDPNQNTGTSIQKCEISASSDLEPVKASYKSYLGRPWKEYSRTVVMQSTIGD  475

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW   FA+ TL+YGE++N G GA TS+RV W G+ VI S +EAQ +T    I
Sbjct  476  LIDPAGWAEWDKDFALKTLYYGEYANQGPGAGTSKRVNWAGYHVITSPSEAQKFTVAELI  535

Query  362  SGSNW  376
             G  W
Sbjct  536  QGGYW  540



>ref|XP_011095339.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=550

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +Q C I A+ DL+PV+ +FPTYLGRPWKEYSRTVVMQS I D
Sbjct  414  NMVTAQGRTDPNQNTGTSIQDCEIRASEDLEPVKSSFPTYLGRPWKEYSRTVVMQSYIGD  473

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +   GW EWSG FA+ TL+YGE+ N G GA TS+RVKW G+ VI +A EA  +T    I
Sbjct  474  HIDPVGWSEWSGDFALKTLYYGEYMNKGPGAGTSKRVKWAGYHVITNAAEAAKFTVKELI  533

Query  362  SGSNW  376
             G  W
Sbjct  534  QGVEW  538



>ref|XP_008800482.1| PREDICTED: pectinesterase-like isoform X1 [Phoenix dactylifera]
Length=585

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TA GR DPN+ TGI + + RI AA DL+PV+ +F +YLGRPWKEYSR V+M+S ISD
Sbjct  447  NMVTADGRDDPNEPTGIAIHRSRITAAPDLEPVKSSFRSYLGRPWKEYSRAVIMESEISD  506

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGWHEW+G F ++TL+YGE+ NTGAGA T+ RVKWKG++V+    EA+ +  G  +
Sbjct  507  VIDPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTADRVKWKGYRVLTDVQEAKQFAPGNLL  566

Query  362  SGSNW  376
             GSNW
Sbjct  567  GGSNW  571



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +Q+C++AAA+DL PVQ NF TYLGRPWKEYSRTV MQS +  
Sbjct  430  NIFTAQGREDPNQNTGISIQRCKVAAAADLIPVQANFSTYLGRPWKEYSRTVFMQSYLDS  489

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW+GSFA++TL+YGE+ N G G+ TS RV W GF+VI  A EA ++TA  F+
Sbjct  490  LISPAGWLEWNGSFALSTLYYGEYMNRGPGSNTSSRVAWPGFRVIGDAAEASNFTAAAFV  549

Query  362  SGSNW  376
             G  W
Sbjct  550  QGDQW  554



>emb|CBI38888.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C++ AASDLK VQ +  TYLGRPWKEYSRTV M++ +  
Sbjct  123  NTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPWKEYSRTVFMKTYLDS  182

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG+FA+ TL+YGE+ NTG G++TS RV W G+ VI S++EA  +T G FI
Sbjct  183  LINPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVNWAGYHVITSSSEASKFTVGNFI  242

Query  362  SGSNW  376
            +G++W
Sbjct  243  AGNSW  247



>ref|XP_007213952.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
 gb|EMJ15151.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
Length=555

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTG  +QKC I A+SDL+PV+    +YLGRPWKEYSRTVVMQS I D
Sbjct  419  NMVTAQGRIDPNQNTGTSIQKCDIIASSDLEPVKGTIRSYLGRPWKEYSRTVVMQSKIGD  478

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +  +GW  WSG FA+ TL+YGE++N+GAGA TS+RVKW G+ VI S TEAQ++T  + I
Sbjct  479  HIDPSGWSIWSGDFALKTLYYGEYANSGAGAGTSKRVKWAGYHVITSPTEAQTFTVAQLI  538

Query  362  SGSNW  376
             G +W
Sbjct  539  QGGSW  543



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPN+NTGI +    + AASDLKPVQ +F TYLGRPW+EYSRTV M++S+  
Sbjct  380  NTVTAQGRTDPNENTGISIHDSAVTAASDLKPVQGSFETYLGRPWQEYSRTVFMKTSLDS  439

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EWSG+FA++TL+YGE+ NTG GA TSQRVKW G+ VI SA EA  +T G F+
Sbjct  440  LIDPAGWLEWSGNFALSTLYYGEYMNTGPGADTSQRVKWPGYHVITSAAEASKFTVGNFL  499

Query  362  SGSNW  376
            SG++W
Sbjct  500  SGNSW  504



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N++TAQGRTDPNQNTGI +  CR+ A+SDLKPVQ +F T+LGRPWKEYSRTV +Q+ +  
Sbjct  392  NVVTAQGRTDPNQNTGISIHNCRVMASSDLKPVQSSFKTFLGRPWKEYSRTVYLQTYLDT  451

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EWSG+FA+NTL+YGE+ N G  ++T++RVKW+G++VI + +EA  +T G FI
Sbjct  452  LVDPAGWMEWSGNFALNTLYYGEYRNFGPASSTARRVKWRGYRVITNPSEASRFTVGNFI  511

Query  362  SGSNW  376
            SG +W
Sbjct  512  SGGSW  516



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +QKC++AAASDL PVQ NF TYLGRPWK+YSRTV MQS +  
Sbjct  421  NIFTAQGREDPNQNTGISIQKCKVAAASDLIPVQSNFSTYLGRPWKQYSRTVFMQSFLGS  480

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW G FA++TL+YGE+ N G G+ TS+RV W G++VI SA EA ++T   FI
Sbjct  481  LIDPAGWLEWDGDFALSTLYYGEYMNQGPGSNTSRRVTWPGYRVITSAAEASNFTVASFI  540

Query  362  SGSNW  376
             G  W
Sbjct  541  QGDQW  545



>ref|XP_011017474.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  CR+ AASDLKPVQ +  TYLGRPWKEYSRTV M++ +  
Sbjct  378  NTITAQGRTDPNQNTGISIHNCRVTAASDLKPVQGSVKTYLGRPWKEYSRTVFMKTYLDS  437

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW  W+G+FA++TL+YGE+ NTG G++T+ RV WKG++VI S+T A  +T G FI
Sbjct  438  LINPAGWLPWNGNFALDTLYYGEYMNTGPGSSTANRVNWKGYRVITSSTVASQFTVGSFI  497

Query  362  SGSNW  376
            SG+NW
Sbjct  498  SGNNW  502



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM TAQGR DPNQNTGI +  C++AAASDL PV+  F TYLGRPWKEYSRTV M+S I D
Sbjct  424  NMFTAQGREDPNQNTGISILNCKVAAASDLVPVKSTFKTYLGRPWKEYSRTVYMKSYIDD  483

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EW+G+FA++TL+YGE+ N G G+ TS RVKW G++VI S+ EA  +T G FI
Sbjct  484  LVQPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVKWPGYRVINSSDEANQFTVGPFI  543

Query  362  SGSNW  376
             G+ W
Sbjct  544  QGNEW  548



>ref|XP_004971511.1| PREDICTED: pectinesterase 1-like [Setaria italica]
Length=428

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +Q+C++AAASDL   + +  TYLGRPWK+YSRTV +QS +  
Sbjct  292  NIFTAQGREDPNQNTGISIQRCKVAAASDLAGQESSTKTYLGRPWKQYSRTVFLQSELDS  351

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW+GSFA++TL+YGE+ NTGAGA T+ RVKWKG++VI SA EA ++T G FI
Sbjct  352  LIDPAGWLEWNGSFALDTLYYGEYMNTGAGAGTAGRVKWKGYRVITSAAEASAFTVGSFI  411

Query  362  SGSNW  376
             G  W
Sbjct  412  DGDVW  416



>ref|XP_008224789.1| PREDICTED: pectinesterase [Prunus mume]
Length=555

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTG  +QKC I A+SDL+PV+    +YLGRPWKEYSRTVVMQS I D
Sbjct  419  NMVTAQGRIDPNQNTGTSIQKCDIIASSDLEPVKGTIRSYLGRPWKEYSRTVVMQSKIGD  478

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +   GW  WSG FA+ TL+YGE++N+GAGA TS+RVKW G+ VI S TEAQ++T  + I
Sbjct  479  HIDPTGWSIWSGDFALKTLYYGEYANSGAGAGTSKRVKWAGYHVITSPTEAQNFTVAQLI  538

Query  362  SGSNW  376
             G +W
Sbjct  539  QGGSW  543



>gb|AAQ21125.1| pectinesterase [Fragaria x ananassa]
Length=193

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQ R DPN+NTGI++  CRI AA DL+ VQ +F TYLGRPW++YSR V+M+S++  
Sbjct  57   NTVTAQSRRDPNENTGIIIHNCRITAAPDLRAVQGSFRTYLGRPWQKYSRVVIMKSNLDG  116

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++   GW  WSGSF ++TL+YGE+ NTGAGAAT  RVKW GF+VI SATEA  +T G F+
Sbjct  117  LIAPQGWFPWSGSFGLDTLYYGEYMNTGAGAATGGRVKWPGFRVITSATEAGKFTVGNFL  176

Query  362  SGSNW  376
            +G  W
Sbjct  177  AGDAW  181



>ref|XP_004514851.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=515

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +   R+ AASDLKPVQ +  TYLGRPWK+YSRTV M++S+  
Sbjct  379  NTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQNSVKTYLGRPWKQYSRTVFMKTSLDS  438

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H AGW EWSG+FA++TL+YGE+ NTG G++T  RVKW+G+ VI  A+EA  +T G FI
Sbjct  439  LIHPAGWLEWSGNFALSTLYYGEYMNTGLGSSTRNRVKWQGYHVITRASEASKFTVGNFI  498

Query  362  SGSNW  376
            +G++W
Sbjct  499  AGNSW  503



>ref|XP_002317208.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE97820.1| pectin methylesterase family protein [Populus trichocarpa]
Length=549

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +QKC I A+SDL PV+ +F ++LGRPWKEYSRTVVMQS+I D
Sbjct  413  NMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSFLGRPWKEYSRTVVMQSNIGD  472

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW  W G FA+ TL+YGE+ N GAGA TS+RV W G+ VI SA EA+ +T    I
Sbjct  473  LIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWAGYHVITSANEAKKFTVAELI  532

Query  362  SGSNW  376
             G  W
Sbjct  533  QGGVW  537



>gb|EPS74082.1| hypothetical protein M569_00674, partial [Genlisea aurea]
Length=502

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+Q+  I   SDL PV KNFPTYLGRPWK+YSRTV+MQ++IS 
Sbjct  366  NMVTAQGREDPNQNTGIVIQRSTIDGTSDLLPVIKNFPTYLGRPWKQYSRTVIMQTTISA  425

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+   GW+ W G FA++TLFY E++NTG GA+T+ RV W GF V  S+++A+ YTA  FI
Sbjct  426  VIRPEGWYPWEGDFALSTLFYAEYANTGPGASTANRVNWVGFTVFTSSSQAKPYTAENFI  485

Query  362  SGSNW  376
              ++W
Sbjct  486  GANSW  490



>gb|ABK92615.1| unknown [Populus trichocarpa]
Length=144

 Score =   163 bits (412),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQ R DPNQNTGI +  C+I AASDL P +  FPTYLGRPWK YSRTV M S + D
Sbjct  6    NTITAQNRKDPNQNTGISIHACKILAASDLAPSKGTFPTYLGRPWKLYSRTVYMLSFMGD  65

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +H  GW EW  SFA++TL+YGE+ N G GAA  QRVKW G++VI S  EA  +T  +FI
Sbjct  66   HIHPRGWLEWDASFALDTLYYGEYMNYGPGAAVGQRVKWPGYRVITSTVEANKFTVAQFI  125

Query  362  SGSNW  376
             GS+W
Sbjct  126  YGSSW  130



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N++TAQGRTDPNQNTGI +   R+ AA DL PV   F T+LGRPWKEYSRTV MQ+ +  
Sbjct  382  NVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTFLGRPWKEYSRTVYMQTYLDS  441

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EWSG+FA+NTLFYGE+ N G  A+TS RVKW+G++VI SATEA  +T G FI
Sbjct  442  LVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWRGYRVITSATEASKFTVGSFI  501

Query  362  SGSNW  376
            +G++W
Sbjct  502  AGNSW  506



>emb|CBI24582.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N++TAQGRTDPNQNTGI +   R+ AA+DLKPV  +F TYLGRPWKEYSRTV + + +  
Sbjct  124  NVVTAQGRTDPNQNTGISIHNSRVMAATDLKPVLSSFKTYLGRPWKEYSRTVYLGTYLDT  183

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EW G+FA+NTL+YGE+ N G G++TS RVKW+G++VI SATEA  ++   FI
Sbjct  184  LVDSAGWLEWDGNFALNTLYYGEYKNFGPGSSTSGRVKWRGYRVITSATEASKFSVANFI  243

Query  362  SGSNW  376
            +G +W
Sbjct  244  AGQSW  248



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N++TAQGRTDPNQNTGI +   R+ AA DL PV   F T+LGRPWKEYSRTV MQ+ +  
Sbjct  382  NVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTFLGRPWKEYSRTVYMQTYLDS  441

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EWSG+FA+NTLFYGE+ N G  A+TS RVKW+G++VI SATEA  +T G FI
Sbjct  442  LVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWRGYRVITSATEASKFTVGSFI  501

Query  362  SGSNW  376
            +G++W
Sbjct  502  TGNSW  506



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPN+NTGI +    + AAS+LKPVQ +F TYLGRPWK+YSRTV M++S+  
Sbjct  379  NTVTAQGRTDPNENTGISIHDSAVTAASELKPVQGSFKTYLGRPWKKYSRTVFMKTSLDC  438

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EWSG+FA++TL+YGE+ NTGAGA TSQRVKW G+ VI SATEA  +T   F+
Sbjct  439  LIDPAGWLEWSGNFALSTLYYGEYMNTGAGADTSQRVKWPGYHVITSATEASKFTVANFL  498

Query  362  SGSNW  376
            SG++W
Sbjct  499  SGNSW  503



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N++TAQGRTDPNQNTGI +   R+ AA DL PV   F T+LGRPWKEYSRTV MQ+ +  
Sbjct  382  NVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTFLGRPWKEYSRTVYMQTYLDS  441

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EWSG+FA+NTLFYGE+ N G  A+TS RVKW+G++VI SATEA  +T G FI
Sbjct  442  LVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWRGYRVITSATEASKFTVGSFI  501

Query  362  SGSNW  376
            +G++W
Sbjct  502  AGNSW  506



>dbj|BAF95866.1| pectin methylesterase isoform alpha [Vitis hybrid cultivar]
Length=234

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPN+NTGI +Q C++AAA+DL PV  +F +YLGRPWKEYSRTV MQS+I D
Sbjct  63   NVFTAQGRDDPNENTGISIQNCKVAAAADLIPVLSSFKSYLGRPWKEYSRTVYMQSNIGD  122

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EW G FA++TL+YGE+ N G G+ TS RV W G++VI S++ A  +T G FI
Sbjct  123  LIDPAGWLEWDGDFALSTLYYGEYKNRGPGSNTSGRVTWPGYRVINSSSVASQFTVGAFI  182

Query  362  SGSNW  376
             G  W
Sbjct  183  QGDEW  187



>ref|XP_004174049.1| PREDICTED: pectinesterase 2-like, partial [Cucumis sativus]
Length=431

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +2

Query  5    MLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDV  184
            ++TAQGRTDPNQNTGI +   R+ A  DLKPV K+  TYLGRPWKEYSRTV +QS +  +
Sbjct  296  VVTAQGRTDPNQNTGISIHNSRVMATDDLKPVIKSVRTYLGRPWKEYSRTVYLQSFMDSL  355

Query  185  VHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFIS  364
            V+ AGW EWSG+FA+NTL+YGE  N+G G++T+ RVKWKG++VI SA+EA  +T G FIS
Sbjct  356  VNPAGWLEWSGNFALNTLYYGEFKNSGLGSSTANRVKWKGYRVITSASEAAKFTVGSFIS  415

Query  365  GSNW  376
            G++W
Sbjct  416  GNSW  419



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C+I   +DL PV+ +FPTYLGRPWKEYSRTV MQS I  
Sbjct  419  NAITAQGRTDPNQNTGISIHNCKITPGTDLVPVKSSFPTYLGRPWKEYSRTVFMQSYIDG  478

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +  AGW EW G FA+ TL+YGE+ NTG G+ T  RVKW G++VI S  EA  +T G FI
Sbjct  479  FIQPAGWLEWDGDFALKTLYYGEYMNTGPGSGTGNRVKWPGYRVIKSPQEASKFTVGEFI  538

Query  362  SGSNW  376
             G +W
Sbjct  539  QGDSW  543



>ref|XP_004293266.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Fragaria 
vesca subsp. vesca]
Length=528

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +QKC++ A+SDL+PV+    +YLGRPWKEYSRTVVMQS+I D
Sbjct  392  NMVTAQGRTDPNQNTGTSIQKCQVIASSDLEPVKGTVRSYLGRPWKEYSRTVVMQSTIGD  451

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +   GW  WSG FA+ TL+YGE++N+G GA TS+RV W G+ VI +A+EAQS+T    I
Sbjct  452  HIDPTGWSIWSGDFALKTLYYGEYANSGPGAGTSKRVTWAGYHVIKTASEAQSFTVAGLI  511

Query  362  SGSNW  376
             G +W
Sbjct  512  QGGSW  516



>emb|CBI24285.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C + AASDLK VQ +  TYLGRPWKEYSRTV +++ +  
Sbjct  308  NTVTAQGRTDPNQNTGISIHDCEVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKTYLDS  367

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG FA+NTL+YGE+ NTG G++TS RV W G+ VI S+TEA  +T G FI
Sbjct  368  LINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTSGRVNWTGYHVITSSTEAAKFTVGNFI  427

Query  362  SGSNW  376
            SG++W
Sbjct  428  SGNSW  432



>ref|XP_010685210.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=592

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQ RTD NQNTGIV+QKCRI   SDL+  + +F TYLGRPWK+YSRTV+MQS ISD
Sbjct  456  NMITAQSRTDINQNTGIVIQKCRIDGTSDLQATKNSFSTYLGRPWKDYSRTVIMQSFISD  515

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VVH  GWHEW G +A+ TL Y E+ N+G GA TS+RV+W+G + I+   +AQ +T G FI
Sbjct  516  VVHENGWHEWEGEYALKTLHYMEYKNSGPGADTSKRVQWRGVQEISEVDKAQEFTPGNFI  575

Query  362  SGSNW  376
            +G +W
Sbjct  576  AGGSW  580



>pdb|1XG2|A Chain A, Crystal Structure Of The Complex Between Pectin Methylesterase 
And Its Inhibitor Protein
Length=317

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQ TG  +Q C I A+SDL+PV K FPTYLGRPWKEYSRTVVM+S +  
Sbjct  179  NMVTAQGRTDPNQATGTSIQFCNIIASSDLEPVLKEFPTYLGRPWKEYSRTVVMESYLGG  238

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EW G FA+ TL+YGE  N G GA TS+RVKW G+ VI    +A  +T  + I
Sbjct  239  LINPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAKAMPFTVAKLI  298

Query  362  SGSNW  376
             G +W
Sbjct  299  QGGSW  303



>pir||S00629 pectinesterase (EC 3.1.1.11) precursor (clone PE1) - tomato
 emb|CAA30746.1| unnamed protein product [Solanum lycopersicum]
Length=389

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQ TG  +Q C I A+ DLKPV K FPTYLGRPWK+YSRTVVM+SS+  
Sbjct  236  NMVTAQGRTDPNQATGTSIQFCDIIASPDLKPVVKEFPTYLGRPWKKYSRTVVMESSLGG  295

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  +GW EW G FA+ TL+YGE  N G GA TS+RVKW G+ VI    EA S+T  + I
Sbjct  296  LIDPSGWAEWHGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAEAMSFTVAKLI  355

Query  362  SGSNW  376
             G +W
Sbjct  356  QGGSW  360



>ref|XP_009590338.1| PREDICTED: pectinesterase 3-like, partial [Nicotiana tomentosiformis]
Length=244

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQ TG  +Q C I A+ DL+PV+  + TYLGRPWKEYSRTVVM+S + D
Sbjct  106  NMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTYLGRPWKEYSRTVVMESYLGD  165

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EWSG FA+ TL+YGE+ N G GA TS+RVKW G+ +I +  EA  +T    I
Sbjct  166  LIDPAGWSEWSGDFALKTLYYGEYMNNGPGAGTSKRVKWSGYHIITNPAEAMPFTVAELI  225

Query  362  SGSNW  376
             G +W
Sbjct  226  QGGSW  230



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +  C++ A SDL PV+ NF TYLGRPWKEYSRTV ++S I D
Sbjct  441  NIFTAQGREDPNQNTGISILNCKVTAGSDLIPVKSNFTTYLGRPWKEYSRTVYLKSYIDD  500

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EW+GSFA++TL+YGE+ N G G+ TS RV W G++VI S+ EA  +T G FI
Sbjct  501  LVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNTSARVTWPGYRVINSSVEASQFTVGEFI  560

Query  362  SGSNW  376
             GS+W
Sbjct  561  QGSDW  565



>ref|XP_002302526.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE81799.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  8    LTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDVV  187
            +TAQGRTDPNQNTGI +  CR+ AASDLKPVQ +  TYLGRPWK+YSRTV M++ +  ++
Sbjct  380  ITAQGRTDPNQNTGISIHNCRVTAASDLKPVQGSVKTYLGRPWKQYSRTVFMKTFLDSLI  439

Query  188  HIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFISG  367
            + AGW  W+G+FA++TL+YGE+ NTG G++T+ RV WKG++VI S+T A  +T G FISG
Sbjct  440  NPAGWSPWNGNFALDTLYYGEYMNTGPGSSTANRVNWKGYRVITSSTVASQFTVGSFISG  499

Query  368  SNW  376
            +NW
Sbjct  500  NNW  502



>ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
 gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
Length=511

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGR+DPNQNTGI +  CR+ AASDLK VQ +  TYLGRPW+EYSRTV M++ +  
Sbjct  375  NTITAQGRSDPNQNTGISIHNCRVTAASDLKSVQSSVKTYLGRPWREYSRTVFMKTYLDS  434

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EWSG+FA+ TL+YGE+ NTG G++TS RVKW G+ VI SA+EA  +T G FI
Sbjct  435  LIDPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVKWAGYHVITSASEASKFTVGNFI  494

Query  362  SGSNW  376
            +G++W
Sbjct  495  AGNSW  499



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +QKC + A+SDL+PV+ +  +YLGRPWKEYSRTVVMQS I D
Sbjct  420  NMVTAQGRTDPNQNTGTSIQKCEVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGD  479

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +  AGW EWSG FA+ TL+YGE+ N G GA TS+RVKW G+ VI    EA+ +T    I
Sbjct  480  HIDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPEEAKKFTVAELI  539

Query  362  SGSNW  376
             G +W
Sbjct  540  GGGSW  544



>ref|XP_010534985.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=589

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTD NQ+TGIV+Q CRI A SDL PV   +P+YLGRPW+EYSRTVVMQSSIS+
Sbjct  452  NMVTAQGRTDKNQDTGIVIQNCRINATSDLWPVMDEYPSYLGRPWQEYSRTVVMQSSISE  511

Query  182  VVHIAGWHEW-SGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRF  358
            V++  GW  W S +F ++TL Y E+SN G GA T  RVKWKGFKVI    EA+ YTA  F
Sbjct  512  VINPKGWRPWNSSNFYLDTLTYREYSNRGPGANTKYRVKWKGFKVITDPKEAEPYTADEF  571

Query  359  ISGSNW  376
            I GS+W
Sbjct  572  IDGSSW  577



>gb|KFK43434.1| hypothetical protein AALP_AA1G125000 [Arabis alpina]
Length=556

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNT I  QKC+I A+SDL PV+ +  T+LGRPWK YSRTV+MQSSI D
Sbjct  420  NMVTAQGREDPNQNTAISFQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSSIGD  479

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +  AGW  W G FA++TL+YGE++N G GA TS+RVKWKGFKVI  + EA+ +T  + I
Sbjct  480  HIDPAGWFPWDGEFALSTLYYGEYANNGPGADTSKRVKWKGFKVIRDSKEAEQFTVAKLI  539

Query  362  SGSNW  376
             G  W
Sbjct  540  QGGLW  544



>ref|XP_009378667.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009339421.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=510

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C++ AASDLKPVQ +  TYLGRPWK+YSRTV M++ +  
Sbjct  374  NTITAQGRTDPNQNTGISIHNCKVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTYLDS  433

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG FA+ TL+YGE+ NTG GA+T  RV W G+ VI SA+EA  ++ G FI
Sbjct  434  LINPAGWMEWSGDFALKTLYYGEYMNTGPGASTKNRVSWAGYHVITSASEASKFSVGNFI  493

Query  362  SGSNW  376
            +G +W
Sbjct  494  AGGSW  498



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +Q C++AAASDL PVQ NF TYLGRPWK YSRTV MQS +  
Sbjct  429  NIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKAYSRTVYMQSLLDS  488

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EW G FA++TL+YGE+ N G G++T+ RVKW G++VI S+ EA  +T   FI
Sbjct  489  LINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYRVINSSAEASMFTVESFI  548

Query  362  SGSNW  376
             G  W
Sbjct  549  EGDQW  553



>ref|XP_008343201.1| PREDICTED: pectinesterase 2 [Malus domestica]
Length=511

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C++ AASDLKPVQ +  TYLGRPWK+YSRTV M++ +  
Sbjct  375  NTVTAQGRTDPNQNTGISIHNCKVTAASDLKPVQSSVKTYLGRPWKQYSRTVFMKTYLDS  434

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG FA+ TL+YGE+ NTG GA+T  RV W G+ VI SA+EA  ++ G FI
Sbjct  435  LINPAGWMEWSGDFALKTLYYGEYMNTGPGASTKNRVSWAGYHVITSASEASEFSVGNFI  494

Query  362  SGSNW  376
            +G +W
Sbjct  495  AGGSW  499



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  5    MLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDV  184
            M TAQGR DPNQNTGI +Q CR++A SDL   + +F  YLGRPWK+YSRTV++QS + D+
Sbjct  448  MYTAQGREDPNQNTGISIQNCRLSATSDLVAAKSSFQVYLGRPWKQYSRTVILQSHLDDL  507

Query  185  VHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFIS  364
            +H AGWHEW G+FA++TL+YGE+ N G GAAT+ RVKW G +VI S++EA  +T  +F+ 
Sbjct  508  IHPAGWHEWDGNFALSTLYYGEYMNRGPGAATANRVKWGGHRVITSSSEANQFTVNQFLQ  567

Query  365  GSNW  376
            G +W
Sbjct  568  GDSW  571



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +Q C++AAASDL PVQ NF TYLGRPWK YSRTV MQS +  
Sbjct  428  NIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKAYSRTVYMQSLLDS  487

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EW G FA++TL+YGE+ N G G++T+ RVKW G++VI S+ EA  +T   FI
Sbjct  488  LINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYRVINSSAEASMFTVESFI  547

Query  362  SGSNW  376
             G  W
Sbjct  548  EGDQW  552



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGRTDPNQNTG  +QKC + A+SDL+PV+ +  +YLGRPWKEYSRTVVMQS I D
Sbjct  420  NMVTAQGRTDPNQNTGTSIQKCDVIASSDLEPVKGSIRSYLGRPWKEYSRTVVMQSHIGD  479

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +  AGW EWSG FA+ TL+YGE+ N G GA TS+RVKW G+ VI    EA+ +T    I
Sbjct  480  HIDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYHVITDPEEAKKFTVAELI  539

Query  362  SGSNW  376
             G +W
Sbjct  540  GGGSW  544



>ref|NP_001275775.1| pectinesterase 2 precursor [Citrus sinensis]
 gb|AAB57671.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N LTAQGRTDPNQNTGI++  CR+ AASDLKPVQ +  T+LGRPWK+YSRTV +++ +  
Sbjct  374  NTLTAQGRTDPNQNTGIIIHNCRVTAASDLKPVQSSVKTFLGRPWKQYSRTVXIKTFLDS  433

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG FA+NTL+Y E+ NTG G++T+ RVKW+G+ V+ S ++   +T G FI
Sbjct  434  LINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTANRVKWRGYHVLTSPSQVSQFTVGNFI  493

Query  362  SGSNW  376
            +G++W
Sbjct  494  AGNSW  498



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +Q C++AAASDL PVQ NF TYLGRPWK YSRTV MQS +  
Sbjct  429  NVFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTYLGRPWKAYSRTVYMQSLLDS  488

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EW G FA++TL+YGE+ N G G++T+ RVKW G++VI S+ EA  +T   FI
Sbjct  489  LINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWPGYRVINSSAEASMFTVESFI  548

Query  362  SGSNW  376
             G  W
Sbjct  549  EGDQW  553



>ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
 gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
Length=510

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N LTAQGRTDPNQNTGI++  CR+ AASDLKPVQ +  T+LGRPWK+YSRTV +++ +  
Sbjct  374  NTLTAQGRTDPNQNTGIIIHNCRVTAASDLKPVQSSVKTFLGRPWKQYSRTVYIKTFLDS  433

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG FA+NTL+Y E+ NTG G++T+ RVKW+G+ V+ S ++   +T G FI
Sbjct  434  LINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTANRVKWRGYHVLTSPSQVSQFTVGNFI  493

Query  362  SGSNW  376
            +G++W
Sbjct  494  AGNSW  498



>gb|KHN25547.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +   R+ AASDL+PVQ +  TYLGRPWK+YSRTV M++ +  
Sbjct  223  NTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQNSVRTYLGRPWKQYSRTVFMKTYLDG  282

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG+FA++TL+YGE+ NTG G++T++RVKW G++VI SA+EA  ++   FI
Sbjct  283  LINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTARRVKWSGYRVITSASEASKFSVANFI  342

Query  362  SGSNW  376
            +G+ W
Sbjct  343  AGNAW  347



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N++TAQGRTDPNQNTGI +   R+ A+SDL+PV  +F T+LGRPWK YSRTV +Q+ +  
Sbjct  383  NVVTAQGRTDPNQNTGISIHNSRVMASSDLRPVLSSFKTFLGRPWKAYSRTVFLQTYLDS  442

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EW G+FA+NTL+YGE+ N+G GA+TS RVKW+G++VI SATEA  +TA  FI
Sbjct  443  LVDAAGWLEWDGNFALNTLYYGEYRNSGPGASTSGRVKWRGYRVITSATEASRFTAANFI  502

Query  362  SGSNW  376
            +G +W
Sbjct  503  AGRSW  507



>emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera]
Length=497

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C++ AASDLK VQ +  TYLGRPWKEYSRTV +++ +  
Sbjct  361  NTVTAQGRTDPNQNTGISIHDCKVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKTYLDS  420

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG FA+ TL+YGE+ NTG G++TS RV W G+ VI S+TEA  +T G FI
Sbjct  421  LINSAGWMEWSGDFALKTLYYGEYMNTGPGSSTSGRVDWAGYHVITSSTEAAKFTVGNFI  480

Query  362  SGSNW  376
            SG++W
Sbjct  481  SGNSW  485



>gb|KEH29121.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=513

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +   R+ AASDLKPVQ +  TYLGRPWK+YSR V M++S+  
Sbjct  377  NTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQNSVKTYLGRPWKQYSRAVFMKTSLDS  436

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++H +GW EWSG+FA++TL+YGE+ NTG G++T  RVKW+GF VI SA+EA  +T   FI
Sbjct  437  LIHPSGWLEWSGNFALSTLYYGEYMNTGLGSSTRNRVKWQGFHVITSASEASKFTVSNFI  496

Query  362  SGSNW  376
            +G+ W
Sbjct  497  AGNAW  501



>gb|AIZ46897.1| pectin methylesterase, partial [Dendrobium hybrid cultivar]
Length=217

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGR DPNQNTG  +QKCR+  + DLKPV  +FPTYLGRPWKEYSRTVVMQSSI +
Sbjct  81   NAITAQGRIDPNQNTGTSIQKCRLVPSQDLKPVIVSFPTYLGRPWKEYSRTVVMQSSIDN  140

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             V+  GW EW G+FA+ TLF+GE+ N G GA T+ RV W G+ VI  A  A  +T  + I
Sbjct  141  HVNPKGWLEWDGNFALQTLFHGEYQNYGPGAGTAGRVNWAGYHVITDANVANDFTVAKLI  200

Query  362  SGSNW  376
             G  W
Sbjct  201  QGGQW  205



>ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C + AASDLK VQ +  TYLGRPWKEYSRTV +++ +  
Sbjct  377  NTVTAQGRTDPNQNTGISIHDCEVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKTYLDS  436

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG FA+NTL+YGE+ NTG G++TS RV W G+ VI S+TEA  +T G FI
Sbjct  437  LINSAGWLEWSGDFALNTLYYGEYMNTGPGSSTSGRVNWTGYHVITSSTEAAKFTVGNFI  496

Query  362  SGSNW  376
            SG++W
Sbjct  497  SGNSW  501



>gb|AAF16637.1|AC011661_15 T23J18.24 [Arabidopsis thaliana]
Length=223

 Score =   163 bits (412),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGR D NQNT I +QKC+I A+SDL PV+ +  T+LGRPWK YSRTV+MQS I +
Sbjct  87   NMLTAQGREDQNQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDN  146

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +  AGW  W G FA++TL+YGE++NTG GA TS+RV WKGFKVI  + EA+ +T  + I
Sbjct  147  HIDPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEAEQFTVAKLI  206

Query  362  SGSNW  376
             G  W
Sbjct  207  QGGLW  211



>gb|AEW08385.1| hypothetical protein 2_7981_01, partial [Pinus radiata]
 gb|AFG58848.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58849.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58850.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58851.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58852.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58853.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58854.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58855.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58856.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58857.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58858.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58859.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58860.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58861.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58862.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
 gb|AFG58863.1| hypothetical protein 2_7981_01, partial [Pinus taeda]
Length=138

 Score =   160 bits (405),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  5    MLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDV  184
            + TAQGR DPN+NTGI +Q C + AASDL PV+ +F  YLGRPW+ YSRTV M+S + D+
Sbjct  5    IYTAQGRQDPNENTGISIQNCTVTAASDLVPVKTSFEAYLGRPWRNYSRTVFMKSYLDDL  64

Query  185  VHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFIS  364
            +  AGW EW+GSFA++TL+YGE+ N+G GA T+ RV+W G++VI  + EA+ +T  +FI 
Sbjct  65   IQPAGWLEWNGSFALSTLYYGEYMNSGPGAGTANRVRWAGYQVIKKSKEAKKFTVSQFIE  124

Query  365  GSNW  376
            G++W
Sbjct  125  GNSW  128



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +  C++ AASDL PV  +F  YLGRPWK+YSRTV++ S+I  
Sbjct  340  NLFTAQGREDPNQNTGISILNCKVEAASDLVPVLSSFKNYLGRPWKQYSRTVILFSNIGS  399

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EWSG FA+NTL+YGE+ N G G+ TS RVKW G++VI S+TEA  +T G FI
Sbjct  400  LIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNTSARVKWPGYRVINSSTEASQFTVGNFI  459

Query  362  SGSNW  376
             GS W
Sbjct  460  QGSEW  464



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N LTAQGRTDPNQNTGI +  C++ AASDLK +Q +  TYLGRPWK+YSRT+ M++ +  
Sbjct  379  NTLTAQGRTDPNQNTGISIHNCKVTAASDLKSIQSSVKTYLGRPWKQYSRTIFMKTYLDS  438

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V+ AGW EW G+FA++TL+YGE+ NTG G++T+ RVKW G+ VI SATEA  +T G F+
Sbjct  439  LVNSAGWMEWDGNFALDTLYYGEYVNTGPGSSTTNRVKWAGYHVITSATEAAKFTVGSFL  498

Query  362  SGSNW  376
            +G +W
Sbjct  499  AGGSW  503



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N++TAQGRTDPNQNTGI +   R+ A+SDL+PV  +F TYLGRPWKEYSRTV +Q+ +  
Sbjct  381  NVVTAQGRTDPNQNTGISIHNSRVMASSDLRPVLSSFKTYLGRPWKEYSRTVFLQTYLDS  440

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EW G+FA+NTL+YGE+ N+G GA+T  RVKW+G++VI S+TEA  +T   FI
Sbjct  441  LVDPAGWLEWDGNFALNTLYYGEYRNSGPGASTRGRVKWRGYRVITSSTEASRFTVANFI  500

Query  362  SGSNW  376
            +G +W
Sbjct  501  AGRSW  505



>ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50348.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=514

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N LTAQGRTDPNQNTGI +   R+ AASDL PVQ +  TYLGRPWKEYSRTV M++ +  
Sbjct  378  NTLTAQGRTDPNQNTGISIHNSRVTAASDLSPVQSSVRTYLGRPWKEYSRTVFMKTFLDS  437

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG+FA++TL+YGE+ NTG G++T+ RV WKG++VI SA EA  +T   FI
Sbjct  438  LINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTANRVTWKGYRVITSAAEASQFTVQNFI  497

Query  362  SGSNW  376
            SG++W
Sbjct  498  SGNSW  502



>ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=512

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C++ AASDLK VQ +  TYLGRPWKEYSRTV +++ +  
Sbjct  376  NTVTAQGRTDPNQNTGISIHDCKVTAASDLKAVQSSVKTYLGRPWKEYSRTVFLKTYLDS  435

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG FA+ TL+YGE+ NTG G++TS RV W G+ VI S+TEA  +T G FI
Sbjct  436  LINSAGWMEWSGDFALKTLYYGEYMNTGPGSSTSGRVDWAGYHVITSSTEAAKFTVGNFI  495

Query  362  SGSNW  376
            SG++W
Sbjct  496  SGNSW  500



>ref|XP_010267745.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=553

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGI +QKC I A+SDL PV+ +FP+YLGRPWKEYSRTVVMQS I D
Sbjct  417  NMVTAQGRVDPNQNTGISIQKCDIIASSDLAPVKNSFPSYLGRPWKEYSRTVVMQSYIGD  476

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +  AGW  WSG FA+ TL+YGE+ N+G GA  S+RV W G+ VI ++ EA  +T    I
Sbjct  477  HIAPAGWSIWSGEFALKTLYYGEYLNSGPGAGISKRVTWPGYHVITNSAEALKFTVAELI  536

Query  362  SGSNW  376
             G  W
Sbjct  537  QGGAW  541



>gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N LTAQGRTDPNQNTGI +   R+ AASDL PVQ +  TYLGRPWK+YSRTV M++ +  
Sbjct  378  NTLTAQGRTDPNQNTGISIHNSRVTAASDLTPVQGSVRTYLGRPWKQYSRTVFMKTYLDS  437

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG+FA++TL+YGE+ NTG G++T+ RV WKG+ VI S TEA  +T G FI
Sbjct  438  LINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTANRVNWKGYHVITSPTEASQFTVGNFI  497

Query  362  SGSNW  376
            SG++W
Sbjct  498  SGNSW  502



>ref|XP_011090444.1| PREDICTED: pectinesterase 2 [Sesamum indicum]
Length=531

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N LTAQGRTDPNQNTGI +  CR+ AA DL+PVQ +  TYLGRPW++YSRTV M++ +  
Sbjct  395  NTLTAQGRTDPNQNTGISIHNCRVTAAPDLRPVQGSVKTYLGRPWQKYSRTVFMKTFLDS  454

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW  WSG+FA++TL+YGE++NTG G++T+ RVKWKG+ VI SA+EA  +T G FI
Sbjct  455  LINPAGWMPWSGNFALDTLYYGEYANTGPGSSTANRVKWKGYHVITSASEASRFTPGSFI  514

Query  362  SGSNW  376
            + ++W
Sbjct  515  AANSW  519



>ref|XP_009118185.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Brassica 
rapa]
Length=556

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NMLTAQGR DPNQNT I  QKCR+ A+SDL PV+ +  TYLGRPWK YSRTV+MQS I +
Sbjct  420  NMLTAQGREDPNQNTAISFQKCRLTASSDLAPVKGSVKTYLGRPWKLYSRTVIMQSFIDN  479

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             +  AGW  W G FA++TL+YGE++N G GA TS+RVKWKGFKVI  + EA  +T  + I
Sbjct  480  HIDPAGWFPWDGDFALSTLYYGEYANNGPGADTSKRVKWKGFKVIRDSKEADQFTVAKLI  539

Query  362  SGSNW  376
             G  W
Sbjct  540  QGGLW  544



>ref|XP_008436965.1| PREDICTED: pectinesterase 2-like [Cucumis melo]
Length=519

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = +2

Query  5    MLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDV  184
            ++TAQGRTDPNQNTGI +   R+ AA DLKPV K+  TYLGRPWKEYSRTV +QS +  +
Sbjct  384  VVTAQGRTDPNQNTGISIHNSRVMAADDLKPVIKSVRTYLGRPWKEYSRTVYLQSFMESL  443

Query  185  VHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFIS  364
            V+ AGW EWSG+FA+NTL+YGE  N G G++T+ RVKWKG++VI SA EA  +T G FI+
Sbjct  444  VNPAGWLEWSGNFALNTLYYGEFKNYGPGSSTANRVKWKGYRVITSANEAAKFTVGNFIA  503

Query  365  GSNW  376
            G++W
Sbjct  504  GNSW  507



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGR+DPNQNTGI +  C++ AASDLK VQ +  TYLGRPW+EYSRTV M++ +  
Sbjct  375  NTVTAQGRSDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPWREYSRTVFMKTYLDS  434

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EWSG+FA+ TL+YGE+ NTG G++TS RVKW G+ VI SA+EA  +T G FI
Sbjct  435  LIDPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVKWAGYHVITSASEASKFTVGNFI  494

Query  362  SGSNW  376
            +G++W
Sbjct  495  AGNSW  499



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +2

Query  5    MLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISDV  184
            ++TAQGRTDPNQNTGI +   R+ A  DLKPV K+  TYLGRPWKEYSRTV +QS +  +
Sbjct  385  VVTAQGRTDPNQNTGISIHNSRVMATDDLKPVIKSVRTYLGRPWKEYSRTVYLQSFMDSL  444

Query  185  VHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFIS  364
            V+ AGW EWSG+FA+NTL+YGE  N+G G++T+ RVKWKG++VI SA+EA  +T G FI+
Sbjct  445  VNPAGWLEWSGNFALNTLYYGEFKNSGPGSSTANRVKWKGYRVITSASEAAKFTVGSFIA  504

Query  365  GSNW  376
            G++W
Sbjct  505  GNSW  508



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +  C++ AASDLK VQ +  TYLGRPWKEYSRTV M++ +  
Sbjct  377  NTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTYLGRPWKEYSRTVFMKTYLDS  436

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +++ AGW EWSG+FA+ TL+YGE+ NTG G++TS RV W G+ VI S++EA  +T G FI
Sbjct  437  LINPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVNWAGYHVITSSSEASKFTVGNFI  496

Query  362  SGSNW  376
            +G++W
Sbjct  497  AGNSW  501



>gb|KHN16553.1| Pectinesterase 2 [Glycine soja]
Length=415

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPN+NTGI++  CRI AA DLK VQ +F T+LGRPW++YSRTVVM+S++  
Sbjct  280  NTVTAQGRTDPNENTGIIIHNCRITAAGDLKAVQGSFRTFLGRPWQKYSRTVVMKSALDG  339

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW  WSG+FA++TL+Y EH+NTGAGA+T  RV W GF+VI S+TEA  +T G F+
Sbjct  340  LISPAGWFPWSGNFALSTLYYAEHANTGAGASTGGRVDWAGFRVI-SSTEAVKFTVGNFL  398

Query  362  SGSNW  376
            +G +W
Sbjct  399  AGGSW  403



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGRTDPNQNTGI +QKCR AAASDL  VQ +F TYLGRPWK+YSRTV +QS +  
Sbjct  336  NIYTAQGRTDPNQNTGISVQKCRGAAASDLAAVQSSFRTYLGRPWKQYSRTVFIQSELDS  395

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            VV  AGW  W G+FA++TL+Y E+ NTG GA TS RV W G++ + SA+EA ++T G FI
Sbjct  396  VVDPAGWLAWDGTFALDTLYYAEYQNTGPGAGTSGRVSWMGYRGVISASEASTFTVGSFI  455

Query  362  SGSNW  376
             G  W
Sbjct  456  DGDVW  460



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N +TAQGRTDPNQNTGI +   R+ AASDLKPV  +F T+LGRPWK+YSRTV +Q+ +  
Sbjct  319  NTITAQGRTDPNQNTGISIHNSRVMAASDLKPVLSSFKTFLGRPWKQYSRTVFLQTYLDS  378

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +V  AGW EW G+FA+NTL+YGE+ N G  ++TS RVKW+G++VI SATEA  +T   FI
Sbjct  379  LVDPAGWLEWDGNFALNTLYYGEYKNMGPASSTSGRVKWRGYRVITSATEASQFTVANFI  438

Query  362  SGSNW  376
            +G +W
Sbjct  439  AGRSW  443



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +  C+IAAA+DL PV+ +F TYLGRPWKEYSRTV+M+S I D
Sbjct  423  NIFTAQGREDPNQNTGISILNCKIAAAADLVPVKSSFKTYLGRPWKEYSRTVIMRSYIDD  482

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
             V  AGW EW+G+FA++TL+YGE+ N G G++TS RV W G++VI S+TEA  +T   FI
Sbjct  483  SVDPAGWLEWNGTFALSTLYYGEYLNRGPGSSTSARVTWPGYRVINSSTEATQFTIEPFI  542

Query  362  SGSNW  376
             G+ W
Sbjct  543  QGNEW  547



>gb|AAK69696.1|AF355057_1 putative pectin methylesterase LuPME5 [Linum usitatissimum]
Length=553

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM+TAQGR DPNQNTGIV+QKCRI A  DL  VQ +  +YLGRPWK YSRTV+MQ+ IS+
Sbjct  417  NMVTAQGRDDPNQNTGIVIQKCRIGATQDLLQVQSSVESYLGRPWKMYSRTVIMQTDISN  476

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            V+  AGW  W G+FA+ TL Y E++NTGAG+ TS RV+W G+KVI SA+EAQ +    FI
Sbjct  477  VIRPAGWFMWDGNFALATLTYREYANTGAGSGTSGRVRWGGYKVITSASEAQPFAPRSFI  536

Query  362  SGSNW  376
             G++W
Sbjct  537  GGASW  541



>gb|EMT27728.1| Pectinesterase [Aegilops tauschii]
Length=389

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            N+ TAQGR DPNQNTGI +Q C+IAAA+DL PVQ NF +YLGRPWK YSRTV MQS +  
Sbjct  252  NVFTAQGREDPNQNTGIAVQGCKIAAAADLVPVQANFSSYLGRPWKTYSRTVFMQSKMES  311

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            +VH  GW EW+G+FA++TL+Y E+ N G GA TS RV W G++VI +A +A ++TA  FI
Sbjct  312  LVHPRGWLEWNGTFALDTLYYAEYMNRGPGANTSARVAWPGYRVITTAADAGNFTAQAFI  371

Query  362  SGSNW  376
             G  W
Sbjct  372  QGDLW  376



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    NMLTAQGRTDPNQNTGIVLQKCRIAAASDLKPVQKNFPTYLGRPWKEYSRTVVMQSSISD  181
            NM TAQGR DPNQNTGI +  C++ AASDL PV  +F  YLGRPWK+YSRTV++ S+I  
Sbjct  425  NMFTAQGREDPNQNTGISILNCKVEAASDLVPVVSSFKNYLGRPWKQYSRTVILISNIGS  484

Query  182  VVHIAGWHEWSGSFAVNTLFYGEHSNTGAGAATSQRVKWKGFKVIASATEAQSYTAGRFI  361
            ++  AGW EWSG FA+NTL+YGE+ N G G+ TS RVKW G++VI S++EA  +T G FI
Sbjct  485  LIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNTSARVKWPGYRVINSSSEASQFTVGNFI  544

Query  362  SGSNW  376
             GS W
Sbjct  545  QGSEW  549



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1017575415288